Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140704_OR004_04 C20140704_OR004_04 TB413915.[MT7]-EFEALTEENRTLR.3y10_2.heavy 584.64 / 601.828 9677.0 31.88559913635254 45 15 10 10 10 1.6597984356742093 42.96754392851537 0.0 3 0.9592243646800446 6.090811017334663 9677.0 27.010772779700112 0.0 - - - - - - - 336.6666666666667 19 3 C21orf7 chromosome 21 open reading frame 7 3 1 C20140704_OR004_04 C20140704_OR004_04 TB413915.[MT7]-EFEALTEENRTLR.3b4_1.heavy 584.64 / 621.3 24843.0 31.88559913635254 45 15 10 10 10 1.6597984356742093 42.96754392851537 0.0 3 0.9592243646800446 6.090811017334663 24843.0 53.09002923444103 0.0 - - - - - - - 247.42857142857142 49 7 C21orf7 chromosome 21 open reading frame 7 5 1 C20140704_OR004_04 C20140704_OR004_04 TB413915.[MT7]-EFEALTEENRTLR.3b3_1.heavy 584.64 / 550.263 15599.0 31.88559913635254 45 15 10 10 10 1.6597984356742093 42.96754392851537 0.0 3 0.9592243646800446 6.090811017334663 15599.0 34.18465974625144 0.0 - - - - - - - 681.1428571428571 31 7 C21orf7 chromosome 21 open reading frame 7 7 1 C20140704_OR004_04 C20140704_OR004_04 TB413915.[MT7]-EFEALTEENRTLR.3y12_2.heavy 584.64 / 739.883 26577.0 31.88559913635254 45 15 10 10 10 1.6597984356742093 42.96754392851537 0.0 3 0.9592243646800446 6.090811017334663 26577.0 77.2480276816609 0.0 - - - - - - - 312.8333333333333 53 6 C21orf7 chromosome 21 open reading frame 7 9 2 C20140704_OR004_04 C20140704_OR004_04 TB427701.[MT7]-VEQFAR.2y4_1.heavy 447.252 / 521.283 810.0 23.532575130462646 32 17 6 3 6 7.131926846290872 14.021456214460105 0.07589912414550781 6 0.9779805077977625 8.301538213021686 810.0 5.207920792079208 5.0 - - - - - - - 185.33333333333334 4 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 11 2 C20140704_OR004_04 C20140704_OR004_04 TB427701.[MT7]-VEQFAR.2b3_1.heavy 447.252 / 501.279 1923.0 23.532575130462646 32 17 6 3 6 7.131926846290872 14.021456214460105 0.07589912414550781 6 0.9779805077977625 8.301538213021686 1923.0 0.0 1.0 - - - - - - - 202.36363636363637 3 11 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 13 2 C20140704_OR004_04 C20140704_OR004_04 TB427701.[MT7]-VEQFAR.2y5_1.heavy 447.252 / 650.326 2327.0 23.532575130462646 32 17 6 3 6 7.131926846290872 14.021456214460105 0.07589912414550781 6 0.9779805077977625 8.301538213021686 2327.0 9.45585792854171 1.0 - - - - - - - 202.25 6 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 15 2 C20140704_OR004_04 C20140704_OR004_04 TB427701.[MT7]-VEQFAR.2b4_1.heavy 447.252 / 648.347 304.0 23.532575130462646 32 17 6 3 6 7.131926846290872 14.021456214460105 0.07589912414550781 6 0.9779805077977625 8.301538213021686 304.0 3.8094059405940595 13.0 - - - - - - - 0.0 1 0 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 17 3 C20140704_OR004_04 C20140704_OR004_04 TB413661.[MT7]-IPHGVSGVQDR.2y8_1.heavy 654.861 / 817.416 2677.0 22.803499698638916 38 17 10 3 8 4.340020292535074 23.041366919874104 0.07380104064941406 4 0.9767433702202282 8.076880969628096 2677.0 37.85656565656566 0.0 - - - - - - - 198.1 5 10 DPYSL5 dihydropyrimidinase-like 5 19 3 C20140704_OR004_04 C20140704_OR004_04 TB413661.[MT7]-IPHGVSGVQDR.2y10_1.heavy 654.861 / 1051.53 7437.0 22.803499698638916 38 17 10 3 8 4.340020292535074 23.041366919874104 0.07380104064941406 4 0.9767433702202282 8.076880969628096 7437.0 142.73030303030305 0.0 - - - - - - - 165.0 14 3 DPYSL5 dihydropyrimidinase-like 5 21 3 C20140704_OR004_04 C20140704_OR004_04 TB413661.[MT7]-IPHGVSGVQDR.2y9_1.heavy 654.861 / 954.475 496.0 22.803499698638916 38 17 10 3 8 4.340020292535074 23.041366919874104 0.07380104064941406 4 0.9767433702202282 8.076880969628096 496.0 1.2934453781512605 3.0 - - - - - - - 0.0 1 0 DPYSL5 dihydropyrimidinase-like 5 23 3 C20140704_OR004_04 C20140704_OR004_04 TB413661.