Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140704_OR004_03 C20140704_OR004_03 TB427703.[MT7]-VQTAALR.2y5_1.heavy 451.781 / 531.325 4525.0 21.875550270080566 46 20 10 6 10 23.043660197901183 4.339588378807461 0.039798736572265625 3 0.998926105059567 37.65672947729709 4525.0 89.4376022578534 0.0 - - - - - - - 127.5 9 8 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 3 1 C20140704_OR004_03 C20140704_OR004_03 TB427703.[MT7]-VQTAALR.2b4_1.heavy 451.781 / 544.321 3123.0 21.875550270080566 46 20 10 6 10 23.043660197901183 4.339588378807461 0.039798736572265625 3 0.998926105059567 37.65672947729709 3123.0 20.078265904480915 0.0 - - - - - - - 182.0 6 14 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 5 1 C20140704_OR004_03 C20140704_OR004_03 TB427703.[MT7]-VQTAALR.2y6_1.heavy 451.781 / 659.383 13766.0 21.875550270080566 46 20 10 6 10 23.043660197901183 4.339588378807461 0.039798736572265625 3 0.998926105059567 37.65672947729709 13766.0 92.06610092814554 0.0 - - - - - - - 177.11111111111111 27 9 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 7 1 C20140704_OR004_03 C20140704_OR004_03 TB427703.[MT7]-VQTAALR.2b5_1.heavy 451.781 / 615.358 4589.0 21.875550270080566 46 20 10 6 10 23.043660197901183 4.339588378807461 0.039798736572265625 3 0.998926105059567 37.65672947729709 4589.0 3.615695067264574 1.0 - - - - - - - 243.27272727272728 9 11 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 9 2 C20140704_OR004_03 C20140704_OR004_03 TB413662.[MT7]-FEVPDVLTSK[MT7]PSTVR.3b3_1.heavy 655.042 / 520.289 12771.0 36.40909957885742 50 20 10 10 10 9.720635653037402 10.287393085117131 0.0 3 0.991257117719885 13.189190178163669 12771.0 8.658599780895681 0.0 - - - - - - - 238.0 25 5 GANC glucosidase, alpha; neutral C 11 2 C20140704_OR004_03 C20140704_OR004_03 TB413662.[MT7]-FEVPDVLTSK[MT7]PSTVR.3y8_1.heavy 655.042 / 1019.6 5940.0 36.40909957885742 50 20 10 10 10 9.720635653037402 10.287393085117131 0.0 3 0.991257117719885 13.189190178163669 5940.0 9.983333333333334 1.0 - - - - - - - 742.7142857142857 11 7 GANC glucosidase, alpha; neutral C 13 2 C20140704_OR004_03 C20140704_OR004_03 TB413662.[MT7]-FEVPDVLTSK[MT7]PSTVR.3y12_2.heavy 655.042 / 722.418 8762.0 36.40909957885742 50 20 10 10 10 9.720635653037402 10.287393085117131 0.0 3 0.991257117719885 13.189190178163669 8762.0 11.242543537707046 0.0 - - - - - - - 297.14285714285717 17 7 GANC glucosidase, alpha; neutral C 15 2 C20140704_OR004_03 C20140704_OR004_03 TB413662.[MT7]-FEVPDVLTSK[MT7]PSTVR.3y5_1.heavy 655.042 / 559.32 7722.0 36.40909957885742 50 20 10 10 10 9.720635653037402 10.287393085117131 0.0 3 0.991257117719885 13.189190178163669 7722.0 16.12514131897712 0.0 - - - - - - - 700.2857142857143 15 7 GANC glucosidase, alpha; neutral C 17 3 C20140704_OR004_03 C20140704_OR004_03 TB413910.[MT7]-VALVYGQMNEPPGAR.2y5_1.heavy 873.46 / 497.283 15109.0 33.22549819946289 41 11 10 10 10 1.2622510881214521 67.81862726385874 0.0 3 0.8571640592241812 3.225768928777215 15109.0 26.925340007636184 0.0 - - - - - - - 280.0 30 3 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 19 3 C20140704_OR004_03 C20140704_OR004_03 TB413910.[MT7]-VALVYGQMNEPPGAR.2b4_1.heavy 873.46 / 527.367 14830.0 33.22549819946289 41 11 10 10 10 1.2622510881214521 67.81862726385874 0.0 3 0.8571640592241812 3.225768928777215 14830.0 39.40620068885418 0.0 - - - - - - - 280.0 29 4 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 21 3 C20140704_OR004_03 C20140704_OR004_03 TB413910.[MT7]-VALVYGQMNEPPGAR.2y10_1.heavy 873.46 / 1056.49 10912.0 33.22549819946289 41 11 10 10 10 1.2622510881214521 67.81862726385874 0.0 3 0.8571640592241812 3.225768928777215 10912.0 74.4261884837617 0.0 - - - - - - - 140.0 21 1 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 23 3 C20140704_OR004_03 C20140704_OR004_03 TB413910.[MT7]-VALVYGQMNEPPGAR.2y11_1.heavy 873.46 / 1219.55 5316.0 33.22549819946289 41 11 10 10 10 1.2622510881214521 67.81862726385874 0.0 3 0.8571640592241812 3.225768928777215 5316.0 9.04292590018606 0.0 - - - - - - - 819.2857142857143 10 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 25 4 C20140704_OR004_03 C20140704_OR004_03 TB413912.[MT7]-TVLIMELINNVAK[MT7].3b6_1.heavy 582.686 / 831.477 113978.0 50.86989974975586 43 13 10 10 10 0.9577362705330889 64.68115362993876 0.0 3 0.9144112920791001 4.188001145541588 113978.0 1194.5805211986683 0.0 - - - - - - - 212.2 227 5 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 27 4 C20140704_OR004_03 C20140704_OR004_03 TB413912.[MT7]-TVLIMELINNVAK[MT7].3b4_1.heavy 582.686 / 571.394 77862.0 50.86989974975586 43 13 10 10 10 0.9577362705330889 64.68115362993876 0.0 3 0.9144112920791001 4.188001145541588 77862.0 241.6543498268635 0.0 - - - - - - - 185.75 155 4 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 29 4 C20140704_OR004_03 C20140704_OR004_03 TB413912.[MT7]-TVLIMELINNVAK[MT7].3b5_1.heavy 582.686 / 702.434 73082.0 50.86989974975586 43 13 10 10 10 0.9577362705330889 64.68115362993876 0.0 3 0.9144112920791001 4.188001145541588 73082.0 407.00794900134207 0.0 - - - - - - - 212.4 146 5 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 31 4 C20140704_OR004_03 C20140704_OR004_03 TB413912.[MT7]-TVLIMELINNVAK[MT7].3y5_1.heavy 582.686 / 689.406 84873.0 50.86989974975586 43 13 10 10 10 0.9577362705330889 64.68115362993876 0.0 3 0.9144112920791001 4.188001145541588 84873.0 947.7379447820061 0.0 - - - - - - - 148.4 169 5 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 33 5 C20140704_OR004_03 C20140704_OR004_03 TB451732.[MT7]-AELLGRQPVLEFSLENLR.3y7_1.heavy 743.422 / 878.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 35 5 C20140704_OR004_03 C20140704_OR004_03 TB451732.[MT7]-AELLGRQPVLEFSLENLR.3y6_1.heavy 743.422 / 731.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 37 5 C20140704_OR004_03 C20140704_OR004_03 TB451732.[MT7]-AELLGRQPVLEFSLENLR.3y8_1.heavy 743.422 / 1007.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 39 5 C20140704_OR004_03 C20140704_OR004_03 TB451732.[MT7]-AELLGRQPVLEFSLENLR.3y9_1.heavy 743.422 / 1120.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 41 6 C20140704_OR004_03 C20140704_OR004_03 TB413557.[MT7]-FLVFNSK[MT7].2b3_1.heavy 571.844 / 504.33 27718.0 37.21149826049805 46 16 10 10 10 2.1116704854797956 37.33567155366063 0.0 3 0.967217600025391 6.797486708075891 27718.0 44.07051166057818 0.0 - - - - - - - 312.125 55 8 GK;GK2 glycerol kinase;glycerol kinase 2 43 6 C20140704_OR004_03 C20140704_OR004_03 TB413557.[MT7]-FLVFNSK[MT7].2y4_1.heavy 571.844 / 639.358 34943.0 37.21149826049805 46 16 10 10 10 2.1116704854797956 37.33567155366063 0.0 3 0.967217600025391 6.797486708075891 34943.0 116.6630396159788 0.0 - - - - - - - 229.75 69 8 GK;GK2 glycerol kinase;glycerol kinase 2 45 6 C20140704_OR004_03 C20140704_OR004_03 TB413557.[MT7]-FLVFNSK[MT7].2y5_1.heavy 571.844 / 738.427 18785.0 37.21149826049805 46 16 10 10 10 2.1116704854797956 37.33567155366063 0.0 3 0.967217600025391 6.797486708075891 18785.0 41.37071541153837 0.0 - - - - - - - 306.5 37 6 GK;GK2 glycerol kinase;glycerol kinase 2 47 6 C20140704_OR004_03 C20140704_OR004_03 TB413557.[MT7]-FLVFNSK[MT7].2y6_1.heavy 571.844 / 851.511 18785.0 37.21149826049805 46 16 10 10 10 2.1116704854797956 37.33567155366063 0.0 3 0.967217600025391 6.797486708075891 18785.0 159.51819241619648 0.0 - - - - - - - 218.66666666666666 37 6 GK;GK2 glycerol kinase;glycerol kinase 2 49 7 C20140704_OR004_03 C20140704_OR004_03 TB428396.[MT7]-DQVEYLVQQNVIPPFC[CAM]NLLSVK[MT7].3b6_1.heavy 964.524 / 892.453 3161.0 49.51339912414551 40 15 10 5 10 2.083598444113504 47.99389262480774 0.048198699951171875 3 0.954898507919179 5.7892322198957356 3161.0 10.770199265714856 0.0 - - - - - - - 255.71428571428572 6 7 KPNA3 karyopherin alpha 3 (importin alpha 4) 51 7 C20140704_OR004_03 C20140704_OR004_03 TB428396.[MT7]-DQVEYLVQQNVIPPFC[CAM]NLLSVK[MT7].3b4_1.heavy 964.524 / 616.306 3793.0 49.51339912414551 40 15 10 5 10 2.083598444113504 47.99389262480774 0.048198699951171875 3 0.954898507919179 5.7892322198957356 3793.0 2.3062479406353824 1.0 - - - - - - - 225.71428571428572 7 7 KPNA3 karyopherin alpha 3 (importin alpha 4) 53 7 C20140704_OR004_03 C20140704_OR004_03 TB428396.[MT7]-DQVEYLVQQNVIPPFC[CAM]NLLSVK[MT7].3b5_1.heavy 964.524 / 779.369 3793.0 49.51339912414551 40 15 10 5 10 2.083598444113504 47.99389262480774 0.048198699951171875 3 0.954898507919179 5.7892322198957356 3793.0 0.6197549842800523 1.0 - - - - - - - 168.6 7 5 KPNA3 karyopherin alpha 3 (importin alpha 4) 55 7 C20140704_OR004_03 C20140704_OR004_03 TB428396.[MT7]-DQVEYLVQQNVIPPFC[CAM]NLLSVK[MT7].3b7_1.heavy 964.524 / 991.522 3477.0 49.51339912414551 40 15 10 5 10 2.083598444113504 47.99389262480774 0.048198699951171875 3 0.954898507919179 5.7892322198957356 3477.0 14.344954184263543 0.0 - - - - - - - 276.25 6 8 KPNA3 karyopherin alpha 3 (importin alpha 4) 57 8 C20140704_OR004_03 C20140704_OR004_03 TB413767.[MT7]-EAAVEDLHHYR.3b6_1.heavy 495.252 / 759.364 4851.0 22.537349700927734 46 20 10 6 10 6.556080752536471 15.25301529596187 0.0364990234375 3 0.9913752959278034 13.279375000628427 4851.0 14.9 1.0 - - - - - - - 168.0 9 9 PISD phosphatidylserine decarboxylase 59 8 C20140704_OR004_03 C20140704_OR004_03 TB413767.[MT7]-EAAVEDLHHYR.3b4_1.heavy 495.252 / 515.295 3276.0 22.537349700927734 46 20 10 6 10 6.556080752536471 15.25301529596187 0.0364990234375 3 0.9913752959278034 13.279375000628427 3276.0 27.733333333333334 0.0 - - - - - - - 151.2 6 15 PISD phosphatidylserine decarboxylase 61 8 C20140704_OR004_03 C20140704_OR004_03 TB413767.[MT7]-EAAVEDLHHYR.3b5_1.heavy 495.252 / 644.337 1827.0 22.537349700927734 46 20 10 6 10 6.556080752536471 15.25301529596187 0.0364990234375 3 0.9913752959278034 13.279375000628427 1827.0 40.31 2.0 - - - - - - - 169.6153846153846 4 13 PISD phosphatidylserine decarboxylase 63 8 C20140704_OR004_03 C20140704_OR004_03 TB413767.[MT7]-EAAVEDLHHYR.3y4_1.heavy 495.252 / 612.3 3654.0 22.537349700927734 46 20 10 6 10 6.556080752536471 15.25301529596187 0.0364990234375 3 0.9913752959278034 13.279375000628427 3654.0 58.435 0.0 - - - - - - - 207.0 7 7 PISD phosphatidylserine decarboxylase 65 9 C20140704_OR004_03 C20140704_OR004_03 TB428398.[MT7]-TFDMEDEYMLGSALLVHPVTEPK[MT7].4b7_1.heavy 728.368 / 1012.41 10383.0 45.80315017700195 41 15 10 6 10 4.454976131281652 22.446809377456983 0.0373992919921875 3 0.9527213169580319 5.653320201031522 10383.0 54.780438311688314 0.0 - - - - - - - 195.55555555555554 20 9 GANC glucosidase, alpha; neutral C 67 9 C20140704_OR004_03 C20140704_OR004_03 TB428398.[MT7]-TFDMEDEYMLGSALLVHPVTEPK[MT7].4y6_1.heavy 728.368 / 814.479 7303.0 45.80315017700195 41 15 10 6 10 4.454976131281652 22.446809377456983 0.0373992919921875 3 0.9527213169580319 5.653320201031522 7303.0 55.049128787878786 0.0 - - - - - - - 220.0 14 12 GANC glucosidase, alpha; neutral C 69 9 C20140704_OR004_03 C20140704_OR004_03 TB428398.[MT7]-TFDMEDEYMLGSALLVHPVTEPK[MT7].4b6_1.heavy 728.368 / 883.362 6159.0 45.80315017700195 41 15 10 6 10 4.454976131281652 22.446809377456983 0.0373992919921875 3 0.9527213169580319 5.653320201031522 6159.0 17.847102272727273 0.0 - - - - - - - 216.6153846153846 12 13 GANC glucosidase, alpha; neutral C 71 9 C20140704_OR004_03 C20140704_OR004_03 TB428398.[MT7]-TFDMEDEYMLGSALLVHPVTEPK[MT7].4b3_1.heavy 728.368 / 508.252 4576.0 45.80315017700195 41 15 10 6 10 4.454976131281652 22.446809377456983 0.0373992919921875 3 0.9527213169580319 5.653320201031522 4576.0 32.77733333333333 0.0 - - - - - - - 132.0 9 6 GANC glucosidase, alpha; neutral C 73 10 C20140704_OR004_03 C20140704_OR004_03 TB413410.[MT7]-AVEEGR.2y4_1.heavy 402.72 / 490.226 1029.0 14.497049808502197 39 14 10 5 10 1.1661139699838807 55.927589976951325 0.043900489807128906 3 0.9386201964777692 4.955674630682107 1029.0 19.0125845094086 1.0 - - - - - - - 140.55555555555554 2 9 GK2 glycerol kinase 2 75 10 C20140704_OR004_03 C20140704_OR004_03 TB413410.[MT7]-AVEEGR.2b3_1.heavy 402.72 / 444.258 1651.0 14.497049808502197 39 14 10 5 10 1.1661139699838807 55.927589976951325 0.043900489807128906 3 0.9386201964777692 4.955674630682107 1651.0 29.625420560747664 0.0 - - - - - - - 100.375 3 16 GK2 glycerol kinase 2 77 10 C20140704_OR004_03 C20140704_OR004_03 TB413410.[MT7]-AVEEGR.2y5_1.heavy 402.72 / 589.294 3110.0 14.497049808502197 39 14 10 5 10 1.1661139699838807 55.927589976951325 0.043900489807128906 3 0.9386201964777692 4.955674630682107 3110.0 55.50988372093023 0.0 - - - - - - - 98.6 6 10 GK2 glycerol kinase 2 79 10 C20140704_OR004_03 C20140704_OR004_03 TB413410.[MT7]-AVEEGR.2b4_1.heavy 402.72 / 573.3 2080.0 14.497049808502197 39 14 10 5 10 1.1661139699838807 55.927589976951325 0.043900489807128906 3 0.9386201964777692 4.955674630682107 2080.0 98.48295505117935 0.0 - - - - - - - 92.77777777777777 4 9 GK2 glycerol kinase 2 81 11 C20140704_OR004_03 C20140704_OR004_03 TB413669.[MT7]-TAELLSHHK[MT7].3b4_1.heavy 441.926 / 559.321 9918.0 20.859100341796875 50 20 10 10 10 7.105439310757243 14.073725159907498 0.0 3 0.9905548845459785 12.68867607864257 9918.0 293.99785714285713 0.0 - - - - - - - 168.9090909090909 19 11 GK2 glycerol kinase 2 83 11 C20140704_OR004_03 C20140704_OR004_03 TB413669.[MT7]-TAELLSHHK[MT7].3b5_1.heavy 441.926 / 672.405 2592.0 20.859100341796875 50 20 10 10 10 7.105439310757243 14.073725159907498 0.0 3 0.9905548845459785 12.68867607864257 2592.0 64.41169152970923 0.0 - - - - - - - 131.33333333333334 5 6 GK2 glycerol kinase 2 85 11 C20140704_OR004_03 C20140704_OR004_03 TB413669.[MT7]-TAELLSHHK[MT7].3y4_1.heavy 441.926 / 652.365 1521.0 20.859100341796875 50 20 10 10 10 7.105439310757243 14.073725159907498 0.0 3 0.9905548845459785 12.68867607864257 1521.0 21.99249557522124 0.0 - - - - - - - 146.4 3 10 GK2 glycerol kinase 2 87 11 C20140704_OR004_03 C20140704_OR004_03 TB413669.[MT7]-TAELLSHHK[MT7].3b3_1.heavy 441.926 / 446.237 11495.0 20.859100341796875 50 20 10 10 10 7.105439310757243 14.073725159907498 0.0 3 0.9905548845459785 12.68867607864257 11495.0 88.42307692307693 0.0 - - - - - - - 151.69230769230768 22 13 GK2 glycerol kinase 2 89 12 C20140704_OR004_03 C20140704_OR004_03 TB413668.[MT7]-LQGVSNMRK[MT7].3y7_1.heavy 440.927 / 935.521 N/A 22.981399536132812 48 18 10 10 10 4.577766601959067 21.844713524102506 0.0 3 0.9869556890008422 10.793904593384957 0.0 0.0 7.0 - - - - - - - 0.0 0 0 RICTOR RPTOR independent companion of MTOR, complex 2 91 12 C20140704_OR004_03 C20140704_OR004_03 TB413668.[MT7]-LQGVSNMRK[MT7].3b4_1.heavy 440.927 / 542.342 3293.0 22.981399536132812 48 18 10 10 10 4.577766601959067 21.844713524102506 0.0 3 0.9869556890008422 10.793904593384957 3293.0 26.91023189835944 0.0 - - - - - - - 107.2 6 10 RICTOR RPTOR independent companion of MTOR, complex 2 93 12 C20140704_OR004_03 C20140704_OR004_03 TB413668.[MT7]-LQGVSNMRK[MT7].3y8_2.heavy 440.927 / 532.294 11356.0 22.981399536132812 48 18 10 10 10 4.577766601959067 21.844713524102506 0.0 3 0.9869556890008422 10.793904593384957 11356.0 45.88016315572078 0.0 - - - - - - - 268.72727272727275 22 11 RICTOR RPTOR independent companion of MTOR, complex 2 95 12 C20140704_OR004_03 C20140704_OR004_03 TB413668.[MT7]-LQGVSNMRK[MT7].3y5_1.heavy 440.927 / 779.431 4233.0 22.981399536132812 48 18 10 10 10 4.577766601959067 21.844713524102506 0.0 3 0.9869556890008422 10.793904593384957 4233.0 68.9680954336126 0.0 - - - - - - - 163.28571428571428 8 7 RICTOR RPTOR independent companion of MTOR, complex 2 97 13 C20140704_OR004_03 C20140704_OR004_03 TB414205.[MT7]-GVLQFENVSYGIEPLESSVGFEHVIYQVK[MT7].4b7_1.heavy 889.721 / 932.496 6182.0 47.651899337768555 45 20 10 5 10 11.310354312351649 8.841456000259289 0.042400360107421875 3 0.9977594691813718 26.067884488974123 6182.0 98.91199999999999 0.0 - - - - - - - 168.88888888888889 12 9 ADAM2 ADAM metallopeptidase domain 2 99 13 C20140704_OR004_03 C20140704_OR004_03 TB414205.[MT7]-GVLQFENVSYGIEPLESSVGFEHVIYQVK[MT7].4b4_1.heavy 889.721 / 542.342 13410.0 47.651899337768555 45 20 10 5 10 11.310354312351649 8.841456000259289 0.042400360107421875 3 0.9977594691813718 26.067884488974123 13410.0 161.82232279472763 0.0 - - - - - - - 237.5 26 8 ADAM2 ADAM metallopeptidase domain 2 101 13 C20140704_OR004_03 C20140704_OR004_03 TB414205.[MT7]-GVLQFENVSYGIEPLESSVGFEHVIYQVK[MT7].4b5_1.heavy 889.721 / 689.41 3994.0 47.651899337768555 45 20 10 5 10 11.310354312351649 8.841456000259289 0.042400360107421875 3 0.9977594691813718 26.067884488974123 3994.0 34.17322456140351 0.0 - - - - - - - 237.625 7 8 ADAM2 ADAM metallopeptidase domain 2 103 13 C20140704_OR004_03 C20140704_OR004_03 TB414205.[MT7]-GVLQFENVSYGIEPLESSVGFEHVIYQVK[MT7].4b6_1.heavy 889.721 / 818.453 4945.0 47.651899337768555 45 20 10 5 10 11.310354312351649 8.841456000259289 0.042400360107421875 3 0.9977594691813718 26.067884488974123 4945.0 21.277526643712083 0.0 - - - - - - - 215.9090909090909 9 11 ADAM2 ADAM metallopeptidase domain 2 105 14 C20140704_OR004_03 C20140704_OR004_03 TB414202.[MT7]-AQNVTLEAILQNATSDNPVVQLSAVQAARK[MT7].4b8_1.heavy 860.229 / 971.528 10573.0 48.528249740600586 37 16 10 1 10 6.135116517152548 16.29960893495994 0.0948028564453125 3 0.9658582538135563 6.660028171895126 10573.0 31.312288854445537 0.0 - - - - - - - 167.83333333333334 21 6 KPNA3 karyopherin alpha 3 (importin alpha 4) 107 14 C20140704_OR004_03 C20140704_OR004_03 TB414202.[MT7]-AQNVTLEAILQNATSDNPVVQLSAVQAARK[MT7].4b7_1.heavy 860.229 / 900.491 6042.0 48.528249740600586 37 16 10 1 10 6.135116517152548 16.29960893495994 0.0948028564453125 3 0.9658582538135563 6.660028171895126 6042.0 11.975089961828088 2.0 - - - - - - - 575.1428571428571 12 7 KPNA3 karyopherin alpha 3 (importin alpha 4) 109 14 C20140704_OR004_03 C20140704_OR004_03 TB414202.[MT7]-AQNVTLEAILQNATSDNPVVQLSAVQAARK[MT7].4y10_1.heavy 860.229 / 1215.73 3726.0 48.528249740600586 37 16 10 1 10 6.135116517152548 16.29960893495994 0.0948028564453125 3 0.9658582538135563 6.660028171895126 3726.0 23.532873875654836 0.0 - - - - - - - 228.8181818181818 7 11 KPNA3 karyopherin alpha 3 (importin alpha 4) 111 14 C20140704_OR004_03 C20140704_OR004_03 TB414202.[MT7]-AQNVTLEAILQNATSDNPVVQLSAVQAARK[MT7].4b4_1.heavy 860.229 / 557.316 8157.0 48.528249740600586 37 16 10 1 10 6.135116517152548 16.29960893495994 0.0948028564453125 3 0.9658582538135563 6.660028171895126 8157.0 35.728246698469235 0.0 - - - - - - - 251.66666666666666 16 6 KPNA3 karyopherin alpha 3 (importin alpha 4) 113 15 C20140704_OR004_03 C20140704_OR004_03 TB414201.[MT7]-VLFLLSGLGGLRMDSNFDSLPVQITVPEK[MT7].3y3_1.heavy 1145.31 / 517.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 115 15 C20140704_OR004_03 C20140704_OR004_03 TB414201.[MT7]-VLFLLSGLGGLRMDSNFDSLPVQITVPEK[MT7].3b4_1.heavy 1145.31 / 617.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 117 15 C20140704_OR004_03 C20140704_OR004_03 TB414201.[MT7]-VLFLLSGLGGLRMDSNFDSLPVQITVPEK[MT7].3b3_1.heavy 1145.31 / 504.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 119 15 C20140704_OR004_03 C20140704_OR004_03 TB414201.[MT7]-VLFLLSGLGGLRMDSNFDSLPVQITVPEK[MT7].3y9_1.heavy 1145.31 / 1154.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 121 16 C20140704_OR004_03 C20140704_OR004_03 TB413677.[MT7]-LPNLESLRPR.3y6_1.heavy 446.937 / 757.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 123 16 C20140704_OR004_03 C20140704_OR004_03 TB413677.[MT7]-LPNLESLRPR.3b3_1.heavy 446.937 / 469.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 125 16 C20140704_OR004_03 C20140704_OR004_03 TB413677.[MT7]-LPNLESLRPR.3y8_1.heavy 446.937 / 984.558 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 127 16 C20140704_OR004_03 C20140704_OR004_03 TB413677.[MT7]-LPNLESLRPR.3y5_1.heavy 446.937 / 628.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 129 17 C20140704_OR004_03 C20140704_OR004_03 TB428097.[MT7]-QPLC[CAM]QLWAEK[MT7].3b6_1.heavy 520.953 / 884.478 1406.0 37.376800537109375 39 18 8 5 8 12.999948074679407 7.692338417472188 0.04740142822265625 4 0.9890479156030125 11.781940126952868 1406.0 6.667656979980098 1.0 - - - - - - - 365.6 9 5 SLCO4A1 solute carrier organic anion transporter family, member 4A1 131 17 C20140704_OR004_03 C20140704_OR004_03 TB428097.[MT7]-QPLC[CAM]QLWAEK[MT7].3b4_1.heavy 520.953 / 643.335 984.0 37.376800537109375 39 18 8 5 8 12.999948074679407 7.692338417472188 0.04740142822265625 4 0.9890479156030125 11.781940126952868 984.0 9.53750586810025 1.0 - - - - - - - 0.0 1 0 SLCO4A1 solute carrier organic anion transporter family, member 4A1 133 17 C20140704_OR004_03 C20140704_OR004_03 TB428097.[MT7]-QPLC[CAM]QLWAEK[MT7].3b5_1.heavy 520.953 / 771.394 3514.0 37.376800537109375 39 18 8 5 8 12.999948074679407 7.692338417472188 0.04740142822265625 4 0.9890479156030125 11.781940126952868 3514.0 21.94410984332597 0.0 - - - - - - - 169.0 7 5 SLCO4A1 solute carrier organic anion transporter family, member 4A1 135 17 C20140704_OR004_03 C20140704_OR004_03 TB428097.[MT7]-QPLC[CAM]QLWAEK[MT7].3y4_1.heavy 520.953 / 677.374 3374.0 37.376800537109375 39 18 8 5 8 12.999948074679407 7.692338417472188 0.04740142822265625 4 0.9890479156030125 11.781940126952868 3374.0 19.542579480865562 1.0 - - - - - - - 281.25 6 4 SLCO4A1 solute carrier organic anion transporter family, member 4A1 137 18 C20140704_OR004_03 C20140704_OR004_03 TB413771.[MT7]-IDPDYSVYVK[MT7].2y8_1.heavy 743.905 / 1114.59 6068.0 33.32460021972656 43 17 10 10 6 7.50933258110814 13.316762697603567 0.0 6 0.9782669680232184 8.356270937888818 6068.0 25.539830917874397 0.0 - - - - - - - 138.0 12 2 GANC glucosidase, alpha; neutral C 139 18 C20140704_OR004_03 C20140704_OR004_03 TB413771.[MT7]-IDPDYSVYVK[MT7].2b4_1.heavy 743.905 / 585.3 3310.0 33.32460021972656 43 17 10 10 6 7.50933258110814 13.316762697603567 0.0 6 0.9782669680232184 8.356270937888818 3310.0 11.593961936806688 1.0 - - - - - - - 276.0 7 4 GANC glucosidase, alpha; neutral C 141 18 C20140704_OR004_03 C20140704_OR004_03 TB413771.[MT7]-IDPDYSVYVK[MT7].2y3_1.heavy 743.905 / 553.347 3172.0 33.32460021972656 43 17 10 10 6 7.50933258110814 13.316762697603567 0.0 6 0.9782669680232184 8.356270937888818 3172.0 27.46768115942029 0.0 - - - - - - - 197.14285714285714 6 7 GANC glucosidase, alpha; neutral C 143 18 C20140704_OR004_03 C20140704_OR004_03 TB413771.[MT7]-IDPDYSVYVK[MT7].2y6_1.heavy 743.905 / 902.51 3585.0 33.32460021972656 43 17 10 10 6 7.50933258110814 13.316762697603567 0.0 6 0.9782669680232184 8.356270937888818 3585.0 36.36956521739131 3.0 - - - - - - - 197.14285714285714 13 7 GANC glucosidase, alpha; neutral C 145 19 C20140704_OR004_03 C20140704_OR004_03 TB428299.[MT7]-IVIEGK[MT7]PYTVNLMQK[MT7].4b11_2.heavy 542.074 / 751.945 36323.0 36.02560043334961 45 15 10 10 10 3.430816305793618 29.147582116573847 0.0 3 0.9596657162398805 6.124272872262923 36323.0 113.11109649122805 0.0 - - - - - - - 395.2 72 5 ADAM2 ADAM metallopeptidase domain 2 147 19 C20140704_OR004_03 C20140704_OR004_03 TB428299.[MT7]-IVIEGK[MT7]PYTVNLMQK[MT7].4b4_1.heavy 542.074 / 599.388 7295.0 36.02560043334961 45 15 10 10 10 3.430816305793618 29.147582116573847 0.0 3 0.9596657162398805 6.124272872262923 7295.0 29.721640037593986 2.0 - - - - - - - 325.7142857142857 14 7 ADAM2 ADAM metallopeptidase domain 2 149 19 C20140704_OR004_03 C20140704_OR004_03 TB428299.[MT7]-IVIEGK[MT7]PYTVNLMQK[MT7].4y3_1.heavy 542.074 / 550.314 40426.0 36.02560043334961 45 15 10 10 10 3.430816305793618 29.147582116573847 0.0 3 0.9596657162398805 6.124272872262923 40426.0 331.56412280701755 0.0 - - - - - - - 219.55555555555554 80 9 ADAM2 ADAM metallopeptidase domain 2 151 19 C20140704_OR004_03 C20140704_OR004_03 TB428299.[MT7]-IVIEGK[MT7]PYTVNLMQK[MT7].4b9_2.heavy 542.074 / 645.389 23709.0 36.02560043334961 45 15 10 10 10 3.430816305793618 29.147582116573847 0.0 3 0.9596657162398805 6.124272872262923 23709.0 82.92950657894738 0.0 - - - - - - - 334.4 47 5 ADAM2 ADAM metallopeptidase domain 2 153 20 C20140704_OR004_03 C20140704_OR004_03 TB428294.[MT7]-AIAAEDPSLDFRNNPTK[MT7].4y10_2.heavy 537.539 / 668.36 6391.0 30.357200622558594 42 14 10 10 8 2.0220444674301024 42.65800672402274 0.0 4 0.9376419055539406 4.9162378267607 6391.0 29.067694423295055 1.0 - - - - - - - 292.15384615384613 16 13 KIAA1267 KIAA1267 155 20 C20140704_OR004_03 C20140704_OR004_03 TB428294.[MT7]-AIAAEDPSLDFRNNPTK[MT7].4b5_1.heavy 537.539 / 600.347 2964.0 30.357200622558594 42 14 10 10 8 2.0220444674301024 42.65800672402274 0.0 4 0.9376419055539406 4.9162378267607 2964.0 32.174324295359554 0.0 - - - - - - - 271.2857142857143 5 14 KIAA1267 KIAA1267 157 20 C20140704_OR004_03 C20140704_OR004_03 TB428294.[MT7]-AIAAEDPSLDFRNNPTK[MT7].4y7_2.heavy 537.539 / 510.789 12319.0 30.357200622558594 42 14 10 10 8 2.0220444674301024 42.65800672402274 0.0 4 0.9376419055539406 4.9162378267607 12319.0 28.58185251798561 0.0 - - - - - - - 331.0 24 7 KIAA1267 KIAA1267 159 20 C20140704_OR004_03 C20140704_OR004_03 TB428294.[MT7]-AIAAEDPSLDFRNNPTK[MT7].4b6_1.heavy 537.539 / 715.374 5094.0 30.357200622558594 42 14 10 10 8 2.0220444674301024 42.65800672402274 0.0 4 0.9376419055539406 4.9162378267607 5094.0 9.293648002691773 0.0 - - - - - - - 764.0 10 8 KIAA1267 KIAA1267 161 21 C20140704_OR004_03 C20140704_OR004_03 TB428293.[MT7]-AIAELGIYPAVDPLDSTSR.2b4_1.heavy 1066.57 / 529.31 14840.0 43.05030059814453 42 12 10 10 10 3.0483705361634197 32.80441101686305 0.0 3 0.8914439130174507 3.711298513814706 14840.0 57.05675489222796 0.0 - - - - - - - 272.0 29 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 163 21 C20140704_OR004_03 C20140704_OR004_03 TB428293.[MT7]-AIAELGIYPAVDPLDSTSR.2b6_1.heavy 1066.57 / 699.416 14016.0 43.05030059814453 42 12 10 10 10 3.0483705361634197 32.80441101686305 0.0 3 0.8914439130174507 3.711298513814706 14016.0 48.86508779734645 0.0 - - - - - - - 219.5 28 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 165 21 C20140704_OR004_03 C20140704_OR004_03 TB428293.[MT7]-AIAELGIYPAVDPLDSTSR.2y11_1.heavy 1066.57 / 1157.58 11790.0 43.05030059814453 42 12 10 10 10 3.0483705361634197 32.80441101686305 0.0 3 0.8914439130174507 3.711298513814706 11790.0 56.49672727272727 0.0 - - - - - - - 194.14285714285714 23 14 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 167 21 C20140704_OR004_03 C20140704_OR004_03 TB428293.[MT7]-AIAELGIYPAVDPLDSTSR.2y7_1.heavy 1066.57 / 775.394 11377.0 43.05030059814453 42 12 10 10 10 3.0483705361634197 32.80441101686305 0.0 3 0.8914439130174507 3.711298513814706 11377.0 32.303564073495316 0.0 - - - - - - - 276.7142857142857 22 14 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 169 22 C20140704_OR004_03 C20140704_OR004_03 TB451339.[MT7]-MFDVGGQR.2b3_1.heavy 527.267 / 538.245 18217.0 29.50550079345703 50 20 10 10 10 5.186129095192699 19.282204157373435 0.0 3 0.9929423701827651 14.681728100388542 18217.0 29.774021505376346 0.0 - - - - - - - 204.54545454545453 36 11 GNAI1;GNAI2;GNAI3;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 171 22 C20140704_OR004_03 C20140704_OR004_03 TB451339.[MT7]-MFDVGGQR.2y5_1.heavy 527.267 / 516.289 26124.0 29.50550079345703 50 20 10 10 10 5.186129095192699 19.282204157373435 0.0 3 0.9929423701827651 14.681728100388542 26124.0 53.16294193548387 0.0 - - - - - - - 215.44444444444446 52 9 GNAI1;GNAI2;GNAI3;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 173 22 C20140704_OR004_03 C20140704_OR004_03 TB451339.[MT7]-MFDVGGQR.2y6_1.heavy 527.267 / 631.316 5659.0 29.50550079345703 50 20 10 10 10 5.186129095192699 19.282204157373435 0.0 3 0.9929423701827651 14.681728100388542 5659.0 10.996665848469972 0.0 - - - - - - - 198.38888888888889 11 18 GNAI1;GNAI2;GNAI3;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 175 22 C20140704_OR004_03 C20140704_OR004_03 TB451339.[MT7]-MFDVGGQR.2y7_1.heavy 527.267 / 778.384 11628.0 29.50550079345703 50 20 10 10 10 5.186129095192699 19.282204157373435 0.0 3 0.9929423701827651 14.681728100388542 11628.0 132.03406451612904 0.0 - - - - - - - 208.92307692307693 23 13 GNAI1;GNAI2;GNAI3;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 177 23 C20140704_OR004_03 C20140704_OR004_03 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 143279.0 29.939599990844727 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 143279.0 1553.935862939742 0.0 - - - - - - - 220.07142857142858 286 14 179 23 C20140704_OR004_03 C20140704_OR004_03 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 61590.0 29.939599990844727 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 61590.0 678.1503521245979 0.0 - - - - - - - 228.6 123 10 181 23 C20140704_OR004_03 C20140704_OR004_03 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 53730.0 29.939599990844727 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 53730.0 147.14999999999998 0.0 - - - - - - - 784.6666666666666 107 9 183 24 C20140704_OR004_03 C20140704_OR004_03 TB414000.[MT7]-IMDPNIVGSEHYDVAR.3b5_1.heavy 653.995 / 715.357 59270.0 32.770301818847656 48 18 10 10 10 3.928148395433522 21.25194134836693 0.0 3 0.9849745724673991 10.055499716472964 59270.0 71.43496263885558 0.0 - - - - - - - 309.0 118 3 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 185 24 C20140704_OR004_03 C20140704_OR004_03 TB414000.[MT7]-IMDPNIVGSEHYDVAR.3b3_1.heavy 653.995 / 504.261 94329.0 32.770301818847656 48 18 10 10 10 3.928148395433522 21.25194134836693 0.0 3 0.9849745724673991 10.055499716472964 94329.0 160.2410813624622 0.0 - - - - - - - 755.8571428571429 188 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 187 24 C20140704_OR004_03 C20140704_OR004_03 TB414000.[MT7]-IMDPNIVGSEHYDVAR.3y10_1.heavy 653.995 / 1132.54 20242.0 32.770301818847656 48 18 10 10 10 3.928148395433522 21.25194134836693 0.0 3 0.9849745724673991 10.055499716472964 20242.0 50.94115867176751 0.0 - - - - - - - 231.5 40 8 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 189 24 C20140704_OR004_03 C20140704_OR004_03 TB414000.[MT7]-IMDPNIVGSEHYDVAR.3y9_1.heavy 653.995 / 1033.47 74749.0 32.770301818847656 48 18 10 10 10 3.928148395433522 21.25194134836693 0.0 3 0.9849745724673991 10.055499716472964 74749.0 89.93267064253176 0.0 - - - - - - - 231.5 149 8 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 191 25 C20140704_OR004_03 C20140704_OR004_03 TB428192.[MT7]-VYGVSLATHLQELGR.3y6_1.heavy 596.336 / 715.41 11100.0 37.58980178833008 50 20 10 10 10 8.17127136179007 12.237997683887116 0.0 3 0.9925248657798654 14.26533472785679 11100.0 56.48754448398577 0.0 - - - - - - - 281.2857142857143 22 7 SH3BP1 SH3-domain binding protein 1 193 25 C20140704_OR004_03 C20140704_OR004_03 TB428192.[MT7]-VYGVSLATHLQELGR.3b4_1.heavy 596.336 / 563.331 5339.0 37.58980178833008 50 20 10 10 10 8.17127136179007 12.237997683887116 0.0 3 0.9925248657798654 14.26533472785679 5339.0 6.526387351778656 0.0 - - - - - - - 309.4 10 5 SH3BP1 SH3-domain binding protein 1 195 25 C20140704_OR004_03 C20140704_OR004_03 TB428192.[MT7]-VYGVSLATHLQELGR.3b5_1.heavy 596.336 / 650.363 3794.0 37.58980178833008 50 20 10 10 10 8.17127136179007 12.237997683887116 0.0 3 0.9925248657798654 14.26533472785679 3794.0 14.333423176231857 1.0 - - - - - - - 228.625 8 8 SH3BP1 SH3-domain binding protein 1 197 25 C20140704_OR004_03 C20140704_OR004_03 TB428192.[MT7]-VYGVSLATHLQELGR.3y5_1.heavy 596.336 / 602.326 9695.0 37.58980178833008 50 20 10 10 10 8.17127136179007 12.237997683887116 0.0 3 0.9925248657798654 14.26533472785679 9695.0 27.52169330927122 0.0 - - - - - - - 304.8333333333333 19 6 SH3BP1 SH3-domain binding protein 1 199 26 C20140704_OR004_03 C20140704_OR004_03 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 41647.0 16.058300018310547 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 41647.0 48.98237442307456 0.0 - - - - - - - 138.0 83 11 201 26 C20140704_OR004_03 C20140704_OR004_03 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 60581.0 16.058300018310547 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 60581.0 1572.9208925300645 0.0 - - - - - - - 173.76923076923077 121 13 203 26 C20140704_OR004_03 C20140704_OR004_03 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 35941.0 16.058300018310547 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 35941.0 330.39973884815987 0.0 - - - - - - - 178.45454545454547 71 11 205 27 C20140704_OR004_03 C20140704_OR004_03 TB414008.[MT7]-LISC[CAM]SGDTGSLILADGK[MT7].3b10_1.heavy 665.694 / 1122.52 1985.0 36.76179885864258 43 13 10 10 10 1.6280939439740922 61.42151708758601 0.0 3 0.9023591168316475 3.916947614920014 1985.0 19.919894366197184 0.0 - - - - - - - 243.28571428571428 3 7 GANC glucosidase, alpha; neutral C 207 27 C20140704_OR004_03 C20140704_OR004_03 TB414008.[MT7]-LISC[CAM]SGDTGSLILADGK[MT7].3y4_1.heavy 665.694 / 534.3 8364.0 36.76179885864258 43 13 10 10 10 1.6280939439740922 61.42151708758601 0.0 3 0.9023591168316475 3.916947614920014 8364.0 20.20931216931217 0.0 - - - - - - - 708.8571428571429 16 7 GANC glucosidase, alpha; neutral C 209 27 C20140704_OR004_03 C20140704_OR004_03 TB414008.[MT7]-LISC[CAM]SGDTGSLILADGK[MT7].3b7_1.heavy 665.694 / 877.421 2126.0 36.76179885864258 43 13 10 10 10 1.6280939439740922 61.42151708758601 0.0 3 0.9023591168316475 3.916947614920014 2126.0 19.463380281690142 0.0 - - - - - - - 241.2 4 10 GANC glucosidase, alpha; neutral C 211 27 C20140704_OR004_03 C20140704_OR004_03 TB414008.[MT7]-LISC[CAM]SGDTGSLILADGK[MT7].3y5_1.heavy 665.694 / 647.385 8364.0 36.76179885864258 43 13 10 10 10 1.6280939439740922 61.42151708758601 0.0 3 0.9023591168316475 3.916947614920014 8364.0 16.810578279266572 0.0 - - - - - - - 726.625 16 8 GANC glucosidase, alpha; neutral C 213 28 C20140704_OR004_03 C20140704_OR004_03 TB451308.[MT7]-EC[CAM]VQC[CAM]R.2b3_1.heavy 498.23 / 533.251 420.0 15.200900077819824 50 20 10 10 10 7.223982701523774 13.84277954858706 0.0 3 0.9922084890987636 13.972339854215827 420.0 3.3996723996724 1.0 - - - - - - - 0.0 0 0 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 215 28 C20140704_OR004_03 C20140704_OR004_03 TB451308.[MT7]-EC[CAM]VQC[CAM]R.2y4_1.heavy 498.23 / 562.277 297.0 15.200900077819824 50 20 10 10 10 7.223982701523774 13.84277954858706 0.0 3 0.9922084890987636 13.972339854215827 297.0 2.809459459459459 0.0 - - - - - - - 0.0 0 0 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 217 28 C20140704_OR004_03 C20140704_OR004_03 TB451308.[MT7]-EC[CAM]VQC[CAM]R.2y5_1.heavy 498.23 / 722.307 865.0 15.200900077819824 50 20 10 10 10 7.223982701523774 13.84277954858706 0.0 3 0.9922084890987636 13.972339854215827 865.0 64.35600000000001 0.0 - - - - - - - 0.0 1 0 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 219 28 C20140704_OR004_03 C20140704_OR004_03 TB451308.[MT7]-EC[CAM]VQC[CAM]R.2b4_1.heavy 498.23 / 661.31 371.0 15.200900077819824 50 20 10 10 10 7.223982701523774 13.84277954858706 0.0 3 0.9922084890987636 13.972339854215827 371.0 11.66 0.0 - - - - - - - 0.0 0 0 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 221 29 C20140704_OR004_03 C20140704_OR004_03 TB428374.[MT7]-QLFVLAGAAEEGFMTAELAGVIK[MT7].4y4_1.heavy 664.118 / 560.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 223 29 C20140704_OR004_03 C20140704_OR004_03 TB428374.[MT7]-QLFVLAGAAEEGFMTAELAGVIK[MT7].4b4_1.heavy 664.118 / 632.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 225 29 C20140704_OR004_03 C20140704_OR004_03 TB428374.[MT7]-QLFVLAGAAEEGFMTAELAGVIK[MT7].4b5_1.heavy 664.118 / 745.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 227 29 C20140704_OR004_03 C20140704_OR004_03 TB428374.[MT7]-QLFVLAGAAEEGFMTAELAGVIK[MT7].4b3_1.heavy 664.118 / 533.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 229 30 C20140704_OR004_03 C20140704_OR004_03 TB428371.[MT7]-VQVLTAGSLMGLGDIISQQLVER.3y7_1.heavy 857.815 / 859.463 11231.0 54.22694969177246 45 18 10 7 10 3.4501222142595718 19.504000167995414 0.025897979736328125 3 0.9867239066760476 10.6990586899312 11231.0 31.560956651718982 0.0 - - - - - - - 142.92307692307693 22 13 MPV17 MpV17 mitochondrial inner membrane protein 231 30 C20140704_OR004_03 C20140704_OR004_03 TB428371.[MT7]-VQVLTAGSLMGLGDIISQQLVER.3b4_1.heavy 857.815 / 584.389 7958.0 54.22694969177246 45 18 10 7 10 3.4501222142595718 19.504000167995414 0.025897979736328125 3 0.9867239066760476 10.6990586899312 7958.0 6.904631684763129 1.0 - - - - - - - 218.76470588235293 15 17 MPV17 MpV17 mitochondrial inner membrane protein 233 30 C20140704_OR004_03 C20140704_OR004_03 TB428371.[MT7]-VQVLTAGSLMGLGDIISQQLVER.3y8_1.heavy 857.815 / 972.547 8330.0 54.22694969177246 45 18 10 7 10 3.4501222142595718 19.504000167995414 0.025897979736328125 3 0.9867239066760476 10.6990586899312 8330.0 41.65 0.0 - - - - - - - 174.94117647058823 16 17 MPV17 MpV17 mitochondrial inner membrane protein 235 30 C20140704_OR004_03 C20140704_OR004_03 TB428371.[MT7]-VQVLTAGSLMGLGDIISQQLVER.3b7_1.heavy 857.815 / 813.495 4165.0 54.22694969177246 45 18 10 7 10 3.4501222142595718 19.504000167995414 0.025897979736328125 3 0.9867239066760476 10.6990586899312 4165.0 16.56819438315241 1.0 - - - - - - - 214.35294117647058 8 17 MPV17 MpV17 mitochondrial inner membrane protein 237 31 C20140704_OR004_03 C20140704_OR004_03 TB451443.[MT7]-SQC[CAM]LHNQPR.2b3_1.heavy 642.323 / 520.231 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 239 31 C20140704_OR004_03 C20140704_OR004_03 TB451443.[MT7]-SQC[CAM]LHNQPR.2y8_1.heavy 642.323 / 1052.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 241 31 C20140704_OR004_03 C20140704_OR004_03 TB451443.[MT7]-SQC[CAM]LHNQPR.2b4_1.heavy 642.323 / 633.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 243 31 C20140704_OR004_03 C20140704_OR004_03 TB451443.[MT7]-SQC[CAM]LHNQPR.2y7_1.heavy 642.323 / 924.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 245 32 C20140704_OR004_03 C20140704_OR004_03 TB451444.[MT7]-VAAAPASGALRR.3b11_2.heavy 428.594 / 555.331 4909.0 21.229900360107422 44 14 10 10 10 2.8581682882319726 34.98744297588536 0.0 3 0.9469752073673735 5.335620302065228 4909.0 35.184682392141326 0.0 - - - - - - - 204.0 9 11 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 247 32 C20140704_OR004_03 C20140704_OR004_03 TB451444.[MT7]-VAAAPASGALRR.3y11_2.heavy 428.594 / 520.802 17128.0 21.229900360107422 44 14 10 10 10 2.8581682882319726 34.98744297588536 0.0 3 0.9469752073673735 5.335620302065228 17128.0 232.6731947000368 0.0 - - - - - - - 108.5 34 12 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 249 32 C20140704_OR004_03 C20140704_OR004_03 TB451444.[MT7]-VAAAPASGALRR.3b4_1.heavy 428.594 / 457.289 22349.0 21.229900360107422 44 14 10 10 10 2.8581682882319726 34.98744297588536 0.0 3 0.9469752073673735 5.335620302065228 22349.0 113.71937772312955 0.0 - - - - - - - 208.92857142857142 44 14 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 251 32 C20140704_OR004_03 C20140704_OR004_03 TB451444.[MT7]-VAAAPASGALRR.3y8_1.heavy 428.594 / 827.485 1201.0 21.229900360107422 44 14 10 10 10 2.8581682882319726 34.98744297588536 0.0 3 0.9469752073673735 5.335620302065228 1201.0 19.136560999510046 0.0 - - - - - - - 274.25 2 4 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 253 33 C20140704_OR004_03 C20140704_OR004_03 TB427902.[MT7]-QQAVC[CAM]GNAK[MT7].2y4_1.heavy 632.34 / 533.316 477.0 15.746225118637085 40 14 10 6 10 1.3540037817482369 45.55981345131795 0.035500526428222656 3 0.9376874875197972 4.918054745823576 477.0 10.481447368421053 3.0 - - - - - - - 114.53333333333333 2 15 ADAM2 ADAM metallopeptidase domain 2 255 33 C20140704_OR004_03 C20140704_OR004_03 TB427902.[MT7]-QQAVC[CAM]GNAK[MT7].2y5_1.heavy 632.34 / 693.347 985.0 15.746225118637085 40 14 10 6 10 1.3540037817482369 45.55981345131795 0.035500526428222656 3 0.9376874875197972 4.918054745823576 985.0 58.7921875 0.0 - - - - - - - 0.0 1 0 ADAM2 ADAM metallopeptidase domain 2 257 33 C20140704_OR004_03 C20140704_OR004_03 TB427902.