[MT7]-IPHGVSGVQDR.2y7_1.heavy 654.861 / 760.395 297.0 22.803499698638916 38 17 10 3 8 4.340020292535074 23.041366919874104 0.07380104064941406 4 0.9767433702202282 8.076880969628096 297.0 1.2000000000000002 11.0 - - - - - - - 0.0 0 0 DPYSL5 dihydropyrimidinase-like 5 25 4 C20140704_OR004_04 C20140704_OR004_04 TB451738.[MT7]-RLPYVPEPYYPESGWDR.3y7_1.heavy 756.712 / 846.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 27 4 C20140704_OR004_04 C20140704_OR004_04 TB451738.[MT7]-RLPYVPEPYYPESGWDR.3b4_1.heavy 756.712 / 674.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 29 4 C20140704_OR004_04 C20140704_OR004_04 TB451738.[MT7]-RLPYVPEPYYPESGWDR.3b5_1.heavy 756.712 / 773.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 31 4 C20140704_OR004_04 C20140704_OR004_04 TB451738.[MT7]-RLPYVPEPYYPESGWDR.3b7_1.heavy 756.712 / 999.574 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 33 5 C20140704_OR004_04 C20140704_OR004_04 TB413763.[MT7]-GIMEGNC[CAM]VSLTR.2y9_1.heavy 740.872 / 1035.49 3639.0 30.931050300598145 39 14 10 5 10 2.3067055049216623 33.374843689784306 0.043399810791015625 3 0.9432250662202198 5.154749555102577 3639.0 36.05852775031775 0.0 - - - - - - - 175.0 7 5 RBL1 retinoblastoma-like 1 (p107) 35 5 C20140704_OR004_04 C20140704_OR004_04 TB413763.[MT7]-GIMEGNC[CAM]VSLTR.2b6_1.heavy 740.872 / 746.362 873.0 30.931050300598145 39 14 10 5 10 2.3067055049216623 33.374843689784306 0.043399810791015625 3 0.9432250662202198 5.154749555102577 873.0 7.278648788439233 1.0 - - - - - - - 0.0 1 0 RBL1 retinoblastoma-like 1 (p107) 37 5 C20140704_OR004_04 C20140704_OR004_04 TB413763.[MT7]-GIMEGNC[CAM]VSLTR.2y6_1.heavy 740.872 / 735.382 582.0 30.931050300598145 39 14 10 5 10 2.3067055049216623 33.374843689784306 0.043399810791015625 3 0.9432250662202198 5.154749555102577 582.0 1.0654462242562928 28.0 - - - - - - - 315.6666666666667 6 6 RBL1 retinoblastoma-like 1 (p107) 39 5 C20140704_OR004_04 C20140704_OR004_04 TB413763.[MT7]-GIMEGNC[CAM]VSLTR.2y10_1.heavy 740.872 / 1166.53 1747.0 30.931050300598145 39 14 10 5 10 2.3067055049216623 33.374843689784306 0.043399810791015625 3 0.9432250662202198 5.154749555102577 1747.0 11.346494845360825 0.0 - - - - - - - 218.5 3 4 RBL1 retinoblastoma-like 1 (p107) 41 6 C20140704_OR004_04 C20140704_OR004_04 TB413558.[MT7]-EELLDIK[MT7].2b3_1.heavy 574.344 / 516.279 3168.0 33.96592426300049 31 16 10 5 0 3.794261964674658 26.355586654537852 0.042102813720703125 37 0.9696349725391639 7.064320821174149 3168.0 3.1586013986013985 1.0 - - - - - - - 245.14285714285714 6 7 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 43 6 C20140704_OR004_04 C20140704_OR004_04 TB413558.[MT7]-EELLDIK[MT7].2y3_1.heavy 574.344 / 519.326 2244.0 33.96592426300049 31 16 10 5 0 3.794261964674658 26.355586654537852 0.042102813720703125 37 0.9696349725391639 7.064320821174149 2244.0 2.371052631578947 4.0 - - - - - - - 584.5714285714286 5 7 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 45 6 C20140704_OR004_04 C20140704_OR004_04 TB413558.[MT7]-EELLDIK[MT7].2y6_1.heavy 574.344 / 874.537 2112.0 33.96592426300049 31 16 10 5 0 3.794261964674658 26.355586654537852 0.042102813720703125 37 0.9696349725391639 7.064320821174149 2112.0 9.600000000000001 1.0 - - - - - - - 546.8571428571429 8 7 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 47 6 C20140704_OR004_04 C20140704_OR004_04 TB413558.[MT7]-EELLDIK[MT7].2b5_1.heavy 574.344 / 744.39 8447.0 33.96592426300049 31 16 10 5 0 3.794261964674658 26.355586654537852 0.042102813720703125 37 0.9696349725391639 7.064320821174149 8447.0 40.63518939393939 0.0 - - - - - - - 207.42857142857142 16 7 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 49 7 C20140704_OR004_04 C20140704_OR004_04 TB428393.[MT7]-ENNIFY[MT7]SPISITSALGMVLLGAK[MT7].4y4_1.heavy 718.407 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 51 7 C20140704_OR004_04 C20140704_OR004_04 TB428393.[MT7]-ENNIFY[MT7]SPISITSALGMVLLGAK[MT7].4b4_1.heavy 718.407 / 615.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 53 7 C20140704_OR004_04 C20140704_OR004_04 TB428393.[MT7]-ENNIFY[MT7]SPISITSALGMVLLGAK[MT7].4b5_1.heavy 718.407 / 762.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 55 7 C20140704_OR004_04 C20140704_OR004_04 TB428393.[MT7]-ENNIFY[MT7]SPISITSALGMVLLGAK[MT7].4b3_1.heavy 718.407 / 502.238 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 57 8 C20140704_OR004_04 C20140704_OR004_04 TB451421.[MT7]-REIEAPEVR.3b4_1.heavy 414.902 / 672.38 6767.0 22.23550033569336 47 17 10 10 10 5.928240877556337 16.86841038774064 0.0 3 0.9743710490096068 7.692456031018351 6767.0 48.866888781780936 0.0 - - - - - - - 215.0 13 9 C7orf43 chromosome 7 open reading frame 43 59 8 C20140704_OR004_04 C20140704_OR004_04 TB451421.[MT7]-REIEAPEVR.3b5_1.heavy 414.902 / 743.417 2320.0 22.23550033569336 47 17 10 10 10 5.928240877556337 16.86841038774064 0.0 3 0.9743710490096068 7.692456031018351 2320.0 34.61659099407083 0.0 - - - - - - - 241.75 4 8 C7orf43 chromosome 7 open reading frame 43 61 8 C20140704_OR004_04 C20140704_OR004_04 TB451421.[MT7]-REIEAPEVR.3y4_1.heavy 414.902 / 500.283 14887.0 22.23550033569336 47 17 10 10 10 5.928240877556337 16.86841038774064 0.0 3 0.9743710490096068 7.692456031018351 14887.0 173.55297709760728 0.0 - - - - - - - 181.25 29 8 C7orf43 chromosome 7 open reading frame 43 63 8 C20140704_OR004_04 C20140704_OR004_04 TB451421.[MT7]-REIEAPEVR.3y5_1.heavy 414.902 / 571.32 3963.0 22.23550033569336 47 17 10 10 10 5.928240877556337 16.86841038774064 0.0 3 0.9743710490096068 7.692456031018351 3963.0 0.0 1.0 - - - - - - - 225.55555555555554 7 9 C7orf43 chromosome 7 open reading frame 43 65 9 C20140704_OR004_04 C20140704_OR004_04 TB413553.[MT7]-AETTPSGGK[MT7].2y4_1.heavy 568.313 / 492.29 541.0 15.189299583435059 47 17 10 10 10 11.200996883138048 8.92777679016586 0.0 3 0.9785944450494203 8.420179946479326 541.0 1.325969284467714 3.0 - - - - - - - 203.14285714285714 2 21 DPP8 dipeptidyl-peptidase 8 67 9 C20140704_OR004_04 C20140704_OR004_04 TB413553.[MT7]-AETTPSGGK[MT7].2y5_1.heavy 568.313 / 589.343 4138.0 15.189299583435059 47 17 10 10 10 11.200996883138048 8.92777679016586 0.0 3 0.9785944450494203 8.420179946479326 4138.0 50.158246091668964 0.0 - - - - - - - 143.08333333333334 8 12 DPP8 dipeptidyl-peptidase 8 69 9 C20140704_OR004_04 C20140704_OR004_04 TB413553.[MT7]-AETTPSGGK[MT7].2y6_1.heavy 568.313 / 690.39 955.0 15.189299583435059 47 17 10 10 10 11.200996883138048 8.92777679016586 0.0 3 0.9785944450494203 8.420179946479326 955.0 17.248517156862746 0.0 - - - - - - - 0.0 1 0 DPP8 dipeptidyl-peptidase 8 71 9 C20140704_OR004_04 C20140704_OR004_04 TB413553.[MT7]-AETTPSGGK[MT7].2y7_1.heavy 568.313 / 791.438 1178.0 15.189299583435059 47 17 10 10 10 11.200996883138048 8.92777679016586 0.0 3 0.9785944450494203 8.420179946479326 1178.0 52.27374999999999 0.0 - - - - - - - 104.71428571428571 2 7 DPP8 dipeptidyl-peptidase 8 73 10 C20140704_OR004_04 C20140704_OR004_04 TB413551.[MT7]-IVVTVWK[MT7].2y4_1.heavy 566.87 / 677.41 10447.0 37.13330078125 45 15 10 10 10 2.0829261978830087 38.372556463507905 0.0 3 0.9579052838122076 5.99395147755228 10447.0 36.97533707865169 0.0 - - - - - - - 267.0 20 12 C7orf43 chromosome 7 open reading frame 43 75 10 C20140704_OR004_04 C20140704_OR004_04 TB413551.[MT7]-IVVTVWK[MT7].2y5_1.heavy 566.87 / 776.479 10210.0 37.13330078125 45 15 10 10 10 2.0829261978830087 38.372556463507905 0.0 3 0.9579052838122076 5.99395147755228 10210.0 58.98355318676438 0.0 - - - - - - - 322.2857142857143 20 7 C7orf43 chromosome 7 open reading frame 43 77 10 C20140704_OR004_04 C20140704_OR004_04 TB413551.