[MT7]-QQAVC[CAM]GNAK[MT7].2b4_1.heavy 632.34 / 571.332 1112.0 15.746225118637085 40 14 10 6 10 1.3540037817482369 45.55981345131795 0.035500526428222656 3 0.9376874875197972 4.918054745823576 1112.0 15.455244755244756 0.0 - - - - - - - 131.1875 2 16 ADAM2 ADAM metallopeptidase domain 2 259 33 C20140704_OR004_03 C20140704_OR004_03 TB427902.[MT7]-QQAVC[CAM]GNAK[MT7].2y7_1.heavy 632.34 / 863.453 795.0 15.746225118637085 40 14 10 6 10 1.3540037817482369 45.55981345131795 0.035500526428222656 3 0.9376874875197972 4.918054745823576 795.0 41.240624999999994 0.0 - - - - - - - 0.0 1 0 ADAM2 ADAM metallopeptidase domain 2 261 34 C20140704_OR004_03 C20140704_OR004_03 TB428182.[MT7]-IRPTAVTLEHVPK[MT7].4b7_1.heavy 438.021 / 883.548 753.0 27.683299382527668 31 5 10 6 10 0.4225734515664232 113.81846311522557 0.0345001220703125 3 0.6607789424768314 2.055891738362696 753.0 16.064 0.0 - - - - - - - 0.0 1 0 SUN2 Sad1 and UNC84 domain containing 2 263 34 C20140704_OR004_03 C20140704_OR004_03 TB428182.[MT7]-IRPTAVTLEHVPK[MT7].4b7_2.heavy 438.021 / 442.278 6923.0 27.683299382527668 31 5 10 6 10 0.4225734515664232 113.81846311522557 0.0345001220703125 3 0.6607789424768314 2.055891738362696 6923.0 99.0213640117994 0.0 - - - - - - - 225.9090909090909 13 11 SUN2 Sad1 and UNC84 domain containing 2 265 34 C20140704_OR004_03 C20140704_OR004_03 TB428182.[MT7]-IRPTAVTLEHVPK[MT7].4b9_1.heavy 438.021 / 1125.67 N/A 27.683299382527668 31 5 10 6 10 0.4225734515664232 113.81846311522557 0.0345001220703125 3 0.6607789424768314 2.055891738362696 0.0 0.0 11.0 - - - - - - - 0.0 0 0 SUN2 Sad1 and UNC84 domain containing 2 267 34 C20140704_OR004_03 C20140704_OR004_03 TB428182.[MT7]-IRPTAVTLEHVPK[MT7].4b6_1.heavy 438.021 / 782.5 1731.0 27.683299382527668 31 5 10 6 10 0.4225734515664232 113.81846311522557 0.0345001220703125 3 0.6607789424768314 2.055891738362696 1731.0 23.53393222591362 0.0 - - - - - - - 197.625 3 8 SUN2 Sad1 and UNC84 domain containing 2 269 35 C20140704_OR004_03 C20140704_OR004_03 TB413790.[MT7]-ILTHVAEMQGK[MT7].3y6_1.heavy 505.625 / 807.415 11149.0 29.232800006866455 44 18 10 6 10 5.027218337073648 19.89171611317168 0.03479957580566406 3 0.9892997382874895 11.920024620654328 11149.0 81.78026838901837 0.0 - - - - - - - 197.5 22 8 SUN2 Sad1 and UNC84 domain containing 2 271 35 C20140704_OR004_03 C20140704_OR004_03 TB413790.[MT7]-ILTHVAEMQGK[MT7].3b4_1.heavy 505.625 / 609.384 16767.0 29.232800006866455 44 18 10 6 10 5.027218337073648 19.89171611317168 0.03479957580566406 3 0.9892997382874895 11.920024620654328 16767.0 68.44052693037513 0.0 - - - - - - - 212.25 33 12 SUN2 Sad1 and UNC84 domain containing 2 273 35 C20140704_OR004_03 C20140704_OR004_03 TB413790.[MT7]-ILTHVAEMQGK[MT7].3y4_1.heavy 505.625 / 607.335 12641.0 29.232800006866455 44 18 10 6 10 5.027218337073648 19.89171611317168 0.03479957580566406 3 0.9892997382874895 11.920024620654328 12641.0 54.74165242165242 0.0 - - - - - - - 215.63636363636363 25 11 SUN2 Sad1 and UNC84 domain containing 2 275 35 C20140704_OR004_03 C20140704_OR004_03 TB413790.[MT7]-ILTHVAEMQGK[MT7].3y5_1.heavy 505.625 / 736.378 7198.0 29.232800006866455 44 18 10 6 10 5.027218337073648 19.89171611317168 0.03479957580566406 3 0.9892997382874895 11.920024620654328 7198.0 51.58473452473453 0.0 - - - - - - - 241.5625 14 16 SUN2 Sad1 and UNC84 domain containing 2 277 36 C20140704_OR004_03 C20140704_OR004_03 TB413526.[MT7]-TPEEGEK[MT7].2y4_1.heavy 539.287 / 606.321 547.0 15.98812484741211 45 20 10 5 10 9.970583205157391 10.029503584933119 0.04010009765625 3 0.9941820356636405 16.17208660076468 547.0 9.32708153580673 0.0 - - - - - - - 0.0 1 0 GAGE12F;GAGE12D;GAGE2C;GAGE12I;GAGE2B;GAGE12G;GAGE2D;GAGE12C;GAGE12E;GAGE12H;GAGE2A G antigen 12F;G antigen 12D;G antigen 2C;G antigen 12I;G antigen 2B;G antigen 12G;G antigen 2D;G antigen 12C;G antigen 12E;G antigen 12H;G antigen 2A 279 36 C20140704_OR004_03 C20140704_OR004_03 TB413526.[MT7]-TPEEGEK[MT7].2y5_1.heavy 539.287 / 735.364 273.0 15.98812484741211 45 20 10 5 10 9.970583205157391 10.029503584933119 0.04010009765625 3 0.9941820356636405 16.17208660076468 273.0 4.180327868852459 1.0 - - - - - - - 0.0 0 0 GAGE12F;GAGE12D;GAGE2C;GAGE12I;GAGE2B;GAGE12G;GAGE2D;GAGE12C;GAGE12E;GAGE12H;GAGE2A G antigen 12F;G antigen 12D;G antigen 2C;G antigen 12I;G antigen 2B;G antigen 12G;G antigen 2D;G antigen 12C;G antigen 12E;G antigen 12H;G antigen 2A 281 36 C20140704_OR004_03 C20140704_OR004_03 TB413526.[MT7]-TPEEGEK[MT7].2y3_1.heavy 539.287 / 477.279 941.0 15.98812484741211 45 20 10 5 10 9.970583205157391 10.029503584933119 0.04010009765625 3 0.9941820356636405 16.17208660076468 941.0 7.254967755249444 0.0 - - - - - - - 0.0 1 0 GAGE12F;GAGE12D;GAGE2C;GAGE12I;GAGE2B;GAGE12G;GAGE2D;GAGE12C;GAGE12E;GAGE12H;GAGE2A G antigen 12F;G antigen 12D;G antigen 2C;G antigen 12I;G antigen 2B;G antigen 12G;G antigen 2D;G antigen 12C;G antigen 12E;G antigen 12H;G antigen 2A 283 36 C20140704_OR004_03 C20140704_OR004_03 TB413526.[MT7]-TPEEGEK[MT7].2y6_1.heavy 539.287 / 832.417 1943.0 15.98812484741211 45 20 10 5 10 9.970583205157391 10.029503584933119 0.04010009765625 3 0.9941820356636405 16.17208660076468 1943.0 19.99767896636014 0.0 - - - - - - - 118.63636363636364 3 11 GAGE12F;GAGE12D;GAGE2C;GAGE12I;GAGE2B;GAGE12G;GAGE2D;GAGE12C;GAGE12E;GAGE12H;GAGE2A G antigen 12F;G antigen 12D;G antigen 2C;G antigen 12I;G antigen 2B;G antigen 12G;G antigen 2D;G antigen 12C;G antigen 12E;G antigen 12H;G antigen 2A 285 37 C20140704_OR004_03 C20140704_OR004_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 207570.0 18.84480094909668 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 207570.0 4754.123769430052 0.0 - - - - - - - 700.0 415 8 287 37 C20140704_OR004_03 C20140704_OR004_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 120129.0 18.84480094909668 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 120129.0 1410.149123875501 0.0 - - - - - - - 201.08333333333334 240 12 289 37 C20140704_OR004_03 C20140704_OR004_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 129351.0 18.84480094909668 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 129351.0 1328.2607189667726 0.0 - - - - - - - 161.94117647058823 258 17 291 38 C20140704_OR004_03 C20140704_OR004_03 TB413799.[MT7]-K[MT7]IPGNSNFVK[MT7].3y3_1.heavy 512.647 / 537.352 7724.0 24.572699546813965 38 15 10 3 10 2.2061079985465564 36.32673494250634 0.07220077514648438 3 0.9573197810372143 5.952400864686701 7724.0 22.111225235653095 0.0 - - - - - - - 229.7 15 10 GK2 glycerol kinase 2 293 38 C20140704_OR004_03 C20140704_OR004_03 TB413799.[MT7]-K[MT7]IPGNSNFVK[MT7].3b5_2.heavy 512.647 / 399.757 8977.0 24.572699546813965 38 15 10 3 10 2.2061079985465564 36.32673494250634 0.07220077514648438 3 0.9573197810372143 5.952400864686701 8977.0 17.084624631131472 0.0 - - - - - - - 656.1428571428571 17 7 GK2 glycerol kinase 2 295 38 C20140704_OR004_03 C20140704_OR004_03 TB413799.[MT7]-K[MT7]IPGNSNFVK[MT7].3y4_1.heavy 512.647 / 651.395 2088.0 24.572699546813965 38 15 10 3 10 2.2061079985465564 36.32673494250634 0.07220077514648438 3 0.9573197810372143 5.952400864686701 2088.0 9.590813397129185 1.0 - - - - - - - 208.9 4 10 GK2 glycerol kinase 2 297 38 C20140704_OR004_03 C20140704_OR004_03 TB413799.[MT7]-K[MT7]IPGNSNFVK[MT7].3b7_2.heavy 512.647 / 500.295 8142.0 24.572699546813965 38 15 10 3 10 2.2061079985465564 36.32673494250634 0.07220077514648438 3 0.9573197810372143 5.952400864686701 8142.0 46.36659214651048 0.0 - - - - - - - 231.91666666666666 16 12 GK2 glycerol kinase 2 299 39 C20140704_OR004_03 C20140704_OR004_03 TB428384.[MT7]-IQEELSALRAEHQQDSEDLFK[MT7].3y7_1.heavy 925.478 / 997.496 1824.0 37.12139892578125 48 18 10 10 10 4.864049832789396 20.55899989467271 0.0 3 0.981789736555226 9.131518275048448 1824.0 7.199999999999999 0.0 - - - - - - - 354.6666666666667 3 6 SUN2 Sad1 and UNC84 domain containing 2 301 39 C20140704_OR004_03 C20140704_OR004_03 TB428384.[MT7]-IQEELSALRAEHQQDSEDLFK[MT7].3y6_1.heavy 925.478 / 882.469 3345.0 37.12139892578125 48 18 10 10 10 4.864049832789396 20.55899989467271 0.0 3 0.981789736555226 9.131518275048448 3345.0 34.110197368421055 0.0 - - - - - - - 266.0 6 8 SUN2 Sad1 and UNC84 domain containing 2 303 39 C20140704_OR004_03 C20140704_OR004_03 TB428384.[MT7]-IQEELSALRAEHQQDSEDLFK[MT7].3y3_1.heavy 925.478 / 551.367 5777.0 37.12139892578125 48 18 10 10 10 4.864049832789396 20.55899989467271 0.0 3 0.981789736555226 9.131518275048448 5777.0 44.17631359649123 0.0 - - - - - - - 212.8 11 5 SUN2 Sad1 and UNC84 domain containing 2 305 39 C20140704_OR004_03 C20140704_OR004_03 TB428384.[MT7]-IQEELSALRAEHQQDSEDLFK[MT7].3b18_2.heavy 925.478 / 1112.53 3192.0 37.12139892578125 48 18 10 10 10 4.864049832789396 20.55899989467271 0.0 3 0.981789736555226 9.131518275048448 3192.0 14.3325 0.0 - - - - - - - 304.0 6 1 SUN2 Sad1 and UNC84 domain containing 2 307 40 C20140704_OR004_03 C20140704_OR004_03 TB428383.[MT7]-IQEELSALRAEHQQDSEDLFK[MT7].4b12_2.heavy 694.36 / 761.411 10654.0 37.12139892578125 41 11 10 10 10 1.404167644412306 43.428530586998 0.0 3 0.8657307062998923 3.3295872561598574 10654.0 79.60749999999999 0.0 - - - - - - - 212.8 21 5 SUN2 Sad1 and UNC84 domain containing 2 309 40 C20140704_OR004_03 C20140704_OR004_03 TB428383.[MT7]-IQEELSALRAEHQQDSEDLFK[MT7].4b4_1.heavy 694.36 / 644.337 10046.0 37.12139892578125 41 11 10 10 10 1.404167644412306 43.428530586998 0.0 3 0.8657307062998923 3.3295872561598574 10046.0 17.380388443941413 0.0 - - - - - - - 276.45454545454544 20 11 SUN2 Sad1 and UNC84 domain containing 2 311 40 C20140704_OR004_03 C20140704_OR004_03 TB428383.[MT7]-IQEELSALRAEHQQDSEDLFK[MT7].4y3_1.heavy 694.36 / 551.367 13546.0 37.12139892578125 41 11 10 10 10 1.404167644412306 43.428530586998 0.0 3 0.8657307062998923 3.3295872561598574 13546.0 40.49228812908183 0.0 - - - - - - - 329.6666666666667 27 6 SUN2 Sad1 and UNC84 domain containing 2 313 40 C20140704_OR004_03 C20140704_OR004_03 TB428383.[MT7]-IQEELSALRAEHQQDSEDLFK[MT7].4b3_1.heavy 694.36 / 515.295 2892.0 37.12139892578125 41 11 10 10 10 1.404167644412306 43.428530586998 0.0 3 0.8657307062998923 3.3295872561598574 2892.0 7.314101875287249 0.0 - - - - - - - 253.5 5 6 SUN2 Sad1 and UNC84 domain containing 2 315 41 C20140704_OR004_03 C20140704_OR004_03 TB428381.[MT7]-VQVLTAGSLMGLGDIISQQLVERR.3y10_2.heavy 909.848 / 621.37 8617.0 52.200199127197266 41 11 10 10 10 0.9417152015051888 61.02275435741126 0.0 3 0.8671423977314632 3.3476441533003625 8617.0 53.55452089817697 0.0 - - - - - - - 222.42857142857142 17 7 MPV17 MpV17 mitochondrial inner membrane protein 317 41 C20140704_OR004_03 C20140704_OR004_03 TB428381.[MT7]-VQVLTAGSLMGLGDIISQQLVERR.3y20_2.heavy 909.848 / 1072.58 25540.0 52.200199127197266 41 11 10 10 10 0.9417152015051888 61.02275435741126 0.0 3 0.8671423977314632 3.3476441533003625 25540.0 54.23720782333655 0.0 - - - - - - - 166.2 51 5 MPV17 MpV17 mitochondrial inner membrane protein 319 41 C20140704_OR004_03 C20140704_OR004_03 TB428381.[MT7]-VQVLTAGSLMGLGDIISQQLVERR.3b4_1.heavy 909.848 / 584.389 7579.0 52.200199127197266 41 11 10 10 10 0.9417152015051888 61.02275435741126 0.0 3 0.8671423977314632 3.3476441533003625 7579.0 7.123289343119755 1.0 - - - - - - - 252.0 17 7 MPV17 MpV17 mitochondrial inner membrane protein 321 41 C20140704_OR004_03 C20140704_OR004_03 TB428381.[MT7]-VQVLTAGSLMGLGDIISQQLVERR.3y10_1.heavy 909.848 / 1241.73 19622.0 52.200199127197266 41 11 10 10 10 0.9417152015051888 61.02275435741126 0.0 3 0.8671423977314632 3.3476441533003625 19622.0 56.69642137959731 0.0 - - - - - - - 259.5 39 8 MPV17 MpV17 mitochondrial inner membrane protein 323 42 C20140704_OR004_03 C20140704_OR004_03 TB428179.[MT7]-VALVYGQMNEPPGAR.3y7_1.heavy 582.642 / 740.369 16455.0 33.213223457336426 34 9 10 5 10 6.494459148045644 15.397741015907792 0.049098968505859375 3 0.8087974054327375 2.776127565827239 16455.0 17.00220679968088 0.0 - - - - - - - 328.3333333333333 32 3 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 325 42 C20140704_OR004_03 C20140704_OR004_03 TB428179.[MT7]-VALVYGQMNEPPGAR.3b4_1.heavy 582.642 / 527.367 61038.0 33.213223457336426 34 9 10 5 10 6.494459148045644 15.397741015907792 0.049098968505859375 3 0.8087974054327375 2.776127565827239 61038.0 75.10322769683023 0.0 - - - - - - - 1125.0 122 1 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 327 42 C20140704_OR004_03 C20140704_OR004_03 TB428179.[MT7]-VALVYGQMNEPPGAR.3b5_1.heavy 582.642 / 690.431 8860.0 33.213223457336426 34 9 10 5 10 6.494459148045644 15.397741015907792 0.049098968505859375 3 0.8087974054327375 2.776127565827239 8860.0 23.502837655425857 1.0 - - - - - - - 281.14285714285717 17 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 329 42 C20140704_OR004_03 C20140704_OR004_03 TB428179.[MT7]-VALVYGQMNEPPGAR.3y13_2.heavy 582.642 / 716.356 1406.0 33.213223457336426 34 9 10 5 10 6.494459148045644 15.397741015907792 0.049098968505859375 3 0.8087974054327375 2.776127565827239 1406.0 0.29411456924745205 11.0 - - - - - - - 234.33333333333334 21 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 331 43 C20140704_OR004_03 C20140704_OR004_03 TB428175.[MT7]-LTPSASLPPAQLLLR.2y9_1.heavy 861.026 / 1020.66 1969.0 42.42090034484863 42 16 10 6 10 5.095313917885398 19.62587617005959 0.033802032470703125 3 0.9613314741003183 6.255673486324588 1969.0 8.404268292682927 0.0 - - - - - - - 656.0 3 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 333 43 C20140704_OR004_03 C20140704_OR004_03 TB428175.[MT7]-LTPSASLPPAQLLLR.2y10_1.heavy 861.026 / 1107.69 2461.0 42.42090034484863 42 16 10 6 10 5.095313917885398 19.62587617005959 0.033802032470703125 3 0.9613314741003183 6.255673486324588 2461.0 14.13732349165597 0.0 - - - - - - - 250.31578947368422 4 19 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 335 43 C20140704_OR004_03 C20140704_OR004_03 TB428175.[MT7]-LTPSASLPPAQLLLR.2b5_1.heavy 861.026 / 614.363 1804.0 42.42090034484863 42 16 10 6 10 5.095313917885398 19.62587617005959 0.033802032470703125 3 0.9613314741003183 6.255673486324588 1804.0 -0.5 2.0 - - - - - - - 749.7142857142857 3 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 337 43 C20140704_OR004_03 C20140704_OR004_03 TB428175.[MT7]-LTPSASLPPAQLLLR.2y11_1.heavy 861.026 / 1178.73 574.0 42.42090034484863 42 16 10 6 10 5.095313917885398 19.62587617005959 0.033802032470703125 3 0.9613314741003183 6.255673486324588 574.0 0.7111111111111111 19.0 - - - - - - - 261.375 2 16 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 339 44 C20140704_OR004_03 C20140704_OR004_03 TB451317.[MT7]-FSAYIK[MT7].2y4_1.heavy 508.805 / 638.399 6481.0 31.13670063018799 44 20 10 6 8 25.991739276920097 3.847376234986978 0.039600372314453125 4 0.9995425257132227 57.6982269290363 6481.0 16.271215477842322 1.0 - - - - - - - 226.6153846153846 13 13 CLIC1;CLIC2;CLIC4;CLIC5 chloride intracellular channel 1;chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5 341 44 C20140704_OR004_03 C20140704_OR004_03 TB451317.[MT7]-FSAYIK[MT7].2y5_1.heavy 508.805 / 725.431 20707.0 31.13670063018799 44 20 10 6 8 25.991739276920097 3.847376234986978 0.039600372314453125 4 0.9995425257132227 57.6982269290363 20707.0 113.0017070216781 0.0 - - - - - - - 271.44444444444446 41 9 CLIC1;CLIC2;CLIC4;CLIC5 chloride intracellular channel 1;chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5 343 44 C20140704_OR004_03 C20140704_OR004_03 TB451317.[MT7]-FSAYIK[MT7].2b4_1.heavy 508.805 / 613.31 6229.0 31.13670063018799 44 20 10 6 8 25.991739276920097 3.847376234986978 0.039600372314453125 4 0.9995425257132227 57.6982269290363 6229.0 35.41427943208946 0.0 - - - - - - - 198.9090909090909 12 11 CLIC1;CLIC2;CLIC4;CLIC5 chloride intracellular channel 1;chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5 345 44 C20140704_OR004_03 C20140704_OR004_03 TB451317.[MT7]-FSAYIK[MT7].2y3_1.heavy 508.805 / 567.362 11279.0 31.13670063018799 44 20 10 6 8 25.991739276920097 3.847376234986978 0.039600372314453125 4 0.9995425257132227 57.6982269290363 11279.0 48.69517736141829 0.0 - - - - - - - 246.64285714285714 22 14 CLIC1;CLIC2;CLIC4;CLIC5 chloride intracellular channel 1;chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5 347 45 C20140704_OR004_03 C20140704_OR004_03 TB427917.[MT7]-ETTVIWDK[MT7].3y3_1.heavy 427.243 / 592.321 7652.0 31.541000366210938 39 14 10 5 10 1.5872616999799312 43.166403137098875 0.04199981689453125 3 0.9494984215587894 5.468459737867468 7652.0 98.91529310344828 0.0 - - - - - - - 232.0 15 2 GK2 glycerol kinase 2 349 45 C20140704_OR004_03 C20140704_OR004_03 TB427917.[MT7]-ETTVIWDK[MT7].3b4_1.heavy 427.243 / 575.316 13218.0 31.541000366210938 39 14 10 5 10 1.5872616999799312 43.166403137098875 0.04199981689453125 3 0.9494984215587894 5.468459737867468 13218.0 64.19086206896552 0.0 - - - - - - - 348.0 26 2 GK2 glycerol kinase 2 351 45 C20140704_OR004_03 C20140704_OR004_03 TB427917.[MT7]-ETTVIWDK[MT7].3b5_1.heavy 427.243 / 688.4 928.0 31.541000366210938 39 14 10 5 10 1.5872616999799312 43.166403137098875 0.04199981689453125 3 0.9494984215587894 5.468459737867468 928.0 -0.22321250158738104 3.0 - - - - - - - 215.42857142857142 3 7 GK2 glycerol kinase 2 353 45 C20140704_OR004_03 C20140704_OR004_03 TB427917.[MT7]-ETTVIWDK[MT7].3b3_1.heavy 427.243 / 476.247 12058.0 31.541000366210938 39 14 10 5 10 1.5872616999799312 43.166403137098875 0.04199981689453125 3 0.9494984215587894 5.468459737867468 12058.0 96.67189655172413 0.0 - - - - - - - 314.85714285714283 24 7 GK2 glycerol kinase 2 355 46 C20140704_OR004_03 C20140704_OR004_03 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 274481.0 38.03889846801758 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 274481.0 716.8970189595832 0.0 - - - - - - - 216.22222222222223 548 9 357 46 C20140704_OR004_03 C20140704_OR004_03 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 152294.0 38.03889846801758 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 152294.0 661.3270416234476 0.0 - - - - - - - 324.375 304 8 359 46 C20140704_OR004_03 C20140704_OR004_03 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 242800.0 38.03889846801758 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 242800.0 1083.4989431635286 0.0 - - - - - - - 216.16666666666666 485 6 361 47 C20140704_OR004_03 C20140704_OR004_03 TB427895.[MT7]-NLREDGEK[MT7].2b3_1.heavy 624.843 / 528.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 363 47 C20140704_OR004_03 C20140704_OR004_03 TB427895.[MT7]-NLREDGEK[MT7].2y5_1.heavy 624.843 / 721.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 365 47 C20140704_OR004_03 C20140704_OR004_03 TB427895.[MT7]-NLREDGEK[MT7].2b7_1.heavy 624.843 / 958.471 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 367 47 C20140704_OR004_03 C20140704_OR004_03 TB427895.[MT7]-NLREDGEK[MT7].2b5_1.heavy 624.843 / 772.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 369 48 C20140704_OR004_03 C20140704_OR004_03 TB414181.[MT7]-QGAPGQGGGGGLSHEDTLALLEGLVSRR.4b11_1.heavy 719.883 / 968.467 2360.0 43.43739891052246 44 18 10 6 10 3.8042068492694012 26.28668838530823 0.032199859619140625 3 0.9826720137657725 9.361796577048173 2360.0 17.68219853163029 0.0 - - - - - - - 192.57894736842104 4 19 SUN2 Sad1 and UNC84 domain containing 2 371 48 C20140704_OR004_03 C20140704_OR004_03 TB414181.[MT7]-QGAPGQGGGGGLSHEDTLALLEGLVSRR.4y16_2.heavy 719.883 / 898.487 4801.0 43.43739891052246 44 18 10 6 10 3.8042068492694012 26.28668838530823 0.032199859619140625 3 0.9826720137657725 9.361796577048173 4801.0 11.805737704918032 0.0 - - - - - - - 186.0 9 14 SUN2 Sad1 and UNC84 domain containing 2 373 48 C20140704_OR004_03 C20140704_OR004_03 TB414181.[MT7]-QGAPGQGGGGGLSHEDTLALLEGLVSRR.4b5_1.heavy 719.883 / 555.301 2523.0 43.43739891052246 44 18 10 6 10 3.8042068492694012 26.28668838530823 0.032199859619140625 3 0.9826720137657725 9.361796577048173 2523.0 33.974432748538014 0.0 - - - - - - - 189.77777777777777 5 18 SUN2 Sad1 and UNC84 domain containing 2 375 48 C20140704_OR004_03 C20140704_OR004_03 TB414181.[MT7]-QGAPGQGGGGGLSHEDTLALLEGLVSRR.4y14_2.heavy 719.883 / 786.441 3336.0 43.43739891052246 44 18 10 6 10 3.8042068492694012 26.28668838530823 0.032199859619140625 3 0.9826720137657725 9.361796577048173 3336.0 15.163636363636364 0.0 - - - - - - - 226.57142857142858 6 14 SUN2 Sad1 and UNC84 domain containing 2 377 49 C20140704_OR004_03 C20140704_OR004_03 TB413452.[MT7]-EGIESQASYK[MT7].3b6_1.heavy 467.248 / 788.391 500.0 22.75617504119873 43 17 10 6 10 3.0860695232152255 27.629134847131034 0.034900665283203125 3 0.9775568162903595 8.222512242365825 500.0 5.964 6.0 - - - - - - - 0.0 1 0 ADAM2 ADAM metallopeptidase domain 2 379 49 C20140704_OR004_03 C20140704_OR004_03 TB413452.[MT7]-EGIESQASYK[MT7].3y3_1.heavy 467.248 / 541.31 2690.0 22.75617504119873 43 17 10 6 10 3.0860695232152255 27.629134847131034 0.034900665283203125 3 0.9775568162903595 8.222512242365825 2690.0 12.867491684434967 0.0 - - - - - - - 219.0 5 14 ADAM2 ADAM metallopeptidase domain 2 381 49 C20140704_OR004_03 C20140704_OR004_03 TB413452.[MT7]-EGIESQASYK[MT7].3b4_1.heavy 467.248 / 573.3 2878.0 22.75617504119873 43 17 10 6 10 3.0860695232152255 27.629134847131034 0.034900665283203125 3 0.9775568162903595 8.222512242365825 2878.0 24.98104 0.0 - - - - - - - 183.07692307692307 5 13 ADAM2 ADAM metallopeptidase domain 2 383 49 C20140704_OR004_03 C20140704_OR004_03 TB413452.[MT7]-EGIESQASYK[MT7].3y4_1.heavy 467.248 / 612.347 1877.0 22.75617504119873 43 17 10 6 10 3.0860695232152255 27.629134847131034 0.034900665283203125 3 0.9775568162903595 8.222512242365825 1877.0 31.009231746031745 0.0 - - - - - - - 158.92307692307693 3 13 ADAM2 ADAM metallopeptidase domain 2 385 50 C20140704_OR004_03 C20140704_OR004_03 TB428350.[MT7]-MTPSNIAIVLGPNLLWPPEK[MT7].3y3_1.heavy 826.806 / 517.31 6308.0 50.357398986816406 43 13 10 10 10 1.7921438169970745 45.00142747914928 0.0 3 0.9081127142466773 4.039723698036554 6308.0 28.15018691588785 0.0 - - - - - - - 301.54545454545456 12 11 SH3BP1 SH3-domain binding protein 1 387 50 C20140704_OR004_03 C20140704_OR004_03 TB428350.[MT7]-MTPSNIAIVLGPNLLWPPEK[MT7].3b5_1.heavy 826.806 / 675.325 2566.0 50.357398986816406 43 13 10 10 10 1.7921438169970745 45.00142747914928 0.0 3 0.9081127142466773 4.039723698036554 2566.0 35.348448598130844 0.0 - - - - - - - 214.0 5 4 SH3BP1 SH3-domain binding protein 1 389 50 C20140704_OR004_03 C20140704_OR004_03 TB428350.[MT7]-MTPSNIAIVLGPNLLWPPEK[MT7].3y4_1.heavy 826.806 / 614.363 10478.0 50.357398986816406 43 13 10 10 10 1.7921438169970745 45.00142747914928 0.0 3 0.9081127142466773 4.039723698036554 10478.0 33.47013950499637 0.0 - - - - - - - 278.2 20 5 SH3BP1 SH3-domain binding protein 1 391 50 C20140704_OR004_03 C20140704_OR004_03 TB428350.[MT7]-MTPSNIAIVLGPNLLWPPEK[MT7].3b7_1.heavy 826.806 / 859.446 2887.0 50.357398986816406 43 13 10 10 10 1.7921438169970745 45.00142747914928 0.0 3 0.9081127142466773 4.039723698036554 2887.0 9.71561296073212 0.0 - - - - - - - 171.2 5 5 SH3BP1 SH3-domain binding protein 1 393 51 C20140704_OR004_03 C20140704_OR004_03 TB428072.[MT7]-TISTTISPLLLIP.2b6_1.heavy 756.972 / 761.453 1789.0 54.61519908905029 42 15 10 7 10 4.093764958406603 24.42739165927165 0.024799346923828125 3 0.9517244063623062 5.594170954736901 1789.0 9.911233590182647 0.0 - - - - - - - 156.33333333333334 3 18 ALOX5AP arachidonate 5-lipoxygenase-activating protein 395 51 C20140704_OR004_03 C20140704_OR004_03 TB428072.[MT7]-TISTTISPLLLIP.2b7_1.heavy 756.972 / 848.485 4199.0 54.61519908905029 42 15 10 7 10 4.093764958406603 24.42739165927165 0.024799346923828125 3 0.9517244063623062 5.594170954736901 4199.0 12.462785388127855 0.0 - - - - - - - 166.5 8 18 ALOX5AP arachidonate 5-lipoxygenase-activating protein 397 51 C20140704_OR004_03 C20140704_OR004_03 TB428072.[MT7]-TISTTISPLLLIP.2b5_1.heavy 756.972 / 648.369 1570.0 54.61519908905029 42 15 10 7 10 4.093764958406603 24.42739165927165 0.024799346923828125 3 0.9517244063623062 5.594170954736901 1570.0 0.781094527363184 0.0 - - - - - - - 173.65 3 20 ALOX5AP arachidonate 5-lipoxygenase-activating protein 399 51 C20140704_OR004_03 C20140704_OR004_03 TB428072.[MT7]-TISTTISPLLLIP.2b9_1.heavy 756.972 / 1058.62 3359.0 54.61519908905029 42 15 10 7 10 4.093764958406603 24.42739165927165 0.024799346923828125 3 0.9517244063623062 5.594170954736901 3359.0 49.53693730626937 0.0 - - - - - - - 148.26315789473685 6 19 ALOX5AP arachidonate 5-lipoxygenase-activating protein 401 52 C20140704_OR004_03 C20140704_OR004_03 TB413597.[MT7]-ILNFGQVK[MT7].2y4_1.heavy 603.876 / 575.363 17170.0 35.97560119628906 39 17 2 10 10 8.310049582306258 12.033622544553744 0.0 3 0.9765512214654986 8.043590373912929 17170.0 45.565702740807026 0.0 - - - - - - - 273.6 34 5 PISD phosphatidylserine decarboxylase 403 52 C20140704_OR004_03 C20140704_OR004_03 TB413597.[MT7]-ILNFGQVK[MT7].2y5_1.heavy 603.876 / 722.432 5774.0 35.97560119628906 39 17 2 10 10 8.310049582306258 12.033622544553744 0.0 3 0.9765512214654986 8.043590373912929 5774.0 14.7955882236078 1.0 - - - - - - - 418.0 104 4 PISD phosphatidylserine decarboxylase 405 52 C20140704_OR004_03 C20140704_OR004_03 TB413597.[MT7]-ILNFGQVK[MT7].2y6_1.heavy 603.876 / 836.475 13220.0 35.97560119628906 39 17 2 10 10 8.310049582306258 12.033622544553744 0.0 3 0.9765512214654986 8.043590373912929 13220.0 104.8032894736842 0.0 - - - - - - - 253.33333333333334 26 3 PISD phosphatidylserine decarboxylase 407 52 C20140704_OR004_03 C20140704_OR004_03 TB413597.[MT7]-ILNFGQVK[MT7].2y7_1.heavy 603.876 / 949.559 22185.0 35.97560119628906 39 17 2 10 10 8.310049582306258 12.033622544553744 0.0 3 0.9765512214654986 8.043590373912929 22185.0 67.62532894736842 0.0 - - - - - - - 282.2857142857143 44 7 PISD phosphatidylserine decarboxylase 409 53 C20140704_OR004_03 C20140704_OR004_03 TB414018.[MT7]-LTGEPLYNAVVWLDLR.2y9_1.heavy 1002.06 / 1085.61 6972.0 52.24509811401367 46 16 10 10 10 1.328363365462864 43.9001084798776 0.0 3 0.964746735932789 6.5535786753552685 6972.0 92.49980198019801 0.0 - - - - - - - 202.0 13 6 GK2 glycerol kinase 2 411 53 C20140704_OR004_03 C20140704_OR004_03 TB414018.[MT7]-LTGEPLYNAVVWLDLR.2b4_1.heavy 1002.06 / 545.305 26778.0 52.24509811401367 46 16 10 10 10 1.328363365462864 43.9001084798776 0.0 3 0.964746735932789 6.5535786753552685 26778.0 91.20427722772277 0.0 - - - - - - - 202.0 53 4 GK2 glycerol kinase 2 413 53 C20140704_OR004_03 C20140704_OR004_03 TB414018.[MT7]-LTGEPLYNAVVWLDLR.2y10_1.heavy 1002.06 / 1248.67 1718.0 52.24509811401367 46 16 10 10 10 1.328363365462864 43.9001084798776 0.0 3 0.964746735932789 6.5535786753552685 1718.0 8.660874587458746 1.0 - - - - - - - 235.66666666666666 3 6 GK2 glycerol kinase 2 415 53 C20140704_OR004_03 C20140704_OR004_03 TB414018.[MT7]-LTGEPLYNAVVWLDLR.2b5_1.heavy 1002.06 / 642.358 1617.0 52.24509811401367 46 16 10 10 10 1.328363365462864 43.9001084798776 0.0 3 0.964746735932789 6.5535786753552685 1617.0 17.61089108910891 0.0 - - - - - - - 202.0 3 5 GK2 glycerol kinase 2 417 54 C20140704_OR004_03 C20140704_OR004_03 TB414173.[MT7]-LSENNIQTIFAVTEEFQPVYK[MT7].4y4_1.heavy 690.369 / 650.399 9539.0 50.093299865722656 43 13 10 10 10 1.7858059577878584 43.62945551748523 0.0 3 0.9124056314072142 4.139062229808447 9539.0 17.015022990328205 0.0 - - - - - - - 254.4 19 10 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 419 54 C20140704_OR004_03 C20140704_OR004_03 TB414173.[MT7]-LSENNIQTIFAVTEEFQPVYK[MT7].4b4_1.heavy 690.369 / 588.311 3180.0 50.093299865722656 43 13 10 10 10 1.7858059577878584 43.62945551748523 0.0 3 0.9124056314072142 4.139062229808447 3180.0 34.32 0.0 - - - - - - - 238.5 6 4 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 421 54 C20140704_OR004_03 C20140704_OR004_03 TB414173.[MT7]-LSENNIQTIFAVTEEFQPVYK[MT7].4b5_1.heavy 690.369 / 702.354 5193.0 50.093299865722656 43 13 10 10 10 1.7858059577878584 43.62945551748523 0.0 3 0.9124056314072142 4.139062229808447 5193.0 17.865226415094337 0.0 - - - - - - - 247.33333333333334 10 9 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 423 54 C20140704_OR004_03 C20140704_OR004_03 TB414173.[MT7]-LSENNIQTIFAVTEEFQPVYK[MT7].4b6_1.heavy 690.369 / 815.438 1802.0 50.093299865722656 43 13 10 10 10 1.7858059577878584 43.62945551748523 0.0 3 0.9124056314072142 4.139062229808447 1802.0 20.96666666666667 0.0 - - - - - - - 254.4 3 5 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 425 55 C20140704_OR004_03 C20140704_OR004_03 TB427883.[MT7]-EVDLQSLK[MT7].2y4_1.heavy 610.36 / 619.39 904.0 34.439100901285805 26 13 10 3 0 1.4812515457526787 56.57828739586551 0.050701141357421875 31 0.9210668250646272 4.363486477515177 904.0 -0.6 22.0 - - - - - - - 254.25 3 4 KIAA1267 KIAA1267 427 55 C20140704_OR004_03 C20140704_OR004_03 TB427883.[MT7]-EVDLQSLK[MT7].2y5_1.heavy 610.36 / 732.474 2826.0 34.439100901285805 26 13 10 3 0 1.4812515457526787 56.57828739586551 0.050701141357421875 31 0.9210668250646272 4.363486477515177 2826.0 -0.0833628318584072 0.0 - - - - - - - 282.5 5 4 KIAA1267 KIAA1267 429 55 C20140704_OR004_03 C20140704_OR004_03 TB427883.[MT7]-EVDLQSLK[MT7].2b4_1.heavy 610.36 / 601.331 N/A 34.439100901285805 26 13 10 3 0 1.4812515457526787 56.57828739586551 0.050701141357421875 31 0.9210668250646272 4.363486477515177 5199.0 -0.10617426820966669 3.0 - - - - - - - 282.5 10 2 KIAA1267 KIAA1267 431 55 C20140704_OR004_03 C20140704_OR004_03 TB427883.[MT7]-EVDLQSLK[MT7].2y7_1.heavy 610.36 / 946.569 452.0 34.439100901285805 26 13 10 3 0 1.4812515457526787 56.57828739586551 0.050701141357421875 31 0.9210668250646272 4.363486477515177 452.0 -0.2400000000000001 30.0 - - - - - - - 254.25 2 8 KIAA1267 KIAA1267 433 56 C20140704_OR004_03 C20140704_OR004_03 TB427887.[MT7]-SGILPILVK[MT7].2y5_1.heavy 614.418 / 713.504 9836.0 40.552650451660156 40 14 10 6 10 8.290706433199993 12.061698337255278 0.0343017578125 3 0.9453931142061036 5.2570521773712215 9836.0 49.891618906106274 0.0 - - - - - - - 609.5 19 8 KPNA3 karyopherin alpha 3 (importin alpha 4) 435 56 C20140704_OR004_03 C20140704_OR004_03 TB427887.[MT7]-SGILPILVK[MT7].2b4_1.heavy 614.418 / 515.331 8996.0 40.552650451660156 40 14 10 6 10 8.290706433199993 12.061698337255278 0.0343017578125 3 0.9453931142061036 5.2570521773712215 8996.0 16.315347828969763 1.0 - - - - - - - 726.1818181818181 17 11 KPNA3 karyopherin alpha 3 (importin alpha 4) 437 56 C20140704_OR004_03 C20140704_OR004_03 TB427887.[MT7]-SGILPILVK[MT7].2y3_1.heavy 614.418 / 503.367 1513.0 40.552650451660156 40 14 10 6 10 8.290706433199993 12.061698337255278 0.0343017578125 3 0.9453931142061036 5.2570521773712215 1513.0 0.5998017839444996 12.0 - - - - - - - 695.3636363636364 8 11 KPNA3 karyopherin alpha 3 (importin alpha 4) 439 56 C20140704_OR004_03 C20140704_OR004_03 TB427887.[MT7]-SGILPILVK[MT7].2y6_1.heavy 614.418 / 826.588 3111.0 40.552650451660156 40 14 10 6 10 8.290706433199993 12.061698337255278 0.0343017578125 3 0.9453931142061036 5.2570521773712215 3111.0 26.471276785714284 0.0 - - - - - - - 183.27272727272728 6 11 KPNA3 karyopherin alpha 3 (importin alpha 4) 441 57 C20140704_OR004_03 C20140704_OR004_03 TB414170.[MT7]-AVVYSNTIQSIIAIIRAMGRLK[MT7].4b4_1.heavy 677.158 / 577.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 443 57 C20140704_OR004_03 C20140704_OR004_03 TB414170.[MT7]-AVVYSNTIQSIIAIIRAMGRLK[MT7].4y13_2.heavy 677.158 / 793.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 445 57 C20140704_OR004_03 C20140704_OR004_03 TB414170.[MT7]-AVVYSNTIQSIIAIIRAMGRLK[MT7].4b6_1.heavy 677.158 / 778.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 447 57 C20140704_OR004_03 C20140704_OR004_03 TB414170.[MT7]-AVVYSNTIQSIIAIIRAMGRLK[MT7].4y14_2.heavy 677.158 / 857.536 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 449 58 C20140704_OR004_03 C20140704_OR004_03 TB427752.[MT7]-VDYLIAR.2y6_1.heavy 497.296 / 750.414 5205.0 32.382925033569336 34 18 10 2 4 8.061346215954657 12.404875974943796 0.08390045166015625 8 0.9892468815049865 11.890639602880162 5205.0 17.554691011235953 0.0 - - - - - - - 266.6666666666667 10 6 RICTOR RPTOR independent companion of MTOR, complex 2 451 58 C20140704_OR004_03 C20140704_OR004_03 TB427752.[MT7]-VDYLIAR.2b3_1.heavy 497.296 / 522.268 3604.0 32.382925033569336 34 18 10 2 4 8.061346215954657 12.404875974943796 0.08390045166015625 8 0.9892468815049865 11.890639602880162 3604.0 5.199250936329588 1.0 - - - - - - - 266.8 7 5 RICTOR RPTOR independent companion of MTOR, complex 2 453 58 C20140704_OR004_03 C20140704_OR004_03 TB427752.[MT7]-VDYLIAR.2y4_1.heavy 497.296 / 472.324 1201.0 32.382925033569336 34 18 10 2 4 8.061346215954657 12.404875974943796 0.08390045166015625 8 0.9892468815049865 11.890639602880162 1201.0 8.16406015037594 8.0 - - - - - - - 166.5 4 4 RICTOR RPTOR independent companion of MTOR, complex 2 455 58 C20140704_OR004_03 C20140704_OR004_03 TB427752.[MT7]-VDYLIAR.2b5_1.heavy 497.296 / 748.436 934.0 32.382925033569336 34 18 10 2 4 8.061346215954657 12.404875974943796 0.08390045166015625 8 0.9892468815049865 11.890639602880162 934.0 0.7399250936329588 3.0 - - - - - - - 293.4 2 5 RICTOR RPTOR independent companion of MTOR, complex 2 457 59 C20140704_OR004_03 C20140704_OR004_03 TB414171.[MT7]-GRNDSGEENVPLDLTREPSDNLR.4y13_2.heavy 682.591 / 763.402 11569.0 30.501099586486816 36 11 10 5 10 1.4174352316250987 59.96616814953711 0.04220008850097656 3 0.8701801625312781 3.387485943138416 11569.0 18.593065968229613 1.0 - - - - - - - 296.875 23 8 RICTOR RPTOR independent companion of MTOR, complex 2 459 59 C20140704_OR004_03 C20140704_OR004_03 TB414171.[MT7]-GRNDSGEENVPLDLTREPSDNLR.4b9_1.heavy 682.591 / 1103.48 4351.0 30.501099586486816 36 11 10 5 10 1.4174352316250987 59.96616814953711 0.04220008850097656 3 0.8701801625312781 3.387485943138416 4351.0 10.883426799111446 1.0 - - - - - - - 240.42857142857142 8 14 RICTOR RPTOR independent companion of MTOR, complex 2 461 59 C20140704_OR004_03 C20140704_OR004_03 TB414171.[MT7]-GRNDSGEENVPLDLTREPSDNLR.4y6_1.heavy 682.591 / 701.358 2670.0 30.501099586486816 36 11 10 5 10 1.4174352316250987 59.96616814953711 0.04220008850097656 3 0.8701801625312781 3.387485943138416 2670.0 3.801492385614825 1.0 - - - - - - - 318.6666666666667 5 9 RICTOR RPTOR independent companion of MTOR, complex 2 463 59 C20140704_OR004_03 C20140704_OR004_03 TB414171.[MT7]-GRNDSGEENVPLDLTREPSDNLR.4b9_2.heavy 682.591 / 552.245 16909.0 30.501099586486816 36 11 10 5 10 1.4174352316250987 59.96616814953711 0.04220008850097656 3 0.8701801625312781 3.387485943138416 16909.0 50.03396406313969 0.0 - - - - - - - 356.1 33 10 RICTOR RPTOR independent companion of MTOR, complex 2 465 60 C20140704_OR004_03 C20140704_OR004_03 TB427889.[MT7]-ILVLGFRK[MT7].3y6_1.heavy 411.948 / 863.558 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 467 60 C20140704_OR004_03 C20140704_OR004_03 TB427889.[MT7]-ILVLGFRK[MT7].3y7_2.heavy 411.948 / 488.825 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 469 60 C20140704_OR004_03 C20140704_OR004_03 TB427889.[MT7]-ILVLGFRK[MT7].3y4_1.heavy 411.948 / 651.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 471 60 C20140704_OR004_03 C20140704_OR004_03 TB427889.[MT7]-ILVLGFRK[MT7].3y5_1.heavy 411.948 / 764.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 473 61 C20140704_OR004_03 C20140704_OR004_03 TB414011.[MT7]-NVQFVFDAVTDVIIK[MT7].4y4_1.heavy 499.789 / 616.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 475 61 C20140704_OR004_03 C20140704_OR004_03 TB414011.[MT7]-NVQFVFDAVTDVIIK[MT7].4b7_1.heavy 499.789 / 994.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 477 61 C20140704_OR004_03 C20140704_OR004_03 TB414011.[MT7]-NVQFVFDAVTDVIIK[MT7].4b5_1.heavy 499.789 / 732.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 479 61 C20140704_OR004_03 C20140704_OR004_03 TB414011.[MT7]-NVQFVFDAVTDVIIK[MT7].4y3_1.heavy 499.789 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 481 62 C20140704_OR004_03 C20140704_OR004_03 TB428059.[MT7]-ILAEFEMTLER.3y6_1.heavy 499.27 / 778.376 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 483 62 C20140704_OR004_03 C20140704_OR004_03 TB428059.[MT7]-ILAEFEMTLER.3b4_1.heavy 499.27 / 571.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 485 62 C20140704_OR004_03 C20140704_OR004_03 TB428059.[MT7]-ILAEFEMTLER.3y4_1.heavy 499.27 / 518.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 487 62 C20140704_OR004_03 C20140704_OR004_03 TB428059.[MT7]-ILAEFEMTLER.3y5_1.heavy 499.27 / 649.334 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 489 63 C20140704_OR004_03 C20140704_OR004_03 TB413580.[MT7]-ALAAHPWK[MT7].2y5_1.heavy 591.355 / 782.443 1153.0 25.884900093078613 44 18 10 6 10 3.755874140315299 26.6249603325646 0.03339958190917969 3 0.9869455189068244 10.789690089943162 1153.0 17.919541666666667 0.0 - - - - - - - 180.0 2 16 MPV17 MpV17 mitochondrial inner membrane protein 491 63 C20140704_OR004_03 C20140704_OR004_03 TB413580.[MT7]-ALAAHPWK[MT7].2y3_1.heavy 591.355 / 574.347 7349.0 25.884900093078613 44 18 10 6 10 3.755874140315299 26.6249603325646 0.03339958190917969 3 0.9869455189068244 10.789690089943162 7349.0 11.233695170604117 0.0 - - - - - - - 678.25 14 12 MPV17 MpV17 mitochondrial inner membrane protein 493 63 C20140704_OR004_03 C20140704_OR004_03 TB413580.[MT7]-ALAAHPWK[MT7].2b5_1.heavy 591.355 / 608.364 2017.0 25.884900093078613 44 18 10 6 10 3.755874140315299 26.6249603325646 0.03339958190917969 3 0.9869455189068244 10.789690089943162 2017.0 11.072156084656086 0.0 - - - - - - - 171.0 4 16 MPV17 MpV17 mitochondrial inner membrane protein 495 63 C20140704_OR004_03 C20140704_OR004_03 TB413580.[MT7]-ALAAHPWK[MT7].2y7_1.heavy 591.355 / 966.564 720.0 25.884900093078613 44 18 10 6 10 3.755874140315299 26.6249603325646 0.03339958190917969 3 0.9869455189068244 10.789690089943162 720.0 4.933333333333334 5.0 - - - - - - - 216.0 4 15 MPV17 MpV17 mitochondrial inner membrane protein 497 64 C20140704_OR004_03 C20140704_OR004_03 TB413581.[MT7]-IPVGPETLGR.2y8_1.heavy 591.852 / 828.457 11122.0 32.174198150634766 50 20 10 10 10 7.9962706672859944 12.505829800023628 0.0 3 0.9911614233130064 13.117491885333635 11122.0 12.942363396915272 0.0 - - - - - - - 235.8 22 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 499 64 C20140704_OR004_03 C20140704_OR004_03 TB413581.[MT7]-IPVGPETLGR.2y9_1.heavy 591.852 / 925.51 351456.0 32.174198150634766 50 20 10 10 10 7.9962706672859944 12.505829800023628 0.0 3 0.9911614233130064 13.117491885333635 351456.0 718.9809870246869 0.0 - - - - - - - 262.0 702 2 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 501 64 C20140704_OR004_03 C20140704_OR004_03 TB413581.[MT7]-IPVGPETLGR.2y6_1.heavy 591.852 / 672.367 7197.0 32.174198150634766 50 20 10 10 10 7.9962706672859944 12.505829800023628 0.0 3 0.9911614233130064 13.117491885333635 7197.0 6.388290576676201 2.0 - - - - - - - 205.85714285714286 14 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 503 64 C20140704_OR004_03 C20140704_OR004_03 TB413581.[MT7]-IPVGPETLGR.2y7_1.heavy 591.852 / 729.389 28525.0 32.174198150634766 50 20 10 10 10 7.9962706672859944 12.505829800023628 0.0 3 0.9911614233130064 13.117491885333635 28525.0 84.1961875809343 0.0 - - - - - - - 288.2 57 5 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 505 65 C20140704_OR004_03 C20140704_OR004_03 TB428361.[MT7]-DFAIFGFDEDLQQEGTLLGK[MT7].4b4_1.heavy 633.578 / 591.326 5614.0 49.31127643585205 43 18 10 5 10 9.338761267390144 10.708058289185338 0.046298980712890625 3 0.9887660618186942 11.63292545717912 5614.0 31.218878205128206 0.0 - - - - - - - 242.66666666666666 11 9 SUN2 Sad1 and UNC84 domain containing 2 507 65 C20140704_OR004_03 C20140704_OR004_03 TB428361.[MT7]-DFAIFGFDEDLQQEGTLLGK[MT7].4b5_1.heavy 633.578 / 738.394 1248.0 49.31127643585205 43 18 10 5 10 9.338761267390144 10.708058289185338 0.046298980712890625 3 0.9887660618186942 11.63292545717912 1248.0 21.6 1.0 - - - - - - - 237.71428571428572 2 7 SUN2 Sad1 and UNC84 domain containing 2 509 65 C20140704_OR004_03 C20140704_OR004_03 TB428361.