[MT7]-IVVTVWK[MT7].2y3_1.heavy 566.87 / 576.363 7954.0 37.13330078125 45 15 10 10 10 2.0829261978830087 38.372556463507905 0.0 3 0.9579052838122076 5.99395147755228 7954.0 10.485461909029015 0.0 - - - - - - - 644.7142857142857 15 7 C7orf43 chromosome 7 open reading frame 43 79 10 C20140704_OR004_04 C20140704_OR004_04 TB413551.[MT7]-IVVTVWK[MT7].2y6_1.heavy 566.87 / 875.547 17570.0 37.13330078125 45 15 10 10 10 2.0829261978830087 38.372556463507905 0.0 3 0.9579052838122076 5.99395147755228 17570.0 40.37384330193319 0.0 - - - - - - - 213.7 35 10 C7orf43 chromosome 7 open reading frame 43 81 11 C20140704_OR004_04 C20140704_OR004_04 TB451325.[MT7]-AVLSLDK[MT7].2y4_1.heavy 517.328 / 606.358 23401.0 29.744699478149414 40 20 2 10 8 12.154142128133953 8.227647738997863 0.0 4 0.9980970374371139 28.286443931698397 23401.0 60.051900893641836 1.0 - - - - - - - 242.85714285714286 117 7 C7orf43 chromosome 7 open reading frame 43 83 11 C20140704_OR004_04 C20140704_OR004_04 TB451325.[MT7]-AVLSLDK[MT7].2y5_1.heavy 517.328 / 719.442 18694.0 29.744699478149414 40 20 2 10 8 12.154142128133953 8.227647738997863 0.0 4 0.9980970374371139 28.286443931698397 18694.0 43.287334198654584 1.0 - - - - - - - 157.0 37 5 C7orf43 chromosome 7 open reading frame 43 85 11 C20140704_OR004_04 C20140704_OR004_04 TB451325.[MT7]-AVLSLDK[MT7].2y3_1.heavy 517.328 / 519.326 8759.0 29.744699478149414 40 20 2 10 8 12.154142128133953 8.227647738997863 0.0 4 0.9980970374371139 28.286443931698397 8759.0 20.361524527473904 0.0 - - - - - - - 261.2 17 10 C7orf43 chromosome 7 open reading frame 43 87 11 C20140704_OR004_04 C20140704_OR004_04 TB451325.[MT7]-AVLSLDK[MT7].2y6_1.heavy 517.328 / 818.51 10851.0 29.744699478149414 40 20 2 10 8 12.154142128133953 8.227647738997863 0.0 4 0.9980970374371139 28.286443931698397 10851.0 88.64803697737936 0.0 - - - - - - - 186.71428571428572 21 7 C7orf43 chromosome 7 open reading frame 43 89 12 C20140704_OR004_04 C20140704_OR004_04 TB451327.[MT7]-IQEMTK[MT7].2b3_1.heavy 519.299 / 515.295 11223.0 23.253999710083008 50 20 10 10 10 5.809663284511018 17.212701511739454 0.0 3 0.993076153970207 14.823056634346003 11223.0 81.71749892454616 0.0 - - - - - - - 259.3636363636364 22 11 HAUS7 HAUS augmin-like complex, subunit 7 91 12 C20140704_OR004_04 C20140704_OR004_04 TB451327.[MT7]-IQEMTK[MT7].2y4_1.heavy 519.299 / 652.346 14275.0 23.253999710083008 50 20 10 10 10 5.809663284511018 17.212701511739454 0.0 3 0.993076153970207 14.823056634346003 14275.0 96.2097909317732 0.0 - - - - - - - 186.8 28 10 HAUS7 HAUS augmin-like complex, subunit 7 93 12 C20140704_OR004_04 C20140704_OR004_04 TB451327.[MT7]-IQEMTK[MT7].2y5_1.heavy 519.299 / 780.404 23726.0 23.253999710083008 50 20 10 10 10 5.809663284511018 17.212701511739454 0.0 3 0.993076153970207 14.823056634346003 23726.0 113.33963750035849 0.0 - - - - - - - 196.5 47 6 HAUS7 HAUS augmin-like complex, subunit 7 95 12 C20140704_OR004_04 C20140704_OR004_04 TB451327.[MT7]-IQEMTK[MT7].2y3_1.heavy 519.299 / 523.303 21658.0 23.253999710083008 50 20 10 10 10 5.809663284511018 17.212701511739454 0.0 3 0.993076153970207 14.823056634346003 21658.0 223.92830101569712 0.0 - - - - - - - 204.91666666666666 43 12 HAUS7 HAUS augmin-like complex, subunit 7 97 13 C20140704_OR004_04 C20140704_OR004_04 TB413414.[MT7]-SSLVLR.2y4_1.heavy 409.764 / 500.355 4835.0 26.00850009918213 40 14 10 6 10 1.518729400884062 47.568549676915 0.035999298095703125 3 0.9499532593611515 5.493465061498593 4835.0 46.50614406779661 0.0 - - - - - - - 249.11111111111111 9 9 DIRAS1;DIRAS2;RAB5A;RAB5B;RAB5C DIRAS family, GTP-binding RAS-like 1;DIRAS family, GTP-binding RAS-like 2;RAB5A, member RAS oncogene family;RAB5B, member RAS oncogene family;RAB5C, member RAS oncogene family 99 13 C20140704_OR004_04 C20140704_OR004_04 TB413414.[MT7]-SSLVLR.2b3_1.heavy 409.764 / 432.258 13090.0 26.00850009918213 40 14 10 6 10 1.518729400884062 47.568549676915 0.035999298095703125 3 0.9499532593611515 5.493465061498593 13090.0 54.63411016949152 0.0 - - - - - - - 265.5 26 12 DIRAS1;DIRAS2;RAB5A;RAB5B;RAB5C DIRAS family, GTP-binding RAS-like 1;DIRAS family, GTP-binding RAS-like 2;RAB5A, member RAS oncogene family;RAB5B, member RAS oncogene family;RAB5C, member RAS oncogene family 101 13 C20140704_OR004_04 C20140704_OR004_04 TB413414.[MT7]-SSLVLR.2y5_1.heavy 409.764 / 587.388 18986.0 26.00850009918213 40 14 10 6 10 1.518729400884062 47.568549676915 0.035999298095703125 3 0.9499532593611515 5.493465061498593 18986.0 87.91014065209686 0.0 - - - - - - - 236.0 37 8 DIRAS1;DIRAS2;RAB5A;RAB5B;RAB5C DIRAS family, GTP-binding RAS-like 1;DIRAS family, GTP-binding RAS-like 2;RAB5A, member RAS oncogene family;RAB5B, member RAS oncogene family;RAB5C, member RAS oncogene family 103 13 C20140704_OR004_04 C20140704_OR004_04 TB413414.[MT7]-SSLVLR.2b4_1.heavy 409.764 / 531.326 17925.0 26.00850009918213 40 14 10 6 10 1.518729400884062 47.568549676915 0.035999298095703125 3 0.9499532593611515 5.493465061498593 17925.0 101.16991525423728 0.0 - - - - - - - 311.09090909090907 35 11 DIRAS1;DIRAS2;RAB5A;RAB5B;RAB5C DIRAS family, GTP-binding RAS-like 1;DIRAS family, GTP-binding RAS-like 2;RAB5A, member RAS oncogene family;RAB5B, member RAS oncogene family;RAB5C, member RAS oncogene family 105 14 C20140704_OR004_04 C20140704_OR004_04 TB451322.[MT7]-SSPSSPAVR.2y8_1.heavy 516.284 / 800.426 2907.0 16.828899383544922 40 15 10 5 10 2.2597228859383254 37.425957529760595 0.0447998046875 3 0.9547594255404167 5.78025837217521 2907.0 58.24400715563506 0.0 - - - - - - - 86.33333333333333 5 3 C7orf43 chromosome 7 open reading frame 43 107 14 C20140704_OR004_04 C20140704_OR004_04 TB451322.[MT7]-SSPSSPAVR.2b7_1.heavy 516.284 / 758.38 1744.0 16.828899383544922 40 15 10 5 10 2.2597228859383254 37.425957529760595 0.0447998046875 3 0.9547594255404167 5.78025837217521 1744.0 38.19016815742397 0.0 - - - - - - - 137.375 3 8 C7orf43 chromosome 7 open reading frame 43 109 14 C20140704_OR004_04 C20140704_OR004_04 TB451322.[MT7]-SSPSSPAVR.2b5_1.heavy 516.284 / 590.29 388.0 16.828899383544922 40 15 10 5 10 2.2597228859383254 37.425957529760595 0.0447998046875 3 0.9547594255404167 5.78025837217521 388.0 7.16261419200954 1.0 - - - - - - - 0.0 0 0 C7orf43 chromosome 7 open reading frame 43 111 14 C20140704_OR004_04 C20140704_OR004_04 TB451322.[MT7]-SSPSSPAVR.2y7_1.heavy 516.284 / 713.394 2390.0 16.828899383544922 40 15 10 5 10 2.2597228859383254 37.425957529760595 0.0447998046875 3 0.9547594255404167 5.78025837217521 2390.0 33.65556411179746 1.0 - - - - - - - 137.5 5 8 C7orf43 chromosome 7 open reading frame 43 113 15 C20140704_OR004_04 C20140704_OR004_04 TB413411.[MT7]-GVVGGK[MT7].2y4_1.heavy 402.763 / 504.326 10266.0 17.22130012512207 39 18 8 5 8 5.941244284176762 16.83149105084413 0.040599822998046875 4 0.980766709563316 8.884582640443057 10266.0 176.84895999999998 0.0 - - - - - - - 156.25 20 12 DPYSL5 dihydropyrimidinase-like 5 115 15 C20140704_OR004_04 C20140704_OR004_04 TB413411.[MT7]-GVVGGK[MT7].2y5_1.heavy 402.763 / 603.395 2398.0 17.22130012512207 39 18 8 5 8 5.941244284176762 16.83149105084413 0.040599822998046875 4 0.980766709563316 8.884582640443057 2398.0 23.98 0.0 - - - - - - - 203.57142857142858 4 7 DPYSL5 dihydropyrimidinase-like 5 117 15 C20140704_OR004_04 C20140704_OR004_04 TB413411.[MT7]-GVVGGK[MT7].2y3_1.heavy 402.763 / 405.258 10566.0 17.22130012512207 39 18 8 5 8 5.941244284176762 16.83149105084413 0.040599822998046875 4 0.980766709563316 8.884582640443057 10566.0 98.61600000000001 1.0 - - - - - - - 181.25 28 12 DPYSL5 dihydropyrimidinase-like 5 119 15 C20140704_OR004_04 C20140704_OR004_04 TB413411.