[MT7]-DFAIFGFDEDLQQEGTLLGK[MT7].4y6_1.heavy 633.578 / 732.474 1352.0 49.31127643585205 43 18 10 5 10 9.338761267390144 10.708058289185338 0.046298980712890625 3 0.9887660618186942 11.63292545717912 1352.0 13.606666666666667 0.0 - - - - - - - 237.71428571428572 2 7 SUN2 Sad1 and UNC84 domain containing 2 511 65 C20140704_OR004_03 C20140704_OR004_03 TB428361.[MT7]-DFAIFGFDEDLQQEGTLLGK[MT7].4b3_1.heavy 633.578 / 478.242 10501.0 49.31127643585205 43 18 10 5 10 9.338761267390144 10.708058289185338 0.046298980712890625 3 0.9887660618186942 11.63292545717912 10501.0 22.357898351648352 0.0 - - - - - - - 252.57142857142858 21 7 SUN2 Sad1 and UNC84 domain containing 2 513 66 C20140704_OR004_03 C20140704_OR004_03 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1190870.0 35.00740051269531 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1190870.0 557.6014652664453 0.0 - - - - - - - 1811.0 2381 1 515 66 C20140704_OR004_03 C20140704_OR004_03 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 182283.0 35.00740051269531 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 182283.0 397.5773856772294 0.0 - - - - - - - 302.0 364 6 517 66 C20140704_OR004_03 C20140704_OR004_03 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 321862.0 35.00740051269531 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 321862.0 518.0793451629938 0.0 - - - - - - - 754.0 643 1 519 67 C20140704_OR004_03 C20140704_OR004_03 TB414049.[MT7]-IMNVIGEPIDERGPIK[MT7].4y9_2.heavy 518.047 / 584.844 55560.0 36.499698638916016 44 14 10 10 10 2.1292622849323295 37.3190363164983 0.0 3 0.9342275159148778 4.785536431103076 55560.0 155.0667067669173 0.0 - - - - - - - 379.0 111 5 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 521 67 C20140704_OR004_03 C20140704_OR004_03 TB414049.[MT7]-IMNVIGEPIDERGPIK[MT7].4y11_2.heavy 518.047 / 677.876 31061.0 36.499698638916016 44 14 10 10 10 2.1292622849323295 37.3190363164983 0.0 3 0.9342275159148778 4.785536431103076 31061.0 109.71389264869237 0.0 - - - - - - - 291.75 62 4 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 523 67 C20140704_OR004_03 C20140704_OR004_03 TB414049.[MT7]-IMNVIGEPIDERGPIK[MT7].4b4_1.heavy 518.047 / 602.345 29165.0 36.499698638916016 44 14 10 10 10 2.1292622849323295 37.3190363164983 0.0 3 0.9342275159148778 4.785536431103076 29165.0 109.49939490491879 0.0 - - - - - - - 237.0 58 8 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 525 67 C20140704_OR004_03 C20140704_OR004_03 TB414049.[MT7]-IMNVIGEPIDERGPIK[MT7].4b3_1.heavy 518.047 / 503.277 47540.0 36.499698638916016 44 14 10 10 10 2.1292622849323295 37.3190363164983 0.0 3 0.9342275159148778 4.785536431103076 47540.0 128.00577355196504 0.0 - - - - - - - 687.2857142857143 95 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 527 68 C20140704_OR004_03 C20140704_OR004_03 TB428089.[MT7]-AHGGYSVFAGVGER.2y13_2.heavy 775.895 / 668.326 1076.0 29.85724973678589 36 12 8 6 10 2.0359454477683676 49.11722959454125 0.03660011291503906 3 0.8815973813244723 3.5505890228656805 1076.0 4.207821229050279 0.0 - - - - - - - 212.875 2 16 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 529 68 C20140704_OR004_03 C20140704_OR004_03 TB428089.[MT7]-AHGGYSVFAGVGER.2y12_1.heavy 775.895 / 1198.59 1524.0 29.85724973678589 36 12 8 6 10 2.0359454477683676 49.11722959454125 0.03660011291503906 3 0.8815973813244723 3.5505890228656805 1524.0 23.15798882681564 0.0 - - - - - - - 194.16666666666666 3 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 531 68 C20140704_OR004_03 C20140704_OR004_03 TB428089.[MT7]-AHGGYSVFAGVGER.2y9_1.heavy 775.895 / 921.479 1165.0 29.85724973678589 36 12 8 6 10 2.0359454477683676 49.11722959454125 0.03660011291503906 3 0.8815973813244723 3.5505890228656805 1165.0 4.782759834732994 0.0 - - - - - - - 239.08333333333334 2 12 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 533 68 C20140704_OR004_03 C20140704_OR004_03 TB428089.[MT7]-AHGGYSVFAGVGER.2y11_1.heavy 775.895 / 1141.56 717.0 29.85724973678589 36 12 8 6 10 2.0359454477683676 49.11722959454125 0.03660011291503906 3 0.8815973813244723 3.5505890228656805 717.0 2.8039106145251393 4.0 - - - - - - - 152.5 3 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 535 69 C20140704_OR004_03 C20140704_OR004_03 TB414041.[MT7]-IEVLQQHENEDIYK[MT7].4b11_2.heavy 512.274 / 740.363 9417.0 31.008100509643555 35 10 10 5 10 1.174534292020014 70.4481920293762 0.0410003662109375 3 0.8268559840514151 2.9220211776779963 9417.0 155.426213592233 0.0 - - - - - - - 137.66666666666666 18 6 KPNA3 karyopherin alpha 3 (importin alpha 4) 537 69 C20140704_OR004_03 C20140704_OR004_03 TB414041.[MT7]-IEVLQQHENEDIYK[MT7].4b4_1.heavy 512.274 / 599.388 3932.0 31.008100509643555 35 10 10 5 10 1.174534292020014 70.4481920293762 0.0410003662109375 3 0.8268559840514151 2.9220211776779963 3932.0 13.423252818035426 0.0 - - - - - - - 180.875 7 8 KPNA3 karyopherin alpha 3 (importin alpha 4) 539 69 C20140704_OR004_03 C20140704_OR004_03 TB414041.[MT7]-IEVLQQHENEDIYK[MT7].4b5_1.heavy 512.274 / 727.447 1656.0 31.008100509643555 35 10 10 5 10 1.174534292020014 70.4481920293762 0.0410003662109375 3 0.8268559840514151 2.9220211776779963 1656.0 11.368 0.0 - - - - - - - 245.5 3 8 KPNA3 karyopherin alpha 3 (importin alpha 4) 541 69 C20140704_OR004_03 C20140704_OR004_03 TB414041.[MT7]-IEVLQQHENEDIYK[MT7].4b6_1.heavy 512.274 / 855.506 1656.0 31.008100509643555 35 10 10 5 10 1.174534292020014 70.4481920293762 0.0410003662109375 3 0.8268559840514151 2.9220211776779963 1656.0 23.105009708737864 0.0 - - - - - - - 168.0 3 8 KPNA3 karyopherin alpha 3 (importin alpha 4) 543 70 C20140704_OR004_03 C20140704_OR004_03 TB451811.[MT7]-EAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAK[MT7].4y5_1.heavy 1027.07 / 740.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - KPNA3 karyopherin alpha 3 (importin alpha 4) 545 70 C20140704_OR004_03 C20140704_OR004_03 TB451811.[MT7]-EAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAK[MT7].4y9_1.heavy 1027.07 / 1194.71 N/A N/A - - - - - - - - - 0.0 - - - - - - - KPNA3 karyopherin alpha 3 (importin alpha 4) 547 70 C20140704_OR004_03 C20140704_OR004_03 TB451811.[MT7]-EAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAK[MT7].4b4_1.heavy 1027.07 / 630.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - KPNA3 karyopherin alpha 3 (importin alpha 4) 549 70 C20140704_OR004_03 C20140704_OR004_03 TB451811.[MT7]-EAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAK[MT7].4b5_1.heavy 1027.07 / 777.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - KPNA3 karyopherin alpha 3 (importin alpha 4) 551 71 C20140704_OR004_03 C20140704_OR004_03 TB413685.[MT7]-LAEEQEVNK[MT7].2y8_1.heavy 674.372 / 1090.55 2741.0 22.555599212646484 41 11 10 10 10 0.821674644325559 69.79728212343032 0.0 3 0.8624960616888531 3.2892579829096693 2741.0 28.550432128514057 0.0 - - - - - - - 218.0 5 4 SH3BP1 SH3-domain binding protein 1 553 71 C20140704_OR004_03 C20140704_OR004_03 TB413685.[MT7]-LAEEQEVNK[MT7].2b4_1.heavy 674.372 / 587.316 1059.0 22.555599212646484 41 11 10 10 10 0.821674644325559 69.79728212343032 0.0 3 0.8624960616888531 3.2892579829096693 1059.0 15.7141935483871 3.0 - - - - - - - 211.8 2 15 SH3BP1 SH3-domain binding protein 1 555 71 C20140704_OR004_03 C20140704_OR004_03 TB413685.[MT7]-LAEEQEVNK[MT7].2y3_1.heavy 674.372 / 504.326 1308.0 22.555599212646484 41 11 10 10 10 0.821674644325559 69.79728212343032 0.0 3 0.8624960616888531 3.2892579829096693 1308.0 21.07567741935484 0.0 - - - - - - - 200.77777777777777 2 9 SH3BP1 SH3-domain binding protein 1 557 71 C20140704_OR004_03 C20140704_OR004_03 TB413685.[MT7]-LAEEQEVNK[MT7].2y6_1.heavy 674.372 / 890.47 872.0 22.555599212646484 41 11 10 10 10 0.821674644325559 69.79728212343032 0.0 3 0.8624960616888531 3.2892579829096693 872.0 19.636314838709676 0.0 - - - - - - - 0.0 1 0 SH3BP1 SH3-domain binding protein 1 559 72 C20140704_OR004_03 C20140704_OR004_03 TB413683.[MT7]-LLLLGAGESGK[MT7].3b5_1.heavy 449.281 / 654.467 11110.0 37.937801361083984 45 15 10 10 10 1.6943343188745688 38.08705276850737 0.0 3 0.9504337202920049 5.520250898971084 11110.0 29.585134090695952 1.0 - - - - - - - 187.2 26 5 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 561 72 C20140704_OR004_03 C20140704_OR004_03 TB413683.[MT7]-LLLLGAGESGK[MT7].3b3_1.heavy 449.281 / 484.362 18127.0 37.937801361083984 45 15 10 10 10 1.6943343188745688 38.08705276850737 0.0 3 0.9504337202920049 5.520250898971084 18127.0 116.19871794871796 0.0 - - - - - - - 117.0 36 1 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 563 72 C20140704_OR004_03 C20140704_OR004_03 TB413683.[MT7]-LLLLGAGESGK[MT7].3y5_1.heavy 449.281 / 621.332 10876.0 37.937801361083984 45 15 10 10 10 1.6943343188745688 38.08705276850737 0.0 3 0.9504337202920049 5.520250898971084 10876.0 123.94301994301995 0.0 - - - - - - - 351.0 21 1 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 565 72 C20140704_OR004_03 C20140704_OR004_03 TB413683.[MT7]-LLLLGAGESGK[MT7].3b8_2.heavy 449.281 / 456.288 11812.0 37.937801361083984 45 15 10 10 10 1.6943343188745688 38.08705276850737 0.0 3 0.9504337202920049 5.520250898971084 11812.0 151.18350427350427 0.0 - - - - - - - 175.5 23 2 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 567 73 C20140704_OR004_03 C20140704_OR004_03 TB428339.[MT7]-EK[MT7]PAYYALEGSVAIAGAVIR.3b6_2.heavy 789.449 / 520.786 1930.0 44.78697395324707 38 14 10 6 8 1.9810717770704036 40.27517535815958 0.03209686279296875 4 0.9416377053821755 5.083478813949782 1930.0 10.569047619047618 0.0 - - - - - - - 210.0 3 12 GK2 glycerol kinase 2 569 73 C20140704_OR004_03 C20140704_OR004_03 TB428339.[MT7]-EK[MT7]PAYYALEGSVAIAGAVIR.3y11_1.heavy 789.449 / 1013.61 1091.0 44.78697395324707 38 14 10 6 8 1.9810717770704036 40.27517535815958 0.03209686279296875 4 0.9416377053821755 5.083478813949782 1091.0 2.5976190476190477 2.0 - - - - - - - 179.2 3 15 GK2 glycerol kinase 2 571 73 C20140704_OR004_03 C20140704_OR004_03 TB428339.[MT7]-EK[MT7]PAYYALEGSVAIAGAVIR.3y8_1.heavy 789.449 / 770.488 1259.0 44.78697395324707 38 14 10 6 8 1.9810717770704036 40.27517535815958 0.03209686279296875 4 0.9416377053821755 5.083478813949782 1259.0 3.559672619047619 2.0 - - - - - - - 199.5 3 8 GK2 glycerol kinase 2 573 73 C20140704_OR004_03 C20140704_OR004_03 TB428339.[MT7]-EK[MT7]PAYYALEGSVAIAGAVIR.3b7_2.heavy 789.449 / 556.305 2265.0 44.78697395324707 38 14 10 6 8 1.9810717770704036 40.27517535815958 0.03209686279296875 4 0.9416377053821755 5.083478813949782 2265.0 13.03296123563626 1.0 - - - - - - - 184.8 4 15 GK2 glycerol kinase 2 575 74 C20140704_OR004_03 C20140704_OR004_03 TB413885.[MT7]-FEPQIQATESEIR.2y8_1.heavy 846.44 / 933.464 1793.0 33.71369934082031 46 18 10 10 8 26.76650363686064 3.7360127925818514 0.0 4 0.9886168602966826 11.556291943961673 1793.0 6.296376811594203 1.0 - - - - - - - 138.0 3 2 GK2 glycerol kinase 2 577 74 C20140704_OR004_03 C20140704_OR004_03 TB413885.[MT7]-FEPQIQATESEIR.2b4_1.heavy 846.44 / 646.332 827.0 33.71369934082031 46 18 10 10 8 26.76650363686064 3.7360127925818514 0.0 4 0.9886168602966826 11.556291943961673 827.0 1.6264271232259517 7.0 - - - - - - - 248.4 2 5 GK2 glycerol kinase 2 579 74 C20140704_OR004_03 C20140704_OR004_03 TB413885.[MT7]-FEPQIQATESEIR.2y9_1.heavy 846.44 / 1046.55 1379.0 33.71369934082031 46 18 10 10 8 26.76650363686064 3.7360127925818514 0.0 4 0.9886168602966826 11.556291943961673 1379.0 5.246422142509887 1.0 - - - - - - - 220.8 2 5 GK2 glycerol kinase 2 581 74 C20140704_OR004_03 C20140704_OR004_03 TB413885.[MT7]-FEPQIQATESEIR.2y7_1.heavy 846.44 / 805.405 965.0 33.71369934082031 46 18 10 10 8 26.76650363686064 3.7360127925818514 0.0 4 0.9886168602966826 11.556291943961673 965.0 3.3467391304347824 3.0 - - - - - - - 345.0 2 6 GK2 glycerol kinase 2 583 75 C20140704_OR004_03 C20140704_OR004_03 TB428335.[MT7]-TALLSLFGIPLWYHSQSPR.3y7_1.heavy 777.431 / 874.417 1114.0 52.36452579498291 30 11 8 5 6 4.628750779253434 21.60410114284202 0.043102264404296875 6 0.8587463364979356 3.2442370353153973 1114.0 10.682166208158192 0.0 - - - - - - - 177.0 2 4 SUN2 Sad1 and UNC84 domain containing 2 585 75 C20140704_OR004_03 C20140704_OR004_03 TB428335.[MT7]-TALLSLFGIPLWYHSQSPR.3b4_1.heavy 777.431 / 543.362 1620.0 52.36452579498291 30 11 8 5 6 4.628750779253434 21.60410114284202 0.043102264404296875 6 0.8587463364979356 3.2442370353153973 1620.0 3.8655335968379445 1.0 - - - - - - - 263.6 4 5 SUN2 Sad1 and UNC84 domain containing 2 587 75 C20140704_OR004_03 C20140704_OR004_03 TB428335.[MT7]-TALLSLFGIPLWYHSQSPR.3b5_1.heavy 777.431 / 630.394 405.0 52.36452579498291 30 11 8 5 6 4.628750779253434 21.60410114284202 0.043102264404296875 6 0.8587463364979356 3.2442370353153973 405.0 -0.2071447108836897 14.0 - - - - - - - 286.8333333333333 3 6 SUN2 Sad1 and UNC84 domain containing 2 589 75 C20140704_OR004_03 C20140704_OR004_03 TB428335.[MT7]-TALLSLFGIPLWYHSQSPR.3y5_1.heavy 777.431 / 574.294 810.0 52.36452579498291 30 11 8 5 6 4.628750779253434 21.60410114284202 0.043102264404296875 6 0.8587463364979356 3.2442370353153973 810.0 7.5236397248342435 4.0 - - - - - - - 215.375 2 8 SUN2 Sad1 and UNC84 domain containing 2 591 76 C20140704_OR004_03 C20140704_OR004_03 TB428336.[MT7]-VPLLAEIYGIEGNIFRLK[MT7].3y7_1.heavy 778.466 / 991.617 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 593 76 C20140704_OR004_03 C20140704_OR004_03 TB428336.[MT7]-VPLLAEIYGIEGNIFRLK[MT7].3y17_2.heavy 778.466 / 1045.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 595 76 C20140704_OR004_03 C20140704_OR004_03 TB428336.[MT7]-VPLLAEIYGIEGNIFRLK[MT7].3y11_2.heavy 778.466 / 727.418 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 597 76 C20140704_OR004_03 C20140704_OR004_03 TB428336.[MT7]-VPLLAEIYGIEGNIFRLK[MT7].3y8_1.heavy 778.466 / 1120.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 599 77 C20140704_OR004_03 C20140704_OR004_03 TB428332.[MT7]-FLSQPFQVAEVFTGHMGK[MT7].2y5_1.heavy 1156.11 / 673.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 601 77 C20140704_OR004_03 C20140704_OR004_03 TB428332.[MT7]-FLSQPFQVAEVFTGHMGK[MT7].2b4_1.heavy 1156.11 / 620.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 603 77 C20140704_OR004_03 C20140704_OR004_03 TB428332.[MT7]-FLSQPFQVAEVFTGHMGK[MT7].2b9_1.heavy 1156.11 / 1162.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 605 77 C20140704_OR004_03 C20140704_OR004_03 TB428332.[MT7]-FLSQPFQVAEVFTGHMGK[MT7].2y7_1.heavy 1156.11 / 921.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 607 78 C20140704_OR004_03 C20140704_OR004_03 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 18437.0 22.590499877929688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 18437.0 517.3367164179103 0.0 - - - - - - - 151.33333333333334 36 12 609 78 C20140704_OR004_03 C20140704_OR004_03 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 25032.0 22.590499877929688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 25032.0 269.1793011152416 0.0 - - - - - - - 134.6 50 5 611 78 C20140704_OR004_03 C20140704_OR004_03 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 85862.0 22.590499877929688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 85862.0 714.8191783009776 0.0 - - - - - - - 185.125 171 8 613 79 C20140704_OR004_03 C20140704_OR004_03 TB413577.[MT7]-TSILSLEK[MT7].2y4_1.heavy 589.865 / 620.374 5045.0 33.17639923095703 36 20 2 10 4 9.04589116593913 11.054742773883259 0.0 7 0.9972225617275248 23.412058027130104 5045.0 4.030419268510258 2.0 - - - - - - - 881.0 20 7 GANC glucosidase, alpha; neutral C 615 79 C20140704_OR004_03 C20140704_OR004_03 TB413577.[MT7]-TSILSLEK[MT7].2y5_1.heavy 589.865 / 733.458 3783.0 33.17639923095703 36 20 2 10 4 9.04589116593913 11.054742773883259 0.0 7 0.9972225617275248 23.412058027130104 3783.0 8.481811653950015 1.0 - - - - - - - 801.0 13 7 GANC glucosidase, alpha; neutral C 617 79 C20140704_OR004_03 C20140704_OR004_03 TB413577.[MT7]-TSILSLEK[MT7].2b4_1.heavy 589.865 / 559.357 2382.0 33.17639923095703 36 20 2 10 4 9.04589116593913 11.054742773883259 0.0 7 0.9972225617275248 23.412058027130104 2382.0 1.5867878558800288 6.0 - - - - - - - 681.0 24 7 GANC glucosidase, alpha; neutral C 619 79 C20140704_OR004_03 C20140704_OR004_03 TB413577.[MT7]-TSILSLEK[MT7].2y3_1.heavy 589.865 / 533.341 1962.0 33.17639923095703 36 20 2 10 4 9.04589116593913 11.054742773883259 0.0 7 0.9972225617275248 23.412058027130104 1962.0 2.555562962863916 13.0 - - - - - - - 256.6666666666667 8 6 GANC glucosidase, alpha; neutral C 621 80 C20140704_OR004_03 C20140704_OR004_03 TB451618.[MT7]-LTPSASLPPAQLLLR.3b6_1.heavy 574.353 / 701.395 6239.0 42.42090034484863 39 13 10 6 10 2.233798329926217 36.92415307982972 0.033802032470703125 3 0.9180041768006693 4.280094237545833 6239.0 -0.5 4.0 - - - - - - - 279.1666666666667 12 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 623 80 C20140704_OR004_03 C20140704_OR004_03 TB451618.[MT7]-LTPSASLPPAQLLLR.3y6_1.heavy 574.353 / 713.467 3818.0 42.42090034484863 39 13 10 6 10 2.233798329926217 36.92415307982972 0.033802032470703125 3 0.9180041768006693 4.280094237545833 3818.0 21.002705084280358 1.0 - - - - - - - 239.28571428571428 7 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 625 80 C20140704_OR004_03 C20140704_OR004_03 TB451618.[MT7]-LTPSASLPPAQLLLR.3b5_1.heavy 574.353 / 614.363 7729.0 42.42090034484863 39 13 10 6 10 2.233798329926217 36.92415307982972 0.033802032470703125 3 0.9180041768006693 4.280094237545833 7729.0 40.02027523361213 1.0 - - - - - - - 819.4 15 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 627 80 C20140704_OR004_03 C20140704_OR004_03 TB451618.[MT7]-LTPSASLPPAQLLLR.3y5_1.heavy 574.353 / 642.43 3911.0 42.42090034484863 39 13 10 6 10 2.233798329926217 36.92415307982972 0.033802032470703125 3 0.9180041768006693 4.280094237545833 3911.0 22.437982610887097 0.0 - - - - - - - 686.875 7 8 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 629 81 C20140704_OR004_03 C20140704_OR004_03 TB427731.[MT7]-QADIESR.2y4_1.heavy 481.755 / 504.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 631 81 C20140704_OR004_03 C20140704_OR004_03 TB427731.[MT7]-QADIESR.2b4_1.heavy 481.755 / 572.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 633 81 C20140704_OR004_03 C20140704_OR004_03 TB427731.[MT7]-QADIESR.2y6_1.heavy 481.755 / 690.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 635 81 C20140704_OR004_03 C20140704_OR004_03 TB427731.[MT7]-QADIESR.2b5_1.heavy 481.755 / 701.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 637 82 C20140704_OR004_03 C20140704_OR004_03 TB414033.[MT7]-RLEALAAEFSSNWQK[MT7].4b8_1.heavy 510.279 / 998.575 1264.0 41.03070068359375 39 13 10 6 10 19.188466353705625 5.211463915702063 0.033203125 3 0.925760863507654 4.501132259499734 1264.0 25.95760824742268 0.0 - - - - - - - 194.33333333333334 2 3 SUN2 Sad1 and UNC84 domain containing 2 639 82 C20140704_OR004_03 C20140704_OR004_03 TB414033.[MT7]-RLEALAAEFSSNWQK[MT7].4b4_1.heavy 510.279 / 614.374 1167.0 41.03070068359375 39 13 10 6 10 19.188466353705625 5.211463915702063 0.033203125 3 0.925760863507654 4.501132259499734 1167.0 3.9166438356164384 2.0 - - - - - - - 157.875 2 8 SUN2 Sad1 and UNC84 domain containing 2 641 82 C20140704_OR004_03 C20140704_OR004_03 TB414033.[MT7]-RLEALAAEFSSNWQK[MT7].4b5_1.heavy 510.279 / 727.458 972.0 41.03070068359375 39 13 10 6 10 19.188466353705625 5.211463915702063 0.033203125 3 0.925760863507654 4.501132259499734 972.0 4.509278350515464 2.0 - - - - - - - 230.625 2 8 SUN2 Sad1 and UNC84 domain containing 2 643 82 C20140704_OR004_03 C20140704_OR004_03 TB414033.[MT7]-RLEALAAEFSSNWQK[MT7].4b6_1.heavy 510.279 / 798.495 486.0 41.03070068359375 39 13 10 6 10 19.188466353705625 5.211463915702063 0.033203125 3 0.925760863507654 4.501132259499734 486.0 7.014432989690722 3.0 - - - - - - - 0.0 1 0 SUN2 Sad1 and UNC84 domain containing 2 645 83 C20140704_OR004_03 C20140704_OR004_03 TB414194.[MT7]-NQEGEDFEGVC[CAM]WPGLSSYLDFTNPK[MT7].4b5_1.heavy 795.123 / 702.318 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 647 83 C20140704_OR004_03 C20140704_OR004_03 TB414194.[MT7]-NQEGEDFEGVC[CAM]WPGLSSYLDFTNPK[MT7].4b9_1.heavy 795.123 / 1150.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 649 83 C20140704_OR004_03 C20140704_OR004_03 TB414194.[MT7]-NQEGEDFEGVC[CAM]WPGLSSYLDFTNPK[MT7].4b3_1.heavy 795.123 / 516.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 651 83 C20140704_OR004_03 C20140704_OR004_03 TB414194.[MT7]-NQEGEDFEGVC[CAM]WPGLSSYLDFTNPK[MT7].4b6_1.heavy 795.123 / 817.344 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 653 84 C20140704_OR004_03 C20140704_OR004_03 TB414197.[MT7]-QFAPIHAEAPEFMEMSVEQEILVTGIK[MT7].3b9_1.heavy 1111.58 / 1109.59 2948.0 47.589298248291016 41 14 9 10 8 3.034502718917334 32.954328686737355 0.0 4 0.9353724548204095 4.828212475453316 2948.0 15.127894736842105 0.0 - - - - - - - 278.35714285714283 5 14 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 655 84 C20140704_OR004_03 C20140704_OR004_03 TB414197.[MT7]-QFAPIHAEAPEFMEMSVEQEILVTGIK[MT7].3b5_1.heavy 1111.58 / 701.41 1236.0 47.589298248291016 41 14 9 10 8 3.034502718917334 32.954328686737355 0.0 4 0.9353724548204095 4.828212475453316 1236.0 6.288177922030021 1.0 - - - - - - - 247.0 2 5 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 657 84 C20140704_OR004_03 C20140704_OR004_03 TB414197.[MT7]-QFAPIHAEAPEFMEMSVEQEILVTGIK[MT7].3b3_1.heavy 1111.58 / 491.273 1522.0 47.589298248291016 41 14 9 10 8 3.034502718917334 32.954328686737355 0.0 4 0.9353724548204095 4.828212475453316 1522.0 14.016842105263157 0.0 - - - - - - - 205.83333333333334 3 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 659 84 C20140704_OR004_03 C20140704_OR004_03 TB414197.[MT7]-QFAPIHAEAPEFMEMSVEQEILVTGIK[MT7].3y4_1.heavy 1111.58 / 562.368 3329.0 47.589298248291016 41 14 9 10 8 3.034502718917334 32.954328686737355 0.0 4 0.9353724548204095 4.828212475453316 3329.0 14.183542155338271 1.0 - - - - - - - 176.42857142857142 7 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 661 85 C20140704_OR004_03 C20140704_OR004_03 TB427739.[MT7]-AVGVSNQR.2y4_1.heavy 487.779 / 504.253 3606.0 16.560199737548828 50 20 10 10 10 10.330822222140151 9.679771643508529 0.0 3 0.9968720282355185 22.060618668984908 3606.0 63.15027755749405 0.0 - - - - - - - 116.53333333333333 7 15 GK2 glycerol kinase 2 663 85 C20140704_OR004_03 C20140704_OR004_03 TB427739.[MT7]-AVGVSNQR.2y5_1.heavy 487.779 / 603.321 2326.0 16.560199737548828 50 20 10 10 10 10.330822222140151 9.679771643508529 0.0 3 0.9968720282355185 22.060618668984908 2326.0 24.06206896551724 0.0 - - - - - - - 74.6923076923077 4 13 GK2 glycerol kinase 2 665 85 C20140704_OR004_03 C20140704_OR004_03 TB427739.[MT7]-AVGVSNQR.2y6_1.heavy 487.779 / 660.342 11050.0 16.560199737548828 50 20 10 10 10 10.330822222140151 9.679771643508529 0.0 3 0.9968720282355185 22.060618668984908 11050.0 67.0928324469491 0.0 - - - - - - - 152.42857142857142 22 14 GK2 glycerol kinase 2 667 85 C20140704_OR004_03 C20140704_OR004_03 TB427739.[MT7]-AVGVSNQR.2y7_1.heavy 487.779 / 759.411 10933.0 16.560199737548828 50 20 10 10 10 10.330822222140151 9.679771643508529 0.0 3 0.9968720282355185 22.060618668984908 10933.0 185.58355670103091 0.0 - - - - - - - 142.33333333333334 21 12 GK2 glycerol kinase 2 669 86 C20140704_OR004_03 C20140704_OR004_03 TB428348.[MT7]-ITAYK[MT7]PPHSVILEPPVLK[MT7].4y5_1.heavy 609.375 / 697.473 10755.0 35.722801208496094 42 14 10 10 8 1.6051946729157618 42.305333219634946 0.0 4 0.9467372748573494 5.323581799837668 10755.0 12.725857561306254 0.0 - - - - - - - 302.7142857142857 21 7 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 671 86 C20140704_OR004_03 C20140704_OR004_03 TB428348.[MT7]-ITAYK[MT7]PPHSVILEPPVLK[MT7].4y4_1.heavy 609.375 / 600.42 N/A 35.722801208496094 42 14 10 10 8 1.6051946729157618 42.305333219634946 0.0 4 0.9467372748573494 5.323581799837668 21662.0 15.749979390560414 1.0 - - - - - - - 2348.0 43 2 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 673 86 C20140704_OR004_03 C20140704_OR004_03 TB428348.[MT7]-ITAYK[MT7]PPHSVILEPPVLK[MT7].4y3_1.heavy 609.375 / 503.367 7271.0 35.722801208496094 42 14 10 10 8 1.6051946729157618 42.305333219634946 0.0 4 0.9467372748573494 5.323581799837668 7271.0 8.55766193890797 1.0 - - - - - - - 353.3333333333333 14 3 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 675 86 C20140704_OR004_03 C20140704_OR004_03 TB428348.[MT7]-ITAYK[MT7]PPHSVILEPPVLK[MT7].4b9_2.heavy 609.375 / 642.371 10755.0 35.722801208496094 42 14 10 10 8 1.6051946729157618 42.305333219634946 0.0 4 0.9467372748573494 5.323581799837668 10755.0 13.133285481543696 0.0 - - - - - - - 327.8333333333333 21 6 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 677 87 C20140704_OR004_03 C20140704_OR004_03 TB428345.[MT7]-SLQDIIAILGMDELSEEDK[MT7].4y5_1.heavy 602.568 / 751.359 2926.0 53.296424865722656 26 0 10 6 10 0.36971005613510155 120.68569775146558 0.0384979248046875 3 0.399052626101892 1.504188418172682 2926.0 21.219 0.0 - - - - - - - 221.66666666666666 5 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 679 87 C20140704_OR004_03 C20140704_OR004_03 TB428345.[MT7]-SLQDIIAILGMDELSEEDK[MT7].4b7_1.heavy 602.568 / 885.516 887.0 53.296424865722656 26 0 10 6 10 0.36971005613510155 120.68569775146558 0.0384979248046875 3 0.399052626101892 1.504188418172682 887.0 13.00188983695193 0.0 - - - - - - - 0.0 1 0 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 681 87 C20140704_OR004_03 C20140704_OR004_03 TB428345.[MT7]-SLQDIIAILGMDELSEEDK[MT7].4b4_1.heavy 602.568 / 588.311 355.0 53.296424865722656 26 0 10 6 10 0.36971005613510155 120.68569775146558 0.0384979248046875 3 0.399052626101892 1.504188418172682 355.0 2.797881355932203 1.0 - - - - - - - 0.0 0 0 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 683 87 C20140704_OR004_03 C20140704_OR004_03 TB428345.[MT7]-SLQDIIAILGMDELSEEDK[MT7].4b5_1.heavy 602.568 / 701.395 709.0 53.296424865722656 26 0 10 6 10 0.36971005613510155 120.68569775146558 0.0384979248046875 3 0.399052626101892 1.504188418172682 709.0 3.805367231638418 1.0 - - - - - - - 0.0 1 0 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 685 88 C20140704_OR004_03 C20140704_OR004_03 TB428343.[MT7]-SLQDIIAILGMDELSEEDK[MT7].3b6_1.heavy 803.089 / 814.479 7407.0 53.286800384521484 50 20 10 10 10 20.528952644601617 4.871169110826335 0.0 3 0.9981993688823465 29.079357430899638 7407.0 76.98286516853932 0.0 - - - - - - - 144.75 14 8 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 687 88 C20140704_OR004_03 C20140704_OR004_03 TB428343.[MT7]-SLQDIIAILGMDELSEEDK[MT7].3b4_1.heavy 803.089 / 588.311 18920.0 53.286800384521484 50 20 10 10 10 20.528952644601617 4.871169110826335 0.0 3 0.9981993688823465 29.079357430899638 18920.0 172.19325842696628 0.0 - - - - - - - 200.5 37 12 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 689 88 C20140704_OR004_03 C20140704_OR004_03 TB428343.[MT7]-SLQDIIAILGMDELSEEDK[MT7].3b5_1.heavy 803.089 / 701.395 12851.0 53.286800384521484 50 20 10 10 10 20.528952644601617 4.871169110826335 0.0 3 0.9981993688823465 29.079357430899638 12851.0 55.66496066396988 0.0 - - - - - - - 141.08333333333334 25 12 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 691 88 C20140704_OR004_03 C20140704_OR004_03 TB428343.[MT7]-SLQDIIAILGMDELSEEDK[MT7].3b7_1.heavy 803.089 / 885.516 9638.0 53.286800384521484 50 20 10 10 10 20.528952644601617 4.871169110826335 0.0 3 0.9981993688823465 29.079357430899638 9638.0 70.26866510145899 0.0 - - - - - - - 257.55555555555554 19 9 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 693 89 C20140704_OR004_03 C20140704_OR004_03 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 120191.0 32.298500061035156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 120191.0 341.5071182310293 0.0 - - - - - - - 190.75 240 8 695 89 C20140704_OR004_03 C20140704_OR004_03 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 124515.0 32.298500061035156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 124515.0 261.33420348618483 0.0 - - - - - - - 228.8 249 5 697 89 C20140704_OR004_03 C20140704_OR004_03 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 229571.0 32.298500061035156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 229571.0 24.221923264686502 1.0 - - - - - - - 236.14285714285714 464 7 699 90 C20140704_OR004_03 C20140704_OR004_03 TB428341.[MT7]-NVLSLTNK[MT7]GEVFNELVGK[MT7].4b11_2.heavy 599.1 / 722.424 15865.0 40.96439838409424 40 14 10 6 10 1.9409387191547116 41.25176573429257 0.033199310302734375 3 0.9384029403571151 4.946835812640275 15865.0 139.97102446483183 0.0 - - - - - - - 260.7857142857143 31 14 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 701 90 C20140704_OR004_03 C20140704_OR004_03 TB428341.[MT7]-NVLSLTNK[MT7]GEVFNELVGK[MT7].4b4_1.heavy 599.1 / 558.337 7692.0 40.96439838409424 40 14 10 6 10 1.9409387191547116 41.25176573429257 0.033199310302734375 3 0.9384029403571151 4.946835812640275 7692.0 10.702782834850455 0.0 - - - - - - - 266.15384615384613 15 13 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 703 90 C20140704_OR004_03 C20140704_OR004_03 TB428341.[MT7]-NVLSLTNK[MT7]GEVFNELVGK[MT7].4b13_2.heavy 599.1 / 852.98 8557.0 40.96439838409424 40 14 10 6 10 1.9409387191547116 41.25176573429257 0.033199310302734375 3 0.9384029403571151 4.946835812640275 8557.0 108.74520833333335 0.0 - - - - - - - 192.1818181818182 17 11 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 705 90 C20140704_OR004_03 C20140704_OR004_03 TB428341.[MT7]-NVLSLTNK[MT7]GEVFNELVGK[MT7].4b10_2.heavy 599.1 / 672.89 12692.0 40.96439838409424 40 14 10 6 10 1.9409387191547116 41.25176573429257 0.033199310302734375 3 0.9384029403571151 4.946835812640275 12692.0 130.8697583160083 0.0 - - - - - - - 248.33333333333334 25 12 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 707 91 C20140704_OR004_03 C20140704_OR004_03 TB451413.[MT7]-AQSESAQSK[MT7].2y8_1.heavy 612.327 / 1008.51 468.0 13.413200378417969 47 17 10 10 10 3.9777491396364906 20.111377034741608 0.0 3 0.9756437264532535 7.891716994528958 468.0 72.97260504201681 0.0 - - - - - - - 0.0 0 0 LOC100133583;LOC100293977;LOC100507687;LOC100507710;LOC100507719;LOC100509325;LOC100510517;LOC100510688;LOC100510689;HLA-DQB1;HLA-DRB5 HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;major histocompatibility complex, class II, DQ beta 1;major histocompatibility complex, class II, DR beta 5 709 91 C20140704_OR004_03 C20140704_OR004_03 TB451413.[MT7]-AQSESAQSK[MT7].2y5_1.heavy 612.327 / 664.375 535.0 13.413200378417969 47 17 10 10 10 3.9777491396364906 20.111377034741608 0.0 3 0.9756437264532535 7.891716994528958 535.0 39.550370370370366 0.0 - - - - - - - 0.0 1 0 LOC100133583;LOC100293977;LOC100507687;LOC100507710;LOC100507719;LOC100509325;LOC100510517;LOC100510688;LOC100510689;HLA-DQB1;HLA-DRB5 HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;major histocompatibility complex, class II, DQ beta 1;major histocompatibility complex, class II, DR beta 5 711 91 C20140704_OR004_03 C20140704_OR004_03 TB451413.[MT7]-AQSESAQSK[MT7].2y3_1.heavy 612.327 / 506.306 251.0 13.413200378417969 47 17 10 10 10 3.9777491396364906 20.111377034741608 0.0 3 0.9756437264532535 7.891716994528958 251.0 19.415588235294116 0.0 - - - - - - - 0.0 0 0 LOC100133583;LOC100293977;LOC100507687;LOC100507710;LOC100507719;LOC100509325;LOC100510517;LOC100510688;LOC100510689;HLA-DQB1;HLA-DRB5 HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;major histocompatibility complex, class II, DQ beta 1;major histocompatibility complex, class II, DR beta 5 713 91 C20140704_OR004_03 C20140704_OR004_03 TB451413.[MT7]-AQSESAQSK[MT7].2y7_1.heavy 612.327 / 880.449 576.0 13.413200378417969 47 17 10 10 10 3.9777491396364906 20.111377034741608 0.0 3 0.9756437264532535 7.891716994528958 576.0 85.08693009118542 0.0 - - - - - - - 0.0 1 0 LOC100133583;LOC100293977;LOC100507687;LOC100507710;LOC100507719;LOC100509325;LOC100510517;LOC100510688;LOC100510689;HLA-DQB1;HLA-DRB5 HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;major histocompatibility complex, class II, DQ beta 1;major histocompatibility complex, class II, DR beta 5 715 92 C20140704_OR004_03 C20140704_OR004_03 TB451608.[MT7]-DFAIFGFDEDLQQEGTLLGK[MT7].3y7_1.heavy 844.435 / 861.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 717 92 C20140704_OR004_03 C20140704_OR004_03 TB451608.[MT7]-DFAIFGFDEDLQQEGTLLGK[MT7].3y6_1.heavy 844.435 / 732.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 719 92 C20140704_OR004_03 C20140704_OR004_03 TB451608.[MT7]-DFAIFGFDEDLQQEGTLLGK[MT7].3b4_1.heavy 844.435 / 591.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 721 92 C20140704_OR004_03 C20140704_OR004_03 TB451608.[MT7]-DFAIFGFDEDLQQEGTLLGK[MT7].3y8_1.heavy 844.435 / 989.575 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 723 93 C20140704_OR004_03 C20140704_OR004_03 TB428342.[MT7]-ILAEFEMTLERDVLQPLSR.3y18_2.heavy 802.106 / 1074.06 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 725 93 C20140704_OR004_03 C20140704_OR004_03 TB428342.[MT7]-ILAEFEMTLERDVLQPLSR.3y17_2.heavy 802.106 / 1017.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 727 93 C20140704_OR004_03 C20140704_OR004_03 TB428342.[MT7]-ILAEFEMTLERDVLQPLSR.3b4_1.heavy 802.106 / 571.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 729 93 C20140704_OR004_03 C20140704_OR004_03 TB428342.[MT7]-ILAEFEMTLERDVLQPLSR.3y16_2.heavy 802.106 / 982.001 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 731 94 C20140704_OR004_03 C20140704_OR004_03 TB428082.[MT7]-LSEEELPAILK[MT7].2y5_1.heavy 765.455 / 685.473 8289.0 39.58459949493408 38 14 10 6 8 3.251267318278089 24.31421942683582 0.035198211669921875 4 0.9438778852688162 5.184931240182383 8289.0 45.958811881188126 0.0 - - - - - - - 274.14285714285717 16 14 SH3BP1 SH3-domain binding protein 1 733 94 C20140704_OR004_03 C20140704_OR004_03 TB428082.[MT7]-LSEEELPAILK[MT7].2b4_1.heavy 765.455 / 603.311 2224.0 39.58459949493408 38 14 10 6 8 3.251267318278089 24.31421942683582 0.035198211669921875 4 0.9438778852688162 5.184931240182383 2224.0 12.642103261173576 0.0 - - - - - - - 235.66666666666666 4 12 SH3BP1 SH3-domain binding protein 1 735 94 C20140704_OR004_03 C20140704_OR004_03 TB428082.[MT7]-LSEEELPAILK[MT7].2b6_1.heavy 765.455 / 845.437 3942.0 39.58459949493408 38 14 10 6 8 3.251267318278089 24.31421942683582 0.035198211669921875 4 0.9438778852688162 5.184931240182383 3942.0 40.453290488851195 0.0 - - - - - - - 161.6 7 10 SH3BP1 SH3-domain binding protein 1 737 94 C20140704_OR004_03 C20140704_OR004_03 TB428082.[MT7]-LSEEELPAILK[MT7].2b5_1.heavy 765.455 / 732.353 5459.0 39.58459949493408 38 14 10 6 8 3.251267318278089 24.31421942683582 0.035198211669921875 4 0.9438778852688162 5.184931240182383 5459.0 17.02559405940594 1.0 - - - - - - - 248.6153846153846 13 13 SH3BP1 SH3-domain binding protein 1 739 95 C20140704_OR004_03 C20140704_OR004_03 TB428340.[MT7]-GVLQFENVSYGIEPLESSVGFEHVIYQVK[MT7].3b4_1.heavy 1185.96 / 542.342 2843.0 47.630699157714844 43 13 10 10 10 1.485778309154984 47.09372571966017 0.0 3 0.9224715534593049 4.4033704666362565 2843.0 11.550745415575136 0.0 - - - - - - - 190.0 5 2 ADAM2 ADAM metallopeptidase domain 2 741 95 C20140704_OR004_03 C20140704_OR004_03 TB428340.[MT7]-GVLQFENVSYGIEPLESSVGFEHVIYQVK[MT7].3b3_1.heavy 1185.96 / 414.283 4454.0 47.630699157714844 43 13 10 10 10 1.485778309154984 47.09372571966017 0.0 3 0.9224715534593049 4.4033704666362565 4454.0 69.83403157894736 0.0 - - - - - - - 216.85714285714286 8 7 ADAM2 ADAM metallopeptidase domain 2 743 95 C20140704_OR004_03 C20140704_OR004_03 TB428340.[MT7]-GVLQFENVSYGIEPLESSVGFEHVIYQVK[MT7].3b8_1.heavy 1185.96 / 1031.56 2938.0 47.630699157714844 43 13 10 10 10 1.485778309154984 47.09372571966017 0.0 3 0.9224715534593049 4.4033704666362565 2938.0 30.575537667698658 0.0 - - - - - - - 162.71428571428572 5 7 ADAM2 ADAM metallopeptidase domain 2 745 95 C20140704_OR004_03 C20140704_OR004_03 TB428340.[MT7]-GVLQFENVSYGIEPLESSVGFEHVIYQVK[MT7].3b7_1.heavy 1185.96 / 932.496 1421.0 47.630699157714844 43 13 10 10 10 1.485778309154984 47.09372571966017 0.0 3 0.9224715534593049 4.4033704666362565 1421.0 21.53188947368421 0.0 - - - - - - - 189.75 2 8 ADAM2 ADAM metallopeptidase domain 2 747 96 C20140704_OR004_03 C20140704_OR004_03 TB428081.[MT7]-IMNVIGEPIDER.2b3_1.heavy 765.409 / 503.277 7291.0 37.56575012207031 39 14 10 5 10 1.4307006372469764 47.81989160100539 0.04810333251953125 3 0.937264689478056 4.9012776176208845 7291.0 71.77078125 0.0 - - - - - - - 256.0 14 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 749 96 C20140704_OR004_03 C20140704_OR004_03 TB428081.[MT7]-IMNVIGEPIDER.2y8_1.heavy 765.409 / 928.473 9082.0 37.56575012207031 39 14 10 5 10 1.4307006372469764 47.81989160100539 0.04810333251953125 3 0.937264689478056 4.9012776176208845 9082.0 35.00354166666666 0.0 - - - - - - - 224.0 18 4 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 751 96 C20140704_OR004_03 C20140704_OR004_03 TB428081.[MT7]-IMNVIGEPIDER.2y5_1.heavy 765.409 / 629.325 6268.0 37.56575012207031 39 14 10 5 10 1.4307006372469764 47.81989160100539 0.04810333251953125 3 0.937264689478056 4.9012776176208845 6268.0 36.7265625 0.0 - - - - - - - 213.33333333333334 12 9 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 753 96 C20140704_OR004_03 C20140704_OR004_03 TB428081.[MT7]-IMNVIGEPIDER.2b4_1.heavy 765.409 / 602.345 10233.0 37.56575012207031 39 14 10 5 10 1.4307006372469764 47.81989160100539 0.04810333251953125 3 0.937264689478056 4.9012776176208845 10233.0 33.12307043027638 0.0 - - - - - - - 270.22222222222223 20 9 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 755 97 C20140704_OR004_03 C20140704_OR004_03 TB428423.[MT7]-FTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQER.4b7_1.heavy 957.486 / 865.417 3489.0 47.673099517822266 44 14 10 10 10 1.424551160808912 47.15692033008921 0.0 3 0.9344754082415134 4.7946816918115065 3489.0 12.082180208266978 0.0 - - - - - - - 254.8 6 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 757 97 C20140704_OR004_03 C20140704_OR004_03 TB428423.[MT7]-FTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQER.4y10_1.heavy 957.486 / 1139.48 6507.0 47.673099517822266 44 14 10 10 10 1.424551160808912 47.15692033008921 0.0 3 0.9344754082415134 4.7946816918115065 6507.0 16.04035465687313 1.0 - - - - - - - 253.92307692307693 14 13 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 759 97 C20140704_OR004_03 C20140704_OR004_03 TB428423.[MT7]-FTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQER.4y7_1.heavy 957.486 / 852.37 4715.0 47.673099517822266 44 14 10 10 10 1.424551160808912 47.15692033008921 0.0 3 0.9344754082415134 4.7946816918115065 4715.0 27.54243047679748 0.0 - - - - - - - 198.0 9 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 761 97 C20140704_OR004_03 C20140704_OR004_03 TB428423.[MT7]-FTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQER.4b3_1.heavy 957.486 / 521.284 3678.0 47.673099517822266 44 14 10 10 10 1.424551160808912 47.15692033008921 0.0 3 0.9344754082415134 4.7946816918115065 3678.0 0.7474963580131089 1.0 - - - - - - - 188.41666666666666 7 12 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 763 98 C20140704_OR004_03 C20140704_OR004_03 TB428422.[MT7]-GFQQILAGEYDHLPEQAFYMVGPIEEAVAK[MT7].4b5_1.heavy 910.467 / 718.4 3102.0 51.39722442626953 27 8 10 1 8 0.5897169105729948 85.14617568240527 0.10049819946289062 4 0.7687674025677016 2.515301291147617 3102.0 4.400604340148716 1.0 - - - - - - - 178.33333333333334 8 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 765 98 C20140704_OR004_03 C20140704_OR004_03 TB428422.[MT7]-GFQQILAGEYDHLPEQAFYMVGPIEEAVAK[MT7].4y9_1.heavy 910.467 / 1057.6 8449.0 51.39722442626953 27 8 10 1 8 0.5897169105729948 85.14617568240527 0.10049819946289062 4 0.7687674025677016 2.515301291147617 8449.0 -0.6583636363636365 0.0 - - - - - - - 149.8 16 5 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 767 98 C20140704_OR004_03 C20140704_OR004_03 TB428422.