[MT7]-GVVGGK[MT7].2b5_1.heavy 402.763 / 514.311 674.0 17.22130012512207 39 18 8 5 8 5.941244284176762 16.83149105084413 0.040599822998046875 4 0.980766709563316 8.884582640443057 674.0 2.029565776865161 9.0 - - - - - - - 279.54545454545456 2 11 DPYSL5 dihydropyrimidinase-like 5 121 16 C20140704_OR004_04 C20140704_OR004_04 TB413905.[MT7]-FYQTSVESTDFANAPEESRK[MT7].3y7_1.heavy 865.425 / 960.523 2184.0 31.256699562072754 35 10 10 5 10 0.803483748872772 76.56755946122328 0.04500007629394531 3 0.8499914277627196 3.14571621554375 2184.0 12.15302649272217 0.0 - - - - - - - 364.0 4 2 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 123 16 C20140704_OR004_04 C20140704_OR004_04 TB413905.[MT7]-FYQTSVESTDFANAPEESRK[MT7].3y6_1.heavy 865.425 / 889.486 1456.0 31.256699562072754 35 10 10 5 10 0.803483748872772 76.56755946122328 0.04500007629394531 3 0.8499914277627196 3.14571621554375 1456.0 12.606328328265572 0.0 - - - - - - - 146.0 2 3 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 125 16 C20140704_OR004_04 C20140704_OR004_04 TB413905.[MT7]-FYQTSVESTDFANAPEESRK[MT7].3b3_1.heavy 865.425 / 583.3 1456.0 31.256699562072754 35 10 10 5 10 0.803483748872772 76.56755946122328 0.04500007629394531 3 0.8499914277627196 3.14571621554375 1456.0 5.297574370709382 0.0 - - - - - - - 291.4 2 5 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 127 16 C20140704_OR004_04 C20140704_OR004_04 TB413905.[MT7]-FYQTSVESTDFANAPEESRK[MT7].3y9_1.heavy 865.425 / 1145.6 728.0 31.256699562072754 35 10 10 5 10 0.803483748872772 76.56755946122328 0.04500007629394531 3 0.8499914277627196 3.14571621554375 728.0 4.7532646048109966 1.0 - - - - - - - 0.0 1 0 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 129 17 C20140704_OR004_04 C20140704_OR004_04 TB427711.[MT7]-LLQSLFLDK[MT7].3y3_1.heavy 455.618 / 519.326 3127.0 45.38510036468506 44 18 10 6 10 6.393429941397319 15.641056665453107 0.037197113037109375 3 0.9867823158167193 10.722724727156502 3127.0 55.291193873999305 0.0 - - - - - - - 211.5 6 2 FAM198B family with sequence similarity 198, member B 131 17 C20140704_OR004_04 C20140704_OR004_04 TB427711.[MT7]-LLQSLFLDK[MT7].3b4_1.heavy 455.618 / 586.368 2367.0 45.38510036468506 44 18 10 6 10 6.393429941397319 15.641056665453107 0.037197113037109375 3 0.9867823158167193 10.722724727156502 2367.0 26.191065088757398 0.0 - - - - - - - 169.25 4 4 FAM198B family with sequence similarity 198, member B 133 17 C20140704_OR004_04 C20140704_OR004_04 TB427711.[MT7]-LLQSLFLDK[MT7].3y4_1.heavy 455.618 / 666.394 1606.0 45.38510036468506 44 18 10 6 10 6.393429941397319 15.641056665453107 0.037197113037109375 3 0.9867823158167193 10.722724727156502 1606.0 16.155029585798815 0.0 - - - - - - - 135.6 3 5 FAM198B family with sequence similarity 198, member B 135 17 C20140704_OR004_04 C20140704_OR004_04 TB427711.[MT7]-LLQSLFLDK[MT7].3b3_1.heavy 455.618 / 499.336 2198.0 45.38510036468506 44 18 10 6 10 6.393429941397319 15.641056665453107 0.037197113037109375 3 0.9867823158167193 10.722724727156502 2198.0 25.377228437387224 2.0 - - - - - - - 197.33333333333334 4 3 FAM198B family with sequence similarity 198, member B 137 18 C20140704_OR004_04 C20140704_OR004_04 TB451729.[MT7]-LPFTQSIYTHYRLPSVR.4y5_1.heavy 556.31 / 571.356 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 139 18 C20140704_OR004_04 C20140704_OR004_04 TB451729.[MT7]-LPFTQSIYTHYRLPSVR.4y10_2.heavy 556.31 / 646.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 141 18 C20140704_OR004_04 C20140704_OR004_04 TB451729.[MT7]-LPFTQSIYTHYRLPSVR.4b4_1.heavy 556.31 / 603.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 143 18 C20140704_OR004_04 C20140704_OR004_04 TB451729.[MT7]-LPFTQSIYTHYRLPSVR.4b3_1.heavy 556.31 / 502.