[MT7]-GFQQILAGEYDHLPEQAFYMVGPIEEAVAK[MT7].4b6_1.heavy 910.467 / 831.484 1925.0 51.39722442626953 27 8 10 1 8 0.5897169105729948 85.14617568240527 0.10049819946289062 4 0.7687674025677016 2.515301291147617 1925.0 -0.1799065420560746 0.0 - - - - - - - 254.125 3 8 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 769 98 C20140704_OR004_03 C20140704_OR004_03 TB428422.[MT7]-GFQQILAGEYDHLPEQAFYMVGPIEEAVAK[MT7].4b4_1.heavy 910.467 / 605.316 4706.0 51.39722442626953 27 8 10 1 8 0.5897169105729948 85.14617568240527 0.10049819946289062 4 0.7687674025677016 2.515301291147617 4706.0 10.4823945794975 0.0 - - - - - - - 278.2 9 5 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 771 99 C20140704_OR004_03 C20140704_OR004_03 TB451639.[MT7]-GSPLAPSGTSVPFWVR.3y7_1.heavy 601.329 / 890.488 6970.0 41.923867543538414 43 17 10 6 10 4.321398618399147 16.85417852316769 0.03369903564453125 3 0.9762598025110721 7.9938732065907985 6970.0 13.200757575757578 0.0 - - - - - - - 223.0 13 9 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 773 99 C20140704_OR004_03 C20140704_OR004_03 TB451639.[MT7]-GSPLAPSGTSVPFWVR.3y12_2.heavy 601.329 / 652.343 N/A 41.923867543538414 43 17 10 6 10 4.321398618399147 16.85417852316769 0.03369903564453125 3 0.9762598025110721 7.9938732065907985 106.0 0.15381703470031546 45.0 - - - - - - - 166.14285714285714 4 7 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 775 99 C20140704_OR004_03 C20140704_OR004_03 TB451639.[MT7]-GSPLAPSGTSVPFWVR.3y5_1.heavy 601.329 / 704.388 34215.0 41.923867543538414 43 17 10 6 10 4.321398618399147 16.85417852316769 0.03369903564453125 3 0.9762598025110721 7.9938732065907985 34215.0 -4.864691943127966 0.0 - - - - - - - 356.25 68 8 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 777 99 C20140704_OR004_03 C20140704_OR004_03 TB451639.[MT7]-GSPLAPSGTSVPFWVR.3b5_1.heavy 601.329 / 570.337 49949.0 41.923867543538414 43 17 10 6 10 4.321398618399147 16.85417852316769 0.03369903564453125 3 0.9762598025110721 7.9938732065907985 49949.0 -0.33794993234100446 0.0 - - - - - - - 211.0 99 1 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 779 100 C20140704_OR004_03 C20140704_OR004_03 TB428425.[MT7]-SPLTIC[CAM]YPEYAGSNTYEEAAAYIQC[CAM]QFEDLNK[MT7].4y8_1.heavy 1009.22 / 1197.57 2995.0 51.730899810791016 50 20 10 10 10 6.778486116129119 14.752556586647609 0.0 3 0.9910335245857508 13.023461977277046 2995.0 7.075415368639668 0.0 - - - - - - - 299.6 5 5 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 781 100 C20140704_OR004_03 C20140704_OR004_03 TB428425.[MT7]-SPLTIC[CAM]YPEYAGSNTYEEAAAYIQC[CAM]QFEDLNK[MT7].4b7_1.heavy 1009.22 / 979.504 4172.0 51.730899810791016 50 20 10 10 10 6.778486116129119 14.752556586647609 0.0 3 0.9910335245857508 13.023461977277046 4172.0 -2.3394392523364473 0.0 - - - - - - - 214.0 8 8 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 783 100 C20140704_OR004_03 C20140704_OR004_03 TB428425.[MT7]-SPLTIC[CAM]YPEYAGSNTYEEAAAYIQC[CAM]QFEDLNK[MT7].4y3_1.heavy 1009.22 / 518.342 4278.0 51.730899810791016 50 20 10 10 10 6.778486116129119 14.752556586647609 0.0 3 0.9910335245857508 13.023461977277046 4278.0 -0.5997196261682252 0.0 - - - - - - - 299.6 8 5 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 785 100 C20140704_OR004_03 C20140704_OR004_03 TB428425.[MT7]-SPLTIC[CAM]YPEYAGSNTYEEAAAYIQC[CAM]QFEDLNK[MT7].4b6_1.heavy 1009.22 / 816.441 4278.0 51.730899810791016 50 20 10 10 10 6.778486116129119 14.752556586647609 0.0 3 0.9910335245857508 13.023461977277046 4278.0 -2.3988785046729006 0.0 - - - - - - - 196.16666666666666 8 6 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 787 101 C20140704_OR004_03 C20140704_OR004_03 TB451534.[MT7]-INEETPLK[MT7]PR.3b4_1.heavy 495.627 / 630.321 5003.0 24.43690013885498 44 18 10 6 10 2.4317545345291274 32.419267836132526 0.036800384521484375 3 0.9807078203302504 8.870968372076586 5003.0 36.11187969924812 1.0 - - - - - - - 158.3125 10 16 GANC glucosidase, alpha; neutral C 789 101 C20140704_OR004_03 C20140704_OR004_03 TB451534.[MT7]-INEETPLK[MT7]PR.3y4_1.heavy 495.627 / 657.453 2068.0 24.43690013885498 44 18 10 6 10 2.4317545345291274 32.419267836132526 0.036800384521484375 3 0.9807078203302504 8.870968372076586 2068.0 43.62502973852542 0.0 - - - - - - - 161.33333333333334 4 12 GANC glucosidase, alpha; neutral C 791 101 C20140704_OR004_03 C20140704_OR004_03 TB451534.[MT7]-INEETPLK[MT7]PR.3b3_1.heavy 495.627 / 501.279 4469.0 24.43690013885498 44 18 10 6 10 2.4317545345291274 32.419267836132526 0.036800384521484375 3 0.9807078203302504 8.870968372076586 4469.0 1.3397430406852249 1.0 - - - - - - - 195.0 8 13 GANC glucosidase, alpha; neutral C 793 101 C20140704_OR004_03 C20140704_OR004_03 TB451534.[MT7]-INEETPLK[MT7]PR.3y5_1.heavy 495.627 / 754.506 7671.0 24.43690013885498 44 18 10 6 10 2.4317545345291274 32.419267836132526 0.036800384521484375 3 0.9807078203302504 8.870968372076586 7671.0 89.88624022556391 0.0 - - - - - - - 176.28571428571428 15 14 GANC glucosidase, alpha; neutral C 795 102 C20140704_OR004_03 C20140704_OR004_03 TB428125.[MT7]-EILQSVYEC[CAM]IAR.2b3_1.heavy 812.928 / 500.32 20972.0 42.704298973083496 38 12 10 6 10 2.6959106796923127 30.92878092381886 0.034000396728515625 3 0.8981053243362577 3.8329048894462163 20972.0 160.72803278688525 0.0 - - - - - - - 205.76470588235293 41 17 GK2 glycerol kinase 2 797 102 C20140704_OR004_03 C20140704_OR004_03 TB428125.[MT7]-EILQSVYEC[CAM]IAR.2y8_1.heavy 812.928 / 997.477 37798.0 42.704298973083496 38 12 10 6 10 2.6959106796923127 30.92878092381886 0.034000396728515625 3 0.8981053243362577 3.8329048894462163 37798.0 333.10758433223214 0.0 - - - - - - - 211.46666666666667 75 15 GK2 glycerol kinase 2 799 102 C20140704_OR004_03 C20140704_OR004_03 TB428125.[MT7]-EILQSVYEC[CAM]IAR.2y9_1.heavy 812.928 / 1125.54 20078.0 42.704298973083496 38 12 10 6 10 2.6959106796923127 30.92878092381886 0.034000396728515625 3 0.8981053243362577 3.8329048894462163 20078.0 141.42574608602365 0.0 - - - - - - - 135.5 40 12 GK2 glycerol kinase 2 801 102 C20140704_OR004_03 C20140704_OR004_03 TB428125.[MT7]-EILQSVYEC[CAM]IAR.2y10_1.heavy 812.928 / 1238.62 6015.0 42.704298973083496 38 12 10 6 10 2.6959106796923127 30.92878092381886 0.034000396728515625 3 0.8981053243362577 3.8329048894462163 6015.0 29.51524748624276 0.0 - - - - - - - 137.53846153846155 12 13 GK2 glycerol kinase 2 803 103 C20140704_OR004_03 C20140704_OR004_03 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 184175.0 26.471933364868164 23 -3 10 6 10 null 0.0 0.03230094909667969 3 0.0 0.0 184175.0 39.773410619304606 0.0 - - - - - - - 2868.5 368 2 805 103 C20140704_OR004_03 C20140704_OR004_03 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 256891.0 26.471933364868164 23 -3 10 6 10 null 0.0 0.03230094909667969 3 0.0 0.0 256891.0 58.61901481703576 0.0 - - - - - - - 3353.0 513 1 807 103 C20140704_OR004_03 C20140704_OR004_03 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 345552.0 26.471933364868164 23 -3 10 6 10 null 0.0 0.03230094909667969 3 0.0 0.0 345552.0 65.53832615474076 0.0 - - - - - - - 4954.5 691 2 809 104 C20140704_OR004_03 C20140704_OR004_03 TB427859.[MT7]-VLDSGAPIK[MT7].2y8_1.heavy 594.366 / 944.553 17830.0 27.753849983215332 39 13 10 6 10 2.1619355604401136 46.2548476605115 0.034198760986328125 3 0.9238077878699883 4.442324121966803 17830.0 250.50590481171548 0.0 - - - - - - - 210.42857142857142 35 14 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 811 104 C20140704_OR004_03 C20140704_OR004_03 TB427859.[MT7]-VLDSGAPIK[MT7].2b6_1.heavy 594.366 / 687.379 10666.0 27.753849983215332 39 13 10 6 10 2.1619355604401136 46.2548476605115 0.034198760986328125 3 0.9238077878699883 4.442324121966803 10666.0 61.71522012578617 1.0 - - - - - - - 244.57142857142858 21 14 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 813 104 C20140704_OR004_03 C20140704_OR004_03 TB427859.[MT7]-VLDSGAPIK[MT7].2y3_1.heavy 594.366 / 501.352 21333.0 27.753849983215332 39 13 10 6 10 2.1619355604401136 46.2548476605115 0.034198760986328125 3 0.9238077878699883 4.442324121966803 21333.0 31.81530612244898 1.0 - - - - - - - 1159.857142857143 42 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 815 104 C20140704_OR004_03 C20140704_OR004_03 TB427859.[MT7]-VLDSGAPIK[MT7].2y6_1.heavy 594.366 / 716.442 16716.0 27.753849983215332 39 13 10 6 10 2.1619355604401136 46.2548476605115 0.034198760986328125 3 0.9238077878699883 4.442324121966803 16716.0 54.23488441130408 0.0 - - - - - - - 167.2 33 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 817 105 C20140704_OR004_03 C20140704_OR004_03 TB413498.[MT7]-GDFGTQK[MT7].2y4_1.heavy 520.784 / 577.343 2865.0 19.73240089416504 47 17 10 10 10 5.378111020710645 18.593889121088903 0.0 3 0.9755544759882505 7.877238397857826 2865.0 22.11160146871911 0.0 - - - - - - - 152.64285714285714 5 14 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 819 105 C20140704_OR004_03 C20140704_OR004_03 TB413498.[MT7]-GDFGTQK[MT7].2y5_1.heavy 520.784 / 724.411 4758.0 19.73240089416504 47 17 10 10 10 5.378111020710645 18.593889121088903 0.0 3 0.9755544759882505 7.877238397857826 4758.0 45.02327213670385 0.0 - - - - - - - 149.91666666666666 9 12 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 821 105 C20140704_OR004_03 C20140704_OR004_03 TB413498.[MT7]-GDFGTQK[MT7].2b6_1.heavy 520.784 / 750.354 1165.0 19.73240089416504 47 17 10 10 10 5.378111020710645 18.593889121088903 0.0 3 0.9755544759882505 7.877238397857826 1165.0 6.005154639175258 0.0 - - - - - - - 116.16666666666667 2 18 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 823 105 C20140704_OR004_03 C20140704_OR004_03 TB413498.[MT7]-GDFGTQK[MT7].2y6_1.heavy 520.784 / 839.438 1262.0 19.73240089416504 47 17 10 10 10 5.378111020710645 18.593889121088903 0.0 3 0.9755544759882505 7.877238397857826 1262.0 24.72489795918367 0.0 - - - - - - - 109.5 2 8 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 825 106 C20140704_OR004_03 C20140704_OR004_03 TB451630.[MT7]-QLFVLAGAAEEGFMTAELAGVIK[MT7].3b9_1.heavy 885.155 / 1015.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 827 106 C20140704_OR004_03 C20140704_OR004_03 TB451630.[MT7]-QLFVLAGAAEEGFMTAELAGVIK[MT7].3b4_1.heavy 885.155 / 632.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 829 106 C20140704_OR004_03 C20140704_OR004_03 TB451630.[MT7]-QLFVLAGAAEEGFMTAELAGVIK[MT7].3b5_1.heavy 885.155 / 745.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 831 106 C20140704_OR004_03 C20140704_OR004_03 TB451630.[MT7]-QLFVLAGAAEEGFMTAELAGVIK[MT7].3b3_1.heavy 885.155 / 533.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 833 107 C20140704_OR004_03 C20140704_OR004_03 TB428229.[MT7]-WFTDTSIILFLNK[MT7].3b6_1.heavy 629.36 / 882.411 1980.0 51.730899810791016 38 8 10 10 10 0.7086574911556104 81.77367161840755 0.0 3 0.7884909103787436 2.634678683624109 1980.0 28.462500000000002 0.0 - - - - - - - 173.66666666666666 3 3 GNAI1;GNAI2;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 835 107 C20140704_OR004_03 C20140704_OR004_03 TB428229.[MT7]-WFTDTSIILFLNK[MT7].3y3_1.heavy 629.36 / 518.342 1876.0 51.730899810791016 38 8 10 10 10 0.7086574911556104 81.77367161840755 0.0 3 0.7884909103787436 2.634678683624109 1876.0 2.2553564764713023 1.0 - - - - - - - 208.36363636363637 4 11 GNAI1;GNAI2;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 837 107 C20140704_OR004_03 C20140704_OR004_03 TB428229.[MT7]-WFTDTSIILFLNK[MT7].3b4_1.heavy 629.36 / 694.332 729.0 51.730899810791016 38 8 10 10 10 0.7086574911556104 81.77367161840755 0.0 3 0.7884909103787436 2.634678683624109 729.0 3.7145579875978147 1.0 - - - - - - - 0.0 1 0 GNAI1;GNAI2;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 839 107 C20140704_OR004_03 C20140704_OR004_03 TB428229.[MT7]-WFTDTSIILFLNK[MT7].3y4_1.heavy 629.36 / 665.41 834.0 51.730899810791016 38 8 10 10 10 0.7086574911556104 81.77367161840755 0.0 3 0.7884909103787436 2.634678683624109 834.0 4.969768197253802 0.0 - - - - - - - 0.0 1 0 GNAI1;GNAI2;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 841 108 C20140704_OR004_03 C20140704_OR004_03 TB428227.[MT7]-RLTPSASLPPAQLLLR.3y7_1.heavy 626.387 / 810.52 24492.0 38.49637413024902 42 17 10 5 10 4.064612480920086 19.08708835971135 0.04669952392578125 3 0.9790183784506108 8.505122182509504 24492.0 9.23451463790447 1.0 - - - - - - - 451.0 48 1 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 843 108 C20140704_OR004_03 C20140704_OR004_03 TB428227.[MT7]-RLTPSASLPPAQLLLR.3y6_1.heavy 626.387 / 713.467 5418.0 38.49637413024902 42 17 10 5 10 4.064612480920086 19.08708835971135 0.04669952392578125 3 0.9790183784506108 8.505122182509504 5418.0 6.729068726459587 1.0 - - - - - - - 316.0 10 5 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 845 108 C20140704_OR004_03 C20140704_OR004_03 TB428227.[MT7]-RLTPSASLPPAQLLLR.3y8_1.heavy 626.387 / 907.572 34312.0 38.49637413024902 42 17 10 5 10 4.064612480920086 19.08708835971135 0.04669952392578125 3 0.9790183784506108 8.505122182509504 34312.0 41.04653297086358 0.0 - - - - - - - 395.0 68 2 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 847 108 C20140704_OR004_03 C20140704_OR004_03 TB428227.[MT7]-RLTPSASLPPAQLLLR.3b7_1.heavy 626.387 / 857.496 12528.0 38.49637413024902 42 17 10 5 10 4.064612480920086 19.08708835971135 0.04669952392578125 3 0.9790183784506108 8.505122182509504 12528.0 8.44291021996912 0.0 - - - - - - - 1142.875 25 8 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 849 109 C20140704_OR004_03 C20140704_OR004_03 TB428226.[MT7]-RLTPSASLPPAQLLLR.4y4_1.heavy 470.042 / 514.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 851 109 C20140704_OR004_03 C20140704_OR004_03 TB428226.[MT7]-RLTPSASLPPAQLLLR.4y5_1.heavy 470.042 / 642.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 853 109 C20140704_OR004_03 C20140704_OR004_03 TB428226.[MT7]-RLTPSASLPPAQLLLR.4b7_1.heavy 470.042 / 857.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 855 109 C20140704_OR004_03 C20140704_OR004_03 TB428226.[MT7]-RLTPSASLPPAQLLLR.4y7_1.heavy 470.042 / 810.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 857 110 C20140704_OR004_03 C20140704_OR004_03 TB413714.[MT7]-GEVFNELVGK[MT7].3b6_1.heavy 460.597 / 820.396 1670.0 35.6567497253418 19 8 0 3 8 0.7416994684105099 74.48539705112294 0.0522003173828125 4 0.7936597857703817 2.668719922179515 1670.0 15.821052631578947 0.0 - - - - - - - 228.0 3 4 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 859 110 C20140704_OR004_03 C20140704_OR004_03 TB413714.[MT7]-GEVFNELVGK[MT7].3b4_1.heavy 460.597 / 577.31 3491.0 35.6567497253418 19 8 0 3 8 0.7416994684105099 74.48539705112294 0.0522003173828125 4 0.7936597857703817 2.668719922179515 3491.0 14.208057041642567 0.0 - - - - - - - 303.75 6 4 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 861 110 C20140704_OR004_03 C20140704_OR004_03 TB413714.[MT7]-GEVFNELVGK[MT7].3b5_1.heavy 460.597 / 691.353 759.0 35.6567497253418 19 8 0 3 8 0.7416994684105099 74.48539705112294 0.0522003173828125 4 0.7936597857703817 2.668719922179515 759.0 4.370683039972253 1.0 - - - - - - - 0.0 1 0 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 863 110 C20140704_OR004_03 C20140704_OR004_03 TB413714.[MT7]-GEVFNELVGK[MT7].3y4_1.heavy 460.597 / 560.389 2125.0 35.6567497253418 19 8 0 3 8 0.7416994684105099 74.48539705112294 0.0522003173828125 4 0.7936597857703817 2.668719922179515 2125.0 14.729973973395026 1.0 - - - - - - - 217.0 27 7 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 865 111 C20140704_OR004_03 C20140704_OR004_03 TB428122.[MT7]-IPVALDTIPVFQR.3b6_1.heavy 538.323 / 753.463 3387.0 45.07990074157715 43 17 10 6 10 4.922156052436225 20.316300201515332 0.03479766845703125 3 0.9744576946688809 7.705548482809277 3387.0 19.57568130236207 0.0 - - - - - - - 198.76923076923077 6 13 GANC glucosidase, alpha; neutral C 867 111 C20140704_OR004_03 C20140704_OR004_03 TB428122.[MT7]-IPVALDTIPVFQR.3b4_1.heavy 538.323 / 525.352 6685.0 45.07990074157715 43 17 10 6 10 4.922156052436225 20.316300201515332 0.03479766845703125 3 0.9744576946688809 7.705548482809277 6685.0 4.2715364398430085 0.0 - - - - - - - 200.375 13 8 GANC glucosidase, alpha; neutral C 869 111 C20140704_OR004_03 C20140704_OR004_03 TB428122.[MT7]-IPVALDTIPVFQR.3y4_1.heavy 538.323 / 549.314 2852.0 45.07990074157715 43 17 10 6 10 4.922156052436225 20.316300201515332 0.03479766845703125 3 0.9744576946688809 7.705548482809277 2852.0 1.4842853516120842 1.0 - - - - - - - 195.9 6 10 GANC glucosidase, alpha; neutral C 871 111 C20140704_OR004_03 C20140704_OR004_03 TB428122.[MT7]-IPVALDTIPVFQR.3y5_1.heavy 538.323 / 646.367 9449.0 45.07990074157715 43 17 10 6 10 4.922156052436225 20.316300201515332 0.03479766845703125 3 0.9744576946688809 7.705548482809277 9449.0 52.21839300628773 0.0 - - - - - - - 267.42857142857144 18 7 GANC glucosidase, alpha; neutral C 873 112 C20140704_OR004_03 C20140704_OR004_03 TB413712.[MT7]-VELTQEFPK[MT7].3b6_1.heavy 460.266 / 844.453 6248.0 32.9911003112793 47 17 10 10 10 2.2311037947864456 34.64912646266404 0.0 3 0.9759018125193628 7.9340358580454655 6248.0 50.6198830268605 0.0 - - - - - - - 190.4 12 5 GK2 glycerol kinase 2 875 112 C20140704_OR004_03 C20140704_OR004_03 TB413712.[MT7]-VELTQEFPK[MT7].3b4_1.heavy 460.266 / 587.352 8557.0 32.9911003112793 47 17 10 10 10 2.2311037947864456 34.64912646266404 0.0 3 0.9759018125193628 7.9340358580454655 8557.0 37.98468813787345 0.0 - - - - - - - 155.42857142857142 17 7 GK2 glycerol kinase 2 877 112 C20140704_OR004_03 C20140704_OR004_03 TB413712.[MT7]-VELTQEFPK[MT7].3b5_1.heavy 460.266 / 715.411 4075.0 32.9911003112793 47 17 10 10 10 2.2311037947864456 34.64912646266404 0.0 3 0.9759018125193628 7.9340358580454655 4075.0 3.5763668531290507 0.0 - - - - - - - 203.75 8 4 GK2 glycerol kinase 2 879 112 C20140704_OR004_03 C20140704_OR004_03 TB413712.[MT7]-VELTQEFPK[MT7].3b3_1.heavy 460.266 / 486.304 19558.0 32.9911003112793 47 17 10 10 10 2.2311037947864456 34.64912646266404 0.0 3 0.9759018125193628 7.9340358580454655 19558.0 97.80355488174652 0.0 - - - - - - - 271.6 39 5 GK2 glycerol kinase 2 881 113 C20140704_OR004_03 C20140704_OR004_03 TB428224.[MT7]-EIYTHFTC[CAM]ATDTK[MT7].3y7_1.heavy 625.645 / 940.453 15312.0 28.622299194335938 41 11 10 10 10 1.4852032625484617 45.36030237376639 0.0 3 0.8692266355865322 3.3748317916236266 15312.0 48.98212293430319 0.0 - - - - - - - 245.6875 30 16 GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 883 113 C20140704_OR004_03 C20140704_OR004_03 TB428224.[MT7]-EIYTHFTC[CAM]ATDTK[MT7].3b4_1.heavy 625.645 / 651.347 9580.0 28.622299194335938 41 11 10 10 10 1.4852032625484617 45.36030237376639 0.0 3 0.8692266355865322 3.3748317916236266 9580.0 43.70209219475332 0.0 - - - - - - - 151.30769230769232 19 13 GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 885 113 C20140704_OR004_03 C20140704_OR004_03 TB428224.[MT7]-EIYTHFTC[CAM]ATDTK[MT7].3y4_1.heavy 625.645 / 608.337 18453.0 28.622299194335938 41 11 10 10 10 1.4852032625484617 45.36030237376639 0.0 3 0.8692266355865322 3.3748317916236266 18453.0 43.13466414141414 0.0 - - - - - - - 331.44444444444446 36 9 GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 887 113 C20140704_OR004_03 C20140704_OR004_03 TB428224.[MT7]-EIYTHFTC[CAM]ATDTK[MT7].3b3_1.heavy 625.645 / 550.299 9030.0 28.622299194335938 41 11 10 10 10 1.4852032625484617 45.36030237376639 0.0 3 0.8692266355865322 3.3748317916236266 9030.0 21.089171974522294 0.0 - - - - - - - 253.84615384615384 18 13 GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 889 114 C20140704_OR004_03 C20140704_OR004_03 TB427851.[MT7]-QRVDELK[MT7].2y4_1.heavy 588.353 / 648.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - NRAP nebulin-related anchoring protein 891 114 C20140704_OR004_03 C20140704_OR004_03 TB427851.[MT7]-QRVDELK[MT7].2y3_1.heavy 588.353 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - NRAP nebulin-related anchoring protein 893 114 C20140704_OR004_03 C20140704_OR004_03 TB427851.[MT7]-QRVDELK[MT7].2y6_1.heavy 588.353 / 903.538 N/A N/A - - - - - - - - - 0.0 - - - - - - - NRAP nebulin-related anchoring protein 895 114 C20140704_OR004_03 C20140704_OR004_03 TB427851.[MT7]-QRVDELK[MT7].2b5_1.heavy 588.353 / 772.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - NRAP nebulin-related anchoring protein 897 115 C20140704_OR004_03 C20140704_OR004_03 TB427991.[MT7]-LK[MT7]VDYLIAR.3y6_1.heavy 460.294 / 750.414 443.0 34.75910186767578 39 11 10 10 8 0.9041703978849127 71.94400811239298 0.0 4 0.8618437179390318 3.281295271478776 443.0 2.499193220338983 2.0 - - - - - - - 0.0 1 0 RICTOR RPTOR independent companion of MTOR, complex 2 899 115 C20140704_OR004_03 C20140704_OR004_03 TB427991.[MT7]-LK[MT7]VDYLIAR.3y5_1.heavy 460.294 / 635.388 1918.0 34.75910186767578 39 11 10 10 8 0.9041703978849127 71.94400811239298 0.0 4 0.8618437179390318 3.281295271478776 1918.0 19.396137425561154 0.0 - - - - - - - 369.0 3 2 RICTOR RPTOR independent companion of MTOR, complex 2 901 115 C20140704_OR004_03 C20140704_OR004_03 TB427991.[MT7]-LK[MT7]VDYLIAR.3b4_1.heavy 460.294 / 744.486 N/A 34.75910186767578 39 11 10 10 8 0.9041703978849127 71.94400811239298 0.0 4 0.8618437179390318 3.281295271478776 148.0 2.0 13.0 - - - - - - - 0.0 0 0 RICTOR RPTOR independent companion of MTOR, complex 2 903 115 C20140704_OR004_03 C20140704_OR004_03 TB427991.[MT7]-LK[MT7]VDYLIAR.3y4_1.heavy 460.294 / 472.324 1770.0 34.75910186767578 39 11 10 10 8 0.9041703978849127 71.94400811239298 0.0 4 0.8618437179390318 3.281295271478776 1770.0 7.955756207674943 1.0 - - - - - - - 253.14285714285714 3 7 RICTOR RPTOR independent companion of MTOR, complex 2 905 116 C20140704_OR004_03 C20140704_OR004_03 TB427785.[MT7]-NLSEFFR.2y5_1.heavy 528.783 / 685.33 10942.0 38.66559982299805 40 18 6 10 6 5.638001107018399 17.736782611751565 0.0 5 0.9853682800175886 10.190223592583719 10942.0 62.72356135265701 0.0 - - - - - - - 164.28571428571428 21 7 PISD phosphatidylserine decarboxylase 907 116 C20140704_OR004_03 C20140704_OR004_03 TB427785.[MT7]-NLSEFFR.2b4_1.heavy 528.783 / 588.311 7832.0 38.66559982299805 40 18 6 10 6 5.638001107018399 17.736782611751565 0.0 5 0.9853682800175886 10.190223592583719 7832.0 16.975972696889272 2.0 - - - - - - - 288.125 32 8 PISD phosphatidylserine decarboxylase 909 116 C20140704_OR004_03 C20140704_OR004_03 TB427785.[MT7]-NLSEFFR.2y6_1.heavy 528.783 / 798.414 9560.0 38.66559982299805 40 18 6 10 6 5.638001107018399 17.736782611751565 0.0 5 0.9853682800175886 10.190223592583719 9560.0 68.64267403870319 0.0 - - - - - - - 243.22222222222223 19 9 PISD phosphatidylserine decarboxylase 911 116 C20140704_OR004_03 C20140704_OR004_03 TB427785.[MT7]-NLSEFFR.2b5_1.heavy 528.783 / 735.379 5644.0 38.66559982299805 40 18 6 10 6 5.638001107018399 17.736782611751565 0.0 5 0.9853682800175886 10.190223592583719 5644.0 27.698082329191376 1.0 - - - - - - - 316.75 19 4 PISD phosphatidylserine decarboxylase 913 117 C20140704_OR004_03 C20140704_OR004_03 TB427854.[MT7]-SRLSQATK[MT7].2y5_1.heavy 589.858 / 678.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 915 117 C20140704_OR004_03 C20140704_OR004_03 TB427854.[MT7]-SRLSQATK[MT7].2b4_1.heavy 589.858 / 588.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 917 117 C20140704_OR004_03 C20140704_OR004_03 TB427854.[MT7]-SRLSQATK[MT7].2y6_1.heavy 589.858 / 791.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 919 117 C20140704_OR004_03 C20140704_OR004_03 TB427854.[MT7]-SRLSQATK[MT7].2b7_1.heavy 589.858 / 888.502 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 921 118 C20140704_OR004_03 C20140704_OR004_03 TB427787.[MT7]-GGSVIPIK[MT7].2y4_1.heavy 529.844 / 614.436 3725.0 28.587499618530273 41 18 10 3 10 4.942118220411887 20.234238749486206 0.06959915161132812 3 0.9864961809565133 10.608259404009292 3725.0 11.600651129123763 0.0 - - - - - - - 288.0833333333333 7 12 GANC glucosidase, alpha; neutral C 923 118 C20140704_OR004_03 C20140704_OR004_03 TB427787.[MT7]-GGSVIPIK[MT7].2b4_1.heavy 529.844 / 445.253 6208.0 28.587499618530273 41 18 10 3 10 4.942118220411887 20.234238749486206 0.06959915161132812 3 0.9864961809565133 10.608259404009292 6208.0 16.587442376432886 0.0 - - - - - - - 259.8666666666667 12 15 GANC glucosidase, alpha; neutral C 925 118 C20140704_OR004_03 C20140704_OR004_03 TB427787.[MT7]-GGSVIPIK[MT7].2y3_1.heavy 529.844 / 501.352 12594.0 28.587499618530273 41 18 10 3 10 4.942118220411887 20.234238749486206 0.06959915161132812 3 0.9864961809565133 10.608259404009292 12594.0 27.4606015037594 0.0 - - - - - - - 659.0 25 7 GANC glucosidase, alpha; neutral C 927 118 C20140704_OR004_03 C20140704_OR004_03 TB427787.[MT7]-GGSVIPIK[MT7].2b5_1.heavy 529.844 / 558.337 4878.0 28.587499618530273 41 18 10 3 10 4.942118220411887 20.234238749486206 0.06959915161132812 3 0.9864961809565133 10.608259404009292 4878.0 33.04013368345667 0.0 - - - - - - - 214.73684210526315 9 19 GANC glucosidase, alpha; neutral C 929 119 C20140704_OR004_03 C20140704_OR004_03 TB414136.[MT7]-AAPTAVHPVRDYAAQTSPSPK[MT7].4y4_1.heavy 613.835 / 572.352 73227.0 23.239099502563477 43 13 10 10 10 1.1623656199835932 50.73301122761676 0.0 3 0.9112401238412414 4.111384637391467 73227.0 273.6933822975518 0.0 - - - - - - - 283.1 146 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 931 119 C20140704_OR004_03 C20140704_OR004_03 TB414136.[MT7]-AAPTAVHPVRDYAAQTSPSPK[MT7].4b13_2.heavy 613.835 / 747.403 11676.0 23.239099502563477 43 13 10 10 10 1.1623656199835932 50.73301122761676 0.0 3 0.9112401238412414 4.111384637391467 11676.0 48.49829754061258 0.0 - - - - - - - 202.2 23 15 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 933 119 C20140704_OR004_03 C20140704_OR004_03 TB414136.[MT7]-AAPTAVHPVRDYAAQTSPSPK[MT7].4b5_1.heavy 613.835 / 556.321 35500.0 23.239099502563477 43 13 10 10 10 1.1623656199835932 50.73301122761676 0.0 3 0.9112401238412414 4.111384637391467 35500.0 94.6822573561704 0.0 - - - - - - - 208.45454545454547 71 11 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 935 119 C20140704_OR004_03 C20140704_OR004_03 TB414136.[MT7]-AAPTAVHPVRDYAAQTSPSPK[MT7].4b6_1.heavy 613.835 / 655.39 37187.0 23.239099502563477 43 13 10 10 10 1.1623656199835932 50.73301122761676 0.0 3 0.9112401238412414 4.111384637391467 37187.0 226.02372216727116 0.0 - - - - - - - 310.2 74 15 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 937 120 C20140704_OR004_03 C20140704_OR004_03 TB451239.[MT7]-LAELAR.2b3_1.heavy 408.757 / 458.273 32932.0 27.240699768066406 48 18 10 10 10 4.8542882883260425 20.60034222534486 0.0 3 0.9839445792644161 9.726772120718733 32932.0 228.16877969295007 0.0 - - - - - - - 241.25 65 12 GLTSCR2;HAUS7 glioma tumor suppressor candidate region gene 2;HAUS augmin-like complex, subunit 7 939 120 C20140704_OR004_03 C20140704_OR004_03 TB451239.[MT7]-LAELAR.2y5_1.heavy 408.757 / 559.32 81354.0 27.240699768066406 48 18 10 10 10 4.8542882883260425 20.60034222534486 0.0 3 0.9839445792644161 9.726772120718733 81354.0 612.2484099809393 0.0 - - - - - - - 201.64285714285714 162 14 GLTSCR2;HAUS7 glioma tumor suppressor candidate region gene 2;HAUS augmin-like complex, subunit 7 941 120 C20140704_OR004_03 C20140704_OR004_03 TB451239.[MT7]-LAELAR.2b4_1.heavy 408.757 / 571.357 20121.0 27.240699768066406 48 18 10 10 10 4.8542882883260425 20.60034222534486 0.0 3 0.9839445792644161 9.726772120718733 20121.0 347.99645545314894 0.0 - - - - - - - 164.06666666666666 40 15 GLTSCR2;HAUS7 glioma tumor suppressor candidate region gene 2;HAUS augmin-like complex, subunit 7 943 120 C20140704_OR004_03 C20140704_OR004_03 TB451239.[MT7]-LAELAR.2b5_1.heavy 408.757 / 642.394 6225.0 27.240699768066406 48 18 10 10 10 4.8542882883260425 20.60034222534486 0.0 3 0.9839445792644161 9.726772120718733 6225.0 112.99147945468509 0.0 - - - - - - - 152.66666666666666 12 9 GLTSCR2;HAUS7 glioma tumor suppressor candidate region gene 2;HAUS augmin-like complex, subunit 7 945 121 C20140704_OR004_03 C20140704_OR004_03 TB428023.[MT7]-DSSPHFQAEQR.2y6_1.heavy 723.348 / 778.384 662.0 19.27245044708252 44 17 10 7 10 4.729404241711175 21.144312240862366 0.029399871826171875 3 0.9741950576701819 7.6660661317635075 662.0 12.879937069223853 0.0 - - - - - - - 0.0 1 0 SUN2 Sad1 and UNC84 domain containing 2 947 121 C20140704_OR004_03 C20140704_OR004_03 TB428023.[MT7]-DSSPHFQAEQR.2y8_1.heavy 723.348 / 1012.5 1703.0 19.27245044708252 44 17 10 7 10 4.729404241711175 21.144312240862366 0.029399871826171875 3 0.9741950576701819 7.6660661317635075 1703.0 28.682105263157894 0.0 - - - - - - - 88.75 3 8 SUN2 Sad1 and UNC84 domain containing 2 949 121 C20140704_OR004_03 C20140704_OR004_03 TB428023.[MT7]-DSSPHFQAEQR.2y10_1.heavy 723.348 / 1186.56 379.0 19.27245044708252 44 17 10 7 10 4.729404241711175 21.144312240862366 0.029399871826171875 3 0.9741950576701819 7.6660661317635075 379.0 3.2255319148936166 0.0 - - - - - - - 0.0 0 0 SUN2 Sad1 and UNC84 domain containing 2 951 121 C20140704_OR004_03 C20140704_OR004_03 TB428023.[MT7]-DSSPHFQAEQR.2y5_1.heavy 723.348 / 631.316 426.0 19.27245044708252 44 17 10 7 10 4.729404241711175 21.144312240862366 0.029399871826171875 3 0.9741950576701819 7.6660661317635075 426.0 1.0127659574468082 1.0 - - - - - - - 0.0 0 0 SUN2 Sad1 and UNC84 domain containing 2 953 122 C20140704_OR004_03 C20140704_OR004_03 TB427999.[MT7]-VLFLLSGLGGLR.2y8_1.heavy 694.941 / 772.468 19649.0 52.375301361083984 45 15 10 10 10 1.7214463054263391 38.92271111046212 0.0 3 0.9584233389637594 6.0314433500231965 19649.0 232.65863412563667 0.0 - - - - - - - 180.0 39 6 ADAM2 ADAM metallopeptidase domain 2 955 122 C20140704_OR004_03 C20140704_OR004_03 TB427999.[MT7]-VLFLLSGLGGLR.2y9_1.heavy 694.941 / 885.552 13460.0 52.375301361083984 45 15 10 10 10 1.7214463054263391 38.92271111046212 0.0 3 0.9584233389637594 6.0314433500231965 13460.0 173.36908336215842 0.0 - - - - - - - 176.8 26 5 ADAM2 ADAM metallopeptidase domain 2 957 122 C20140704_OR004_03 C20140704_OR004_03 TB427999.[MT7]-VLFLLSGLGGLR.2y10_1.heavy 694.941 / 1032.62 22892.0 52.375301361083984 45 15 10 10 10 1.7214463054263391 38.92271111046212 0.0 3 0.9584233389637594 6.0314433500231965 22892.0 85.25597619632157 0.0 - - - - - - - 275.0 45 10 ADAM2 ADAM metallopeptidase domain 2 959 122 C20140704_OR004_03 C20140704_OR004_03 TB427999.[MT7]-VLFLLSGLGGLR.2y11_1.heavy 694.941 / 1145.7 14442.0 52.375301361083984 45 15 10 10 10 1.7214463054263391 38.92271111046212 0.0 3 0.9584233389637594 6.0314433500231965 14442.0 58.785404185722165 1.0 - - - - - - - 208.5 35 8 ADAM2 ADAM metallopeptidase domain 2 961 123 C20140704_OR004_03 C20140704_OR004_03 TB427995.[MT7]-ASPGTPLSPGSLR.2y8_1.heavy 692.389 / 826.478 3110.0 28.656999588012695 42 18 6 10 8 5.090153403104783 19.645773335437028 0.0 4 0.9890336164482515 11.774242251877398 3110.0 18.493392857142858 1.0 - - - - - - - 144.0 6 7 SLCO4A1 solute carrier organic anion transporter family, member 4A1 963 123 C20140704_OR004_03 C20140704_OR004_03 TB427995.[MT7]-ASPGTPLSPGSLR.2y12_1.heavy 692.389 / 1168.63 1429.0 28.656999588012695 42 18 6 10 8 5.090153403104783 19.645773335437028 0.0 4 0.9890336164482515 11.774242251877398 1429.0 13.893055555555556 2.0 - - - - - - - 156.0 3 14 SLCO4A1 solute carrier organic anion transporter family, member 4A1 965 123 C20140704_OR004_03 C20140704_OR004_03 TB427995.[MT7]-ASPGTPLSPGSLR.2y5_1.heavy 692.389 / 529.309 841.0 28.656999588012695 42 18 6 10 8 5.090153403104783 19.645773335437028 0.0 4 0.9890336164482515 11.774242251877398 841.0 0.572108843537415 6.0 - - - - - - - 693.625 14 8 SLCO4A1 solute carrier organic anion transporter family, member 4A1 967 123 C20140704_OR004_03 C20140704_OR004_03 TB427995.[MT7]-ASPGTPLSPGSLR.2y11_1.heavy 692.389 / 1081.6 3026.0 28.656999588012695 42 18 6 10 8 5.090153403104783 19.645773335437028 0.0 4 0.9890336164482515 11.774242251877398 3026.0 11.047301587301588 1.0 - - - - - - - 168.0 8 11 SLCO4A1 solute carrier organic anion transporter family, member 4A1 969 124 C20140704_OR004_03 C20140704_OR004_03 TB413800.[MT7]-SEWQSMTQESFQESSVK[MT7].3y6_1.heavy 769.366 / 821.448 1599.0 35.106300354003906 44 14 10 10 10 1.4655807290918184 42.04547621624435 0.0 3 0.9476118956959517 5.368235525349795 1599.0 13.003456807678635 0.0 - - - - - - - 218.0 3 2 SUN2 Sad1 and UNC84 domain containing 2 971 124 C20140704_OR004_03 C20140704_OR004_03 TB413800.[MT7]-SEWQSMTQESFQESSVK[MT7].3b4_1.heavy 769.366 / 675.322 7850.0 35.106300354003906 44 14 10 10 10 1.4655807290918184 42.04547621624435 0.0 3 0.9476118956959517 5.368235525349795 7850.0 81.05973812063041 0.0 - - - - - - - 290.5 15 2 SUN2 Sad1 and UNC84 domain containing 2 973 124 C20140704_OR004_03 C20140704_OR004_03 TB413800.[MT7]-SEWQSMTQESFQESSVK[MT7].3y4_1.heavy 769.366 / 564.347 10903.0 35.106300354003906 44 14 10 10 10 1.4655807290918184 42.04547621624435 0.0 3 0.9476118956959517 5.368235525349795 10903.0 25.050565381169314 0.0 - - - - - - - 232.4 21 10 SUN2 Sad1 and UNC84 domain containing 2 975 124 C20140704_OR004_03 C20140704_OR004_03 TB413800.[MT7]-SEWQSMTQESFQESSVK[MT7].3y5_1.heavy 769.366 / 693.39 5088.0 35.106300354003906 44 14 10 10 10 1.4655807290918184 42.04547621624435 0.0 3 0.9476118956959517 5.368235525349795 5088.0 40.45129009807023 0.0 - - - - - - - 254.25 10 4 SUN2 Sad1 and UNC84 domain containing 2 977 125 C20140704_OR004_03 C20140704_OR004_03 TB428413.[MT7]-EVGTSYGC[CAM]YFVPAFSGLYAPYWEPSAR.3b8_1.heavy 1073.51 / 998.437 1595.0 50.3046989440918 46 16 10 10 10 1.864165708665505 42.3301629405511 0.0 3 0.9603235526230555 6.1751780073682125 1595.0 1.7497062279670974 0.0 - - - - - - - 243.0 3 7 GK;GK2 glycerol kinase;glycerol kinase 2 979 125 C20140704_OR004_03 C20140704_OR004_03 TB428413.[MT7]-EVGTSYGC[CAM]YFVPAFSGLYAPYWEPSAR.3y8_1.heavy 1073.51 / 1005.48 5104.0 50.3046989440918 46 16 10 10 10 1.864165708665505 42.3301629405511 0.0 3 0.9603235526230555 6.1751780073682125 5104.0 70.43375321109045 0.0 - - - - - - - 191.2 10 5 GK;GK2 glycerol kinase;glycerol kinase 2 981 125 C20140704_OR004_03 C20140704_OR004_03 TB428413.[MT7]-EVGTSYGC[CAM]YFVPAFSGLYAPYWEPSAR.3y10_1.heavy 1073.51 / 1239.58 1595.0 50.3046989440918 46 16 10 10 10 1.864165708665505 42.3301629405511 0.0 3 0.9603235526230555 6.1751780073682125 1595.0 12.330774647887324 0.0 - - - - - - - 194.83333333333334 3 6 GK;GK2 glycerol kinase;glycerol kinase 2 983 125 C20140704_OR004_03 C20140704_OR004_03 TB428413.[MT7]-EVGTSYGC[CAM]YFVPAFSGLYAPYWEPSAR.3y9_1.heavy 1073.51 / 1076.52 3828.0 50.3046989440918 46 16 10 10 10 1.864165708665505 42.3301629405511 0.0 3 0.9603235526230555 6.1751780073682125 3828.0 14.138067893738143 0.0 - - - - - - - 334.14285714285717 7 7 GK;GK2 glycerol kinase;glycerol kinase 2 985 126 C20140704_OR004_03 C20140704_OR004_03 TB428117.[MT7]-K[MT7]ADVSLYNEK[MT7].2y4_1.heavy 799.959 / 697.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 987 126 C20140704_OR004_03 C20140704_OR004_03 TB428117.[MT7]-K[MT7]ADVSLYNEK[MT7].2b3_1.heavy 799.959 / 603.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 989 126 C20140704_OR004_03 C20140704_OR004_03 TB428117.[MT7]-K[MT7]ADVSLYNEK[MT7].2b4_1.heavy 799.959 / 702.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 991 126 C20140704_OR004_03 C20140704_OR004_03 TB428117.[MT7]-K[MT7]ADVSLYNEK[MT7].2y6_1.heavy 799.959 / 897.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 993 127 C20140704_OR004_03 C20140704_OR004_03 TB428212.[MT7]-IIHEAGYSEEEC[CAM]K[MT7].3b6_1.heavy 618.305 / 765.438 11384.0 23.871400833129883 50 20 10 10 10 23.882746829669298 4.187123060558972 0.0 3 0.9920333016435319 13.817657908453235 11384.0 60.774863999411096 0.0 - - - - - - - 247.0 22 9 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 995 127 C20140704_OR004_03 C20140704_OR004_03 TB428212.[MT7]-IIHEAGYSEEEC[CAM]K[MT7].3y3_1.heavy 618.305 / 580.288 21219.0 23.871400833129883 50 20 10 10 10 23.882746829669298 4.187123060558972 0.0 3 0.9920333016435319 13.817657908453235 21219.0 60.89778814231571 0.0 - - - - - - - 244.9090909090909 42 11 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 997 127 C20140704_OR004_03 C20140704_OR004_03 TB428212.[MT7]-IIHEAGYSEEEC[CAM]K[MT7].3y6_1.heavy 618.305 / 925.405 24790.0 23.871400833129883 50 20 10 10 10 23.882746829669298 4.187123060558972 0.0 3 0.9920333016435319 13.817657908453235 24790.0 684.5 0.0 - - - - - - - 134.71428571428572 49 7 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 999 127 C20140704_OR004_03 C20140704_OR004_03 TB428212.[MT7]-IIHEAGYSEEEC[CAM]K[MT7].3y4_1.heavy 618.305 / 709.331 23644.0 23.871400833129883 50 20 10 10 10 23.882746829669298 4.187123060558972 0.0 3 0.9920333016435319 13.817657908453235 23644.0 212.05468646864685 0.0 - - - - - - - 222.2 47 10 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1001 128 C20140704_OR004_03 C20140704_OR004_03 TB413483.[MT7]-GLQEHQR.2b3_1.heavy 506.276 / 443.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPV17 MpV17 mitochondrial inner membrane protein 1003 128 C20140704_OR004_03 C20140704_OR004_03 TB413483.[MT7]-GLQEHQR.2y4_1.heavy 506.276 / 569.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPV17 MpV17 mitochondrial inner membrane protein 1005 128 C20140704_OR004_03 C20140704_OR004_03 TB413483.[MT7]-GLQEHQR.2b4_1.heavy 506.276 / 572.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPV17 MpV17 mitochondrial inner membrane protein 1007 128 C20140704_OR004_03 C20140704_OR004_03 TB413483.[MT7]-GLQEHQR.2y6_1.heavy 506.276 / 810.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPV17 MpV17 mitochondrial inner membrane protein 1009 129 C20140704_OR004_03 C20140704_OR004_03 TB428418.[MT7]-AQNVTLEAILQNATSDNPVVQLSAVQAARK[MT7].3b4_1.heavy 1146.64 / 557.316 2194.0 48.51639938354492 41 16 10 5 10 4.969081949198079 20.12444170218167 0.04740142822265625 3 0.9669295396367807 6.767652740736087 2194.0 5.617377239394783 0.0 - - - - - - - 232.66666666666666 4 3 KPNA3 karyopherin alpha 3 (importin alpha 4) 1011 129 C20140704_OR004_03 C20140704_OR004_03 TB428418.[MT7]-AQNVTLEAILQNATSDNPVVQLSAVQAARK[MT7].3b8_1.heavy 1146.64 / 971.528 3191.0 48.51639938354492 41 16 10 5 10 4.969081949198079 20.12444170218167 0.04740142822265625 3 0.9669295396367807 6.767652740736087 3191.0 3.040170637224958 0.0 - - - - - - - 288.1111111111111 6 9 KPNA3 karyopherin alpha 3 (importin alpha 4) 1013 129 C20140704_OR004_03 C20140704_OR004_03 TB428418.[MT7]-AQNVTLEAILQNATSDNPVVQLSAVQAARK[MT7].3b7_1.heavy 1146.64 / 900.491 997.0 48.51639938354492 41 16 10 5 10 4.969081949198079 20.12444170218167 0.04740142822265625 3 0.9669295396367807 6.767652740736087 997.0 2.534545532886658 1.0 - - - - - - - 0.0 1 0 KPNA3 karyopherin alpha 3 (importin alpha 4) 1015 129 C20140704_OR004_03 C20140704_OR004_03 TB428418.[MT7]-AQNVTLEAILQNATSDNPVVQLSAVQAARK[MT7].3y10_1.heavy 1146.64 / 1215.73 1496.0 48.51639938354492 41 16 10 5 10 4.969081949198079 20.12444170218167 0.04740142822265625 3 0.9669295396367807 6.767652740736087 1496.0 17.736036090225564 0.0 - - - - - - - 174.625 2 8 KPNA3 karyopherin alpha 3 (importin alpha 4) 1017 130 C20140704_OR004_03 C20140704_OR004_03 TB413807.[MT7]-AHGGYSVFAGVGER.3y7_1.heavy 517.599 / 735.378 27404.0 29.86639976501465 50 20 10 10 10 9.698978444947787 10.310364186043753 0.0 3 0.9948935002226424 17.26297841276296 27404.0 108.4993265231462 0.0 - - - - - - - 144.57142857142858 54 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1019 130 C20140704_OR004_03 C20140704_OR004_03 TB413807.[MT7]-AHGGYSVFAGVGER.3b6_1.heavy 517.599 / 717.344 3862.0 29.86639976501465 50 20 10 10 10 9.698978444947787 10.310364186043753 0.0 3 0.9948935002226424 17.26297841276296 3862.0 10.70445652173913 1.0 - - - - - - - 261.84615384615387 9 13 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1021 130 C20140704_OR004_03 C20140704_OR004_03 TB413807.[MT7]-AHGGYSVFAGVGER.3y6_1.heavy 517.599 / 588.31 27128.0 29.86639976501465 50 20 10 10 10 9.698978444947787 10.310364186043753 0.0 3 0.9948935002226424 17.26297841276296 27128.0 14.021554148604618 0.0 - - - - - - - 184.0 54 4 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1023 130 C20140704_OR004_03 C20140704_OR004_03 TB413807.[MT7]-AHGGYSVFAGVGER.3b5_1.heavy 517.599 / 630.312 8276.0 29.86639976501465 50 20 10 10 10 9.698978444947787 10.310364186043753 0.0 3 0.9948935002226424 17.26297841276296 8276.0 24.93794685990338 0.0 - - - - - - - 289.14285714285717 16 14 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1025 131 C20140704_OR004_03 C20140704_OR004_03 TB428415.[MT7]-QFAPIHAEAPEFMEMSVEQEILVTGIK[MT7].4y4_1.heavy 833.934 / 562.368 17911.0 47.630699157714844 41 11 10 10 10 2.4240757417834606 41.25283640123686 0.0 3 0.8704745378452114 3.391420539896468 17911.0 65.29765693013874 0.0 - - - - - - - 331.8 35 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1027 131 C20140704_OR004_03 C20140704_OR004_03 TB428415.[MT7]-QFAPIHAEAPEFMEMSVEQEILVTGIK[MT7].4b12_2.heavy 833.934 / 741.878 6444.0 47.630699157714844 41 11 10 10 10 2.4240757417834606 41.25283640123686 0.0 3 0.8704745378452114 3.391420539896468 6444.0 14.967963800904975 0.0 - - - - - - - 242.22222222222223 12 9 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1029 131 C20140704_OR004_03 C20140704_OR004_03 TB428415.[MT7]-QFAPIHAEAPEFMEMSVEQEILVTGIK[MT7].4b5_1.heavy 833.934 / 701.41 4075.0 47.630699157714844 41 11 10 10 10 2.4240757417834606 41.25283640123686 0.0 3 0.8704745378452114 3.391420539896468 4075.0 21.802287338808576 0.0 - - - - - - - 231.66666666666666 8 9 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1031 131 C20140704_OR004_03 C20140704_OR004_03 TB428415.[MT7]-QFAPIHAEAPEFMEMSVEQEILVTGIK[MT7].4b9_1.heavy 833.934 / 1109.59 5496.0 47.630699157714844 41 11 10 10 10 2.4240757417834606 41.25283640123686 0.0 3 0.8704745378452114 3.391420539896468 5496.0 28.455816028116455 1.0 - - - - - - - 162.71428571428572 12 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1033 132 C20140704_OR004_03 C20140704_OR004_03 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 228577.0 37.688899993896484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 228577.0 108.66992364487092 0.0 - - - - - - - 277.6666666666667 457 3 1035 132 C20140704_OR004_03 C20140704_OR004_03 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 595462.0 37.688899993896484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 595462.0 228.35992012834805 0.0 - - - - - - - 357.0 1190 2 1037 132 C20140704_OR004_03 C20140704_OR004_03 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 584807.0 37.688899993896484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 584807.0 229.3519318608453 0.0 - - - - - - - 784.8 1169 5 1039 133 C20140704_OR004_03 C20140704_OR004_03 TB413708.[MT7]-EGWVEQDPK[MT7].2b3_1.heavy 688.358 / 517.253 1069.0 26.205699920654297 36 12 10 6 8 1.802933284902541 49.29810674471246 0.03079986572265625 4 0.8950638563006013 3.7759549396429604 1069.0 0.0 1.0 - - - - - - - 270.6 2 10 GK;GK2 glycerol kinase;glycerol kinase 2 1041 133 C20140704_OR004_03 C20140704_OR004_03 TB413708.[MT7]-EGWVEQDPK[MT7].2b4_1.heavy 688.358 / 616.321 1211.0 26.205699920654297 36 12 10 6 8 1.802933284902541 49.29810674471246 0.03079986572265625 4 0.8950638563006013 3.7759549396429604 1211.0 1.1766822016038536 3.0 - - - - - - - 237.33333333333334 2 15 GK;GK2 glycerol kinase;glycerol kinase 2 1043 133 C20140704_OR004_03 C20140704_OR004_03 TB413708.[MT7]-EGWVEQDPK[MT7].2b7_1.heavy 688.358 / 988.449 6411.0 26.205699920654297 36 12 10 6 8 1.802933284902541 49.29810674471246 0.03079986572265625 4 0.8950638563006013 3.7759549396429604 6411.0 70.35137896538107 0.0 - - - - - - - 168.1818181818182 12 11 GK;GK2 glycerol kinase;glycerol kinase 2 1045 133 C20140704_OR004_03 C20140704_OR004_03 TB413708.[MT7]-EGWVEQDPK[MT7].2b5_1.heavy 688.358 / 745.364 570.0 26.205699920654297 36 12 10 6 8 1.802933284902541 49.29810674471246 0.03079986572265625 4 0.8950638563006013 3.7759549396429604 570.0 0.0 2.0 - - - - - - - 0.0 1 0 GK;GK2 glycerol kinase;glycerol kinase 2 1047 134 C20140704_OR004_03 C20140704_OR004_03 TB413704.[MT7]-LYNLDVYGYQIYDK[MT7].3b6_1.heavy 685.694 / 862.479 5863.0 41.585875511169434 34 13 10 3 8 1.3090569042061853 50.388315641555934 0.07229995727539062 4 0.9042547312859983 3.956180427965969 5863.0 14.502252886431528 0.0 - - - - - - - 258.45454545454544 11 11 GANC glucosidase, alpha; neutral C 1049 134 C20140704_OR004_03 C20140704_OR004_03 TB413704.[MT7]-LYNLDVYGYQIYDK[MT7].3y3_1.heavy 685.694 / 569.305 10126.0 41.585875511169434 34 13 10 3 8 1.3090569042061853 50.388315641555934 0.07229995727539062 4 0.9042547312859983 3.956180427965969 10126.0 42.113609681274525 1.0 - - - - - - - 688.5 20 8 GANC glucosidase, alpha; neutral C 1051 134 C20140704_OR004_03 C20140704_OR004_03 TB413704.[MT7]-LYNLDVYGYQIYDK[MT7].3b5_1.heavy 685.694 / 763.411 7995.0 41.585875511169434 34 13 10 3 8 1.3090569042061853 50.388315641555934 0.07229995727539062 4 0.9042547312859983 3.956180427965969 7995.0 12.60472972972973 1.0 - - - - - - - 194.375 18 16 GANC glucosidase, alpha; neutral C 1053 134 C20140704_OR004_03 C20140704_OR004_03 TB413704.[MT7]-LYNLDVYGYQIYDK[MT7].3b3_1.heavy 685.694 / 535.3 2310.0 41.585875511169434 34 13 10 3 8 1.3090569042061853 50.388315641555934 0.07229995727539062 4 0.9042547312859983 3.956180427965969 2310.0 8.94864864864865 0.0 - - - - - - - 284.2 4 20 GANC glucosidase, alpha; neutral C 1055 135 C20140704_OR004_03 C20140704_OR004_03 TB413703.[MT7]-ELDPDSSMGK[MT7].3y3_1.heavy 456.23 / 479.277 3556.0 25.08387517929077 44 18 10 6 10 6.593743943978872 15.165890706343818 0.03569984436035156 3 0.9890005270257376 11.756486293306116 3556.0 8.015573770491804 0.0 - - - - - - - 262.6923076923077 7 13 SH3BP1 SH3-domain binding protein 1 1057 135 C20140704_OR004_03 C20140704_OR004_03 TB413703.[MT7]-ELDPDSSMGK[MT7].3b5_1.heavy 456.23 / 714.343 1255.0 25.08387517929077 44 18 10 6 10 6.593743943978872 15.165890706343818 0.03569984436035156 3 0.9890005270257376 11.756486293306116 1255.0 6.844378419166196 0.0 - - - - - - - 199.28571428571428 2 7 SH3BP1 SH3-domain binding protein 1 1059 135 C20140704_OR004_03 C20140704_OR004_03 TB413703.[MT7]-ELDPDSSMGK[MT7].3y4_1.heavy 456.23 / 566.309 1395.0 25.08387517929077 44 18 10 6 10 6.593743943978872 15.165890706343818 0.03569984436035156 3 0.9890005270257376 11.756486293306116 1395.0 6.697707736389685 0.0 - - - - - - - 214.53846153846155 2 13 SH3BP1 SH3-domain binding protein 1 1061 135 C20140704_OR004_03 C20140704_OR004_03 TB413703.[MT7]-ELDPDSSMGK[MT7].3b3_1.heavy 456.23 / 502.263 8716.0 25.08387517929077 44 18 10 6 10 6.593743943978872 15.165890706343818 0.03569984436035156 3 0.9890005270257376 11.756486293306116 8716.0 40.443382263140585 0.0 - - - - - - - 284.8333333333333 17 12 SH3BP1 SH3-domain binding protein 1 1063 136 C20140704_OR004_03 C20140704_OR004_03 TB413700.[MT7]-LVSDWNTLK[MT7].2y8_1.heavy 682.395 / 1106.6 4867.0 36.12409973144531 50 20 10 10 10 7.405058253371302 13.504282691425551 0.0 3 0.993692014386143 15.530608233768142 4867.0 19.532039473684208 0.0 - - - - - - - 236.44444444444446 9 9 SH3BP1 SH3-domain binding protein 1 1065 136 C20140704_OR004_03 C20140704_OR004_03 TB413700.[MT7]-LVSDWNTLK[MT7].2y5_1.heavy 682.395 / 805.469 5931.0 36.12409973144531 50 20 10 10 10 7.405058253371302 13.504282691425551 0.0 3 0.993692014386143 15.530608233768142 5931.0 16.193190789473682 0.0 - - - - - - - 334.4 11 10 SH3BP1 SH3-domain binding protein 1 1067 136 C20140704_OR004_03 C20140704_OR004_03 TB413700.[MT7]-LVSDWNTLK[MT7].2b4_1.heavy 682.395 / 559.321 7756.0 36.12409973144531 50 20 10 10 10 7.405058253371302 13.504282691425551 0.0 3 0.993692014386143 15.530608233768142 7756.0 20.665657894736846 1.0 - - - - - - - 304.0 15 3 SH3BP1 SH3-domain binding protein 1 1069 136 C20140704_OR004_03 C20140704_OR004_03 TB413700.[MT7]-LVSDWNTLK[MT7].2y7_1.heavy 682.395 / 1007.53 7756.0 36.12409973144531 50 20 10 10 10 7.405058253371302 13.504282691425551 0.0 3 0.993692014386143 15.530608233768142 7756.0 55.108421052631584 0.0 - - - - - - - 304.0 15 4 SH3BP1 SH3-domain binding protein 1 1071 137 C20140704_OR004_03 C20140704_OR004_03 TB414140.[MT7]-MTPSNIAIVLGPNLLWPPEK[MT7].4y4_1.heavy 620.356 / 614.363 10803.0 50.37032413482666 36 13 10 3 10 2.7466405570797314 36.40811308281323 0.051700592041015625 3 0.9225562834862036 4.405810661178128 10803.0 73.45030373831776 0.0 - - - - - - - 200.625 21 8 SH3BP1 SH3-domain binding protein 1 1073 137 C20140704_OR004_03 C20140704_OR004_03 TB414140.[MT7]-MTPSNIAIVLGPNLLWPPEK[MT7].4b7_1.heavy 620.356 / 859.446 2246.0 50.37032413482666 36 13 10 3 10 2.7466405570797314 36.40811308281323 0.051700592041015625 3 0.9225562834862036 4.405810661178128 2246.0 10.990507432310103 0.0 - - - - - - - 321.0 4 2 SH3BP1 SH3-domain binding protein 1 1075 137 C20140704_OR004_03 C20140704_OR004_03 TB414140.[MT7]-MTPSNIAIVLGPNLLWPPEK[MT7].4b5_1.heavy 620.356 / 675.325 3423.0 50.37032413482666 36 13 10 3 10 2.7466405570797314 36.40811308281323 0.051700592041015625 3 0.9225562834862036 4.405810661178128 3423.0 11.74153950722175 0.0 - - - - - - - 256.8 6 5 SH3BP1 SH3-domain binding protein 1 1077 137 C20140704_OR004_03 C20140704_OR004_03 TB414140.[MT7]-MTPSNIAIVLGPNLLWPPEK[MT7].4y3_1.heavy 620.356 / 517.31 3209.0 50.37032413482666 36 13 10 3 10 2.7466405570797314 36.40811308281323 0.051700592041015625 3 0.9225562834862036 4.405810661178128 3209.0 5.798130841121496 1.0 - - - - - - - 175.0909090909091 6 11 SH3BP1 SH3-domain binding protein 1 1079 138 C20140704_OR004_03 C20140704_OR004_03 TB427844.[MT7]-LALLNEAK[MT7].2y4_1.heavy 580.368 / 605.338 6819.0 34.25400161743164 48 18 10 10 10 3.9909379992182914 20.0208908031523 0.0 3 0.9893301206670571 11.937013976553594 6819.0 21.001082443346267 0.0 - - - - - - - 296.3 13 10 RICTOR RPTOR independent companion of MTOR, complex 2 1081 138 C20140704_OR004_03 C20140704_OR004_03 TB427844.[MT7]-LALLNEAK[MT7].2y5_1.heavy 580.368 / 718.422 6226.0 34.25400161743164 48 18 10 10 10 3.9909379992182914 20.0208908031523 0.0 3 0.9893301206670571 11.937013976553594 6226.0 26.303101123595507 0.0 - - - - - - - 326.0 12 10 RICTOR RPTOR independent companion of MTOR, complex 2 1083 138 C20140704_OR004_03 C20140704_OR004_03 TB427844.[MT7]-LALLNEAK[MT7].2y6_1.heavy 580.368 / 831.506 4299.0 34.25400161743164 48 18 10 10 10 3.9909379992182914 20.0208908031523 0.0 3 0.9893301206670571 11.937013976553594 4299.0 11.862110451898328 0.0 - - - - - - - 326.0 8 5 RICTOR RPTOR independent companion of MTOR, complex 2 1085 138 C20140704_OR004_03 C20140704_OR004_03 TB427844.[MT7]-LALLNEAK[MT7].2y7_1.heavy 580.368 / 902.543 6374.0 34.25400161743164 48 18 10 10 10 3.9909379992182914 20.0208908031523 0.0 3 0.9893301206670571 11.937013976553594 6374.0 27.591498554913294 0.0 - - - - - - - 269.27272727272725 12 11 RICTOR RPTOR independent companion of MTOR, complex 2 1087 139 C20140704_OR004_03 C20140704_OR004_03 TB427796.[MT7]-DVLQPLSR.2y6_1.heavy 536.318 / 713.43 5102.0 30.14889971415202 37 20 10 6 1 54.273827258792515 1.842508720145578 0.036899566650390625 20 0.9996232281860039 63.57839056924174 5102.0 4.37671568627451 1.0 - - - - - - - 641.1428571428571 10 7 SH3BP1 SH3-domain binding protein 1 1089 139 C20140704_OR004_03 C20140704_OR004_03 TB427796.[MT7]-DVLQPLSR.2y3_1.heavy 536.318 / 375.235 510.0 30.14889971415202 37 20 10 6 1 54.273827258792515 1.842508720145578 0.036899566650390625 20 0.9996232281860039 63.57839056924174 510.0 1.0 29.0 - - - - - - - 238.0 3 9 SH3BP1 SH3-domain binding protein 1 1091 139 C20140704_OR004_03 C20140704_OR004_03 TB427796.[MT7]-DVLQPLSR.2y7_1.heavy 536.318 / 812.499 6428.0 30.14889971415202 37 20 10 6 1 54.273827258792515 1.842508720145578 0.036899566650390625 20 0.9996232281860039 63.57839056924174 6428.0 60.18372549019608 0.0 - - - - - - - 188.30769230769232 12 13 SH3BP1 SH3-domain binding protein 1 1093 140 C20140704_OR004_03 C20140704_OR004_03 TB414145.[MT7]-TLTMVSLGC[CAM]GFVGPVVGGWYK[MT7].3b4_1.heavy 839.448 / 591.329 2337.0 48.6338996887207 47 17 10 10 10 3.654356897224249 21.852294825679046 0.0 3 0.9780040336832736 8.305992916923135 2337.0 25.58630731820287 0.0 - - - - - - - 218.0 4 7 MPV17 MpV17 mitochondrial inner membrane protein 1095 140 C20140704_OR004_03 C20140704_OR004_03 TB414145.[MT7]-TLTMVSLGC[CAM]GFVGPVVGGWYK[MT7].3b5_1.heavy 839.448 / 690.398 1524.0 48.6338996887207 47 17 10 10 10 3.654356897224249 21.852294825679046 0.0 3 0.9780040336832736 8.305992916923135 1524.0 2.659576379974326 2.0 - - - - - - - 135.66666666666666 4 3 MPV17 MpV17 mitochondrial inner membrane protein 1097 140 C20140704_OR004_03 C20140704_OR004_03 TB414145.[MT7]-TLTMVSLGC[CAM]GFVGPVVGGWYK[MT7].3y5_1.heavy 839.448 / 754.4 3049.0 48.6338996887207 47 17 10 10 10 3.654356897224249 21.852294825679046 0.0 3 0.9780040336832736 8.305992916923135 3049.0 9.349942698846387 0.0 - - - - - - - 203.375 6 8 MPV17 MpV17 mitochondrial inner membrane protein 1099 140 C20140704_OR004_03 C20140704_OR004_03 TB414145.[MT7]-TLTMVSLGC[CAM]GFVGPVVGGWYK[MT7].3y9_1.heavy 839.448 / 1106.61 2744.0 48.6338996887207 47 17 10 10 10 3.654356897224249 21.852294825679046 0.0 3 0.9780040336832736 8.305992916923135 2744.0 27.99393066931414 0.0 - - - - - - - 180.77777777777777 5 9 MPV17 MpV17 mitochondrial inner membrane protein 1101 141 C20140704_OR004_03 C20140704_OR004_03 TB428011.[MT7]-LVVISDPHIK[MT7].3b6_1.heavy 470.297 / 771.473 2354.0 32.13159942626953 46 16 10 10 10 2.0808013022380787 36.669765263051545 0.0 3 0.9651225753512199 6.589003822888674 2354.0 24.55247311827957 0.0 - - - - - - - 223.2 4 5 GANC glucosidase, alpha; neutral C 1103 141 C20140704_OR004_03 C20140704_OR004_03 TB428011.[MT7]-LVVISDPHIK[MT7].3y3_1.heavy 470.297 / 541.358 7928.0 32.13159942626953 46 16 10 10 10 2.0808013022380787 36.669765263051545 0.0 3 0.9651225753512199 6.589003822888674 7928.0 59.68459167281727 0.0 - - - - - - - 279.0 15 8 GANC glucosidase, alpha; neutral C 1105 141 C20140704_OR004_03 C20140704_OR004_03 TB428011.[MT7]-LVVISDPHIK[MT7].3b3_1.heavy 470.297 / 456.33 17962.0 32.13159942626953 46 16 10 10 10 2.0808013022380787 36.669765263051545 0.0 3 0.9651225753512199 6.589003822888674 17962.0 44.22487431577829 1.0 - - - - - - - 354.2857142857143 36 7 GANC glucosidase, alpha; neutral C 1107 141 C20140704_OR004_03 C20140704_OR004_03 TB428011.[MT7]-LVVISDPHIK[MT7].3y4_1.heavy 470.297 / 638.411 3469.0 32.13159942626953 46 16 10 10 10 2.0808013022380787 36.669765263051545 0.0 3 0.9651225753512199 6.589003822888674 3469.0 35.436021505376345 0.0 - - - - - - - 201.5 6 8 GANC glucosidase, alpha; neutral C 1109 142 C20140704_OR004_03 C20140704_OR004_03 TB427989.[MT7]-VELTQEFPK[MT7].2b6_1.heavy 689.895 / 844.453 8834.0 32.9911003112793 50 20 10 10 10 11.316949276957416 8.836303632076117 0.0 3 0.9956304640803072 18.663214487911212 8834.0 40.7056862745098 0.0 - - - - - - - 330.2857142857143 17 7 GK2 glycerol kinase 2 1111 142 C20140704_OR004_03 C20140704_OR004_03 TB427989.[MT7]-VELTQEFPK[MT7].2y3_1.heavy 689.895 / 535.336 9650.0 32.9911003112793 50 20 10 10 10 11.316949276957416 8.836303632076117 0.0 3 0.9956304640803072 18.663214487911212 9650.0 72.59272334761718 1.0 - - - - - - - 294.6666666666667 19 6 GK2 glycerol kinase 2 1113 142 C20140704_OR004_03 C20140704_OR004_03 TB427989.[MT7]-VELTQEFPK[MT7].2y6_1.heavy 689.895 / 893.485 6524.0 32.9911003112793 50 20 10 10 10 11.316949276957416 8.836303632076117 0.0 3 0.9956304640803072 18.663214487911212 6524.0 59.91526470588235 0.0 - - - - - - - 204.0 13 4 GK2 glycerol kinase 2 1115 142 C20140704_OR004_03 C20140704_OR004_03 TB427989.[MT7]-VELTQEFPK[MT7].2b5_1.heavy 689.895 / 715.411 4349.0 32.9911003112793 50 20 10 10 10 11.316949276957416 8.836303632076117 0.0 3 0.9956304640803072 18.663214487911212 4349.0 15.535025051029876 0.0 - - - - - - - 249.33333333333334 8 6 GK2 glycerol kinase 2 1117 143 C20140704_OR004_03 C20140704_OR004_03 TB428012.[MT7]-TQTTVEDLSK[MT7].2y4_1.heavy 705.39 / 606.358 4364.0 24.76502513885498 42 16 10 6 10 4.752158070904067 16.83876240462333 0.037700653076171875 3 0.9621996811328976 6.3275708740219505 4364.0 12.307991725145012 0.0 - - - - - - - 200.22222222222223 8 18 GK2 glycerol kinase 2 1119 143 C20140704_OR004_03 C20140704_OR004_03 TB428012.[MT7]-TQTTVEDLSK[MT7].2y8_1.heavy 705.39 / 1036.56 4641.0 24.76502513885498 42 16 10 6 10 4.752158070904067 16.83876240462333 0.037700653076171875 3 0.9621996811328976 6.3275708740219505 4641.0 87.27485869565217 0.0 - - - - - - - 180.2 9 10 GK2 glycerol kinase 2 1121 143 C20140704_OR004_03 C20140704_OR004_03 TB428012.[MT7]-TQTTVEDLSK[MT7].2y5_1.heavy 705.39 / 735.401 3325.0 24.76502513885498 42 16 10 6 10 4.752158070904067 16.83876240462333 0.037700653076171875 3 0.9621996811328976 6.3275708740219505 3325.0 54.867096004021114 0.0 - - - - - - - 230.83333333333334 6 6 GK2 glycerol kinase 2 1123 143 C20140704_OR004_03 C20140704_OR004_03 TB428012.[MT7]-TQTTVEDLSK[MT7].2y7_1.heavy 705.39 / 935.517 4641.0 24.76502513885498 42 16 10 6 10 4.752158070904067 16.83876240462333 0.037700653076171875 3 0.9621996811328976 6.3275708740219505 4641.0 40.977949640287775 0.0 - - - - - - - 185.0 9 6 GK2 glycerol kinase 2 1125 144 C20140704_OR004_03 C20140704_OR004_03 TB428013.[MT7]-SLGTDLMNEMR.3b6_1.heavy 470.899 / 731.406 527.0 38.03889846801758 40 10 10 10 10 0.849576439922257 69.41098197919978 0.0 3 0.8417750033732387 3.060727868881203 527.0 3.728621020329881 3.0 - - - - - - - 0.0 1 0 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1127 144 C20140704_OR004_03 C20140704_OR004_03 TB428013.[MT7]-SLGTDLMNEMR.3b5_1.heavy 470.899 / 618.321 1186.0 38.03889846801758 40 10 10 10 10 0.849576439922257 69.41098197919978 0.0 3 0.8417750033732387 3.060727868881203 1186.0 8.80487883386214 1.0 - - - - - - - 197.75 2 4 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1129 144 C20140704_OR004_03 C20140704_OR004_03 TB428013.[MT7]-SLGTDLMNEMR.3y4_1.heavy 470.899 / 549.245 1845.0 38.03889846801758 40 10 10 10 10 0.849576439922257 69.41098197919978 0.0 3 0.8417750033732387 3.060727868881203 1845.0 4.745485584218512 0.0 - - - - - - - 219.66666666666666 3 3 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1131 144 C20140704_OR004_03 C20140704_OR004_03 TB428013.[MT7]-SLGTDLMNEMR.3y5_1.heavy 470.899 / 680.285 1450.0 38.03889846801758 40 10 10 10 10 0.849576439922257 69.41098197919978 0.0 3 0.8417750033732387 3.060727868881203 1450.0 -0.010984848484849152 0.0 - - - - - - - 198.0 2 2 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1133 145 C20140704_OR004_03 C20140704_OR004_03 TB427791.[MT7]-DLFEEK[MT7].2b3_1.heavy 534.794 / 520.289 8391.0 29.82979965209961 48 18 10 10 10 9.728682089267581 10.278884548022933 0.0 3 0.9892231105265556 11.877494933007199 8391.0 23.85008198230333 1.0 - - - - - - - 279.625 23 16 GNAI1;GNAI2;GNAI3;GNAT2 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 1135 145 C20140704_OR004_03 C20140704_OR004_03 TB427791.[MT7]-DLFEEK[MT7].2y4_1.heavy 534.794 / 696.369 15477.0 29.82979965209961 48 18 10 10 10 9.728682089267581 10.278884548022933 0.0 3 0.9892231105265556 11.877494933007199 15477.0 33.19463806970509 0.0 - - - - - - - 223.5 30 10 GNAI1;GNAI2;GNAI3;GNAT2 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 1137 145 C20140704_OR004_03 C20140704_OR004_03 TB427791.[MT7]-DLFEEK[MT7].2y5_1.heavy 534.794 / 809.453 10815.0 29.82979965209961 48 18 10 10 10 9.728682089267581 10.278884548022933 0.0 3 0.9892231105265556 11.877494933007199 10815.0 89.41064516129032 0.0 - - - - - - - 238.6875 21 16 GNAI1;GNAI2;GNAI3;GNAT2 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 1139 145 C20140704_OR004_03 C20140704_OR004_03 TB427791.[MT7]-DLFEEK[MT7].2y3_1.heavy 534.794 / 549.3 11374.0 29.82979965209961 48 18 10 10 10 9.728682089267581 10.278884548022933 0.0 3 0.9892231105265556 11.877494933007199 11374.0 49.780308310991956 0.0 - - - - - - - 279.6 22 10 GNAI1;GNAI2;GNAI3;GNAT2 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 1141 146 C20140704_OR004_03 C20140704_OR004_03 TB427790.[MT7]-ILQDYK[MT7].2y4_1.heavy 534.321 / 697.364 9497.0 28.76300048828125 46 16 10 10 10 5.725465584826523 17.465828502229993 0.0 3 0.9635605206020846 6.445381072147924 9497.0 31.64670860857712 0.0 - - - - - - - 247.85714285714286 18 14 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1143 146 C20140704_OR004_03 C20140704_OR004_03 TB427790.[MT7]-ILQDYK[MT7].2y5_1.heavy 534.321 / 810.448 19490.0 28.76300048828125 46 16 10 10 10 5.725465584826523 17.465828502229993 0.0 3 0.9635605206020846 6.445381072147924 19490.0 145.60820869990226 0.0 - - - - - - - 189.7058823529412 38 17 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1145 146 C20140704_OR004_03 C20140704_OR004_03 TB427790.[MT7]-ILQDYK[MT7].2b4_1.heavy 534.321 / 614.363 16435.0 28.76300048828125 46 16 10 10 10 5.725465584826523 17.465828502229993 0.0 3 0.9635605206020846 6.445381072147924 16435.0 61.30263713854562 0.0 - - - - - - - 236.86666666666667 32 15 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1147 146 C20140704_OR004_03 C20140704_OR004_03 TB427790.[MT7]-ILQDYK[MT7].2y3_1.heavy 534.321 / 569.305 7515.0 28.76300048828125 46 16 10 10 10 5.725465584826523 17.465828502229993 0.0 3 0.9635605206020846 6.445381072147924 7515.0 38.48407258064516 0.0 - - - - - - - 231.4 15 15 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1149 147 C20140704_OR004_03 C20140704_OR004_03 TB414067.[MT7]-AIAELGIYPAVDPLDSTSR.3y7_1.heavy 711.383 / 775.394 30301.0 43.05030059814453 50 20 10 10 10 7.476093283375399 13.375970070139463 0.0 3 0.9938208086945635 15.691796346994195 30301.0 44.44499037632437 0.0 - - - - - - - 259.09090909090907 60 11 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1151 147 C20140704_OR004_03 C20140704_OR004_03 TB414067.[MT7]-AIAELGIYPAVDPLDSTSR.3b6_1.heavy 711.383 / 699.416 34537.0 43.05030059814453 50 20 10 10 10 7.476093283375399 13.375970070139463 0.0 3 0.9938208086945635 15.691796346994195 34537.0 47.61929256485203 0.0 - - - - - - - 203.33333333333334 69 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1153 147 C20140704_OR004_03 C20140704_OR004_03 TB414067.[MT7]-AIAELGIYPAVDPLDSTSR.3y11_1.heavy 711.383 / 1157.58 12788.0 43.05030059814453 50 20 10 10 10 7.476093283375399 13.375970070139463 0.0 3 0.9938208086945635 15.691796346994195 12788.0 62.10940695296523 0.0 - - - - - - - 267.5 25 14 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1155 147 C20140704_OR004_03 C20140704_OR004_03 TB414067.[MT7]-AIAELGIYPAVDPLDSTSR.3b4_1.heavy 711.383 / 529.31 19875.0 43.05030059814453 50 20 10 10 10 7.476093283375399 13.375970070139463 0.0 3 0.9938208086945635 15.691796346994195 19875.0 49.33193280827594 0.0 - - - - - - - 259.0 39 11 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1157 148 C20140704_OR004_03 C20140704_OR004_03 TB427979.[MT7]-ELDPDSSMGK[MT7].2b3_1.heavy 683.842 / 502.263 11456.0 25.08387517929077 42 16 10 6 10 2.9195754029759713 27.322724315742164 0.03569984436035156 3 0.9655958521915731 6.63443450110866 11456.0 85.05368319869106 0.0 - - - - - - - 209.7 22 10 SH3BP1 SH3-domain binding protein 1 1159 148 C20140704_OR004_03 C20140704_OR004_03 TB427979.[MT7]-ELDPDSSMGK[MT7].2y5_1.heavy 683.842 / 653.341 2864.0 25.08387517929077 42 16 10 6 10 2.9195754029759713 27.322724315742164 0.03569984436035156 3 0.9655958521915731 6.63443450110866 2864.0 6.138362722548769 0.0 - - - - - - - 186.44444444444446 5 9 SH3BP1 SH3-domain binding protein 1 1161 148 C20140704_OR004_03 C20140704_OR004_03 TB427979.[MT7]-ELDPDSSMGK[MT7].2y6_1.heavy 683.842 / 768.368 419.0 25.08387517929077 42 16 10 6 10 2.9195754029759713 27.322724315742164 0.03569984436035156 3 0.9655958521915731 6.63443450110866 419.0 5.318538681948423 3.0 - - - - - - - 0.0 0 0 SH3BP1 SH3-domain binding protein 1 1163 148 C20140704_OR004_03 C20140704_OR004_03 TB427979.[MT7]-ELDPDSSMGK[MT7].2y7_1.heavy 683.842 / 865.421 7055.0 25.08387517929077 42 16 10 6 10 2.9195754029759713 27.322724315742164 0.03569984436035156 3 0.9655958521915731 6.63443450110866 7055.0 97.76214285714286 0.0 - - - - - - - 227.125 14 8 SH3BP1 SH3-domain binding protein 1 1165 149 C20140704_OR004_03 C20140704_OR004_03 TB428107.[MT7]-FTQAGSEVSALLGR.2b3_1.heavy 790.432 / 521.284 1622.0 40.788575172424316 39 18 10 1 10 8.479012089885762 11.793826797261627 0.10089874267578125 3 0.9861906678638017 10.489987861112445 1622.0 4.587895551384635 0.0 - - - - - - - 301.0 3 13 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1167 149 C20140704_OR004_03 C20140704_OR004_03 TB428107.[MT7]-FTQAGSEVSALLGR.2y10_1.heavy 790.432 / 988.542 2195.0 40.788575172424316 39 18 10 1 10 8.479012089885762 11.793826797261627 0.10089874267578125 3 0.9861906678638017 10.489987861112445 2195.0 3.0645724258289704 0.0 - - - - - - - 217.92857142857142 4 14 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1169 149 C20140704_OR004_03 C20140704_OR004_03 TB428107.[MT7]-FTQAGSEVSALLGR.2y11_1.heavy 790.432 / 1059.58 1718.0 40.788575172424316 39 18 10 1 10 8.479012089885762 11.793826797261627 0.10089874267578125 3 0.9861906678638017 10.489987861112445 1718.0 16.43702981229297 0.0 - - - - - - - 216.63636363636363 3 11 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1171 149 C20140704_OR004_03 C20140704_OR004_03 TB428107.[MT7]-FTQAGSEVSALLGR.2y7_1.heavy 790.432 / 715.446 859.0 40.788575172424316 39 18 10 1 10 8.479012089885762 11.793826797261627 0.10089874267578125 3 0.9861906678638017 10.489987861112445 859.0 -0.5 6.0 - - - - - - - 0.0 1 0 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1173 150 C20140704_OR004_03 C20140704_OR004_03 TB428105.[MT7]-MSPEFVAVQPGK[MT7].2b4_1.heavy 789.434 / 589.277 1049.0 32.30910015106201 38 13 10 5 10 1.187821263100979 56.12516692336665 0.042400360107421875 3 0.9223955331375038 4.401184495092674 1049.0 4.804580152671756 2.0 - - - - - - - 235.8 2 5 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 1175 150 C20140704_OR004_03 C20140704_OR004_03 TB428105.[MT7]-MSPEFVAVQPGK[MT7].2b6_1.heavy 789.434 / 835.414 525.0 32.30910015106201 38 13 10 5 10 1.187821263100979 56.12516692336665 0.042400360107421875 3 0.9223955331375038 4.401184495092674 525.0 3.874215544584227 4.0 - - - - - - - 0.0 1 0 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 1177 150 C20140704_OR004_03 C20140704_OR004_03 TB428105.[MT7]-MSPEFVAVQPGK[MT7].2b7_1.heavy 789.434 / 906.451 1705.0 32.30910015106201 38 13 10 5 10 1.187821263100979 56.12516692336665 0.042400360107421875 3 0.9223955331375038 4.401184495092674 1705.0 3.2525772446383128 0.0 - - - - - - - 299.42857142857144 3 7 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 1179 150 C20140704_OR004_03 C20140704_OR004_03 TB428105.[MT7]-MSPEFVAVQPGK[MT7].2b5_1.heavy 789.434 / 736.346 1574.0 32.30910015106201 38 13 10 5 10 1.187821263100979 56.12516692336665 0.042400360107421875 3 0.9223955331375038 4.401184495092674 1574.0 7.369363867684478 0.0 - - - - - - - 299.42857142857144 3 7 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 1181 151 C20140704_OR004_03 C20140704_OR004_03 TB428102.[MT7]-GVTYSLESFLGPR.2y8_1.heavy 785.423 / 918.504 2106.0 44.42135047912598 42 16 10 6 10 12.913810298223646 7.743647900244861 0.031299591064453125 3 0.9653097698208631 6.606862002301535 2106.0 4.001900237529692 1.0 - - - - - - - 192.64285714285714 4 14 PISD phosphatidylserine decarboxylase 1183 151 C20140704_OR004_03 C20140704_OR004_03 TB428102.[MT7]-GVTYSLESFLGPR.2y9_1.heavy 785.423 / 1005.54 6235.0 44.42135047912598 42 16 10 6 10 12.913810298223646 7.743647900244861 0.031299591064453125 3 0.9653097698208631 6.606862002301535 6235.0 35.012412474636704 0.0 - - - - - - - 201.15384615384616 12 13 PISD phosphatidylserine decarboxylase 1185 151 C20140704_OR004_03 C20140704_OR004_03 TB428102.[MT7]-GVTYSLESFLGPR.2y6_1.heavy 785.423 / 676.378 1938.0 44.42135047912598 42 16 10 6 10 12.913810298223646 7.743647900244861 0.031299591064453125 3 0.9653097698208631 6.606862002301535 1938.0 6.777075098814229 1.0 - - - - - - - 174.64285714285714 3 14 PISD phosphatidylserine decarboxylase 1187 151 C20140704_OR004_03 C20140704_OR004_03 TB428102.[MT7]-GVTYSLESFLGPR.2y7_1.heavy 785.423 / 805.42 2022.0 44.42135047912598 42 16 10 6 10 12.913810298223646 7.743647900244861 0.031299591064453125 3 0.9653097698208631 6.606862002301535 2022.0 7.977907711018078 0.0 - - - - - - - 168.53846153846155 4 13 PISD phosphatidylserine decarboxylase 1189 152 C20140704_OR004_03 C20140704_OR004_03 TB428249.[MT7]-VPLLAEIYGIEGNIFR.3b6_1.heavy 650.039 / 767.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 1191 152 C20140704_OR004_03 C20140704_OR004_03 TB428249.[MT7]-VPLLAEIYGIEGNIFR.3b4_1.heavy 650.039 / 567.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 1193 152 C20140704_OR004_03 C20140704_OR004_03 TB428249.[MT7]-VPLLAEIYGIEGNIFR.3y8_1.heavy 650.039 / 905.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 1195 152 C20140704_OR004_03 C20140704_OR004_03 TB428249.[MT7]-VPLLAEIYGIEGNIFR.3y5_1.heavy 650.039 / 606.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 1197 153 C20140704_OR004_03 C20140704_OR004_03 TB428248.[MT7]-VPLLAEIYGIEGNIFR.2y8_1.heavy 974.555 / 905.484 1195.0 54.71929931640625 43 13 10 10 10 2.7217042608984285 36.741684773271515 0.0 3 0.9029742731453396 3.929553912795286 1195.0 2.16289592760181 0.0 - - - - - - - 147.44444444444446 2 18 GANC glucosidase, alpha; neutral C 1199 153 C20140704_OR004_03 C20140704_OR004_03 TB428248.[MT7]-VPLLAEIYGIEGNIFR.2y5_1.heavy 974.555 / 606.336 885.0 54.71929931640625 43 13 10 10 10 2.7217042608984285 36.741684773271515 0.0 3 0.9029742731453396 3.929553912795286 885.0 0.8009049773755654 0.0 - - - - - - - 0.0 1 0 GANC glucosidase, alpha; neutral C 1201 153 C20140704_OR004_03 C20140704_OR004_03 TB428248.[MT7]-VPLLAEIYGIEGNIFR.2y9_1.heavy 974.555 / 1068.55 3894.0 54.71929931640625 43 13 10 10 10 2.7217042608984285 36.741684773271515 0.0 3 0.9029742731453396 3.929553912795286 3894.0 4.063304347826087 0.0 - - - - - - - 177.125 7 24 GANC glucosidase, alpha; neutral C 1203 153 C20140704_OR004_03 C20140704_OR004_03 TB428248.[MT7]-VPLLAEIYGIEGNIFR.2y10_1.heavy 974.555 / 1181.63 1814.0 54.71929931640625 43 13 10 10 10 2.7217042608984285 36.741684773271515 0.0 3 0.9029742731453396 3.929553912795286 1814.0 0.2897621728298367 1.0 - - - - - - - 219.47826086956522 3 23 GANC glucosidase, alpha; neutral C 1205 154 C20140704_OR004_03 C20140704_OR004_03 TB413975.[MT7]-IAQPNYIPTQQDVLR.2y8_1.heavy 950.524 / 956.516 19055.0 34.65760040283203 48 18 10 10 10 5.451015917466787 18.345204181034994 0.0 3 0.9805344832849154 8.831254353180496 19055.0 150.5307529610829 0.0 - - - - - - - 197.0 38 6 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1207 154 C20140704_OR004_03 C20140704_OR004_03 TB413975.[MT7]-IAQPNYIPTQQDVLR.2y9_1.heavy 950.524 / 1069.6 7829.0 34.65760040283203 48 18 10 10 10 5.451015917466787 18.345204181034994 0.0 3 0.9805344832849154 8.831254353180496 7829.0 31.691856663512 0.0 - - - - - - - 197.0 15 6 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1209 154 C20140704_OR004_03 C20140704_OR004_03 TB413975.[MT7]-IAQPNYIPTQQDVLR.2b6_1.heavy 950.524 / 831.448 7090.0 34.65760040283203 48 18 10 10 10 5.451015917466787 18.345204181034994 0.0 3 0.9805344832849154 8.831254353180496 7090.0 27.047268112892326 0.0 - - - - - - - 221.5 14 2 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1211 154 C20140704_OR004_03 C20140704_OR004_03 TB413975.[MT7]-IAQPNYIPTQQDVLR.2y10_1.heavy 950.524 / 1232.66 1329.0 34.65760040283203 48 18 10 10 10 5.451015917466787 18.345204181034994 0.0 3 0.9805344832849154 8.831254353180496 1329.0 6.123559322033898 1.0 - - - - - - - 344.5 2 6 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1213 155 C20140704_OR004_03 C20140704_OR004_03 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 108292.0 40.432498931884766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 108292.0 996.4413313724352 0.0 - - - - - - - 308.6666666666667 216 3 1215 155 C20140704_OR004_03 C20140704_OR004_03 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 194999.0 40.432498931884766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 194999.0 440.8038767893903 0.0 - - - - - - - 417.0 389 2 1217 155 C20140704_OR004_03 C20140704_OR004_03 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 319688.0 40.432498931884766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 319688.0 1499.0742967539395 0.0 - - - - - - - 278.0 639 1 1219 156 C20140704_OR004_03 C20140704_OR004_03 TB428307.[MT7]-MDSNFDSLPVQITVPEK[MT7].2y9_1.heavy 1104.58 / 1154.69 3332.0 40.78830146789551 41 15 10 6 10 2.832667904728322 35.30240867031354 0.034000396728515625 3 0.9565250758750072 5.897349279365181 3332.0 19.745185185185186 0.0 - - - - - - - 168.75 6 16 ADAM2 ADAM metallopeptidase domain 2 1221 156 C20140704_OR004_03 C20140704_OR004_03 TB428307.[MT7]-MDSNFDSLPVQITVPEK[MT7].2b4_1.heavy 1104.58 / 592.252 720.0 40.78830146789551 41 15 10 6 10 2.832667904728322 35.30240867031354 0.034000396728515625 3 0.9565250758750072 5.897349279365181 720.0 0.31999999999999995 0.0 - - - - - - - 0.0 1 0 ADAM2 ADAM metallopeptidase domain 2 1223 156 C20140704_OR004_03 C20140704_OR004_03 TB428307.[MT7]-MDSNFDSLPVQITVPEK[MT7].2b6_1.heavy 1104.58 / 854.347 4142.0 40.78830146789551 41 15 10 6 10 2.832667904728322 35.30240867031354 0.034000396728515625 3 0.9565250758750072 5.897349279365181 4142.0 49.013666666666666 0.0 - - - - - - - 167.14285714285714 8 7 ADAM2 ADAM metallopeptidase domain 2 1225 156 C20140704_OR004_03 C20140704_OR004_03 TB428307.[MT7]-MDSNFDSLPVQITVPEK[MT7].2y3_1.heavy 1104.58 / 517.31 16840.0 40.78830146789551 41 15 10 6 10 2.832667904728322 35.30240867031354 0.034000396728515625 3 0.9565250758750072 5.897349279365181 16840.0 114.7614814814815 0.0 - - - - - - - 219.375 33 16 ADAM2 ADAM metallopeptidase domain 2 1227 157 C20140704_OR004_03 C20140704_OR004_03 TB428309.[MT7]-LEDQLAGLQQELAALALK[MT7].3b6_1.heavy 738.098 / 814.443 894.0 52.71910095214844 43 13 10 10 10 1.769921285720893 44.92916675550701 0.0 3 0.9147124976521989 4.195498631580452 894.0 5.934397795428757 0.0 - - - - - - - 0.0 1 0 SUN2 Sad1 and UNC84 domain containing 2 1229 157 C20140704_OR004_03 C20140704_OR004_03 TB428309.[MT7]-LEDQLAGLQQELAALALK[MT7].3b4_1.heavy 738.098 / 630.321 1192.0 52.71910095214844 43 13 10 10 10 1.769921285720893 44.92916675550701 0.0 3 0.9147124976521989 4.195498631580452 1192.0 3.86 0.0 - - - - - - - 136.5 2 8 SUN2 Sad1 and UNC84 domain containing 2 1231 157 C20140704_OR004_03 C20140704_OR004_03 TB428309.[MT7]-LEDQLAGLQQELAALALK[MT7].3b5_1.heavy 738.098 / 743.406 1589.0 52.71910095214844 43 13 10 10 10 1.769921285720893 44.92916675550701 0.0 3 0.9147124976521989 4.195498631580452 1589.0 4.082408040160214 0.0 - - - - - - - 214.83333333333334 3 6 SUN2 Sad1 and UNC84 domain containing 2 1233 157 C20140704_OR004_03 C20140704_OR004_03 TB428309.[MT7]-LEDQLAGLQQELAALALK[MT7].3b3_1.heavy 738.098 / 502.263 496.0 52.71910095214844 43 13 10 10 10 1.769921285720893 44.92916675550701 0.0 3 0.9147124976521989 4.195498631580452 496.0 0.3565950461107624 13.0 - - - - - - - 0.0 1 0 SUN2 Sad1 and UNC84 domain containing 2 1235 158 C20140704_OR004_03 C20140704_OR004_03 TB414154.[MT7]-LK[MT7]PQARPVC[CAM]GLHSVISPSDGR.4b11_2.heavy 641.36 / 754.952 13959.0 26.729949951171875 42 16 10 6 10 3.427510485697165 29.17569484245056 0.0343017578125 3 0.9693375996278961 7.029805254691936 13959.0 112.27461105775826 0.0 - - - - - - - 265.93333333333334 27 15 PISD phosphatidylserine decarboxylase 1237 158 C20140704_OR004_03 C20140704_OR004_03 TB414154.[MT7]-LK[MT7]PQARPVC[CAM]GLHSVISPSDGR.4y7_1.heavy 641.36 / 731.368 11300.0 26.729949951171875 42 16 10 6 10 3.427510485697165 29.17569484245056 0.0343017578125 3 0.9693375996278961 7.029805254691936 11300.0 110.06500229042602 0.0 - - - - - - - 287.22222222222223 22 9 PISD phosphatidylserine decarboxylase 1239 158 C20140704_OR004_03 C20140704_OR004_03 TB414154.[MT7]-LK[MT7]PQARPVC[CAM]GLHSVISPSDGR.4y6_1.heavy 641.36 / 618.284 13221.0 26.729949951171875 42 16 10 6 10 3.427510485697165 29.17569484245056 0.0343017578125 3 0.9693375996278961 7.029805254691936 13221.0 25.004472156776544 0.0 - - - - - - - 237.35714285714286 26 14 PISD phosphatidylserine decarboxylase 1241 158 C20140704_OR004_03 C20140704_OR004_03 TB414154.[MT7]-LK[MT7]PQARPVC[CAM]GLHSVISPSDGR.4b10_2.heavy 641.36 / 698.41 6426.0 26.729949951171875 42 16 10 6 10 3.427510485697165 29.17569484245056 0.0343017578125 3 0.9693375996278961 7.029805254691936 6426.0 27.778548198435814 0.0 - - - - - - - 244.3846153846154 12 13 PISD phosphatidylserine decarboxylase 1243 159 C20140704_OR004_03 C20140704_OR004_03 TB414073.[MT7]-IVIEGK[MT7]PYTVNLMQK[MT7].3y3_1.heavy 722.429 / 550.314 8219.0 36.02560043334961 38 8 10 10 10 6.883901396273475 14.526646191378322 0.0 3 0.7977183182835554 2.696345658177498 8219.0 19.0292118226601 0.0 - - - - - - - 380.5 16 4 ADAM2 ADAM metallopeptidase domain 2 1245 159 C20140704_OR004_03 C20140704_OR004_03 TB414073.[MT7]-IVIEGK[MT7]PYTVNLMQK[MT7].3y4_1.heavy 722.429 / 663.398 3501.0 36.02560043334961 38 8 10 10 10 6.883901396273475 14.526646191378322 0.0 3 0.7977183182835554 2.696345658177498 3501.0 26.69108856718741 0.0 - - - - - - - 152.0 7 4 ADAM2 ADAM metallopeptidase domain 2 1247 159 C20140704_OR004_03 C20140704_OR004_03 TB414073.[MT7]-IVIEGK[MT7]PYTVNLMQK[MT7].3y5_1.heavy 722.429 / 777.441 6849.0 36.02560043334961 38 8 10 10 10 6.883901396273475 14.526646191378322 0.0 3 0.7977183182835554 2.696345658177498 6849.0 51.57614856105782 0.0 - - - - - - - 273.8 13 5 ADAM2 ADAM metallopeptidase domain 2 1249 159 C20140704_OR004_03 C20140704_OR004_03 TB414073.[MT7]-IVIEGK[MT7]PYTVNLMQK[MT7].3y9_1.heavy 722.429 / 1237.67 2587.0 36.02560043334961 38 8 10 10 10 6.883901396273475 14.526646191378322 0.0 3 0.7977183182835554 2.696345658177498 2587.0 22.283565300011517 0.0 - - - - - - - 304.5 5 4 ADAM2 ADAM metallopeptidase domain 2 1251 160 C20140704_OR004_03 C20140704_OR004_03 TB427762.[MT7]-IDFGDSAR.2b3_1.heavy 512.763 / 520.289 1825.0 28.525700569152832 46 20 10 6 10 30.738139889083005 3.253287295875575 0.035999298095703125 3 0.9967981182206211 21.804381664823033 1825.0 7.292670682730924 0.0 - - - - - - - 217.875 3 16 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1253 160 C20140704_OR004_03 C20140704_OR004_03 TB427762.[MT7]-IDFGDSAR.2y6_1.heavy 512.763 / 652.305 16505.0 28.525700569152832 46 20 10 6 10 30.738139889083005 3.253287295875575 0.035999298095703125 3 0.9967981182206211 21.804381664823033 16505.0 35.8785952319918 0.0 - - - - - - - 269.75 33 16 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1255 160 C20140704_OR004_03 C20140704_OR004_03 TB427762.[MT7]-IDFGDSAR.2b5_1.heavy 512.763 / 692.337 7464.0 28.525700569152832 46 20 10 6 10 30.738139889083005 3.253287295875575 0.035999298095703125 3 0.9967981182206211 21.804381664823033 7464.0 22.267814113597247 0.0 - - - - - - - 276.6666666666667 14 12 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1257 160 C20140704_OR004_03 C20140704_OR004_03 TB427762.[MT7]-IDFGDSAR.2y7_1.heavy 512.763 / 767.332 11528.0 28.525700569152832 46 20 10 6 10 30.738139889083005 3.253287295875575 0.035999298095703125 3 0.9967981182206211 21.804381664823033 11528.0 166.66987951807232 0.0 - - - - - - - 217.07692307692307 23 13 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1259 161 C20140704_OR004_03 C20140704_OR004_03 TB414152.[MT7]-GEHLGEFNLGSTIVLIFEAPK[MT7].4y5_1.heavy 640.607 / 735.416 3285.0 50.93490123748779 33 10 10 3 10 2.4826043078149254 28.035289268289485 0.051998138427734375 3 0.826038322811754 2.914933744955946 3285.0 19.059198113207547 0.0 - - - - - - - 200.22222222222223 6 9 PISD phosphatidylserine decarboxylase 1261 161 C20140704_OR004_03 C20140704_OR004_03 TB414152.