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 145 19 C20140704_OR004_04 C20140704_OR004_04 TB413901.[MT7]-INSWVESQTNEK[MT7].3y3_1.heavy 574.968 / 534.3 10917.0 31.413999557495117 41 16 9 10 6 3.761556154733027 21.724845535519993 0.0 5 0.9653159377063391 6.6074528670914185 10917.0 12.074653168135562 1.0 - - - - - - - 388.3333333333333 41 3 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 147 19 C20140704_OR004_04 C20140704_OR004_04 TB413901.[MT7]-INSWVESQTNEK[MT7].3b4_1.heavy 574.968 / 645.348 10335.0 31.413999557495117 41 16 9 10 6 3.761556154733027 21.724845535519993 0.0 5 0.9653159377063391 6.6074528670914185 10335.0 44.927061855670104 1.0 - - - - - - - 258.8888888888889 30 9 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 149 19 C20140704_OR004_04 C20140704_OR004_04 TB413901.[MT7]-INSWVESQTNEK[MT7].3b5_1.heavy 574.968 / 744.416 5968.0 31.413999557495117 41 16 9 10 6 3.761556154733027 21.724845535519993 0.0 5 0.9653159377063391 6.6074528670914185 5968.0 1.8823267898401905 1.0 - - - - - - - 291.42857142857144 14 7 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 151 19 C20140704_OR004_04 C20140704_OR004_04 TB413901.[MT7]-INSWVESQTNEK[MT7].3y4_1.heavy 574.968 / 635.348 16739.0 31.413999557495117 41 16 9 10 6 3.761556154733027 21.724845535519993 0.0 5 0.9653159377063391 6.6074528670914185 16739.0 50.332044673539514 0.0 - - - - - - - 291.3333333333333 33 9 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 153 20 C20140704_OR004_04 C20140704_OR004_04 TB451728.[MT7]-DLNC[CAM]PFLEGLYITEPK[MT7].3b9_1.heavy 733.053 / 1190.56 9786.0 45.60897636413574 43 17 10 6 10 3.375128761172187 29.628499259171928 0.03910064697265625 3 0.9784675083412704 8.39523474698598 9786.0 -2.1000000000000005 0.0 - - - - - - - 192.0 19 5 HAUS7 HAUS augmin-like complex, subunit 7 155 20 C20140704_OR004_04 C20140704_OR004_04 TB451728.[MT7]-DLNC[CAM]PFLEGLYITEPK[MT7].3b6_1.heavy 733.053 / 891.415 20883.0 45.60897636413574 43 17 10 6 10 3.375128761172187 29.628499259171928 0.03910064697265625 3 0.9784675083412704 8.39523474698598 20883.0 -0.9557437070938235 0.0 - - - - - - - 227.2 41 5 HAUS7 HAUS augmin-like complex, subunit 7 157 20 C20140704_OR004_04 C20140704_OR004_04 TB451728.[MT7]-DLNC[CAM]PFLEGLYITEPK[MT7].3b4_1.heavy 733.053 / 647.294 24379.0 45.60897636413574 43 17 10 6 10 3.375128761172187 29.628499259171928 0.03910064697265625 3 0.9784675083412704 8.39523474698598 24379.0 29.465712468193384 1.0 - - - - - - - 227.2 48 5 HAUS7 HAUS augmin-like complex, subunit 7 159 20 C20140704_OR004_04 C20140704_OR004_04 TB451728.[MT7]-DLNC[CAM]PFLEGLYITEPK[MT7].3y4_1.heavy 733.053 / 618.358 15029.0 45.60897636413574 43 17 10 6 10 3.375128761172187 29.628499259171928 0.03910064697265625 3 0.9784675083412704 8.39523474698598 15029.0 32.21672853400729 2.0 - - - - - - - 252.44444444444446 33 9 HAUS7 HAUS augmin-like complex, subunit 7 161 21 C20140704_OR004_04 C20140704_OR004_04 TB414200.[MT7]-LHALRTEYFAQHEQGAAAGAADISTLDQK[MT7].4y5_1.heavy 850.943 / 748.432 9431.0 32.40489959716797 44 14 10 10 10 4.5286616303283225 22.081579098403544 0.0 3 0.9318371491322782 4.6999169178313105 9431.0 83.6081560283688 0.0 - - - - - - - 197.4 18 5 HAUS7 HAUS augmin-like complex, subunit 7 163 21 C20140704_OR004_04 C20140704_OR004_04 TB414200.[MT7]-LHALRTEYFAQHEQGAAAGAADISTLDQK[MT7].4b16_2.heavy 850.943 / 999.009 8868.0 32.40489959716797 44 14 10 10 10 4.5286616303283225 22.081579098403544 0.0 3 0.9318371491322782 4.6999169178313105 8868.0 87.73659574468084 0.0 - - - - - - - 261.57142857142856 17 7 HAUS7 HAUS augmin-like complex, subunit 7 165 21 C20140704_OR004_04 C20140704_OR004_04 TB414200.