[MT7]-GEHLGEFNLGSTIVLIFEAPK[MT7].4b8_1.heavy 640.607 / 1028.49 2119.0 50.93490123748779 33 10 10 3 10 2.4826043078149254 28.035289268289485 0.051998138427734375 3 0.826038322811754 2.914933744955946 2119.0 19.99056603773585 0.0 - - - - - - - 212.0 4 4 PISD phosphatidylserine decarboxylase 1263 161 C20140704_OR004_03 C20140704_OR004_03 TB414152.[MT7]-GEHLGEFNLGSTIVLIFEAPK[MT7].4b8_2.heavy 640.607 / 514.75 1696.0 50.93490123748779 33 10 10 3 10 2.4826043078149254 28.035289268289485 0.051998138427734375 3 0.826038322811754 2.914933744955946 1696.0 4.1764705882352935 1.0 - - - - - - - 238.5 3 4 PISD phosphatidylserine decarboxylase 1265 161 C20140704_OR004_03 C20140704_OR004_03 TB414152.[MT7]-GEHLGEFNLGSTIVLIFEAPK[MT7].4b10_2.heavy 640.607 / 599.802 2437.0 50.93490123748779 33 10 10 3 10 2.4826043078149254 28.035289268289485 0.051998138427734375 3 0.826038322811754 2.914933744955946 2437.0 13.257893081761006 0.0 - - - - - - - 247.33333333333334 4 3 PISD phosphatidylserine decarboxylase 1267 162 C20140704_OR004_03 C20140704_OR004_03 TB427872.[MT7]-ILNFGQVK[MT7].3b4_1.heavy 402.92 / 632.389 1499.0 35.92559814453125 50 20 10 10 10 2.8342120973640914 25.40266265618102 0.0 3 0.9954929448688626 18.376071999648754 1499.0 3.297666666666667 1.0 - - - - - - - 225.0 2 2 PISD phosphatidylserine decarboxylase 1269 162 C20140704_OR004_03 C20140704_OR004_03 TB427872.[MT7]-ILNFGQVK[MT7].3b5_1.heavy 402.92 / 689.41 1648.0 35.92559814453125 50 20 10 10 10 2.8342120973640914 25.40266265618102 0.0 3 0.9954929448688626 18.376071999648754 1648.0 9.065145398943564 2.0 - - - - - - - 150.0 3 2 PISD phosphatidylserine decarboxylase 1271 162 C20140704_OR004_03 C20140704_OR004_03 TB427872.[MT7]-ILNFGQVK[MT7].3y4_1.heavy 402.92 / 575.363 2847.0 35.92559814453125 50 20 10 10 10 2.8342120973640914 25.40266265618102 0.0 3 0.9954929448688626 18.376071999648754 2847.0 20.5019476635514 0.0 - - - - - - - 262.5 5 4 PISD phosphatidylserine decarboxylase 1273 162 C20140704_OR004_03 C20140704_OR004_03 TB427872.[MT7]-ILNFGQVK[MT7].3b3_1.heavy 402.92 / 485.32 14536.0 35.92559814453125 50 20 10 10 10 2.8342120973640914 25.40266265618102 0.0 3 0.9954929448688626 18.376071999648754 14536.0 56.5693340753107 0.0 - - - - - - - 300.0 29 1 PISD phosphatidylserine decarboxylase 1275 163 C20140704_OR004_03 C20140704_OR004_03 TB451255.[MT7]-SAVTTVVNPK[MT7].3b6_1.heavy 435.266 / 703.411 338.0 24.353900909423828 43 17 10 10 6 4.193016383156821 23.849179412152075 0.0 5 0.9741802866315884 7.6638634782473325 338.0 1.0318226600985223 2.0 - - - - - - - 0.0 0 0 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1277 163 C20140704_OR004_03 C20140704_OR004_03 TB451255.[MT7]-SAVTTVVNPK[MT7].3y3_1.heavy 435.266 / 502.311 1082.0 24.353900909423828 43 17 10 10 6 4.193016383156821 23.849179412152075 0.0 5 0.9741802866315884 7.6638634782473325 1082.0 4.993357933579336 0.0 - - - - - - - 218.53846153846155 2 13 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1279 163 C20140704_OR004_03 C20140704_OR004_03 TB451255.[MT7]-SAVTTVVNPK[MT7].3b5_1.heavy 435.266 / 604.342 1353.0 24.353900909423828 43 17 10 10 6 4.193016383156821 23.849179412152075 0.0 5 0.9741802866315884 7.6638634782473325 1353.0 4.66551724137931 1.0 - - - - - - - 182.15384615384616 2 13 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1281 163 C20140704_OR004_03 C20140704_OR004_03 TB451255.[MT7]-SAVTTVVNPK[MT7].3y4_1.heavy 435.266 / 601.379 541.0 24.353900909423828 43 17 10 10 6 4.193016383156821 23.849179412152075 0.0 5 0.9741802866315884 7.6638634782473325 541.0 -0.5 5.0 - - - - - - - 144.46666666666667 2 15 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1283 164 C20140704_OR004_03 C20140704_OR004_03 TB451796.[MT7]-NILIMAGDEASTIAEIIEEC[CAM]GGLEK[MT7].4y8_1.heavy 741.884 / 1065.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - KPNA3 karyopherin alpha 3 (importin alpha 4) 1285 164 C20140704_OR004_03 C20140704_OR004_03 TB451796.[MT7]-NILIMAGDEASTIAEIIEEC[CAM]GGLEK[MT7].4b4_1.heavy 741.884 / 598.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - KPNA3 karyopherin alpha 3 (importin alpha 4) 1287 164 C20140704_OR004_03 C20140704_OR004_03 TB451796.[MT7]-NILIMAGDEASTIAEIIEEC[CAM]GGLEK[MT7].4b5_1.heavy 741.884 / 729.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - KPNA3 karyopherin alpha 3 (importin alpha 4) 1289 164 C20140704_OR004_03 C20140704_OR004_03 TB451796.[MT7]-NILIMAGDEASTIAEIIEEC[CAM]GGLEK[MT7].4y6_1.heavy 741.884 / 807.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - KPNA3 karyopherin alpha 3 (importin alpha 4) 1291 165 C20140704_OR004_03 C20140704_OR004_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 126421.0 35.41230010986328 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 126421.0 247.67174802110821 0.0 - - - - - - - 252.5 252 4 1293 165 C20140704_OR004_03 C20140704_OR004_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 30311.0 35.41230010986328 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 30311.0 56.22535470936774 2.0 - - - - - - - 252.5 130 2 1295 165 C20140704_OR004_03 C20140704_OR004_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 34731.0 35.41230010986328 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 34731.0 91.9173170791174 0.0 - - - - - - - 234.57142857142858 69 7 1297 166 C20140704_OR004_03 C20140704_OR004_03 TB427973.[MT7]-RLEALAAEFSSNWQK[MT7].3b6_1.heavy 680.037 / 798.495 2403.0 36.80730056762695 34 8 10 10 6 1.5987536414282524 62.54872383631579 0.0 6 0.7725018020033918 2.5367243567364266 2403.0 3.8371257485029946 2.0 - - - - - - - 250.0 10 14 SUN2 Sad1 and UNC84 domain containing 2 1299 166 C20140704_OR004_03 C20140704_OR004_03 TB427973.[MT7]-RLEALAAEFSSNWQK[MT7].3b4_1.heavy 680.037 / 614.374 1201.0 36.80730056762695 34 8 10 10 6 1.5987536414282524 62.54872383631579 0.0 6 0.7725018020033918 2.5367243567364266 1201.0 0.13329633740288566 14.0 - - - - - - - 673.7272727272727 6 11 SUN2 Sad1 and UNC84 domain containing 2 1301 166 C20140704_OR004_03 C20140704_OR004_03 TB427973.[MT7]-RLEALAAEFSSNWQK[MT7].3b5_1.heavy 680.037 / 727.458 2303.0 36.80730056762695 34 8 10 10 6 1.5987536414282524 62.54872383631579 0.0 6 0.7725018020033918 2.5367243567364266 2303.0 -0.19167707032875567 2.0 - - - - - - - 227.27272727272728 8 11 SUN2 Sad1 and UNC84 domain containing 2 1303 166 C20140704_OR004_03 C20140704_OR004_03 TB427973.[MT7]-RLEALAAEFSSNWQK[MT7].3b8_1.heavy 680.037 / 998.575 22927.0 36.80730056762695 34 8 10 10 6 1.5987536414282524 62.54872383631579 0.0 6 0.7725018020033918 2.5367243567364266 22927.0 35.47772046589018 0.0 - - - - - - - 206.66666666666666 45 15 SUN2 Sad1 and UNC84 domain containing 2 1305 167 C20140704_OR004_03 C20140704_OR004_03 TB427870.[MT7]-VVLTGDWK[MT7].2y6_1.heavy 603.36 / 863.474 4258.0 34.371499379475914 43 20 10 3 10 5.280636021896223 18.937112799547016 0.050701141357421875 3 0.9916223045175381 13.473996150123815 4258.0 4.508588256128312 1.0 - - - - - - - 293.6 8 5 PISD phosphatidylserine decarboxylase 1307 167 C20140704_OR004_03 C20140704_OR004_03 TB427870.[MT7]-VVLTGDWK[MT7].2y4_1.heavy 603.36 / 649.343 2643.0 34.371499379475914 43 20 10 3 10 5.280636021896223 18.937112799547016 0.050701141357421875 3 0.9916223045175381 13.473996150123815 2643.0 10.329169002632803 1.0 - - - - - - - 244.77777777777777 5 9 PISD phosphatidylserine decarboxylase 1309 167 C20140704_OR004_03 C20140704_OR004_03 TB427870.[MT7]-VVLTGDWK[MT7].2y5_1.heavy 603.36 / 750.39 N/A 34.371499379475914 43 20 10 3 10 5.280636021896223 18.937112799547016 0.050701141357421875 3 0.9916223045175381 13.473996150123815 10571.0 22.974218117711942 0.0 - - - - - - - 293.6666666666667 21 3 PISD phosphatidylserine decarboxylase 1311 167 C20140704_OR004_03 C20140704_OR004_03 TB427870.[MT7]-VVLTGDWK[MT7].2y7_1.heavy 603.36 / 962.543 5579.0 34.371499379475914 43 20 10 3 10 5.280636021896223 18.937112799547016 0.050701141357421875 3 0.9916223045175381 13.473996150123815 5579.0 11.700239197242293 0.0 - - - - - - - 272.7142857142857 11 7 PISD phosphatidylserine decarboxylase 1313 168 C20140704_OR004_03 C20140704_OR004_03 TB451259.[MT7]-NQLVTR.2y4_1.heavy 437.765 / 488.319 2245.0 18.94184970855713 47 20 10 7 10 7.751745375579682 12.900320528461878 0.029100418090820312 3 0.9960108816898797 19.53347156234946 2245.0 22.10222643674497 0.0 - - - - - - - 153.85714285714286 4 14 PISD phosphatidylserine decarboxylase 1315 168 C20140704_OR004_03 C20140704_OR004_03 TB451259.[MT7]-NQLVTR.2b3_1.heavy 437.765 / 500.295 3849.0 18.94184970855713 47 20 10 7 10 7.751745375579682 12.900320528461878 0.029100418090820312 3 0.9960108816898797 19.53347156234946 3849.0 17.51452316076294 0.0 - - - - - - - 180.14285714285714 7 14 PISD phosphatidylserine decarboxylase 1317 168 C20140704_OR004_03 C20140704_OR004_03 TB451259.[MT7]-NQLVTR.2y5_1.heavy 437.765 / 616.378 4490.0 18.94184970855713 47 20 10 7 10 7.751745375579682 12.900320528461878 0.029100418090820312 3 0.9960108816898797 19.53347156234946 4490.0 58.94500395256917 0.0 - - - - - - - 104.78571428571429 8 14 PISD phosphatidylserine decarboxylase 1319 168 C20140704_OR004_03 C20140704_OR004_03 TB451259.[MT7]-NQLVTR.2b4_1.heavy 437.765 / 599.363 3482.0 18.94184970855713 47 20 10 7 10 7.751745375579682 12.900320528461878 0.029100418090820312 3 0.9960108816898797 19.53347156234946 3482.0 28.568760719556458 0.0 - - - - - - - 146.0 6 16 PISD phosphatidylserine decarboxylase 1321 169 C20140704_OR004_03 C20140704_OR004_03 TB427761.[MT7]-VLDRFIPGTTK[MT7].3y10_2.heavy 512.311 / 646.378 9671.0 34.008201599121094 48 18 10 10 10 3.755127950731885 20.73751560016182 0.0 3 0.983625754485744 9.631353655097836 9671.0 35.680677304774804 0.0 - - - - - - - 284.25 19 8 MPV17 MpV17 mitochondrial inner membrane protein 1323 169 C20140704_OR004_03 C20140704_OR004_03 TB427761.[MT7]-VLDRFIPGTTK[MT7].3y4_1.heavy 512.311 / 550.332 8533.0 34.008201599121094 48 18 10 10 10 3.755127950731885 20.73751560016182 0.0 3 0.983625754485744 9.631353655097836 8533.0 27.888727730478735 0.0 - - - - - - - 284.3333333333333 17 6 MPV17 MpV17 mitochondrial inner membrane protein 1325 169 C20140704_OR004_03 C20140704_OR004_03 TB427761.[MT7]-VLDRFIPGTTK[MT7].3y8_2.heavy 512.311 / 532.323 7253.0 34.008201599121094 48 18 10 10 10 3.755127950731885 20.73751560016182 0.0 3 0.983625754485744 9.631353655097836 7253.0 61.27141364885269 0.0 - - - - - - - 199.0 14 5 MPV17 MpV17 mitochondrial inner membrane protein 1327 169 C20140704_OR004_03 C20140704_OR004_03 TB427761.[MT7]-VLDRFIPGTTK[MT7].3y5_1.heavy 512.311 / 647.385 17492.0 34.008201599121094 48 18 10 10 10 3.755127950731885 20.73751560016182 0.0 3 0.983625754485744 9.631353655097836 17492.0 182.9269014084507 0.0 - - - - - - - 260.5 34 6 MPV17 MpV17 mitochondrial inner membrane protein 1329 170 C20140704_OR004_03 C20140704_OR004_03 TB427978.[MT7]-LVSDWNTLK[MT7].3b6_1.heavy 455.266 / 859.443 454.0 36.11197471618652 36 11 10 5 10 2.2672548490106967 44.106201843006055 0.04850006103515625 3 0.860143375383252 3.260800615169806 454.0 5.9891920529801315 0.0 - - - - - - - 0.0 0 0 SH3BP1 SH3-domain binding protein 1 1331 170 C20140704_OR004_03 C20140704_OR004_03 TB427978.[MT7]-LVSDWNTLK[MT7].3y3_1.heavy 455.266 / 505.347 2878.0 36.11197471618652 36 11 10 5 10 2.2672548490106967 44.106201843006055 0.04850006103515625 3 0.860143375383252 3.260800615169806 2878.0 12.678414096916299 0.0 - - - - - - - 302.6666666666667 5 3 SH3BP1 SH3-domain binding protein 1 1333 170 C20140704_OR004_03 C20140704_OR004_03 TB427978.[MT7]-LVSDWNTLK[MT7].3b4_1.heavy 455.266 / 559.321 3030.0 36.11197471618652 36 11 10 5 10 2.2672548490106967 44.106201843006055 0.04850006103515625 3 0.860143375383252 3.260800615169806 3030.0 19.846158940397352 1.0 - - - - - - - 201.66666666666666 6 3 SH3BP1 SH3-domain binding protein 1 1335 170 C20140704_OR004_03 C20140704_OR004_03 TB427978.[MT7]-LVSDWNTLK[MT7].3y4_1.heavy 455.266 / 619.39 909.0 36.11197471618652 36 11 10 5 10 2.2672548490106967 44.106201843006055 0.04850006103515625 3 0.860143375383252 3.260800615169806 909.0 7.5198675496688745 1.0 - - - - - - - 0.0 1 0 SH3BP1 SH3-domain binding protein 1 1337 171 C20140704_OR004_03 C20140704_OR004_03 TB413825.[MT7]-FTQAGSEVSALLGR.3b4_1.heavy 527.29 / 592.321 1253.0 40.76335048675537 34 15 10 3 6 2.3382240466718165 30.45232055143874 0.06690216064453125 5 0.9598104056773311 6.135362271536729 1253.0 4.8120208473919215 1.0 - - - - - - - 207.69230769230768 2 13 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1339 171 C20140704_OR004_03 C20140704_OR004_03 TB413825.[MT7]-FTQAGSEVSALLGR.3b5_1.heavy 527.29 / 649.343 964.0 40.76335048675537 34 15 10 3 6 2.3382240466718165 30.45232055143874 0.06690216064453125 5 0.9598104056773311 6.135362271536729 964.0 8.033333333333333 3.0 - - - - - - - 201.36363636363637 2 11 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1341 171 C20140704_OR004_03 C20140704_OR004_03 TB413825.[MT7]-FTQAGSEVSALLGR.3b3_1.heavy 527.29 / 521.284 771.0 40.76335048675537 34 15 10 3 6 2.3382240466718165 30.45232055143874 0.06690216064453125 5 0.9598104056773311 6.135362271536729 771.0 0.5335640138408303 11.0 - - - - - - - 252.9375 2 16 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1343 171 C20140704_OR004_03 C20140704_OR004_03 TB413825.[MT7]-FTQAGSEVSALLGR.3y5_1.heavy 527.29 / 529.346 1639.0 40.76335048675537 34 15 10 3 6 2.3382240466718165 30.45232055143874 0.06690216064453125 5 0.9598104056773311 6.135362271536729 1639.0 15.356778929188257 1.0 - - - - - - - 218.4 3 15 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1345 172 C20140704_OR004_03 C20140704_OR004_03 TB451504.[MT7]-TIAMDGTEGLVR.2y9_1.heavy 703.875 / 977.472 30630.0 32.549198150634766 43 13 10 10 10 1.1214174079248942 52.3961409596632 0.0 3 0.9074255646389338 4.024464441212047 30630.0 93.15277746077032 0.0 - - - - - - - 166.66666666666666 61 9 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1347 172 C20140704_OR004_03 C20140704_OR004_03 TB451504.[MT7]-TIAMDGTEGLVR.2y10_1.heavy 703.875 / 1048.51 42742.0 32.549198150634766 43 13 10 10 10 1.1214174079248942 52.3961409596632 0.0 3 0.9074255646389338 4.024464441212047 42742.0 281.66978 0.0 - - - - - - - 200.0 85 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1349 172 C20140704_OR004_03 C20140704_OR004_03 TB451504.[MT7]-TIAMDGTEGLVR.2y11_1.heavy 703.875 / 1161.59 13714.0 32.549198150634766 43 13 10 10 10 1.1214174079248942 52.3961409596632 0.0 3 0.9074255646389338 4.024464441212047 13714.0 171.42499999999998 0.0 - - - - - - - 144.44444444444446 27 9 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1351 172 C20140704_OR004_03 C20140704_OR004_03 TB451504.[MT7]-TIAMDGTEGLVR.2y7_1.heavy 703.875 / 731.405 30530.0 32.549198150634766 43 13 10 10 10 1.1214174079248942 52.3961409596632 0.0 3 0.9074255646389338 4.024464441212047 30530.0 302.69990468870105 0.0 - - - - - - - 227.27272727272728 61 11 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1353 173 C20140704_OR004_03 C20140704_OR004_03 TB428234.[MT7]-EAAWAISNLTISGRK[MT7].4y9_2.heavy 477.025 / 560.334 7871.0 36.94219970703125 37 7 10 10 10 0.572828920491998 100.54905304714791 0.0 3 0.7396705178600229 2.3642537863928412 7871.0 56.0177847832567 0.0 - - - - - - - 280.8888888888889 15 9 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 1355 173 C20140704_OR004_03 C20140704_OR004_03 TB428234.[MT7]-EAAWAISNLTISGRK[MT7].4b4_1.heavy 477.025 / 602.305 3713.0 36.94219970703125 37 7 10 10 10 0.572828920491998 100.54905304714791 0.0 3 0.7396705178600229 2.3642537863928412 3713.0 20.28552316890882 0.0 - - - - - - - 297.3333333333333 7 3 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 1357 173 C20140704_OR004_03 C20140704_OR004_03 TB428234.[MT7]-EAAWAISNLTISGRK[MT7].4b5_1.heavy 477.025 / 673.343 2228.0 36.94219970703125 37 7 10 10 10 0.572828920491998 100.54905304714791 0.0 3 0.7396705178600229 2.3642537863928412 2228.0 6.968697129575938 1.0 - - - - - - - 297.0 5 2 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 1359 173 C20140704_OR004_03 C20140704_OR004_03 TB428234.[MT7]-EAAWAISNLTISGRK[MT7].4y6_1.heavy 477.025 / 805.501 2228.0 36.94219970703125 37 7 10 10 10 0.572828920491998 100.54905304714791 0.0 3 0.7396705178600229 2.3642537863928412 2228.0 12.497199196750767 0.0 - - - - - - - 371.5 4 2 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 1361 174 C20140704_OR004_03 C20140704_OR004_03 TB428233.[MT7]-IAQPNYIPTQQDVLR.3y7_1.heavy 634.018 / 859.463 16233.0 34.65760040283203 50 20 10 10 10 9.033770609957267 11.069574856126774 0.0 3 0.9959786482811529 19.454975806800693 16233.0 55.188628738988314 0.0 - - - - - - - 243.5 32 6 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1363 174 C20140704_OR004_03 C20140704_OR004_03 TB428233.[MT7]-IAQPNYIPTQQDVLR.3b6_1.heavy 634.018 / 831.448 31442.0 34.65760040283203 50 20 10 10 10 9.033770609957267 11.069574856126774 0.0 3 0.9959786482811529 19.454975806800693 31442.0 242.0061214699323 0.0 - - - - - - - 274.125 62 8 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1365 174 C20140704_OR004_03 C20140704_OR004_03 TB428233.[MT7]-IAQPNYIPTQQDVLR.3b5_1.heavy 634.018 / 668.385 52501.0 34.65760040283203 50 20 10 10 10 9.033770609957267 11.069574856126774 0.0 3 0.9959786482811529 19.454975806800693 52501.0 199.4696599887078 0.0 - - - - - - - 263.0 105 5 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1367 174 C20140704_OR004_03 C20140704_OR004_03 TB428233.[MT7]-IAQPNYIPTQQDVLR.3y8_1.heavy 634.018 / 956.516 163208.0 34.65760040283203 50 20 10 10 10 9.033770609957267 11.069574856126774 0.0 3 0.9959786482811529 19.454975806800693 163208.0 411.17767103982754 0.0 - - - - - - - 313.14285714285717 326 7 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1369 175 C20140704_OR004_03 C20140704_OR004_03 TB428236.[MT7]-AVVYSNTIQSIIAIIR.2y8_1.heavy 953.068 / 913.583 7847.0 52.53682518005371 35 10 10 5 10 2.506271423379481 27.42304889477712 0.04309844970703125 3 0.8445434217228995 3.088617079675606 7847.0 79.34678612209046 0.0 - - - - - - - 208.4 15 10 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1371 175 C20140704_OR004_03 C20140704_OR004_03 TB428236.[MT7]-AVVYSNTIQSIIAIIR.2b4_1.heavy 953.068 / 577.347 9039.0 52.53682518005371 35 10 10 5 10 2.506271423379481 27.42304889477712 0.04309844970703125 3 0.8445434217228995 3.088617079675606 9039.0 56.3577410984393 0.0 - - - - - - - 178.6 18 10 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1373 175 C20140704_OR004_03 C20140704_OR004_03 TB428236.[MT7]-AVVYSNTIQSIIAIIR.2y9_1.heavy 953.068 / 1026.67 5662.0 52.53682518005371 35 10 10 5 10 2.506271423379481 27.42304889477712 0.04309844970703125 3 0.8445434217228995 3.088617079675606 5662.0 22.85934508816121 0.0 - - - - - - - 265.0 11 9 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1375 175 C20140704_OR004_03 C20140704_OR004_03 TB428236.[MT7]-AVVYSNTIQSIIAIIR.2y11_1.heavy 953.068 / 1241.76 2185.0 52.53682518005371 35 10 10 5 10 2.506271423379481 27.42304889477712 0.04309844970703125 3 0.8445434217228995 3.088617079675606 2185.0 38.403030303030306 0.0 - - - - - - - 231.66666666666666 4 6 GNAI1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 1377 176 C20140704_OR004_03 C20140704_OR004_03 TB428235.[MT7]-EAAWAISNLTISGRK[MT7].3y6_1.heavy 635.698 / 805.501 7663.0 36.94219970703125 43 13 10 10 10 1.0940079009716182 55.26232481809653 0.0 3 0.9045766525284519 3.9629583073201236 7663.0 60.57967776584317 0.0 - - - - - - - 294.75 15 8 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 1379 176 C20140704_OR004_03 C20140704_OR004_03 TB428235.[MT7]-EAAWAISNLTISGRK[MT7].3b4_1.heavy 635.698 / 602.305 3242.0 36.94219970703125 43 13 10 10 10 1.0940079009716182 55.26232481809653 0.0 3 0.9045766525284519 3.9629583073201236 3242.0 5.719584103341785 2.0 - - - - - - - 276.5 6 8 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 1381 176 C20140704_OR004_03 C20140704_OR004_03 TB428235.[MT7]-EAAWAISNLTISGRK[MT7].3b5_1.heavy 635.698 / 673.343 5305.0 36.94219970703125 43 13 10 10 10 1.0940079009716182 55.26232481809653 0.0 3 0.9045766525284519 3.9629583073201236 5305.0 10.715881735019913 0.0 - - - - - - - 694.5714285714286 10 7 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 1383 176 C20140704_OR004_03 C20140704_OR004_03 TB428235.[MT7]-EAAWAISNLTISGRK[MT7].3y9_1.heavy 635.698 / 1119.66 5895.0 36.94219970703125 43 13 10 10 10 1.0940079009716182 55.26232481809653 0.0 3 0.9045766525284519 3.9629583073201236 5895.0 50.23188890940992 0.0 - - - - - - - 235.6 11 5 KPNA3;KPNA4 karyopherin alpha 3 (importin alpha 4);karyopherin alpha 4 (importin alpha 3) 1385 177 C20140704_OR004_03 C20140704_OR004_03 TB451508.[MT7]-SLGTDLMNEMR.2y9_1.heavy 705.846 / 1066.47 8442.0 38.03889846801758 43 13 10 10 10 1.4833622514446845 44.942944046026724 0.0 3 0.9183786130899707 4.2900384385371915 8442.0 -1.118145695364241 0.0 - - - - - - - 241.4 16 5 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1387 177 C20140704_OR004_03 C20140704_OR004_03 TB451508.[MT7]-SLGTDLMNEMR.2y6_1.heavy 705.846 / 793.37 6633.0 38.03889846801758 43 13 10 10 10 1.4833622514446845 44.942944046026724 0.0 3 0.9183786130899707 4.2900384385371915 6633.0 -0.0732928176795582 0.0 - - - - - - - 226.5 13 2 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1389 177 C20140704_OR004_03 C20140704_OR004_03 TB451508.[MT7]-SLGTDLMNEMR.2y10_1.heavy 705.846 / 1179.55 1809.0 38.03889846801758 43 13 10 10 10 1.4833622514446845 44.942944046026724 0.0 3 0.9183786130899707 4.2900384385371915 1809.0 -0.3201769911504422 0.0 - - - - - - - 352.0 3 3 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1391 177 C20140704_OR004_03 C20140704_OR004_03 TB451508.[MT7]-SLGTDLMNEMR.2b5_1.heavy 705.846 / 618.321 7688.0 38.03889846801758 43 13 10 10 10 1.4833622514446845 44.942944046026724 0.0 3 0.9183786130899707 4.2900384385371915 7688.0 -0.2545695364238405 0.0 - - - - - - - 377.0 15 2 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1393 178 C20140704_OR004_03 C20140704_OR004_03 TB451507.[MT7]-TQTTVEDLSK[MT7].3y3_1.heavy 470.596 / 491.331 11594.0 24.755599975585938 40 14 8 10 8 5.003712514082356 16.002949202784578 0.0 4 0.9428241415026729 5.136469580526734 11594.0 78.82389438943895 1.0 - - - - - - - 202.1818181818182 29 11 GK2 glycerol kinase 2 1395 178 C20140704_OR004_03 C20140704_OR004_03 TB451507.[MT7]-TQTTVEDLSK[MT7].3b4_1.heavy 470.596 / 576.311 9842.0 24.755599975585938 40 14 8 10 8 5.003712514082356 16.002949202784578 0.0 4 0.9428241415026729 5.136469580526734 9842.0 65.75550165995827 0.0 - - - - - - - 202.11111111111111 19 9 GK2 glycerol kinase 2 1397 178 C20140704_OR004_03 C20140704_OR004_03 TB451507.[MT7]-TQTTVEDLSK[MT7].3y4_1.heavy 470.596 / 606.358 8763.0 24.755599975585938 40 14 8 10 8 5.003712514082356 16.002949202784578 0.0 4 0.9428241415026729 5.136469580526734 8763.0 141.14565924088754 0.0 - - - - - - - 157.11111111111111 17 9 GK2 glycerol kinase 2 1399 178 C20140704_OR004_03 C20140704_OR004_03 TB451507.[MT7]-TQTTVEDLSK[MT7].3b7_1.heavy 470.596 / 919.449 3033.0 24.755599975585938 40 14 8 10 8 5.003712514082356 16.002949202784578 0.0 4 0.9428241415026729 5.136469580526734 3033.0 63.20845771144279 0.0 - - - - - - - 235.75 6 4 GK2 glycerol kinase 2 1401 179 C20140704_OR004_03 C20140704_OR004_03 TB451646.[MT7]-SPLSSILFSALDSDTR.3b6_1.heavy 618.331 / 729.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 1403 179 C20140704_OR004_03 C20140704_OR004_03 TB451646.[MT7]-SPLSSILFSALDSDTR.3b5_1.heavy 618.331 / 616.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 1405 179 C20140704_OR004_03 C20140704_OR004_03 TB451646.[MT7]-SPLSSILFSALDSDTR.3y8_1.heavy 618.331 / 864.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 1407 179 C20140704_OR004_03 C20140704_OR004_03 TB451646.[MT7]-SPLSSILFSALDSDTR.3y9_1.heavy 618.331 / 1011.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 1409 180 C20140704_OR004_03 C20140704_OR004_03 TB414091.[MT7]-LEDQLAGLQQELAALALK[MT7].4y4_1.heavy 553.825 / 588.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1411 180 C20140704_OR004_03 C20140704_OR004_03 TB414091.[MT7]-LEDQLAGLQQELAALALK[MT7].4b4_1.heavy 553.825 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1413 180 C20140704_OR004_03 C20140704_OR004_03 TB414091.[MT7]-LEDQLAGLQQELAALALK[MT7].4b5_1.heavy 553.825 / 743.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1415 180 C20140704_OR004_03 C20140704_OR004_03 TB414091.[MT7]-LEDQLAGLQQELAALALK[MT7].4b3_1.heavy 553.825 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1417 181 C20140704_OR004_03 C20140704_OR004_03 TB427868.[MT7]-FDSDVGVYR.2y8_1.heavy 601.302 / 910.427 12354.0 29.541400909423828 50 20 10 10 10 5.8055840102806275 17.224795959014337 0.0 3 0.9948666834289919 17.21778933403649 12354.0 131.2532344653715 0.0 - - - - - - - 225.35714285714286 24 14 LOC100133583;LOC100507687;LOC100507710;LOC100509325;HLA-DQB1 HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;major histocompatibility complex, class II, DQ beta 1 1419 181 C20140704_OR004_03 C20140704_OR004_03 TB427868.[MT7]-FDSDVGVYR.2y5_1.heavy 601.302 / 593.341 29526.0 29.541400909423828 50 20 10 10 10 5.8055840102806275 17.224795959014337 0.0 3 0.9948666834289919 17.21778933403649 29526.0 88.31604562737644 0.0 - - - - - - - 730.25 59 12 LOC100133583;LOC100507687;LOC100507710;LOC100509325;HLA-DQB1 HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;major histocompatibility complex, class II, DQ beta 1 1421 181 C20140704_OR004_03 C20140704_OR004_03 TB427868.[MT7]-FDSDVGVYR.2b4_1.heavy 601.302 / 609.264 21466.0 29.541400909423828 50 20 10 10 10 5.8055840102806275 17.224795959014337 0.0 3 0.9948666834289919 17.21778933403649 21466.0 108.93909452359833 0.0 - - - - - - - 207.27272727272728 42 11 LOC100133583;LOC100507687;LOC100507710;LOC100509325;HLA-DQB1 HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;major histocompatibility complex, class II, DQ beta 1 1423 181 C20140704_OR004_03 C20140704_OR004_03 TB427868.[MT7]-FDSDVGVYR.2y7_1.heavy 601.302 / 795.399 12617.0 29.541400909423828 50 20 10 10 10 5.8055840102806275 17.224795959014337 0.0 3 0.9948666834289919 17.21778933403649 12617.0 22.51165975103735 0.0 - - - - - - - 299.3333333333333 25 12 LOC100133583;LOC100507687;LOC100507710;LOC100509325;HLA-DQB1 HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;HLA class II histocompatibility antigen, DQ beta 1 chain-like;major histocompatibility complex, class II, DQ beta 1 1425 182 C20140704_OR004_03 C20140704_OR004_03 TB427867.[MT7]-DFNFQLK[MT7].3y3_1.heavy 400.56 / 532.357 1367.0 35.489999771118164 40 17 10 3 10 3.363577647843077 29.73024870233808 0.051799774169921875 3 0.9792643330234783 8.555591631847557 1367.0 17.447236842105262 1.0 - - - - - - - 190.0 2 4 PISD phosphatidylserine decarboxylase 1427 182 C20140704_OR004_03 C20140704_OR004_03 TB427867.[MT7]-DFNFQLK[MT7].3b4_1.heavy 400.56 / 668.316 2885.0 35.489999771118164 40 17 10 3 10 3.363577647843077 29.73024870233808 0.051799774169921875 3 0.9792643330234783 8.555591631847557 2885.0 37.96052631578947 0.0 - - - - - - - 759.0 5 1 PISD phosphatidylserine decarboxylase 1429 182 C20140704_OR004_03 C20140704_OR004_03 TB427867.[MT7]-DFNFQLK[MT7].3b5_1.heavy 400.56 / 796.375 607.0 35.489999771118164 40 17 10 3 10 3.363577647843077 29.73024870233808 0.051799774169921875 3 0.9792643330234783 8.555591631847557 607.0 5.986138157894736 0.0 - - - - - - - 0.0 1 0 PISD phosphatidylserine decarboxylase 1431 182 C20140704_OR004_03 C20140704_OR004_03 TB427867.[MT7]-DFNFQLK[MT7].3b3_1.heavy 400.56 / 521.248 7441.0 35.489999771118164 40 17 10 3 10 3.363577647843077 29.73024870233808 0.051799774169921875 3 0.9792643330234783 8.555591631847557 7441.0 40.305416666666666 0.0 - - - - - - - 278.6666666666667 14 6 PISD phosphatidylserine decarboxylase 1433 183 C20140704_OR004_03 C20140704_OR004_03 TB427866.[MT7]-DFNFQLK[MT7].2y4_1.heavy 600.337 / 679.426 3794.0 35.502949714660645 35 14 10 3 8 2.359369180410244 33.530325850339025 0.051799774169921875 4 0.946222892874901 5.297828744290328 3794.0 28.79621862348178 2.0 - - - - - - - 189.75 12 4 PISD phosphatidylserine decarboxylase 1435 183 C20140704_OR004_03 C20140704_OR004_03 TB427866.[MT7]-DFNFQLK[MT7].2b3_1.heavy 600.337 / 521.248 8953.0 35.502949714660645 35 14 10 3 8 2.359369180410244 33.530325850339025 0.051799774169921875 4 0.946222892874901 5.297828744290328 8953.0 29.58434458295328 0.0 - - - - - - - 278.1666666666667 17 6 PISD phosphatidylserine decarboxylase 1437 183 C20140704_OR004_03 C20140704_OR004_03 TB427866.[MT7]-DFNFQLK[MT7].2b4_1.heavy 600.337 / 668.316 1973.0 35.502949714660645 35 14 10 3 8 2.359369180410244 33.530325850339025 0.051799774169921875 4 0.946222892874901 5.297828744290328 1973.0 -0.3070097911766604 3.0 - - - - - - - 328.6666666666667 5 6 PISD phosphatidylserine decarboxylase 1439 183 C20140704_OR004_03 C20140704_OR004_03 TB427866.[MT7]-DFNFQLK[MT7].2y6_1.heavy 600.337 / 940.537 6829.0 35.502949714660645 35 14 10 3 8 2.359369180410244 33.530325850339025 0.051799774169921875 4 0.946222892874901 5.297828744290328 6829.0 10.150378912685339 1.0 - - - - - - - 353.8333333333333 13 6 PISD phosphatidylserine decarboxylase 1441 184 C20140704_OR004_03 C20140704_OR004_03 TB427778.[MT7]-GVTYSLESFLGPR.3y7_1.heavy 523.951 / 805.42 3370.0 44.42135047912598 42 18 10 6 8 3.8730657557127004 25.819339589704057 0.031299591064453125 4 0.980178545410036 8.751341375473087 3370.0 52.46667560700169 0.0 - - - - - - - 185.4 6 5 PISD phosphatidylserine decarboxylase 1443 184 C20140704_OR004_03 C20140704_OR004_03 TB427778.[MT7]-GVTYSLESFLGPR.3y6_1.heavy 523.951 / 676.378 3539.0 44.42135047912598 42 18 10 6 8 3.8730657557127004 25.819339589704057 0.031299591064453125 4 0.980178545410036 8.751341375473087 3539.0 36.018224852071015 0.0 - - - - - - - 102.88888888888889 7 9 PISD phosphatidylserine decarboxylase 1445 184 C20140704_OR004_03 C20140704_OR004_03 TB427778.[MT7]-GVTYSLESFLGPR.3b4_1.heavy 523.951 / 565.31 1938.0 44.42135047912598 42 18 10 6 8 3.8730657557127004 25.819339589704057 0.031299591064453125 4 0.980178545410036 8.751341375473087 1938.0 10.2358823052606 0.0 - - - - - - - 202.2 3 10 PISD phosphatidylserine decarboxylase 1447 184 C20140704_OR004_03 C20140704_OR004_03 TB427778.[MT7]-GVTYSLESFLGPR.3b5_1.heavy 523.951 / 652.342 2696.0 44.42135047912598 42 18 10 6 8 3.8730657557127004 25.819339589704057 0.031299591064453125 4 0.980178545410036 8.751341375473087 2696.0 9.571597633136093 1.0 - - - - - - - 234.78571428571428 6 14 PISD phosphatidylserine decarboxylase 1449 185 C20140704_OR004_03 C20140704_OR004_03 TB414088.[MT7]-MDSNFDSLPVQITVPEK[MT7].3b6_1.heavy 736.72 / 854.347 5643.0 40.763075828552246 39 13 10 6 10 2.077992180675476 42.29196698036294 0.032901763916015625 3 0.9234921626750819 4.433031506504725 5643.0 29.318379888268154 1.0 - - - - - - - 217.71428571428572 11 14 ADAM2 ADAM metallopeptidase domain 2 1451 185 C20140704_OR004_03 C20140704_OR004_03 TB414088.[MT7]-MDSNFDSLPVQITVPEK[MT7].3y3_1.heavy 736.72 / 517.31 55000.0 40.763075828552246 39 13 10 6 10 2.077992180675476 42.29196698036294 0.032901763916015625 3 0.9234921626750819 4.433031506504725 55000.0 41.88279491154978 0.0 - - - - - - - 732.8181818181819 110 11 ADAM2 ADAM metallopeptidase domain 2 1453 185 C20140704_OR004_03 C20140704_OR004_03 TB414088.[MT7]-MDSNFDSLPVQITVPEK[MT7].3y5_1.heavy 736.72 / 717.426 4927.0 40.763075828552246 39 13 10 6 10 2.077992180675476 42.29196698036294 0.032901763916015625 3 0.9234921626750819 4.433031506504725 4927.0 17.58825179235263 0.0 - - - - - - - 258.3529411764706 9 17 ADAM2 ADAM metallopeptidase domain 2 1455 185 C20140704_OR004_03 C20140704_OR004_03 TB414088.[MT7]-MDSNFDSLPVQITVPEK[MT7].3b7_1.heavy 736.72 / 941.379 7972.0 40.763075828552246 39 13 10 6 10 2.077992180675476 42.29196698036294 0.032901763916015625 3 0.9234921626750819 4.433031506504725 7972.0 30.784732142857145 0.0 - - - - - - - 229.6875 15 16 ADAM2 ADAM metallopeptidase domain 2 1457 186 C20140704_OR004_03 C20140704_OR004_03 TB451246.[MT7]-IGFGSFVEK[MT7].3b5_1.heavy 424.579 / 606.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1459 186 C20140704_OR004_03 C20140704_OR004_03 TB451246.[MT7]-IGFGSFVEK[MT7].3y4_1.heavy 424.579 / 666.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1461 186 C20140704_OR004_03 C20140704_OR004_03 TB451246.[MT7]-IGFGSFVEK[MT7].3b3_1.heavy 424.579 / 462.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1463 186 C20140704_OR004_03 C20140704_OR004_03 TB451246.[MT7]-IGFGSFVEK[MT7].3b8_2.heavy 424.579 / 491.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1465 187 C20140704_OR004_03 C20140704_OR004_03 TB413821.[MT7]-SHPLLSQSYELR.3y7_1.heavy 525.287 / 882.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 1467 187 C20140704_OR004_03 C20140704_OR004_03 TB413821.[MT7]-SHPLLSQSYELR.3y4_1.heavy 525.287 / 580.309 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 1469 187 C20140704_OR004_03 C20140704_OR004_03 TB413821.[MT7]-SHPLLSQSYELR.3y8_1.heavy 525.287 / 995.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 1471 187 C20140704_OR004_03 C20140704_OR004_03 TB413821.[MT7]-SHPLLSQSYELR.3y5_1.heavy 525.287 / 667.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIAA1267 KIAA1267 1473 188 C20140704_OR004_03 C20140704_OR004_03 TB451787.[MT7]-VQVLTAGSLMGLGDIISQQLVERR.4y10_2.heavy 682.638 / 621.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPV17 MpV17 mitochondrial inner membrane protein 1475 188 C20140704_OR004_03 C20140704_OR004_03 TB451787.[MT7]-VQVLTAGSLMGLGDIISQQLVERR.4y15_2.heavy 682.638 / 857.967 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPV17 MpV17 mitochondrial inner membrane protein 1477 188 C20140704_OR004_03 C20140704_OR004_03 TB451787.[MT7]-VQVLTAGSLMGLGDIISQQLVERR.4b4_1.heavy 682.638 / 584.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPV17 MpV17 mitochondrial inner membrane protein 1479 188 C20140704_OR004_03 C20140704_OR004_03 TB451787.[MT7]-VQVLTAGSLMGLGDIISQQLVERR.4y14_2.heavy 682.638 / 792.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPV17 MpV17 mitochondrial inner membrane protein 1481 189 C20140704_OR004_03 C20140704_OR004_03 TB427966.[MT7]-NIFRDC[CAM]NK[MT7].2y4_1.heavy 677.861 / 680.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 1483 189 C20140704_OR004_03 C20140704_OR004_03 TB427966.[MT7]-NIFRDC[CAM]NK[MT7].2b3_1.heavy 677.861 / 519.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 1485 189 C20140704_OR004_03 C20140704_OR004_03 TB427966.[MT7]-NIFRDC[CAM]NK[MT7].2y3_1.heavy 677.861 / 565.288 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 1487 189 C20140704_OR004_03 C20140704_OR004_03 TB427966.[MT7]-NIFRDC[CAM]NK[MT7].2b5_1.heavy 677.861 / 790.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 1489 190 C20140704_OR004_03 C20140704_OR004_03 TB451788.[MT7]-LSENNIQTIFAVTEEFQPVYK[MT7].3b6_1.heavy 920.156 / 815.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1491 190 C20140704_OR004_03 C20140704_OR004_03 TB451788.[MT7]-LSENNIQTIFAVTEEFQPVYK[MT7].3b5_1.heavy 920.156 / 702.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1493 190 C20140704_OR004_03 C20140704_OR004_03 TB451788.[MT7]-LSENNIQTIFAVTEEFQPVYK[MT7].3y4_1.heavy 920.156 / 650.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1495 190 C20140704_OR004_03 C20140704_OR004_03 TB451788.[MT7]-LSENNIQTIFAVTEEFQPVYK[MT7].3b7_1.heavy 920.156 / 943.497 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1497 191 C20140704_OR004_03 C20140704_OR004_03 TB427965.[MT7]-LFMILWLK[MT7].3y3_1.heavy 451.285 / 590.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1499 191 C20140704_OR004_03 C20140704_OR004_03 TB427965.[MT7]-LFMILWLK[MT7].3b4_1.heavy 451.285 / 649.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1501 191 C20140704_OR004_03 C20140704_OR004_03 TB427965.[MT7]-LFMILWLK[MT7].3b5_1.heavy 451.285 / 762.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1503 191 C20140704_OR004_03 C20140704_OR004_03 TB427965.[MT7]-LFMILWLK[MT7].3b3_1.heavy 451.285 / 536.302 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1505 192 C20140704_OR004_03 C20140704_OR004_03 TB413952.[MT7]-MGIYGSVPYLLAHK[MT7].3b6_1.heavy 613.014 / 753.372 3428.0 40.78830146789551 44 18 10 6 10 20.700559167166 4.830787380787958 0.034000396728515625 3 0.9850797314560934 10.0909623110784 3428.0 34.480833065409215 0.0 - - - - - - - 213.92307692307693 6 13 GANC glucosidase, alpha; neutral C 1507 192 C20140704_OR004_03 C20140704_OR004_03 TB413952.[MT7]-MGIYGSVPYLLAHK[MT7].3b4_1.heavy 613.014 / 609.319 3057.0 40.78830146789551 44 18 10 6 10 20.700559167166 4.830787380787958 0.034000396728515625 3 0.9850797314560934 10.0909623110784 3057.0 7.540571499603773 0.0 - - - - - - - 311.14285714285717 6 14 GANC glucosidase, alpha; neutral C 1509 192 C20140704_OR004_03 C20140704_OR004_03 TB413952.[MT7]-MGIYGSVPYLLAHK[MT7].3b5_1.heavy 613.014 / 666.34 2223.0 40.78830146789551 44 18 10 6 10 20.700559167166 4.830787380787958 0.034000396728515625 3 0.9850797314560934 10.0909623110784 2223.0 0.0 1.0 - - - - - - - 220.92307692307693 4 13 GANC glucosidase, alpha; neutral C 1511 192 C20140704_OR004_03 C20140704_OR004_03 TB413952.[MT7]-MGIYGSVPYLLAHK[MT7].3b7_1.heavy 613.014 / 852.441 3335.0 40.78830146789551 44 18 10 6 10 20.700559167166 4.830787380787958 0.034000396728515625 3 0.9850797314560934 10.0909623110784 3335.0 32.28871185407688 0.0 - - - - - - - 211.92857142857142 6 14 GANC glucosidase, alpha; neutral C 1513 193 C20140704_OR004_03 C20140704_OR004_03 TB428164.[MT7]-DSQVVQVVLDGLK[MT7].3b6_1.heavy 563.333 / 801.422 19916.0 43.95159912109375 35 9 10 6 10 8.399760941700883 11.905100715848565 0.0316009521484375 3 0.8145499329677512 2.820308385627618 19916.0 145.6015709122296 0.0 - - - - - - - 181.72727272727272 39 11 KPNA3 karyopherin alpha 3 (importin alpha 4) 1515 193 C20140704_OR004_03 C20140704_OR004_03 TB428164.[MT7]-DSQVVQVVLDGLK[MT7].3b4_1.heavy 563.333 / 574.295 10750.0 43.95159912109375 35 9 10 6 10 8.399760941700883 11.905100715848565 0.0316009521484375 3 0.8145499329677512 2.820308385627618 10750.0 82.56 0.0 - - - - - - - 166.625 21 8 KPNA3 karyopherin alpha 3 (importin alpha 4) 1517 193 C20140704_OR004_03 C20140704_OR004_03 TB428164.[MT7]-DSQVVQVVLDGLK[MT7].3y4_1.heavy 563.333 / 576.347 18666.0 43.95159912109375 35 9 10 6 10 8.399760941700883 11.905100715848565 0.0316009521484375 3 0.8145499329677512 2.820308385627618 18666.0 39.7863309352518 1.0 - - - - - - - 196.05882352941177 37 17 KPNA3 karyopherin alpha 3 (importin alpha 4) 1519 193 C20140704_OR004_03 C20140704_OR004_03 TB428164.[MT7]-DSQVVQVVLDGLK[MT7].3y5_1.heavy 563.333 / 689.431 16416.0 43.95159912109375 35 9 10 6 10 8.399760941700883 11.905100715848565 0.0316009521484375 3 0.8145499329677512 2.820308385627618 16416.0 213.43503510444657 0.0 - - - - - - - 208.28571428571428 32 14 KPNA3 karyopherin alpha 3 (importin alpha 4) 1521 194 C20140704_OR004_03 C20140704_OR004_03 TB451578.[MT7]-YLIQDSSILQK[MT7].2b3_1.heavy 798.466 / 534.341 2940.0 36.80730056762695 45 15 10 10 10 1.7649815296146139 40.17355372557616 0.0 3 0.953237536939803 5.6846874504421905 2940.0 18.833333333333332 1.0 - - - - - - - 336.0 7 7 RICTOR RPTOR independent companion of MTOR, complex 2 1523 194 C20140704_OR004_03 C20140704_OR004_03 TB451578.[MT7]-YLIQDSSILQK[MT7].2y3_1.heavy 798.466 / 532.357 2205.0 36.80730056762695 45 15 10 10 10 1.7649815296146139 40.17355372557616 0.0 3 0.953237536939803 5.6846874504421905 2205.0 15.45 0.0 - - - - - - - 147.0 4 4 RICTOR RPTOR independent companion of MTOR, complex 2 1525 194 C20140704_OR004_03 C20140704_OR004_03 TB451578.[MT7]-YLIQDSSILQK[MT7].2y6_1.heavy 798.466 / 819.506 1470.0 36.80730056762695 45 15 10 10 10 1.7649815296146139 40.17355372557616 0.0 3 0.953237536939803 5.6846874504421905 1470.0 3.533333333333333 0.0 - - - - - - - 238.875 2 8 RICTOR RPTOR independent companion of MTOR, complex 2 1527 194 C20140704_OR004_03 C20140704_OR004_03 TB451578.[MT7]-YLIQDSSILQK[MT7].2y7_1.heavy 798.466 / 934.533 2940.0 36.80730056762695 45 15 10 10 10 1.7649815296146139 40.17355372557616 0.0 3 0.953237536939803 5.6846874504421905 2940.0 27.98 0.0 - - - - - - - 220.5 5 4 RICTOR RPTOR independent companion of MTOR, complex 2 1529 195 C20140704_OR004_03 C20140704_OR004_03 TB451276.[MT7]-LAEEHSS.2y4_2.heavy 458.728 / 230.095 643.0 16.768374919891357 30 7 10 3 10 0.32146027058314175 116.42347036343415 0.06669998168945312 3 0.7018921790407582 2.201625362036636 643.0 5.291946902654867 0.0 - - - - - - - 0.0 1 0 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1531 195 C20140704_OR004_03 C20140704_OR004_03 TB451276.[MT7]-LAEEHSS.2b5_2.heavy 458.728 / 362.691 7489.0 16.768374919891357 30 7 10 3 10 0.32146027058314175 116.42347036343415 0.06669998168945312 3 0.7018921790407582 2.201625362036636 7489.0 100.99998454839164 0.0 - - - - - - - 142.66666666666666 14 9 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1533 195 C20140704_OR004_03 C20140704_OR004_03 TB451276.[MT7]-LAEEHSS.2y5_1.heavy 458.728 / 588.226 265.0 16.768374919891357 30 7 10 3 10 0.32146027058314175 116.42347036343415 0.06669998168945312 3 0.7018921790407582 2.201625362036636 265.0 0.0 5.0 - - - - - - - 0.0 0 0 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1535 195 C20140704_OR004_03 C20140704_OR004_03 TB451276.[MT7]-LAEEHSS.2b4_1.heavy 458.728 / 587.316 6203.0 16.768374919891357 30 7 10 3 10 0.32146027058314175 116.42347036343415 0.06669998168945312 3 0.7018921790407582 2.201625362036636 6203.0 183.46526663575236 0.0 - - - - - - - 106.1 12 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1537 196 C20140704_OR004_03 C20140704_OR004_03 TB451576.[MT7]-LLC[CAM]DIGHSEEK[MT7].3y3_1.heavy 530.28 / 549.3 14513.0 29.250199794769287 46 20 10 6 10 10.496319533653569 9.527148985830456 0.03479957580566406 3 0.9975265946261533 24.809908558483436 14513.0 74.05057266599867 0.0 - - - - - - - 204.5625 29 16 RICTOR RPTOR independent companion of MTOR, complex 2 1539 196 C20140704_OR004_03 C20140704_OR004_03 TB451576.[MT7]-LLC[CAM]DIGHSEEK[MT7].3b6_1.heavy 530.28 / 816.441 11387.0 29.250199794769287 46 20 10 6 10 10.496319533653569 9.527148985830456 0.03479957580566406 3 0.9975265946261533 24.809908558483436 11387.0 168.31609468528933 0.0 - - - - - - - 179.75 22 12 RICTOR RPTOR independent companion of MTOR, complex 2 1541 196 C20140704_OR004_03 C20140704_OR004_03 TB451576.[MT7]-LLC[CAM]DIGHSEEK[MT7].3b4_1.heavy 530.28 / 646.335 46740.0 29.250199794769287 46 20 10 6 10 10.496319533653569 9.527148985830456 0.03479957580566406 3 0.9975265946261533 24.809908558483436 46740.0 250.9530201342282 0.0 - - - - - - - 228.92307692307693 93 13 RICTOR RPTOR independent companion of MTOR, complex 2 1543 196 C20140704_OR004_03 C20140704_OR004_03 TB451576.[MT7]-LLC[CAM]DIGHSEEK[MT7].3y4_1.heavy 530.28 / 636.332 40637.0 29.250199794769287 46 20 10 6 10 10.496319533653569 9.527148985830456 0.03479957580566406 3 0.9975265946261533 24.809908558483436 40637.0 258.5690715382069 0.0 - - - - - - - 223.21428571428572 81 14 RICTOR RPTOR independent companion of MTOR, complex 2 1545 197 C20140704_OR004_03 C20140704_OR004_03 TB451476.[MT7]-LFMILWLK[MT7].2y4_1.heavy 676.424 / 703.462 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1547 197 C20140704_OR004_03 C20140704_OR004_03 TB451476.[MT7]-LFMILWLK[MT7].2b3_1.heavy 676.424 / 536.302 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1549 197 C20140704_OR004_03 C20140704_OR004_03 TB451476.[MT7]-LFMILWLK[MT7].2b4_1.heavy 676.424 / 649.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1551 197 C20140704_OR004_03 C20140704_OR004_03 TB451476.[MT7]-LFMILWLK[MT7].2y3_1.heavy 676.424 / 590.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLIC2;CLIC4;CLIC5;CLIC6 chloride intracellular channel 2;chloride intracellular channel 4;chloride intracellular channel 5;chloride intracellular channel 6 1553 198 C20140704_OR004_03 C20140704_OR004_03 TB428260.[MT7]-LTGEPLYNAVVWLDLR.3y6_1.heavy 668.374 / 801.462 27950.0 52.24509811401367 47 17 10 10 10 3.14578049492143 26.532471708087158 0.0 3 0.9754089668656608 7.853802273939228 27950.0 257.68536585365854 0.0 - - - - - - - 256.0 55 6 GK2 glycerol kinase 2 1555 198 C20140704_OR004_03 C20140704_OR004_03 TB428260.[MT7]-LTGEPLYNAVVWLDLR.3b6_1.heavy 668.374 / 755.442 24366.0 52.24509811401367 47 17 10 10 10 3.14578049492143 26.532471708087158 0.0 3 0.9754089668656608 7.853802273939228 24366.0 91.17649956304123 0.0 - - - - - - - 322.0 48 7 GK2 glycerol kinase 2 1557 198 C20140704_OR004_03 C20140704_OR004_03 TB428260.[MT7]-LTGEPLYNAVVWLDLR.3b4_1.heavy 668.374 / 545.305 35833.0 52.24509811401367 47 17 10 10 10 3.14578049492143 26.532471708087158 0.0 3 0.9754089668656608 7.853802273939228 35833.0 116.60599666322396 0.0 - - - - - - - 217.625 71 8 GK2 glycerol kinase 2 1559 198 C20140704_OR004_03 C20140704_OR004_03 TB428260.[MT7]-LTGEPLYNAVVWLDLR.3y5_1.heavy 668.374 / 702.393 21500.0 52.24509811401367 47 17 10 10 10 3.14578049492143 26.532471708087158 0.0 3 0.9754089668656608 7.853802273939228 21500.0 234.4580698729003 0.0 - - - - - - - 175.28571428571428 43 7 GK2 glycerol kinase 2 1561 199 C20140704_OR004_03 C20140704_OR004_03 TB451477.[MT7]-FVPLTHLDLR.3y6_1.heavy 452.27 / 754.421 1218.0 38.179473876953125 39 16 10 3 10 2.3915666899646744 37.08686992054301 0.051300048828125 3 0.9606598737974199 6.201694192225479 1218.0 15.465394736842105 0.0 - - - - - - - 228.16666666666666 2 6 SLITRK5;SLITRK6 SLIT and NTRK-like family, member 5;SLIT and NTRK-like family, member 6 1563 199 C20140704_OR004_03 C20140704_OR004_03 TB451477.[MT7]-FVPLTHLDLR.3b4_1.heavy 452.27 / 601.383 2892.0 38.179473876953125 39 16 10 3 10 2.3915666899646744 37.08686992054301 0.051300048828125 3 0.9606598737974199 6.201694192225479 2892.0 17.69447368421053 0.0 - - - - - - - 253.33333333333334 5 3 SLITRK5;SLITRK6 SLIT and NTRK-like family, member 5;SLIT and NTRK-like family, member 6 1565 199 C20140704_OR004_03 C20140704_OR004_03 TB451477.[MT7]-FVPLTHLDLR.3y4_1.heavy 452.27 / 516.314 3196.0 38.179473876953125 39 16 10 3 10 2.3915666899646744 37.08686992054301 0.051300048828125 3 0.9606598737974199 6.201694192225479 3196.0 0.0 1.0 - - - - - - - 457.0 6 2 SLITRK5;SLITRK6 SLIT and NTRK-like family, member 5;SLIT and NTRK-like family, member 6 1567 199 C20140704_OR004_03 C20140704_OR004_03 TB451477.[MT7]-FVPLTHLDLR.3y5_1.heavy 452.27 / 653.373 3348.0 38.179473876953125 39 16 10 3 10 2.3915666899646744 37.08686992054301 0.051300048828125 3 0.9606598737974199 6.201694192225479 3348.0 31.938157894736843 0.0 - - - - - - - 304.0 6 2 SLITRK5;SLITRK6 SLIT and NTRK-like family, member 5;SLIT and NTRK-like family, member 6 1569 200 C20140704_OR004_03 C20140704_OR004_03 TB427959.[MT7]-LRWMLDNVR.2b4_1.heavy 673.878 / 731.414 2042.0 37.087650299072266 43 18 10 5 10 6.243326015996969 16.01710366297946 0.0449981689453125 3 0.9801586664830025 8.74694171932116 2042.0 1.2713234038192187 4.0 - - - - - - - 255.375 6 8 GK2 glycerol kinase 2 1571 200 C20140704_OR004_03 C20140704_OR004_03 TB427959.[MT7]-LRWMLDNVR.2b6_1.heavy 673.878 / 959.525 8604.0 37.087650299072266 43 18 10 5 10 6.243326015996969 16.01710366297946 0.0449981689453125 3 0.9801586664830025 8.74694171932116 8604.0 12.535361292691883 0.0 - - - - - - - 250.14285714285714 17 7 GK2 glycerol kinase 2 1573 200 C20140704_OR004_03 C20140704_OR004_03 TB427959.[MT7]-LRWMLDNVR.2b7_1.heavy 673.878 / 1073.57 3354.0 37.087650299072266 43 18 10 5 10 6.243326015996969 16.01710366297946 0.0449981689453125 3 0.9801586664830025 8.74694171932116 3354.0 4.331287197943444 0.0 - - - - - - - 275.44444444444446 6 9 GK2 glycerol kinase 2 1575 200 C20140704_OR004_03 C20140704_OR004_03 TB427959.[MT7]-LRWMLDNVR.2y7_1.heavy 673.878 / 933.461 4375.0 37.087650299072266 43 18 10 5 10 6.243326015996969 16.01710366297946 0.0449981689453125 3 0.9801586664830025 8.74694171932116 4375.0 16.43397988674546 0.0 - - - - - - - 200.625 8 8 GK2 glycerol kinase 2 1577 201 C20140704_OR004_03 C20140704_OR004_03 TB451573.[MT7]-MSPEFVAVQPGK[MT7].3b6_1.heavy 526.625 / 835.414 6926.0 32.34090042114258 47 17 10 10 10 3.72785693375065 20.66512492289321 0.0 3 0.9778717638133048 8.281039461599567 6926.0 45.22683380439993 0.0 - - - - - - - 225.75 13 4 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 1579 201 C20140704_OR004_03 C20140704_OR004_03 TB451573.[MT7]-MSPEFVAVQPGK[MT7].3b4_1.heavy 526.625 / 589.277 21983.0 32.34090042114258 47 17 10 10 10 3.72785693375065 20.66512492289321 0.0 3 0.9778717638133048 8.281039461599567 21983.0 64.70391551141091 0.0 - - - - - - - 245.33333333333334 43 9 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 1581 201 C20140704_OR004_03 C20140704_OR004_03 TB451573.[MT7]-MSPEFVAVQPGK[MT7].3b5_1.heavy 526.625 / 736.346 17366.0 32.34090042114258 47 17 10 10 10 3.72785693375065 20.66512492289321 0.0 3 0.9778717638133048 8.281039461599567 17366.0 57.06150967636441 1.0 - - - - - - - 238.5 40 8 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 1583 201 C20140704_OR004_03 C20140704_OR004_03 TB451573.[MT7]-MSPEFVAVQPGK[MT7].3b7_1.heavy 526.625 / 906.451 8131.0 32.34090042114258 47 17 10 10 10 3.72785693375065 20.66512492289321 0.0 3 0.9778717638133048 8.281039461599567 8131.0 45.081281962281615 0.0 - - - - - - - 245.44444444444446 16 9 ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 1585 202 C20140704_OR004_03 C20140704_OR004_03 TB427685.[MT7]-RPDEGWEAR.3y6_1.heavy 420.546 / 747.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1587 202 C20140704_OR004_03 C20140704_OR004_03 TB427685.[MT7]-RPDEGWEAR.3b5_1.heavy 420.546 / 699.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1589 202 C20140704_OR004_03 C20140704_OR004_03 TB427685.[MT7]-RPDEGWEAR.3b3_1.heavy 420.546 / 513.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1591 202 C20140704_OR004_03 C20140704_OR004_03 TB427685.[MT7]-RPDEGWEAR.3y5_1.heavy 420.546 / 618.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1593 203 C20140704_OR004_03 C20140704_OR004_03 TB451776.[MT7]-TREGNDLYHEMIESGVINLK[MT7].4b8_1.heavy 652.343 / 1093.54 1503.0 35.643699645996094 38 17 10 3 8 7.417836306394043 13.481020053489424 0.0522003173828125 4 0.9724472034972192 7.417836947940952 1503.0 14.963421926910298 1.0 - - - - - - - 225.5 3 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1595 203 C20140704_OR004_03 C20140704_OR004_03 TB451776.[MT7]-TREGNDLYHEMIESGVINLK[MT7].4y3_1.heavy 652.343 / 518.342 N/A 35.643699645996094 38 17 10 3 8 7.417836306394043 13.481020053489424 0.0522003173828125 4 0.9724472034972192 7.417836947940952 751.0 1.497840255167191 27.0 - - - - - - - 281.875 3 8 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1597 203 C20140704_OR004_03 C20140704_OR004_03 TB451776.[MT7]-TREGNDLYHEMIESGVINLK[MT7].4b6_1.heavy 652.343 / 817.392 N/A 35.643699645996094 38 17 10 3 8 7.417836306394043 13.481020053489424 0.0522003173828125 4 0.9724472034972192 7.417836947940952 301.0 1.84 25.0 - - - - - - - 0.0 1 0 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1599 203 C20140704_OR004_03 C20140704_OR004_03 TB451776.[MT7]-TREGNDLYHEMIESGVINLK[MT7].4b10_2.heavy 652.343 / 680.324 1202.0 35.643699645996094 38 17 10 3 8 7.417836306394043 13.481020053489424 0.0522003173828125 4 0.9724472034972192 7.417836947940952 1202.0 1.5455254044127416 7.0 - - - - - - - 319.375 2 8 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1601 204 C20140704_OR004_03 C20140704_OR004_03 TB451470.[MT7]-LLLLGAGESGK[MT7].2y8_1.heavy 673.418 / 862.475 26790.0 37.912750244140625 43 20 10 3 10 5.899652640065391 16.950150475111975 0.05010223388671875 3 0.9944057505550475 16.492587065319686 26790.0 223.9779242761693 0.0 - - - - - - - 299.25 53 4 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1603 204 C20140704_OR004_03 C20140704_OR004_03 TB451470.[MT7]-LLLLGAGESGK[MT7].2y5_1.heavy 673.418 / 621.332 18259.0 37.912750244140625 43 20 10 3 10 5.899652640065391 16.950150475111975 0.05010223388671875 3 0.9944057505550475 16.492587065319686 18259.0 71.07724666574953 0.0 - - - - - - - 249.66666666666666 36 6 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1605 204 C20140704_OR004_03 C20140704_OR004_03 TB451470.[MT7]-LLLLGAGESGK[MT7].2y9_1.heavy 673.418 / 975.559 18857.0 37.912750244140625 43 20 10 3 10 5.899652640065391 16.950150475111975 0.05010223388671875 3 0.9944057505550475 16.492587065319686 18857.0 90.57332392309925 0.0 - - - - - - - 336.75 37 8 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1607 204 C20140704_OR004_03 C20140704_OR004_03 TB451470.[MT7]-LLLLGAGESGK[MT7].2y7_1.heavy 673.418 / 749.391 41157.0 37.912750244140625 43 20 10 3 10 5.899652640065391 16.950150475111975 0.05010223388671875 3 0.9944057505550475 16.492587065319686 41157.0 116.30830854454392 0.0 - - - - - - - 239.4 82 5 GNAI1;GNAI2;GNAI3;GNAL;GNAO1;GNAS;GNAT1;GNAT2;GNAT3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O;GNAS complex locus;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2;guanine nucleotide binding protein, alpha transducing 3 1609 205 C20140704_OR004_03 C20140704_OR004_03 TB451371.[MT7]-VAAAPASGALR.2y8_1.heavy 564.336 / 742.421 10697.0 23.503125190734863 43 17 10 6 10 3.2259675980350546 24.231988621594212 0.036899566650390625 3 0.9713634140157973 7.275450200028525 10697.0 27.912760506910587 0.0 - - - - - - - 229.92307692307693 21 13 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1611 205 C20140704_OR004_03 C20140704_OR004_03 TB451371.[MT7]-VAAAPASGALR.2y9_1.heavy 564.336 / 813.458 11693.0 23.503125190734863 43 17 10 6 10 3.2259675980350546 24.231988621594212 0.036899566650390625 3 0.9713634140157973 7.275450200028525 11693.0 256.11506390977445 0.0 - - - - - - - 166.0 23 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1613 205 C20140704_OR004_03 C20140704_OR004_03 TB451371.[MT7]-VAAAPASGALR.2y10_1.heavy 564.336 / 884.495 33950.0 23.503125190734863 43 17 10 6 10 3.2259675980350546 24.231988621594212 0.036899566650390625 3 0.9713634140157973 7.275450200028525 33950.0 101.36630800455973 0.0 - - - - - - - 225.9 67 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1615 205 C20140704_OR004_03 C20140704_OR004_03 TB451371.[MT7]-VAAAPASGALR.2y7_1.heavy 564.336 / 671.383 40926.0 23.503125190734863 43 17 10 6 10 3.2259675980350546 24.231988621594212 0.036899566650390625 3 0.9713634140157973 7.275450200028525 40926.0 104.55636170981337 0.0 - - - - - - - 175.0 81 11 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1617 206 C20140704_OR004_03 C20140704_OR004_03 TB451672.[MT7]-TAAVGPLVGAVVQGTNSTR.2y12_1.heavy 971.546 / 1188.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - GK2 glycerol kinase 2 1619 206 C20140704_OR004_03 C20140704_OR004_03 TB451672.[MT7]-TAAVGPLVGAVVQGTNSTR.2b7_1.heavy 971.546 / 754.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - GK2 glycerol kinase 2 1621 206 C20140704_OR004_03 C20140704_OR004_03 TB451672.[MT7]-TAAVGPLVGAVVQGTNSTR.2b5_1.heavy 971.546 / 544.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - GK2 glycerol kinase 2 1623 206 C20140704_OR004_03 C20140704_OR004_03 TB451672.[MT7]-TAAVGPLVGAVVQGTNSTR.2y11_1.heavy 971.546 / 1089.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - GK2 glycerol kinase 2 1625 207 C20140704_OR004_03 C20140704_OR004_03 TB414095.[MT7]-INEALITTILHLLNHPK[MT7].4b5_1.heavy 557.84 / 685.4 1397.0 52.52605056762695 28 3 10 5 10 0.41550834937741393 110.33070237602932 0.04309844970703125 3 0.5433995106891196 1.7517847032031255 1397.0 22.306935483870966 0.0 - - - - - - - 232.5 2 4 RICTOR RPTOR independent companion of MTOR, complex 2 1627 207 C20140704_OR004_03 C20140704_OR004_03 TB414095.[MT7]-INEALITTILHLLNHPK[MT7].4y7_2.heavy 557.84 / 501.802 3912.0 52.52605056762695 28 3 10 5 10 0.41550834937741393 110.33070237602932 0.04309844970703125 3 0.5433995106891196 1.7517847032031255 3912.0 26.48620240897134 0.0 - - - - - - - 310.3333333333333 7 6 RICTOR RPTOR independent companion of MTOR, complex 2 1629 207 C20140704_OR004_03 C20140704_OR004_03 TB414095.[MT7]-INEALITTILHLLNHPK[MT7].4b3_1.heavy 557.84 / 501.279 2235.0 52.52605056762695 28 3 10 5 10 0.41550834937741393 110.33070237602932 0.04309844970703125 3 0.5433995106891196 1.7517847032031255 2235.0 14.650012972412004 1.0 - - - - - - - 248.16666666666666 4 6 RICTOR RPTOR independent companion of MTOR, complex 2 1631 207 C20140704_OR004_03 C20140704_OR004_03 TB414095.[MT7]-INEALITTILHLLNHPK[MT7].4b4_1.heavy 557.84 / 572.316 466.0 52.52605056762695 28 3 10 5 10 0.41550834937741393 110.33070237602932 0.04309844970703125 3 0.5433995106891196 1.7517847032031255 466.0 -0.15032258064516135 0.0 - - - - - - - 0.0 0 0 RICTOR RPTOR independent companion of MTOR, complex 2 1633 208 C20140704_OR004_03 C20140704_OR004_03 TB451670.[MT7]-IATTGEANELLHTFLR.3y6_1.heavy 644.022 / 786.462 175.0 40.19567584991455 23 8 10 3 2 1.1398854743969133 59.34704002732438 0.06889724731445312 12 0.7642294677418737 2.4899462621036856 175.0 -0.4382716049382716 46.0 - - - - - - - 191.23809523809524 2 21 ADAM2 ADAM metallopeptidase domain 2 1635 208 C20140704_OR004_03 C20140704_OR004_03 TB451670.[MT7]-IATTGEANELLHTFLR.3b6_1.heavy 644.022 / 717.39 3665.0 40.19567584991455 23 8 10 3 2 1.1398854743969133 59.34704002732438 0.06889724731445312 12 0.7642294677418737 2.4899462621036856 3665.0 10.871712538226301 0.0 - - - - - - - 249.42857142857142 7 14 ADAM2 ADAM metallopeptidase domain 2 1637 208 C20140704_OR004_03 C20140704_OR004_03 TB451670.[MT7]-IATTGEANELLHTFLR.3y4_1.heavy 644.022 / 536.319 611.0 40.19567584991455 23 8 10 3 2 1.1398854743969133 59.34704002732438 0.06889724731445312 12 0.7642294677418737 2.4899462621036856 611.0 1.400573065902579 28.0 - - - - - - - 244.5 2 20 ADAM2 ADAM metallopeptidase domain 2 1639 208 C20140704_OR004_03 C20140704_OR004_03 TB451670.[MT7]-IATTGEANELLHTFLR.3y5_1.heavy 644.022 / 673.378 1222.0 40.19567584991455 23 8 10 3 2 1.1398854743969133 59.34704002732438 0.06889724731445312 12 0.7642294677418737 2.4899462621036856 1222.0 11.220729064039409 3.0 - - - - - - - 225.10526315789474 2 19 ADAM2 ADAM metallopeptidase domain 2 1641 209 C20140704_OR004_03 C20140704_OR004_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 220971.0 43.95423253377279 23 -3 10 6 10 null 0.0 0.0316009521484375 3 0.0 0.0 220971.0 472.73212387612386 0.0 - - - - - - - 149.93333333333334 441 15 1643 209 C20140704_OR004_03 C20140704_OR004_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 352436.0 43.95423253377279 23 -3 10 6 10 null 0.0 0.0316009521484375 3 0.0 0.0 352436.0 470.78910469169057 0.0 - - - - - - - 239.75 704 8 1645 209 C20140704_OR004_03 C20140704_OR004_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 267684.0 43.95423253377279 23 -3 10 6 10 null 0.0 0.0316009521484375 3 0.0 0.0 267684.0 640.2536219243782 0.0 - - - - - - - 658.1111111111111 535 9 1647 210 C20140704_OR004_03 C20140704_OR004_03 TB428258.[MT7]-NVQFVFDAVTDVIIK[MT7].3y6_1.heavy 666.05 / 832.526 12112.0 52.54759979248047 47 17 10 10 10 5.11103951883871 19.565491448737852 0.0 3 0.9762667994324126 7.995056182324509 12112.0 49.81279347210658 0.0 - - - - - - - 228.57142857142858 24 7 GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 1649 210 C20140704_OR004_03 C20140704_OR004_03 TB428258.[MT7]-NVQFVFDAVTDVIIK[MT7].3y3_1.heavy 666.05 / 517.383 24224.0 52.54759979248047 47 17 10 10 10 5.11103951883871 19.565491448737852 0.0 3 0.9762667994324126 7.995056182324509 24224.0 131.41779172610558 0.0 - - - - - - - 233.33333333333334 48 6 GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 1651 210 C20140704_OR004_03 C20140704_OR004_03 TB428258.[MT7]-NVQFVFDAVTDVIIK[MT7].3b5_1.heavy 666.05 / 732.416 24624.0 52.54759979248047 47 17 10 10 10 5.11103951883871 19.565491448737852 0.0 3 0.9762667994324126 7.995056182324509 24624.0 255.5204076294278 0.0 - - - - - - - 133.33333333333334 49 3 GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 1653 210 C20140704_OR004_03 C20140704_OR004_03 TB428258.[MT7]-NVQFVFDAVTDVIIK[MT7].3b7_1.heavy 666.05 / 994.511 11611.0 52.54759979248047 47 17 10 10 10 5.11103951883871 19.565491448737852 0.0 3 0.9762667994324126 7.995056182324509 11611.0 44.65890222074173 0.0 - - - - - - - 257.14285714285717 23 7 GNAI1;GNAI2;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 1655 211 C20140704_OR004_03 C20140704_OR004_03 TB427809.[MT7]-EILQNVAR.2b3_1.heavy 543.823 / 500.32 10268.0 27.856625080108643 44 18 10 6 10 4.31146867482498 23.193952581380962 0.03429985046386719 3 0.9859337168810818 10.393511450716828 10268.0 31.19085726294874 0.0 - - - - - - - 265.44444444444446 20 18 RICTOR RPTOR independent companion of MTOR, complex 2 1657 211 C20140704_OR004_03 C20140704_OR004_03 TB427809.[MT7]-EILQNVAR.2y5_1.heavy 543.823 / 587.326 17910.0 27.856625080108643 44 18 10 6 10 4.31146867482498 23.193952581380962 0.03429985046386719 3 0.9859337168810818 10.393511450716828 17910.0 231.97388913824057 0.0 - - - - - - - 214.0625 35 16 RICTOR RPTOR independent companion of MTOR, complex 2 1659 211 C20140704_OR004_03 C20140704_OR004_03 TB427809.[MT7]-EILQNVAR.2y6_1.heavy 543.823 / 700.41 19104.0 27.856625080108643 44 18 10 6 10 4.31146867482498 23.193952581380962 0.03429985046386719 3 0.9859337168810818 10.393511450716828 19104.0 417.90000000000003 0.0 - - - - - - - 182.64705882352942 38 17 RICTOR RPTOR independent companion of MTOR, complex 2 1661 211 C20140704_OR004_03 C20140704_OR004_03 TB427809.[MT7]-EILQNVAR.2y7_1.heavy 543.823 / 813.494 23721.0 27.856625080108643 44 18 10 6 10 4.31146867482498 23.193952581380962 0.03429985046386719 3 0.9859337168810818 10.393511450716828 23721.0 173.3773869257427 0.0 - - - - - - - 195.45454545454547 47 11 RICTOR RPTOR independent companion of MTOR, complex 2 1663 212 C20140704_OR004_03 C20140704_OR004_03 TB451668.[MT7]-TMLFNIHSLEWDK[MT7].4b4_1.heavy 481.258 / 637.35 N/A N/A - - - - - - - - - 0.0 - - - - - - - GK;GK2 glycerol kinase;glycerol kinase 2 1665 212 C20140704_OR004_03 C20140704_OR004_03 TB451668.[MT7]-TMLFNIHSLEWDK[MT7].4b5_1.heavy 481.258 / 751.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - GK;GK2 glycerol kinase;glycerol kinase 2 1667 212 C20140704_OR004_03 C20140704_OR004_03 TB451668.[MT7]-TMLFNIHSLEWDK[MT7].4b6_1.heavy 481.258 / 864.477 N/A N/A - - - - - - - - - 0.0 - - - - - - - GK;GK2 glycerol kinase;glycerol kinase 2 1669 212 C20140704_OR004_03 C20140704_OR004_03 TB451668.[MT7]-TMLFNIHSLEWDK[MT7].4b3_1.heavy 481.258 / 490.282 N/A N/A - - - - - - - - - 0.0 - - - - - - - GK;GK2 glycerol kinase;glycerol kinase 2 1671 213 C20140704_OR004_03 C20140704_OR004_03 TB428156.[MT7]-DNLGIIETSGDIER.2y9_1.heavy 838.435 / 1019.5 1876.0 34.167901039123535 26 13 0 5 8 2.7050940182431895 29.468571410303333 0.049198150634765625 4 0.911940248339812 4.127945125132648 1876.0 10.455869966516698 0.0 - - - - - - - 288.85714285714283 3 7 GK2 glycerol kinase 2 1673 213 C20140704_OR004_03 C20140704_OR004_03 TB428156.[MT7]-DNLGIIETSGDIER.2b5_1.heavy 838.435 / 657.369 2165.0 34.167901039123535 26 13 0 5 8 2.7050940182431895 29.468571410303333 0.049198150634765625 4 0.911940248339812 4.127945125132648 2165.0 12.041695501730104 1.0 - - - - - - - 288.8 21 5 GK2 glycerol kinase 2 1675 213 C20140704_OR004_03 C20140704_OR004_03 TB428156.[MT7]-DNLGIIETSGDIER.2y11_1.heavy 838.435 / 1189.61 1154.0 34.167901039123535 26 13 0 5 8 2.7050940182431895 29.468571410303333 0.049198150634765625 4 0.911940248339812 4.127945125132648 1154.0 8.815277777777778 0.0 - - - - - - - 201.8 2 5 GK2 glycerol kinase 2 1677 213 C20140704_OR004_03 C20140704_OR004_03 TB428156.[MT7]-DNLGIIETSGDIER.2y7_1.heavy 838.435 / 777.374 1587.0 34.167901039123535 26 13 0 5 8 2.7050940182431895 29.468571410303333 0.049198150634765625 4 0.911940248339812 4.127945125132648 1587.0 2.581243510104836 1.0 - - - - - - - 230.8 3 5 GK2 glycerol kinase 2 1679 214 C20140704_OR004_03 C20140704_OR004_03 TB427947.[MT7]-ADVSLYNEK[MT7].3y3_1.heavy 442.91 / 534.3 4693.0 26.782400131225586 50 20 10 10 10 83.02943515679978 1.2043921509420314 0.0 3 0.9999114665751743 131.16124584090747 4693.0 5.759716441880947 0.0 - - - - - - - 691.4285714285714 9 7 ADAM2 ADAM metallopeptidase domain 2 1681 214 C20140704_OR004_03 C20140704_OR004_03 TB427947.[MT7]-ADVSLYNEK[MT7].3b4_1.heavy 442.91 / 517.274 7993.0 26.782400131225586 50 20 10 10 10 83.02943515679978 1.2043921509420314 0.0 3 0.9999114665751743 131.16124584090747 7993.0 27.111918090991665 0.0 - - - - - - - 185.47058823529412 15 17 ADAM2 ADAM metallopeptidase domain 2 1683 214 C20140704_OR004_03 C20140704_OR004_03 TB427947.[MT7]-ADVSLYNEK[MT7].3b5_1.heavy 442.91 / 630.358 1687.0 26.782400131225586 50 20 10 10 10 83.02943515679978 1.2043921509420314 0.0 3 0.9999114665751743 131.16124584090747 1687.0 10.65170648464164 0.0 - - - - - - - 219.9090909090909 3 11 ADAM2 ADAM metallopeptidase domain 2 1685 214 C20140704_OR004_03 C20140704_OR004_03 TB427947.[MT7]-ADVSLYNEK[MT7].3y4_1.heavy 442.91 / 697.364 1173.0 26.782400131225586 50 20 10 10 10 83.02943515679978 1.2043921509420314 0.0 3 0.9999114665751743 131.16124584090747 1173.0 12.854794520547948 0.0 - - - - - - - 183.3 2 10 ADAM2 ADAM metallopeptidase domain 2 1687 215 C20140704_OR004_03 C20140704_OR004_03 TB427944.[MT7]-LQGVSNMRK[MT7].2y8_1.heavy 660.887 / 1063.58 3000.0 22.990724563598633 44 18 10 6 10 5.127408162845379 19.50303093181224 0.03730010986328125 3 0.9865600083407359 10.633476060573413 3000.0 21.428571428571427 0.0 - - - - - - - 179.25 6 8 RICTOR RPTOR independent companion of MTOR, complex 2 1689 215 C20140704_OR004_03 C20140704_OR004_03 TB427944.[MT7]-LQGVSNMRK[MT7].2y5_1.heavy 660.887 / 779.431 783.0 22.990724563598633 44 18 10 6 10 5.127408162845379 19.50303093181224 0.03730010986328125 3 0.9865600083407359 10.633476060573413 783.0 14.263384615384615 0.0 - - - - - - - 0.0 1 0 RICTOR RPTOR independent companion of MTOR, complex 2 1691 215 C20140704_OR004_03 C20140704_OR004_03 TB427944.[MT7]-LQGVSNMRK[MT7].2b4_1.heavy 660.887 / 542.342 913.0 22.990724563598633 44 18 10 6 10 5.127408162845379 19.50303093181224 0.03730010986328125 3 0.9865600083407359 10.633476060573413 913.0 3.8478927203065134 2.0 - - - - - - - 0.0 1 0 RICTOR RPTOR independent companion of MTOR, complex 2 1693 215 C20140704_OR004_03 C20140704_OR004_03 TB427944.[MT7]-LQGVSNMRK[MT7].2y7_1.heavy 660.887 / 935.521 2478.0 22.990724563598633 44 18 10 6 10 5.127408162845379 19.50303093181224 0.03730010986328125 3 0.9865600083407359 10.633476060573413 2478.0 28.592307692307692 0.0 - - - - - - - 123.8 4 10 RICTOR RPTOR independent companion of MTOR, complex 2 1695 216 C20140704_OR004_03 C20140704_OR004_03 TB427945.[MT7]-TAELLSHHK[MT7].2y4_1.heavy 662.385 / 652.365 1329.0 20.840550422668457 34 14 4 6 10 2.1865552733540006 45.73403710330543 0.03709983825683594 3 0.9378938068174306 4.926303643106942 1329.0 10.007530120481928 0.0 - - - - - - - 196.88888888888889 2 9 GK2 glycerol kinase 2 1697 216 C20140704_OR004_03 C20140704_OR004_03 TB427945.[MT7]-TAELLSHHK[MT7].2b4_1.heavy 662.385 / 559.321 1606.0 20.840550422668457 34 14 4 6 10 2.1865552733540006 45.73403710330543 0.03709983825683594 3 0.9378938068174306 4.926303643106942 1606.0 20.439999999999998 0.0 - - - - - - - 158.0 3 7 GK2 glycerol kinase 2 1699 216 C20140704_OR004_03 C20140704_OR004_03 TB427945.[MT7]-TAELLSHHK[MT7].2y6_1.heavy 662.385 / 878.533 1440.0 20.840550422668457 34 14 4 6 10 2.1865552733540006 45.73403710330543 0.03709983825683594 3 0.9378938068174306 4.926303643106942 1440.0 26.181818181818183 0.0 - - - - - - - 147.5 2 6 GK2 glycerol kinase 2 1701 216 C20140704_OR004_03 C20140704_OR004_03 TB427945.[MT7]-TAELLSHHK[MT7].2b5_1.heavy 662.385 / 672.405 1052.0 20.840550422668457 34 14 4 6 10 2.1865552733540006 45.73403710330543 0.03709983825683594 3 0.9378938068174306 4.926303643106942 1052.0 4.975145944603155 1.0 - - - - - - - 228.25 5 8 GK2 glycerol kinase 2 1703 217 C20140704_OR004_03 C20140704_OR004_03 TB413742.[MT7]-EDSYANYFIR.2y8_1.heavy 711.345 / 1033.51 3188.0 36.818650245666504 33 10 10 5 8 1.1949353961019353 55.77480163201282 0.045398712158203125 4 0.8226414178639475 2.886010438783278 3188.0 11.54070926905402 0.0 - - - - - - - 303.75 6 8 SH3BP1 SH3-domain binding protein 1 1705 217 C20140704_OR004_03 C20140704_OR004_03 TB413742.[MT7]-EDSYANYFIR.2y9_1.heavy 711.345 / 1148.54 1063.0 36.818650245666504 33 10 10 5 8 1.1949353961019353 55.77480163201282 0.045398712158203125 4 0.8226414178639475 2.886010438783278 1063.0 3.6376846265862284 1.0 - - - - - - - 303.6666666666667 2 9 SH3BP1 SH3-domain binding protein 1 1707 217 C20140704_OR004_03 C20140704_OR004_03 TB413742.[MT7]-EDSYANYFIR.2b6_1.heavy 711.345 / 824.354 607.0 36.818650245666504 33 10 10 5 8 1.1949353961019353 55.77480163201282 0.045398712158203125 4 0.8226414178639475 2.886010438783278 607.0 1.2365203073545554 13.0 - - - - - - - 238.85714285714286 3 7 SH3BP1 SH3-domain binding protein 1 1709 217 C20140704_OR004_03 C20140704_OR004_03 TB413742.[MT7]-EDSYANYFIR.2y7_1.heavy 711.345 / 946.478 1063.0 36.818650245666504 33 10 10 5 8 1.1949353961019353 55.77480163201282 0.045398712158203125 4 0.8226414178639475 2.886010438783278 1063.0 3.742056327495014 6.0 - - - - - - - 303.8333333333333 2 6 SH3BP1 SH3-domain binding protein 1 1711 218 C20140704_OR004_03 C20140704_OR004_03 TB428406.[MT7]-MITVNASLFPSSVTNSLIAVGNDGLQER.4y5_1.heavy 770.157 / 602.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - RICTOR RPTOR independent companion of MTOR, complex 2 1713 218 C20140704_OR004_03 C20140704_OR004_03 TB428406.[MT7]-MITVNASLFPSSVTNSLIAVGNDGLQER.4y8_1.heavy 770.157 / 888.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - RICTOR RPTOR independent companion of MTOR, complex 2 1715 218 C20140704_OR004_03 C20140704_OR004_03 TB428406.[MT7]-MITVNASLFPSSVTNSLIAVGNDGLQER.4y16_2.heavy 770.157 / 843.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - RICTOR RPTOR independent companion of MTOR, complex 2 1717 218 C20140704_OR004_03 C20140704_OR004_03 TB428406.[MT7]-MITVNASLFPSSVTNSLIAVGNDGLQER.4y10_1.heavy 770.157 / 1058.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - RICTOR RPTOR independent companion of MTOR, complex 2 1719 219 C20140704_OR004_03 C20140704_OR004_03 TB428407.[MT7]-MITVNASLFPSSVTNSLIAVGNDGLQER.3b5_1.heavy 1026.54 / 703.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - RICTOR RPTOR independent companion of MTOR, complex 2 1721 219 C20140704_OR004_03 C20140704_OR004_03 TB428407.[MT7]-MITVNASLFPSSVTNSLIAVGNDGLQER.3y8_1.heavy 1026.54 / 888.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - RICTOR RPTOR independent companion of MTOR, complex 2 1723 219 C20140704_OR004_03 C20140704_OR004_03 TB428407.[MT7]-MITVNASLFPSSVTNSLIAVGNDGLQER.3y10_1.heavy 1026.54 / 1058.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - RICTOR RPTOR independent companion of MTOR, complex 2 1725 219 C20140704_OR004_03 C20140704_OR004_03 TB428407.[MT7]-MITVNASLFPSSVTNSLIAVGNDGLQER.3y16_2.heavy 1026.54 / 843.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - RICTOR RPTOR independent companion of MTOR, complex 2 1727 220 C20140704_OR004_03 C20140704_OR004_03 TB428147.[MT7]-TTGIVETHFTFK[MT7].4y4_1.heavy 417.985 / 686.399 413.0 33.522499084472656 37 7 10 10 10 0.3536745756769068 124.77502836654999 0.0 3 0.717947039780027 2.2668151777198036 413.0 0.7000000000000001 2.0 - - - - - - - 0.0 0 0 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1729 220 C20140704_OR004_03 C20140704_OR004_03 TB428147.[MT7]-TTGIVETHFTFK[MT7].4y5_1.heavy 417.985 / 823.458 275.0 33.522499084472656 37 7 10 10 10 0.3536745756769068 124.77502836654999 0.0 3 0.717947039780027 2.2668151777198036 275.0 0.995 1.0 - - - - - - - 0.0 0 0 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1731 220 C20140704_OR004_03 C20140704_OR004_03 TB428147.[MT7]-TTGIVETHFTFK[MT7].4y3_1.heavy 417.985 / 539.331 9218.0 33.522499084472656 37 7 10 10 10 0.3536745756769068 124.77502836654999 0.0 3 0.717947039780027 2.2668151777198036 9218.0 93.63739130434783 0.0 - - - - - - - 138.0 18 3 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1733 220 C20140704_OR004_03 C20140704_OR004_03 TB428147.[MT7]-TTGIVETHFTFK[MT7].4b4_1.heavy 417.985 / 517.31 8943.0 33.522499084472656 37 7 10 10 10 0.3536745756769068 124.77502836654999 0.0 3 0.717947039780027 2.2668151777198036 8943.0 75.42567059690494 0.0 - - - - - - - 275.5 17 4 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1735 221 C20140704_OR004_03 C20140704_OR004_03 TB428286.[MT7]-MERFEPQIQATESEIR.3y7_1.heavy 703.357 / 805.405 13146.0 33.618099212646484 42 12 10 10 10 2.472448401363345 40.44573789481653 0.0 3 0.8997543815727926 3.86485387466956 13146.0 118.6650140747389 0.0 - - - - - - - 175.75 26 8 GK2 glycerol kinase 2 1737 221 C20140704_OR004_03 C20140704_OR004_03 TB428286.[MT7]-MERFEPQIQATESEIR.3y8_1.heavy 703.357 / 933.464 6637.0 33.618099212646484 42 12 10 10 10 2.472448401363345 40.44573789481653 0.0 3 0.8997543815727926 3.86485387466956 6637.0 24.273203805492013 1.0 - - - - - - - 164.28571428571428 13 7 GK2 glycerol kinase 2 1739 221 C20140704_OR004_03 C20140704_OR004_03 TB428286.[MT7]-MERFEPQIQATESEIR.3b7_1.heavy 703.357 / 1062.52 10210.0 33.618099212646484 42 12 10 10 10 2.472448401363345 40.44573789481653 0.0 3 0.8997543815727926 3.86485387466956 10210.0 42.554424605285774 0.0 - - - - - - - 255.5 20 4 GK2 glycerol kinase 2 1741 221 C20140704_OR004_03 C20140704_OR004_03 TB428286.[MT7]-MERFEPQIQATESEIR.3b7_2.heavy 703.357 / 531.762 29099.0 33.618099212646484 42 12 10 10 10 2.472448401363345 40.44573789481653 0.0 3 0.8997543815727926 3.86485387466956 29099.0 168.21055412301905 0.0 - - - - - - - 223.5 58 4 GK2 glycerol kinase 2 1743 222 C20140704_OR004_03 C20140704_OR004_03 TB428148.[MT7]-TTGIVETHFTFK[MT7].2y4_1.heavy 834.964 / 686.399 2196.0 33.522499084472656 48 18 10 10 10 3.8075540094824505 26.263580175345353 0.0 3 0.9853002049543805 10.166542654054844 2196.0 8.519596059811494 0.0 - - - - - - - 274.4 4 5 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1745 222 C20140704_OR004_03 C20140704_OR004_03 TB428148.[MT7]-TTGIVETHFTFK[MT7].2b4_1.heavy 834.964 / 517.31 6587.0 33.522499084472656 48 18 10 10 10 3.8075540094824505 26.263580175345353 0.0 3 0.9853002049543805 10.166542654054844 6587.0 87.98693430656934 0.0 - - - - - - - 159.83333333333334 13 6 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1747 222 C20140704_OR004_03 C20140704_OR004_03 TB428148.[MT7]-TTGIVETHFTFK[MT7].2y3_1.heavy 834.964 / 539.331 5078.0 33.522499084472656 48 18 10 10 10 3.8075540094824505 26.263580175345353 0.0 3 0.9853002049543805 10.166542654054844 5078.0 31.41317518248175 0.0 - - - - - - - 205.5 10 4 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1749 222 C20140704_OR004_03 C20140704_OR004_03 TB428148.[MT7]-TTGIVETHFTFK[MT7].2y6_1.heavy 834.964 / 924.506 2059.0 33.522499084472656 48 18 10 10 10 3.8075540094824505 26.263580175345353 0.0 3 0.9853002049543805 10.166542654054844 2059.0 5.635264515442809 0.0 - - - - - - - 274.0 4 2 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1751 223 C20140704_OR004_03 C20140704_OR004_03 TB413878.[MT7]-DNLGIIETSGDIER.3y7_1.heavy 559.292 / 777.374 4885.0 34.155601501464844 48 18 10 10 10 5.565881520220915 17.966605943137452 0.0 3 0.9835707274289658 9.615166477340205 4885.0 21.874825986078886 0.0 - - - - - - - 287.5 9 6 GK2 glycerol kinase 2 1753 223 C20140704_OR004_03 C20140704_OR004_03 TB413878.[MT7]-DNLGIIETSGDIER.3y6_1.heavy 559.292 / 676.326 2730.0 34.155601501464844 48 18 10 10 10 5.565881520220915 17.966605943137452 0.0 3 0.9835707274289658 9.615166477340205 2730.0 3.8733672997908357 0.0 - - - - - - - 215.5 5 2 GK2 glycerol kinase 2 1755 223 C20140704_OR004_03 C20140704_OR004_03 TB413878.[MT7]-DNLGIIETSGDIER.3b5_1.heavy 559.292 / 657.369 7040.0 34.155601501464844 48 18 10 10 10 5.565881520220915 17.966605943137452 0.0 3 0.9835707274289658 9.615166477340205 7040.0 63.10296468161897 0.0 - - - - - - - 207.66666666666666 14 9 GK2 glycerol kinase 2 1757 223 C20140704_OR004_03 C20140704_OR004_03 TB413878.[MT7]-DNLGIIETSGDIER.3y8_1.heavy 559.292 / 906.416 4167.0 34.155601501464844 48 18 10 10 10 5.565881520220915 17.966605943137452 0.0 3 0.9835707274289658 9.615166477340205 4167.0 35.459760869565216 0.0 - - - - - - - 191.66666666666666 8 3 GK2 glycerol kinase 2 1759 224 C20140704_OR004_03 C20140704_OR004_03 TB413876.[MT7]-LDELNIDISNIK[MT7].3b4_1.heavy 558.989 / 615.347 29148.0 40.79680156707764 39 13 10 6 10 1.1694996895370768 57.652098963665004 0.034000396728515625 3 0.9088105405752821 4.055395260226725 29148.0 92.50973037731377 0.0 - - - - - - - 237.83333333333334 58 18 GK2 glycerol kinase 2 1761 224 C20140704_OR004_03 C20140704_OR004_03 TB413876.[MT7]-LDELNIDISNIK[MT7].3b5_1.heavy 558.989 / 729.39 44141.0 40.79680156707764 39 13 10 6 10 1.1694996895370768 57.652098963665004 0.034000396728515625 3 0.9088105405752821 4.055395260226725 44141.0 214.16785737845504 0.0 - - - - - - - 272.5 88 14 GK2 glycerol kinase 2 1763 224 C20140704_OR004_03 C20140704_OR004_03 TB413876.[MT7]-LDELNIDISNIK[MT7].3y4_1.heavy 558.989 / 605.374 68353.0 40.79680156707764 39 13 10 6 10 1.1694996895370768 57.652098963665004 0.034000396728515625 3 0.9088105405752821 4.055395260226725 68353.0 151.22260593694097 0.0 - - - - - - - 235.6 136 15 GK2 glycerol kinase 2 1765 224 C20140704_OR004_03 C20140704_OR004_03 TB413876.[MT7]-LDELNIDISNIK[MT7].3b3_1.heavy 558.989 / 502.263 47027.0 40.79680156707764 39 13 10 6 10 1.1694996895370768 57.652098963665004 0.034000396728515625 3 0.9088105405752821 4.055395260226725 47027.0 113.7729741424863 0.0 - - - - - - - 310.4 94 15 GK2 glycerol kinase 2 1767 225 C20140704_OR004_03 C20140704_OR004_03 TB451753.[MT7]-RLEDQLAGLQQELAALALK[MT7].4b8_1.heavy 592.851 / 1027.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1769 225 C20140704_OR004_03 C20140704_OR004_03 TB451753.[MT7]-RLEDQLAGLQQELAALALK[MT7].4b8_2.heavy 592.851 / 514.286 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1771 225 C20140704_OR004_03 C20140704_OR004_03 TB451753.[MT7]-RLEDQLAGLQQELAALALK[MT7].4b4_1.heavy 592.851 / 658.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1773 225 C20140704_OR004_03 C20140704_OR004_03 TB451753.[MT7]-RLEDQLAGLQQELAALALK[MT7].4b5_1.heavy 592.851 / 786.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1775 226 C20140704_OR004_03 C20140704_OR004_03 TB414118.[MT7]-VPLLAEIYGIEGNIFRLK[MT7].4y10_2.heavy 584.101 / 645.886 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 1777 226 C20140704_OR004_03 C20140704_OR004_03 TB414118.[MT7]-VPLLAEIYGIEGNIFRLK[MT7].4b4_1.heavy 584.101 / 567.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 1779 226 C20140704_OR004_03 C20140704_OR004_03 TB414118.[MT7]-VPLLAEIYGIEGNIFRLK[MT7].4y7_1.heavy 584.101 / 991.617 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 1781 226 C20140704_OR004_03 C20140704_OR004_03 TB414118.[MT7]-VPLLAEIYGIEGNIFRLK[MT7].4b6_1.heavy 584.101 / 767.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - GANC glucosidase, alpha; neutral C 1783 227 C20140704_OR004_03 C20140704_OR004_03 TB414116.[MT7]-TALLSLFGIPLWYHSQSPR.4b4_1.heavy 583.325 / 543.362 N/A 52.375301361083984 28 10 0 10 8 0.7062105288286891 73.96250997724152 0.0 4 0.8254376635686116 2.909758677356637 1134.0 0.6636612702366127 3.0 - - - - - - - 188.66666666666666 23 6 SUN2 Sad1 and UNC84 domain containing 2 1785 227 C20140704_OR004_03 C20140704_OR004_03 TB414116.[MT7]-TALLSLFGIPLWYHSQSPR.4b5_1.heavy 583.325 / 630.394 2079.0 52.375301361083984 28 10 0 10 8 0.7062105288286891 73.96250997724152 0.0 4 0.8254376635686116 2.909758677356637 2079.0 22.557021276595744 0.0 - - - - - - - 189.0 4 1 SUN2 Sad1 and UNC84 domain containing 2 1787 227 C20140704_OR004_03 C20140704_OR004_03 TB414116.[MT7]-TALLSLFGIPLWYHSQSPR.4y7_1.heavy 583.325 / 874.417 567.0 52.375301361083984 28 10 0 10 8 0.7062105288286891 73.96250997724152 0.0 4 0.8254376635686116 2.909758677356637 567.0 0.8999999999999998 0.0 - - - - - - - 0.0 1 0 SUN2 Sad1 and UNC84 domain containing 2 1789 227 C20140704_OR004_03 C20140704_OR004_03 TB414116.[MT7]-TALLSLFGIPLWYHSQSPR.4y6_1.heavy 583.325 / 711.353 756.0 52.375301361083984 28 10 0 10 8 0.7062105288286891 73.96250997724152 0.0 4 0.8254376635686116 2.909758677356637 756.0 2.871378091872791 2.0 - - - - - - - 0.0 1 0 SUN2 Sad1 and UNC84 domain containing 2 1791 228 C20140704_OR004_03 C20140704_OR004_03 TB428003.[MT7]-EGIESQASYK[MT7].2y4_1.heavy 700.369 / 612.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 1793 228 C20140704_OR004_03 C20140704_OR004_03 TB428003.[MT7]-EGIESQASYK[MT7].2b4_1.heavy 700.369 / 573.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 1795 228 C20140704_OR004_03 C20140704_OR004_03 TB428003.[MT7]-EGIESQASYK[MT7].2y3_1.heavy 700.369 / 541.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 1797 228 C20140704_OR004_03 C20140704_OR004_03 TB428003.[MT7]-EGIESQASYK[MT7].2y7_1.heavy 700.369 / 956.481 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM2 ADAM metallopeptidase domain 2 1799 229 C20140704_OR004_03 C20140704_OR004_03 TB414113.[MT7]-FLSQPFQVAEVFTGHMGK[MT7].3y7_1.heavy 771.076 / 921.473 9774.0 46.67129898071289 46 20 10 6 10 7.10118292412377 14.082160827076457 0.0391998291015625 3 0.9936229547630017 15.446196576972676 9774.0 12.485036496350364 1.0 - - - - - - - 255.6 19 5 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1801 229 C20140704_OR004_03 C20140704_OR004_03 TB414113.[MT7]-FLSQPFQVAEVFTGHMGK[MT7].3b4_1.heavy 771.076 / 620.352 31787.0 46.67129898071289 46 20 10 6 10 7.10118292412377 14.082160827076457 0.0391998291015625 3 0.9936229547630017 15.446196576972676 31787.0 104.51787672915025 0.0 - - - - - - - 257.27272727272725 63 11 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1803 229 C20140704_OR004_03 C20140704_OR004_03 TB414113.[MT7]-FLSQPFQVAEVFTGHMGK[MT7].3b7_1.heavy 771.076 / 992.532 5572.0 46.67129898071289 46 20 10 6 10 7.10118292412377 14.082160827076457 0.0391998291015625 3 0.9936229547630017 15.446196576972676 5572.0 21.852049226149596 0.0 - - - - - - - 201.0 11 10 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1805 229 C20140704_OR004_03 C20140704_OR004_03 TB414113.[MT7]-FLSQPFQVAEVFTGHMGK[MT7].3y5_1.heavy 771.076 / 673.357 8769.0 46.67129898071289 46 20 10 6 10 7.10118292412377 14.082160827076457 0.0391998291015625 3 0.9936229547630017 15.446196576972676 8769.0 39.61229693354515 0.0 - - - - - - - 253.55555555555554 17 9 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1807 230 C20140704_OR004_03 C20140704_OR004_03 TB428001.[MT7]-SGEPQTFTLK[MT7].2y4_1.heavy 698.39 / 652.415 1260.0 29.541400909423828 50 20 10 10 10 52.82831882803314 1.8929241402801444 0.0 3 0.999454302605083 52.82830518628188 1260.0 5.25 3.0 - - - - - - - 220.9090909090909 2 22 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1809 230 C20140704_OR004_03 C20140704_OR004_03 TB428001.[MT7]-SGEPQTFTLK[MT7].2y5_1.heavy 698.39 / 753.463 N/A 29.541400909423828 50 20 10 10 10 52.82831882803314 1.8929241402801444 0.0 3 0.999454302605083 52.82830518628188 270.0 0.13333333333333333 17.0 - - - - - - - 0.0 1 0 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1811 230 C20140704_OR004_03 C20140704_OR004_03 TB428001.[MT7]-SGEPQTFTLK[MT7].2y3_1.heavy 698.39 / 505.347 N/A 29.541400909423828 50 20 10 10 10 52.82831882803314 1.8929241402801444 0.0 3 0.999454302605083 52.82830518628188 540.0 0.0 5.0 - - - - - - - 140.0 6 9 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1813 230 C20140704_OR004_03 C20140704_OR004_03 TB428001.[MT7]-SGEPQTFTLK[MT7].2y7_1.heavy 698.39 / 978.574 3330.0 29.541400909423828 50 20 10 10 10 52.82831882803314 1.8929241402801444 0.0 3 0.999454302605083 52.82830518628188 3330.0 17.020000000000003 0.0 - - - - - - - 244.28571428571428 6 14 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1815 231 C20140704_OR004_03 C20140704_OR004_03 TB414111.[MT7]-LK[MT7]PEDITQIQPQQLVLR.4y4_1.heavy 577.596 / 500.355 10532.0 38.70899963378906 44 14 10 10 10 3.6837800500482656 27.146028981477812 0.0 3 0.94165378700971 5.08418629343028 10532.0 19.566315770425057 0.0 - - - - - - - 286.22222222222223 21 9 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1817 231 C20140704_OR004_03 C20140704_OR004_03 TB414111.[MT7]-LK[MT7]PEDITQIQPQQLVLR.4y5_1.heavy 577.596 / 628.414 12212.0 38.70899963378906 44 14 10 10 10 3.6837800500482656 27.146028981477812 0.0 3 0.94165378700971 5.08418629343028 12212.0 -0.3217996789318963 2.0 - - - - - - - 768.0 30 7 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1819 231 C20140704_OR004_03 C20140704_OR004_03 TB414111.[MT7]-LK[MT7]PEDITQIQPQQLVLR.4b5_1.heavy 577.596 / 871.513 4594.0 38.70899963378906 44 14 10 10 10 3.6837800500482656 27.146028981477812 0.0 3 0.94165378700971 5.08418629343028 4594.0 0.5341094649159461 3.0 - - - - - - - 112.0 16 3 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1821 231 C20140704_OR004_03 C20140704_OR004_03 TB414111.[MT7]-LK[MT7]PEDITQIQPQQLVLR.4y7_1.heavy 577.596 / 853.525 30139.0 38.70899963378906 44 14 10 10 10 3.6837800500482656 27.146028981477812 0.0 3 0.94165378700971 5.08418629343028 30139.0 218.8665476190476 0.0 - - - - - - - 268.8 60 5 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1823 232 C20140704_OR004_03 C20140704_OR004_03 TB413870.[MT7]-TTGIVETHFTFK[MT7].3b6_1.heavy 556.978 / 745.421 33998.0 33.522499084472656 47 17 10 10 10 3.8612086873066302 20.805532006496662 0.0 3 0.977750286615843 8.258318157742623 33998.0 150.430059311981 0.0 - - - - - - - 249.44444444444446 67 9 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1825 232 C20140704_OR004_03 C20140704_OR004_03 TB413870.[MT7]-TTGIVETHFTFK[MT7].3y3_1.heavy 556.978 / 539.331 117868.0 33.522499084472656 47 17 10 10 10 3.8612086873066302 20.805532006496662 0.0 3 0.977750286615843 8.258318157742623 117868.0 229.48294155643552 0.0 - - - - - - - 308.6 235 5 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1827 232 C20140704_OR004_03 C20140704_OR004_03 TB413870.[MT7]-TTGIVETHFTFK[MT7].3b4_1.heavy 556.978 / 517.31 83870.0 33.522499084472656 47 17 10 10 10 3.8612086873066302 20.805532006496662 0.0 3 0.977750286615843 8.258318157742623 83870.0 98.87365903096892 0.0 - - - - - - - 374.3333333333333 167 3 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1829 232 C20140704_OR004_03 C20140704_OR004_03 TB413870.[MT7]-TTGIVETHFTFK[MT7].3y4_1.heavy 556.978 / 686.399 101853.0 33.522499084472656 47 17 10 10 10 3.8612086873066302 20.805532006496662 0.0 3 0.977750286615843 8.258318157742623 101853.0 170.60970987805348 0.0 - - - - - - - 842.75 203 8 GNAI1;GNAI2;GNAI3;GNAO1 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3;guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O 1831 233 C20140704_OR004_03 C20140704_OR004_03 TB428005.[MT7]-SAAHSPLDTSK[MT7].3y6_1.heavy 467.924 / 804.458 1249.0 19.747650146484375 36 16 6 6 8 8.705494072740674 11.486998803793096 0.030498504638671875 4 0.9635529197015207 6.444704819683927 1249.0 29.809466666666665 0.0 - - - - - - - 106.25 2 8 SLCO4A1 solute carrier organic anion transporter family, member 4A1 1833 233 C20140704_OR004_03 C20140704_OR004_03 TB428005.[MT7]-SAAHSPLDTSK[MT7].3y3_1.heavy 467.924 / 479.295 2998.0 19.747650146484375 36 16 6 6 8 8.705494072740674 11.486998803793096 0.030498504638671875 4 0.9635529197015207 6.444704819683927 2998.0 14.793869158878506 1.0 - - - - - - - 125.0 9 14 SLCO4A1 solute carrier organic anion transporter family, member 4A1 1835 233 C20140704_OR004_03 C20140704_OR004_03 TB428005.[MT7]-SAAHSPLDTSK[MT7].3y4_1.heavy 467.924 / 594.321 2998.0 19.747650146484375 36 16 6 6 8 8.705494072740674 11.486998803793096 0.030498504638671875 4 0.9635529197015207 6.444704819683927 2998.0 -0.3078028747433264 0.0 - - - - - - - 104.54545454545455 5 11 SLCO4A1 solute carrier organic anion transporter family, member 4A1 1837 233 C20140704_OR004_03 C20140704_OR004_03 TB428005.[MT7]-SAAHSPLDTSK[MT7].3y5_1.heavy 467.924 / 707.406 600.0 19.747650146484375 36 16 6 6 8 8.705494072740674 11.486998803793096 0.030498504638671875 4 0.9635529197015207 6.444704819683927 600.0 7.199999999999999 2.0 - - - - - - - 0.0 1 0 SLCO4A1 solute carrier organic anion transporter family, member 4A1 1839 234 C20140704_OR004_03 C20140704_OR004_03 TB413504.[MT7]-FIPGTTK[MT7].2y4_1.heavy 526.323 / 550.332 4595.0 28.190500259399414 40 18 10 6 6 2.664541901835484 28.56495891849376 0.034198760986328125 5 0.9866879456535907 10.684565587392646 4595.0 41.732629228479034 1.0 - - - - - - - 176.375 10 16 MPV17 MpV17 mitochondrial inner membrane protein 1841 234 C20140704_OR004_03 C20140704_OR004_03 TB413504.[MT7]-FIPGTTK[MT7].2y5_1.heavy 526.323 / 647.385 52726.0 28.190500259399414 40 18 10 6 6 2.664541901835484 28.56495891849376 0.034198760986328125 5 0.9866879456535907 10.684565587392646 52726.0 177.28245649803233 0.0 - - - - - - - 241.8 105 15 MPV17 MpV17 mitochondrial inner membrane protein 1843 234 C20140704_OR004_03 C20140704_OR004_03 TB413504.[MT7]-FIPGTTK[MT7].2y3_1.heavy 526.323 / 493.31 2499.0 28.190500259399414 40 18 10 6 6 2.664541901835484 28.56495891849376 0.034198760986328125 5 0.9866879456535907 10.684565587392646 2499.0 9.249594002428594 0.0 - - - - - - - 248.66666666666666 4 12 MPV17 MpV17 mitochondrial inner membrane protein 1845 234 C20140704_OR004_03 C20140704_OR004_03 TB413504.[MT7]-FIPGTTK[MT7].2y6_1.heavy 526.323 / 760.469 5321.0 28.190500259399414 40 18 10 6 6 2.664541901835484 28.56495891849376 0.034198760986328125 5 0.9866879456535907 10.684565587392646 5321.0 30.405714285714286 2.0 - - - - - - - 181.4375 20 16 MPV17 MpV17 mitochondrial inner membrane protein 1847 235 C20140704_OR004_03 C20140704_OR004_03 TB413932.[MT7]-GSYNDFSFVTHTNR.3y6_1.heavy 596.952 / 727.385 6361.0 32.25640106201172 42 12 10 10 10 0.9428480915525465 56.44938794265985 0.0 3 0.8894743408215054 3.677453082464503 6361.0 29.003126853238548 0.0 - - - - - - - 214.36363636363637 12 11 PISD phosphatidylserine decarboxylase 1849 235 C20140704_OR004_03 C20140704_OR004_03 TB413932.[MT7]-GSYNDFSFVTHTNR.3b4_1.heavy 596.952 / 566.269 6714.0 32.25640106201172 42 12 10 10 10 0.9428480915525465 56.44938794265985 0.0 3 0.8894743408215054 3.677453082464503 6714.0 28.441265697369627 0.0 - - - - - - - 306.3 13 10 PISD phosphatidylserine decarboxylase 1851 235 C20140704_OR004_03 C20140704_OR004_03 TB413932.[MT7]-GSYNDFSFVTHTNR.3b5_1.heavy 596.952 / 681.296 13664.0 32.25640106201172 42 12 10 10 10 0.9428480915525465 56.44938794265985 0.0 3 0.8894743408215054 3.677453082464503 13664.0 6.949747816119088 1.0 - - - - - - - 250.375 28 8 PISD phosphatidylserine decarboxylase 1853 235 C20140704_OR004_03 C20140704_OR004_03 TB413932.[MT7]-GSYNDFSFVTHTNR.3y5_1.heavy 596.952 / 628.316 14725.0 32.25640106201172 42 12 10 10 10 0.9428480915525465 56.44938794265985 0.0 3 0.8894743408215054 3.677453082464503 14725.0 18.56231510598649 0.0 - - - - - - - 314.0 29 9 PISD phosphatidylserine decarboxylase 1855 236 C20140704_OR004_03 C20140704_OR004_03 TB451758.[MT7]-EIALPIEAC[CAM]VMMLLSEGMK[MT7].3y7_1.heavy 808.427 / 921.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 1857 236 C20140704_OR004_03 C20140704_OR004_03 TB451758.[MT7]-EIALPIEAC[CAM]VMMLLSEGMK[MT7].3b6_1.heavy 808.427 / 781.494 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 1859 236 C20140704_OR004_03 C20140704_OR004_03 TB451758.[MT7]-EIALPIEAC[CAM]VMMLLSEGMK[MT7].3y4_1.heavy 808.427 / 608.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 1861 236 C20140704_OR004_03 C20140704_OR004_03 TB451758.[MT7]-EIALPIEAC[CAM]VMMLLSEGMK[MT7].3y5_1.heavy 808.427 / 695.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 1863 237 C20140704_OR004_03 C20140704_OR004_03 TB414211.[MT7]-GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.4b8_1.heavy 965.503 / 888.491 23114.0 44.762901306152344 46 16 10 10 10 1.8075218676875326 43.581265603795885 0.0 3 0.9669773177533773 6.772574079656284 23114.0 74.28483910673467 0.0 - - - - - - - 299.61538461538464 46 13 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1865 237 C20140704_OR004_03 C20140704_OR004_03 TB414211.[MT7]-GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.4b7_1.heavy 965.503 / 817.454 12361.0 44.762901306152344 46 16 10 10 10 1.8075218676875326 43.581265603795885 0.0 3 0.9669773177533773 6.772574079656284 12361.0 30.114017559794128 0.0 - - - - - - - 568.4285714285714 24 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1867 237 C20140704_OR004_03 C20140704_OR004_03 TB414211.[MT7]-GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.4b5_1.heavy 965.503 / 590.327 11261.0 44.762901306152344 46 16 10 10 10 1.8075218676875326 43.581265603795885 0.0 3 0.9669773177533773 6.772574079656284 11261.0 23.94306990176468 0.0 - - - - - - - 201.92307692307693 22 13 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1869 237 C20140704_OR004_03 C20140704_OR004_03 TB414211.[MT7]-GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.4b9_1.heavy 965.503 / 1001.57 16425.0 44.762901306152344 46 16 10 10 10 1.8075218676875326 43.581265603795885 0.0 3 0.9669773177533773 6.772574079656284 16425.0 41.38582677165354 0.0 - - - - - - - 556.4285714285714 32 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1871 238 C20140704_OR004_03 C20140704_OR004_03 TB413508.[MT7]-LDPFFK[MT7].2y4_1.heavy 527.812 / 682.404 19147.0 38.34349822998047 44 18 10 10 6 1.0156672075223565 55.53060962009551 0.0 5 0.9862516977003359 10.513298776198226 19147.0 24.746559718192696 1.0 - - - - - - - 285.6 39 5 ADAM2 ADAM metallopeptidase domain 2 1873 238 C20140704_OR004_03 C20140704_OR004_03 TB413508.[MT7]-LDPFFK[MT7].2y5_1.heavy 527.812 / 797.431 2854.0 38.34349822998047 44 18 10 10 6 1.0156672075223565 55.53060962009551 0.0 5 0.9862516977003359 10.513298776198226 2854.0 35.159361344537814 0.0 - - - - - - - 221.0 5 7 ADAM2 ADAM metallopeptidase domain 2 1875 238 C20140704_OR004_03 C20140704_OR004_03 TB413508.[MT7]-LDPFFK[MT7].2b4_1.heavy 527.812 / 617.341 595.0 38.34349822998047 44 18 10 10 6 1.0156672075223565 55.53060962009551 0.0 5 0.9862516977003359 10.513298776198226 595.0 2.9375 14.0 - - - - - - - 214.2 3 15 ADAM2 ADAM metallopeptidase domain 2 1877 238 C20140704_OR004_03 C20140704_OR004_03 TB413508.[MT7]-LDPFFK[MT7].2y3_1.heavy 527.812 / 585.352 1546.0 38.34349822998047 44 18 10 10 6 1.0156672075223565 55.53060962009551 0.0 5 0.9862516977003359 10.513298776198226 1546.0 4.339193277310924 2.0 - - - - - - - 238.0 5 5 ADAM2 ADAM metallopeptidase domain 2 1879 239 C20140704_OR004_03 C20140704_OR004_03 TB428009.[MT7]-TIAMDGTEGLVR.3y7_1.heavy 469.586 / 731.405 784.0 32.549198150634766 47 17 10 10 10 2.352326437399265 32.594825067083065 0.0 3 0.9757781504836385 7.913674478389051 784.0 4.833716475095786 1.0 - - - - - - - 0.0 1 0 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1881 239 C20140704_OR004_03 C20140704_OR004_03 TB428009.[MT7]-TIAMDGTEGLVR.3b4_1.heavy 469.586 / 561.319 3921.0 32.549198150634766 47 17 10 10 10 2.352326437399265 32.594825067083065 0.0 3 0.9757781504836385 7.913674478389051 3921.0 21.092911279015425 0.0 - - - - - - - 205.42857142857142 7 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1883 239 C20140704_OR004_03 C20140704_OR004_03 TB428009.[MT7]-TIAMDGTEGLVR.3b5_1.heavy 469.586 / 676.346 1961.0 32.549198150634766 47 17 10 10 10 2.352326437399265 32.594825067083065 0.0 3 0.9757781504836385 7.913674478389051 1961.0 6.7491395793499045 0.0 - - - - - - - 392.0 3 1 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1885 239 C20140704_OR004_03 C20140704_OR004_03 TB428009.[MT7]-TIAMDGTEGLVR.3y5_1.heavy 469.586 / 573.336 8496.0 32.549198150634766 47 17 10 10 10 2.352326437399265 32.594825067083065 0.0 3 0.9757781504836385 7.913674478389051 8496.0 41.09900140745953 0.0 - - - - - - - 261.14285714285717 16 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1887 240 C20140704_OR004_03 C20140704_OR004_03 TB413937.[MT7]-LVLEVAQHLGESTVR.2y9_1.heavy 898.013 / 1026.53 11170.0 40.93122386932373 42 16 10 6 10 7.78802790699285 12.840221066774847 0.033100128173828125 3 0.9646169024338702 6.541472183468429 11170.0 43.33920564872021 0.0 - - - - - - - 224.8181818181818 22 11 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1889 240 C20140704_OR004_03 C20140704_OR004_03 TB413937.[MT7]-LVLEVAQHLGESTVR.2b4_1.heavy 898.013 / 599.388 26552.0 40.93122386932373 42 16 10 6 10 7.78802790699285 12.840221066774847 0.033100128173828125 3 0.9646169024338702 6.541472183468429 26552.0 57.61862054846526 0.0 - - - - - - - 267.1666666666667 53 12 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1891 240 C20140704_OR004_03 C20140704_OR004_03 TB413937.[MT7]-LVLEVAQHLGESTVR.2y10_1.heavy 898.013 / 1097.57 25545.0 40.93122386932373 42 16 10 6 10 7.78802790699285 12.840221066774847 0.033100128173828125 3 0.9646169024338702 6.541472183468429 25545.0 314.9284529644269 0.0 - - - - - - - 223.94444444444446 51 18 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1893 240 C20140704_OR004_03 C20140704_OR004_03 TB413937.[MT7]-LVLEVAQHLGESTVR.2y11_1.heavy 898.013 / 1196.64 6226.0 40.93122386932373 42 16 10 6 10 7.78802790699285 12.840221066774847 0.033100128173828125 3 0.9646169024338702 6.541472183468429 6226.0 5.437554585152839 1.0 - - - - - - - 241.54545454545453 12 11 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1895 241 C20140704_OR004_03 C20140704_OR004_03 TB451689.[MT7]-TLRGPGWVSYQLLDVR.3y6_1.heavy 668.71 / 743.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 1897 241 C20140704_OR004_03 C20140704_OR004_03 TB451689.[MT7]-TLRGPGWVSYQLLDVR.3b6_1.heavy 668.71 / 726.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 1899 241 C20140704_OR004_03 C20140704_OR004_03 TB451689.[MT7]-TLRGPGWVSYQLLDVR.3y8_1.heavy 668.71 / 993.536 N/A N/A - - - - - - - - - 0.0 - - - - - - - ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 1901 241 C20140704_OR004_03 C20140704_OR004_03 TB451689.[MT7]-TLRGPGWVSYQLLDVR.3b7_1.heavy 668.71 / 912.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) 1903 242 C20140704_OR004_03 C20140704_OR004_03 TB427828.[MT7]-DQGFFVK[MT7].2y5_1.heavy 564.818 / 741.442 3161.0 31.426700592041016 38 18 2 10 8 3.8145232892551326 26.21559561103824 0.0 4 0.9842477114444494 9.82016517059743 3161.0 5.229259023804479 2.0 - - - - - - - 302.25 7 12 GANC glucosidase, alpha; neutral C 1905 242 C20140704_OR004_03 C20140704_OR004_03 TB427828.[MT7]-DQGFFVK[MT7].2b4_1.heavy 564.818 / 592.285 5737.0 31.426700592041016 38 18 2 10 8 3.8145232892551326 26.21559561103824 0.0 4 0.9842477114444494 9.82016517059743 5737.0 16.344729344729345 1.0 - - - - - - - 382.90909090909093 30 11 GANC glucosidase, alpha; neutral C 1907 242 C20140704_OR004_03 C20140704_OR004_03 TB427828.[MT7]-DQGFFVK[MT7].2y3_1.heavy 564.818 / 537.352 5620.0 31.426700592041016 38 18 2 10 8 3.8145232892551326 26.21559561103824 0.0 4 0.9842477114444494 9.82016517059743 5620.0 15.313517896819604 0.0 - - - - - - - 319.09090909090907 11 11 GANC glucosidase, alpha; neutral C 1909 242 C20140704_OR004_03 C20140704_OR004_03 TB427828.[MT7]-DQGFFVK[MT7].2y6_1.heavy 564.818 / 869.5 2810.0 31.426700592041016 38 18 2 10 8 3.8145232892551326 26.21559561103824 0.0 4 0.9842477114444494 9.82016517059743 2810.0 29.3008547008547 0.0 - - - - - - - 221.0 5 9 GANC glucosidase, alpha; neutral C 1911 243 C20140704_OR004_03 C20140704_OR004_03 TB427826.[MT7]-ITTTK[MT7]K[MT7].2y4_1.heavy 562.374 / 765.507 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1913 243 C20140704_OR004_03 C20140704_OR004_03 TB427826.[MT7]-ITTTK[MT7]K[MT7].2y5_1.heavy 562.374 / 866.555 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1915 243 C20140704_OR004_03 C20140704_OR004_03 TB427826.[MT7]-ITTTK[MT7]K[MT7].2b4_1.heavy 562.374 / 561.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1917 243 C20140704_OR004_03 C20140704_OR004_03 TB427826.[MT7]-ITTTK[MT7]K[MT7].2y3_1.heavy 562.374 / 664.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1919 244 C20140704_OR004_03 C20140704_OR004_03 TB428271.[MT7]-C[CAM]HIAFAALEAVC[CAM]FQTR.3y7_1.heavy 680.009 / 881.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - GK;GK2 glycerol kinase;glycerol kinase 2 1921 244 C20140704_OR004_03 C20140704_OR004_03 TB428271.[MT7]-C[CAM]HIAFAALEAVC[CAM]FQTR.3y6_1.heavy 680.009 / 810.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - GK;GK2 glycerol kinase;glycerol kinase 2 1923 244 C20140704_OR004_03 C20140704_OR004_03 TB428271.[MT7]-C[CAM]HIAFAALEAVC[CAM]FQTR.3b6_1.heavy 680.009 / 844.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - GK;GK2 glycerol kinase;glycerol kinase 2 1925 244 C20140704_OR004_03 C20140704_OR004_03 TB428271.[MT7]-C[CAM]HIAFAALEAVC[CAM]FQTR.3b4_1.heavy 680.009 / 626.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - GK;GK2 glycerol kinase;glycerol kinase 2 1927 245 C20140704_OR004_03 C20140704_OR004_03 TB428272.[MT7]-RLEALAAEFSSNWQK[MT7].2b8_1.heavy 1019.55 / 998.575 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1929 245 C20140704_OR004_03 C20140704_OR004_03 TB428272.[MT7]-RLEALAAEFSSNWQK[MT7].2b3_1.heavy 1019.55 / 543.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1931 245 C20140704_OR004_03 C20140704_OR004_03 TB428272.[MT7]-RLEALAAEFSSNWQK[MT7].2y6_1.heavy 1019.55 / 893.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1933 245 C20140704_OR004_03 C20140704_OR004_03 TB428272.[MT7]-RLEALAAEFSSNWQK[MT7].2y7_1.heavy 1019.55 / 1040.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - SUN2 Sad1 and UNC84 domain containing 2 1935 246 C20140704_OR004_03 C20140704_OR004_03 TB451489.[MT7]-VVDLLAPYAK[MT7].3y3_1.heavy 459.618 / 525.315 13033.0 40.23872375488281 42 16 10 6 10 1.9701451539034582 37.15588556525144 0.0345001220703125 3 0.9642486120982452 6.507489343173519 13033.0 59.33723577235772 0.0 - - - - - - - 205.0 26 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1937 246 C20140704_OR004_03 C20140704_OR004_03 TB451489.[MT7]-VVDLLAPYAK[MT7].3b4_1.heavy 459.618 / 571.357 11434.0 40.23872375488281 42 16 10 6 10 1.9701451539034582 37.15588556525144 0.0345001220703125 3 0.9642486120982452 6.507489343173519 11434.0 178.48195121951218 0.0 - - - - - - - 246.0 22 4 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1939 246 C20140704_OR004_03 C20140704_OR004_03 TB451489.[MT7]-VVDLLAPYAK[MT7].3b5_1.heavy 459.618 / 684.441 6639.0 40.23872375488281 42 16 10 6 10 1.9701451539034582 37.15588556525144 0.0345001220703125 3 0.9642486120982452 6.507489343173519 6639.0 48.55106097560976 0.0 - - - - - - - 246.0 13 4 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1941 246 C20140704_OR004_03 C20140704_OR004_03 TB451489.[MT7]-VVDLLAPYAK[MT7].3y4_1.heavy 459.618 / 622.368 13156.0 40.23872375488281 42 16 10 6 10 1.9701451539034582 37.15588556525144 0.0345001220703125 3 0.9642486120982452 6.507489343173519 13156.0 156.16065040650406 0.0 - - - - - - - 164.0 26 3 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1943 247 C20140704_OR004_03 C20140704_OR004_03 TB451487.[MT7]-C[CAM]HITANPFK[MT7].3y3_1.heavy 459.251 / 535.336 5292.0 26.587675094604492 34 17 10 3 4 3.9576510519795947 25.267513150251226 0.06459999084472656 7 0.9727544133880603 7.459732854977756 5292.0 11.380645161290323 1.0 - - - - - - - 190.68421052631578 10 19 GANC glucosidase, alpha; neutral C 1945 247 C20140704_OR004_03 C20140704_OR004_03 TB451487.[MT7]-C[CAM]HITANPFK[MT7].3y4_1.heavy 459.251 / 649.379 627.0 26.587675094604492 34 17 10 3 4 3.9576510519795947 25.267513150251226 0.06459999084472656 7 0.9727544133880603 7.459732854977756 627.0 8.957142857142857 1.0 - - - - - - - 0.0 1 0 GANC glucosidase, alpha; neutral C 1947 247 C20140704_OR004_03 C20140704_OR004_03 TB451487.[MT7]-C[CAM]HITANPFK[MT7].3b3_1.heavy 459.251 / 555.283 1323.0 26.587675094604492 34 17 10 3 4 3.9576510519795947 25.267513150251226 0.06459999084472656 7 0.9727544133880603 7.459732854977756 1323.0 11.81504488330341 2.0 - - - - - - - 188.0 4 10 GANC glucosidase, alpha; neutral C 1949 247 C20140704_OR004_03 C20140704_OR004_03 TB451487.[MT7]-C[CAM]HITANPFK[MT7].3b8_2.heavy 459.251 / 543.27 1393.0 26.587675094604492 34 17 10 3 4 3.9576510519795947 25.267513150251226 0.06459999084472656 7 0.9727544133880603 7.459732854977756 1393.0 2.8567523003312476 3.0 - - - - - - - 706.2857142857143 7 7 GANC glucosidase, alpha; neutral C 1951 248 C20140704_OR004_03 C20140704_OR004_03 TB427929.[MT7]-TAAVGPLVGAVVQGTNSTR.3y6_1.heavy 648.033 / 635.311 21919.0 37.18136723836263 25 14 2 5 4 1.6833851659866017 41.44803546582324 0.045196533203125 7 0.9481718725269963 5.397414934277522 21919.0 30.449905598768257 2.0 - - - - - - - 328.1666666666667 67 6 GK2 glycerol kinase 2 1953 248 C20140704_OR004_03 C20140704_OR004_03 TB427929.[MT7]-TAAVGPLVGAVVQGTNSTR.3b5_1.heavy 648.033 / 544.321 N/A 37.18136723836263 25 14 2 5 4 1.6833851659866017 41.44803546582324 0.045196533203125 7 0.9481718725269963 5.397414934277522 0.0 0.0 33.0 - - - - - - - 422.0 90 1 GK2 glycerol kinase 2 1955 248 C20140704_OR004_03 C20140704_OR004_03 TB427929.[MT7]-TAAVGPLVGAVVQGTNSTR.3y8_1.heavy 648.033 / 862.438 19109.0 37.18136723836263 25 14 2 5 4 1.6833851659866017 41.44803546582324 0.045196533203125 7 0.9481718725269963 5.397414934277522 19109.0 23.141937968476665 1.0 - - - - - - - 246.25 46 4 GK2 glycerol kinase 2 1957 248 C20140704_OR004_03 C20140704_OR004_03 TB427929.[MT7]-TAAVGPLVGAVVQGTNSTR.3b7_1.heavy 648.033 / 754.458 17563.0 37.18136723836263 25 14 2 5 4 1.6833851659866017 41.44803546582324 0.045196533203125 7 0.9481718725269963 5.397414934277522 17563.0 1.0158392649936305 3.0 - - - - - - - 375.0 41 3 GK2 glycerol kinase 2 1959 249 C20140704_OR004_03 C20140704_OR004_03 TB451548.[MT7]-TISTTISPLLLIP.3b4_1.heavy 504.984 / 547.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5AP arachidonate 5-lipoxygenase-activating protein 1961 249 C20140704_OR004_03 C20140704_OR004_03 TB451548.[MT7]-TISTTISPLLLIP.3b5_1.heavy 504.984 / 648.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5AP arachidonate 5-lipoxygenase-activating protein 1963 249 C20140704_OR004_03 C20140704_OR004_03 TB451548.[MT7]-TISTTISPLLLIP.3b10_2.heavy 504.984 / 586.356 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5AP arachidonate 5-lipoxygenase-activating protein 1965 249 C20140704_OR004_03 C20140704_OR004_03 TB451548.[MT7]-TISTTISPLLLIP.3b7_1.heavy 504.984 / 848.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5AP arachidonate 5-lipoxygenase-activating protein 1967 250 C20140704_OR004_03 C20140704_OR004_03 TB428278.[MT7]-DQEGQDVLLFIDNIFR.3y7_1.heavy 689.361 / 924.494 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1969 250 C20140704_OR004_03 C20140704_OR004_03 TB428278.[MT7]-DQEGQDVLLFIDNIFR.3y6_1.heavy 689.361 / 777.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1971 250 C20140704_OR004_03 C20140704_OR004_03 TB428278.[MT7]-DQEGQDVLLFIDNIFR.3b6_1.heavy 689.361 / 817.344 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1973 250 C20140704_OR004_03 C20140704_OR004_03 TB428278.[MT7]-DQEGQDVLLFIDNIFR.3b7_1.heavy 689.361 / 916.413 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1975 251 C20140704_OR004_03 C20140704_OR004_03 TB413929.[MT7]-IYFDRDLHTNSPR.3y7_1.heavy 593.308 / 824.437 1268.0 28.310375213623047 34 13 10 3 8 2.1032850858059913 37.947892244586974 0.06850051879882812 4 0.9045146869272144 3.961651006568874 1268.0 18.137215189873416 0.0 - - - - - - - 150.4 2 10 PISD phosphatidylserine decarboxylase 1977 251 C20140704_OR004_03 C20140704_OR004_03 TB413929.[MT7]-IYFDRDLHTNSPR.3y12_2.heavy 593.308 / 760.866 5864.0 28.310375213623047 34 13 10 3 8 2.1032850858059913 37.947892244586974 0.06850051879882812 4 0.9045146869272144 3.961651006568874 5864.0 92.6881267950218 0.0 - - - - - - - 158.22222222222223 11 9 PISD phosphatidylserine decarboxylase 1979 251 C20140704_OR004_03 C20140704_OR004_03 TB413929.[MT7]-IYFDRDLHTNSPR.3y9_2.heavy 593.308 / 548.286 2853.0 28.310375213623047 34 13 10 3 8 2.1032850858059913 37.947892244586974 0.06850051879882812 4 0.9045146869272144 3.961651006568874 2853.0 11.43 0.0 - - - - - - - 289.0 5 17 PISD phosphatidylserine decarboxylase 1981 251 C20140704_OR004_03 C20140704_OR004_03 TB413929.[MT7]-IYFDRDLHTNSPR.3y5_1.heavy 593.308 / 574.294 3011.0 28.310375213623047 34 13 10 3 8 2.1032850858059913 37.947892244586974 0.06850051879882812 4 0.9045146869272144 3.961651006568874 3011.0 12.656587350729765 2.0 - - - - - - - 277.25 6 16 PISD phosphatidylserine decarboxylase 1983 252 C20140704_OR004_03 C20140704_OR004_03 TB414128.[MT7]-SLQDIIAILGMDELSEEDK[MT7].2y9_1.heavy 1204.13 / 1239.55 511.0 53.26754951477051 39 13 10 6 10 2.158443488981615 46.32968178712034 0.038501739501953125 3 0.9181013602607575 4.2826686931088025 511.0 5.009803921568627 3.0 - - - - - - - 0.0 1 0 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1985 252 C20140704_OR004_03 C20140704_OR004_03 TB414128.[MT7]-SLQDIIAILGMDELSEEDK[MT7].2b4_1.heavy 1204.13 / 588.311 2043.0 53.26754951477051 39 13 10 6 10 2.158443488981615 46.32968178712034 0.038501739501953125 3 0.9181013602607575 4.2826686931088025 2043.0 34.899247058823526 0.0 - - - - - - - 141.66666666666666 4 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1987 252 C20140704_OR004_03 C20140704_OR004_03 TB414128.[MT7]-SLQDIIAILGMDELSEEDK[MT7].2b7_1.heavy 1204.13 / 885.516 1277.0 53.26754951477051 39 13 10 6 10 2.158443488981615 46.32968178712034 0.038501739501953125 3 0.9181013602607575 4.2826686931088025 1277.0 16.525882352941174 0.0 - - - - - - - 132.33333333333334 2 9 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1989 252 C20140704_OR004_03 C20140704_OR004_03 TB414128.[MT7]-SLQDIIAILGMDELSEEDK[MT7].2b5_1.heavy 1204.13 / 701.395 1788.0 53.26754951477051 39 13 10 6 10 2.158443488981615 46.32968178712034 0.038501739501953125 3 0.9181013602607575 4.2826686931088025 1788.0 19.878352941176466 0.0 - - - - - - - 198.33333333333334 3 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 1991 253 C20140704_OR004_03 C20140704_OR004_03 TB451744.[MT7]-LK[MT7]PEDITQIQPQQLVLR.3y7_1.heavy 769.793 / 853.525 39204.0 38.70899963378906 50 20 10 10 10 3.0494812255186248 24.99474716621891 0.0 3 0.9912963437103407 13.218920903847266 39204.0 -0.12938613861385306 0.0 - - - - - - - 302.6666666666667 78 3 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1993 253 C20140704_OR004_03 C20140704_OR004_03 TB451744.[MT7]-LK[MT7]PEDITQIQPQQLVLR.3b5_1.heavy 769.793 / 871.513 10293.0 38.70899963378906 50 20 10 10 10 3.0494812255186248 24.99474716621891 0.0 3 0.9912963437103407 13.218920903847266 10293.0 -1.6985148514851502 0.0 - - - - - - - 201.66666666666666 20 3 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1995 253 C20140704_OR004_03 C20140704_OR004_03 TB451744.[MT7]-LK[MT7]PEDITQIQPQQLVLR.3y8_1.heavy 769.793 / 981.584 14682.0 38.70899963378906 50 20 10 10 10 3.0494812255186248 24.99474716621891 0.0 3 0.9912963437103407 13.218920903847266 14682.0 -0.45274889867841406 0.0 - - - - - - - 340.5 29 4 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1997 253 C20140704_OR004_03 C20140704_OR004_03 TB451744.[MT7]-LK[MT7]PEDITQIQPQQLVLR.3y9_1.heavy 769.793 / 1094.67 4692.0 38.70899963378906 50 20 10 10 10 3.0494812255186248 24.99474716621891 0.0 3 0.9912963437103407 13.218920903847266 4692.0 5.764247293059004 1.0 - - - - - - - 340.75 15 4 ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) 1999 254 C20140704_OR004_03 C20140704_OR004_03 TB451540.[MT7]-ILAEFEMTLER.2b4_1.heavy 748.401 / 571.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 2001 254 C20140704_OR004_03 C20140704_OR004_03 TB451540.[MT7]-ILAEFEMTLER.2y9_1.heavy 748.401 / 1125.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 2003 254 C20140704_OR004_03 C20140704_OR004_03 TB451540.[MT7]-ILAEFEMTLER.2y10_1.heavy 748.401 / 1238.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 2005 254 C20140704_OR004_03 C20140704_OR004_03 TB451540.[MT7]-ILAEFEMTLER.2y7_1.heavy 748.401 / 925.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - SH3BP1 SH3-domain binding protein 1 2007 255 C20140704_OR004_03 C20140704_OR004_03 TB428281.[MT7]-SSLEELHGDANWGEDLR.3b4_1.heavy 691.332 / 561.3 5707.0 34.35459899902344 48 18 10 10 10 6.867125828673724 14.56213305171276 0.0 3 0.9819818633349825 9.180221679676245 5707.0 17.71196780646758 0.0 - - - - - - - 418.0 11 4 SUN2 Sad1 and UNC84 domain containing 2 2009 255 C20140704_OR004_03 C20140704_OR004_03 TB428281.[MT7]-SSLEELHGDANWGEDLR.3b5_1.heavy 691.332 / 690.343 13920.0 34.35459899902344 48 18 10 10 10 6.867125828673724 14.56213305171276 0.0 3 0.9819818633349825 9.180221679676245 13920.0 120.63113028428245 0.0 - - - - - - - 278.4 27 5 SUN2 Sad1 and UNC84 domain containing 2 2011 255 C20140704_OR004_03 C20140704_OR004_03 TB428281.[MT7]-SSLEELHGDANWGEDLR.3y8_1.heavy 691.332 / 960.453 6403.0 34.35459899902344 48 18 10 10 10 6.867125828673724 14.56213305171276 0.0 3 0.9819818633349825 9.180221679676245 6403.0 25.779647462053205 0.0 - - - - - - - 252.9090909090909 12 11 SUN2 Sad1 and UNC84 domain containing 2 2013 255 C20140704_OR004_03 C20140704_OR004_03 TB428281.[MT7]-SSLEELHGDANWGEDLR.3y10_1.heavy 691.332 / 1132.5 10161.0 34.35459899902344 48 18 10 10 10 6.867125828673724 14.56213305171276 0.0 3 0.9819818633349825 9.180221679676245 10161.0 99.4169784172662 0.0 - - - - - - - 238.42857142857142 20 7 SUN2 Sad1 and UNC84 domain containing 2 2015 256 C20140704_OR004_03 C20140704_OR004_03 TB451746.[MT7]-FLSQPFQVAEVFTGHMGK[MT7].4y5_1.heavy 578.559 / 673.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 2017 256 C20140704_OR004_03 C20140704_OR004_03 TB451746.[MT7]-FLSQPFQVAEVFTGHMGK[MT7].4b4_1.heavy 578.559 / 620.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 2019 256 C20140704_OR004_03 C20140704_OR004_03 TB451746.[MT7]-FLSQPFQVAEVFTGHMGK[MT7].4y7_1.heavy 578.559 / 921.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 2021 256 C20140704_OR004_03 C20140704_OR004_03 TB451746.[MT7]-FLSQPFQVAEVFTGHMGK[MT7].4y6_1.heavy 578.559 / 774.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 2023 257 C20140704_OR004_03 C20140704_OR004_03 TB428280.[MT7]-IMNVIGEPIDERGPIK[MT7].3y6_1.heavy 690.394 / 843.517 5837.0 36.499698638916016 43 13 10 10 10 1.1789202090241844 51.77761530204336 0.0 3 0.919261105849053 4.31374721918431 5837.0 12.844611738780843 0.0 - - - - - - - 150.0 11 2 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 2025 257 C20140704_OR004_03 C20140704_OR004_03 TB428280.[MT7]-IMNVIGEPIDERGPIK[MT7].3b4_1.heavy 690.394 / 602.345 26939.0 36.499698638916016 43 13 10 10 10 1.1789202090241844 51.77761530204336 0.0 3 0.919261105849053 4.31374721918431 26939.0 22.436762317508066 0.0 - - - - - - - 277.85714285714283 53 7 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 2027 257 C20140704_OR004_03 C20140704_OR004_03 TB428280.[MT7]-IMNVIGEPIDERGPIK[MT7].3b3_1.heavy 690.394 / 503.277 23347.0 36.499698638916016 43 13 10 10 10 1.1789202090241844 51.77761530204336 0.0 3 0.919261105849053 4.31374721918431 23347.0 44.99531823076629 0.0 - - - - - - - 249.66666666666666 46 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 2029 257 C20140704_OR004_03 C20140704_OR004_03 TB428280.[MT7]-IMNVIGEPIDERGPIK[MT7].3y9_1.heavy 690.394 / 1168.68 11524.0 36.499698638916016 43 13 10 10 10 1.1789202090241844 51.77761530204336 0.0 3 0.919261105849053 4.31374721918431 11524.0 42.0822607835628 0.0 - - - - - - - 274.5 23 6 ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 2031 258 C20140704_OR004_03 C20140704_OR004_03 TB413515.[MT7]-LQGVFSK[MT7].2y5_1.heavy 533.829 / 681.405 3863.0 31.38610076904297 38 20 2 10 6 10.612183545702651 9.423131400746879 0.0 5 0.9963599177085417 20.449134990930638 3863.0 2.7958820523089822 1.0 - - - - - - - 202.22222222222223 8 9 KIAA1267 KIAA1267 2033 258 C20140704_OR004_03 C20140704_OR004_03 TB413515.[MT7]-LQGVFSK[MT7].2b4_1.heavy 533.829 / 542.342 2159.0 31.38610076904297 38 20 2 10 6 10.612183545702651 9.423131400746879 0.0 5 0.9963599177085417 20.449134990930638 2159.0 7.767521281535366 1.0 - - - - - - - 299.72727272727275 4 11 KIAA1267 KIAA1267 2035 258 C20140704_OR004_03 C20140704_OR004_03 TB413515.[MT7]-LQGVFSK[MT7].2y3_1.heavy 533.829 / 525.315 6477.0 31.38610076904297 38 20 2 10 6 10.612183545702651 9.423131400746879 0.0 5 0.9963599177085417 20.449134990930638 6477.0 9.467947214076245 1.0 - - - - - - - 243.57142857142858 30 7 KIAA1267 KIAA1267 2037 258 C20140704_OR004_03 C20140704_OR004_03 TB413515.[MT7]-LQGVFSK[MT7].2y6_1.heavy 533.829 / 809.464 2841.0 31.38610076904297 38 20 2 10 6 10.612183545702651 9.423131400746879 0.0 5 0.9963599177085417 20.449134990930638 2841.0 2.7396485789748373 2.0 - - - - - - - 199.0 8 8 KIAA1267 KIAA1267 2039 259 C20140704_OR004_03 C20140704_OR004_03 TB413922.[MT7]-MIDRNLREDGEK[MT7].4y4_1.heavy 441.738 / 592.306 889.0 21.925299644470215 46 20 10 6 10 12.04649504517258 8.301169728208475 0.03980064392089844 3 0.9913260985108417 13.241607409213822 889.0 2.747963779452899 0.0 - - - - - - - 0.0 1 0 GNAI1;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 2041 259 C20140704_OR004_03 C20140704_OR004_03 TB413922.[MT7]-MIDRNLREDGEK[MT7].4y8_2.heavy 441.738 / 552.792 1777.0 21.925299644470215 46 20 10 6 10 12.04649504517258 8.301169728208475 0.03980064392089844 3 0.9913260985108417 13.241607409213822 1777.0 27.85974576271186 0.0 - - - - - - - 155.25 3 8 GNAI1;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 2043 259 C20140704_OR004_03 C20140704_OR004_03 TB413922.[MT7]-MIDRNLREDGEK[MT7].4y3_1.heavy 441.738 / 477.279 10722.0 21.925299644470215 46 20 10 6 10 12.04649504517258 8.301169728208475 0.03980064392089844 3 0.9913260985108417 13.241607409213822 10722.0 30.92595121095121 0.0 - - - - - - - 243.44444444444446 21 9 GNAI1;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 2045 259 C20140704_OR004_03 C20140704_OR004_03 TB413922.[MT7]-MIDRNLREDGEK[MT7].4b3_1.heavy 441.738 / 504.261 4028.0 21.925299644470215 46 20 10 6 10 12.04649504517258 8.301169728208475 0.03980064392089844 3 0.9913260985108417 13.241607409213822 4028.0 47.24519520091411 0.0 - - - - - - - 172.1818181818182 8 11 GNAI1;GNAI3 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1;guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 2047 260 C20140704_OR004_03 C20140704_OR004_03 TB427823.[MT7]-NTGDGDAYR.2y6_1.heavy 556.758 / 696.295 169.0 16.058300018310547 43 13 10 10 10 1.9537868413547952 51.18265610318984 0.0 3 0.9075147598534138 4.026435607551767 169.0 6.461764705882353 3.0 - - - - - - - 0.0 0 0 GANC glucosidase, alpha; neutral C 2049 260 C20140704_OR004_03 C20140704_OR004_03 TB427823.[MT7]-NTGDGDAYR.2b5_1.heavy 556.758 / 589.27 202.0 16.058300018310547 43 13 10 10 10 1.9537868413547952 51.18265610318984 0.0 3 0.9075147598534138 4.026435607551767 202.0 2.3104477611940295 1.0 - - - - - - - 0.0 0 0 GANC glucosidase, alpha; neutral C 2051 260 C20140704_OR004_03 C20140704_OR004_03 TB427823.[MT7]-NTGDGDAYR.2y5_1.heavy 556.758 / 581.268 2361.0 16.058300018310547 43 13 10 10 10 1.9537868413547952 51.18265610318984 0.0 3 0.9075147598534138 4.026435607551767 2361.0 61.66791044776119 0.0 - - - - - - - 86.71428571428571 4 14 GANC glucosidase, alpha; neutral C 2053 260 C20140704_OR004_03 C20140704_OR004_03 TB427823.[MT7]-NTGDGDAYR.2b6_1.heavy 556.758 / 704.297 1484.0 16.058300018310547 43 13 10 10 10 1.9537868413547952 51.18265610318984 0.0 3 0.9075147598534138 4.026435607551767 1484.0 60.98862159789289 0.0 - - - - - - - 115.88888888888889 2 9 GANC glucosidase, alpha; neutral C