[MT7]-LHALRTEYFAQHEQGAAAGAADISTLDQK[MT7].4b11_2.heavy 850.943 / 737.9 2111.0 32.40489959716797 44 14 10 10 10 4.5286616303283225 22.081579098403544 0.0 3 0.9318371491322782 4.6999169178313105 2111.0 4.8023637335533245 1.0 - - - - - - - 422.0 5 1 HAUS7 HAUS augmin-like complex, subunit 7 167 21 C20140704_OR004_04 C20140704_OR004_04 TB414200.[MT7]-LHALRTEYFAQHEQGAAAGAADISTLDQK[MT7].4y6_1.heavy 850.943 / 835.464 11261.0 32.40489959716797 44 14 10 10 10 4.5286616303283225 22.081579098403544 0.0 3 0.9318371491322782 4.6999169178313105 11261.0 34.677795368763114 0.0 - - - - - - - 211.5 22 4 HAUS7 HAUS augmin-like complex, subunit 7 169 22 C20140704_OR004_04 C20140704_OR004_04 TB451726.[MT7]-TYQFLQEYLDAIK[MT7]K[MT7].3b4_1.heavy 731.416 / 684.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 171 22 C20140704_OR004_04 C20140704_OR004_04 TB451726.[MT7]-TYQFLQEYLDAIK[MT7]K[MT7].3b5_1.heavy 731.416 / 797.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 173 22 C20140704_OR004_04 C20140704_OR004_04 TB451726.[MT7]-TYQFLQEYLDAIK[MT7]K[MT7].3b3_1.heavy 731.416 / 537.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 175 22 C20140704_OR004_04 C20140704_OR004_04 TB451726.[MT7]-TYQFLQEYLDAIK[MT7]K[MT7].3y5_1.heavy 731.416 / 862.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 177 23 C20140704_OR004_04 C20140704_OR004_04 TB451724.[MT7]-DLSMIVLLPNEIDGLQK[MT7].2y4_1.heavy 1093.62 / 589.379 2359.0 48.34744834899902 40 15 10 5 10 1.9957082215098925 33.43416698945886 0.042499542236328125 3 0.9530923215298702 5.675811497887593 2359.0 -0.20999999999999996 0.0 - - - - - - - 224.83333333333334 4 6 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 179 23 C20140704_OR004_04 C20140704_OR004_04 TB451724.[MT7]-DLSMIVLLPNEIDGLQK[MT7].2y9_1.heavy 1093.62 / 1157.63 6573.0 48.34744834899902 40 15 10 5 10 1.9957082215098925 33.43416698945886 0.042499542236328125 3 0.9530923215298702 5.675811497887593 6573.0 11.44062479459901 0.0 - - - - - - - 196.33333333333334 13 3 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 181 23 C20140704_OR004_04 C20140704_OR004_04 TB451724.[MT7]-DLSMIVLLPNEIDGLQK[MT7].2b4_1.heavy 1093.62 / 591.293 3961.0 48.34744834899902 40 15 10 5 10 1.9957082215098925 33.43416698945886 0.042499542236328125 3 0.9530923215298702 5.675811497887593 3961.0 -2.088859591298616 0.0 - - - - - - - 189.5 7 4 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 183 23 C20140704_OR004_04 C20140704_OR004_04 TB451724.[MT7]-DLSMIVLLPNEIDGLQK[MT7].2b6_1.heavy 1093.62 / 803.445 5393.0 48.34744834899902 40 15 10 5 10 1.9957082215098925 33.43416698945886 0.042499542236328125 3 0.9530923215298702 5.675811497887593 5393.0 -8.526482213438737 0.0 - - - - - - - 158.125 10 8 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 185 24 C20140704_OR004_04 C20140704_OR004_04 TB413909.[MT7]-GVNSFQMFMTYK[MT7].2y3_1.heavy 870.938 / 555.326 1392.0 42.211448669433594 42 16 10 6 10 2.2615047962676873 39.84127099142324 0.035400390625 3 0.9687092697845031 6.958498185580636 1392.0 7.010071942446043 0.0 - - - - - - - 216.66666666666666 2 12 DPYSL5 dihydropyrimidinase-like 5 187 24 C20140704_OR004_04 C20140704_OR004_04 TB413909.[MT7]-GVNSFQMFMTYK[MT7].2b6_1.heavy 870.938 / 777.401 1299.0 42.211448669433594 42 16 10 6 10 2.2615047962676873 39.84127099142324 0.035400390625 3 0.9687092697845031 6.958498185580636 1299.0 0.7002695417789758 0.0 - - - - - - - 192.84615384615384 2 13 DPYSL5 dihydropyrimidinase-like 5 189 24 C20140704_OR004_04 C20140704_OR004_04 TB413909.[MT7]-GVNSFQMFMTYK[MT7].2y6_1.heavy 870.938 / 964.475 742.0 42.211448669433594 42 16 10 6 10 2.2615047962676873 39.84127099142324 0.035400390625 3 0.9687092697845031 6.958498185580636 742.0 4.127426479115927 5.0 - - - - - - - 0.0 1 0 DPYSL5 dihydropyrimidinase-like 5 191 24 C20140704_OR004_04 C20140704_OR004_04 TB413909.[MT7]-GVNSFQMFMTYK[MT7].2b7_1.heavy 870.938 / 908.442 1021.0 42.211448669433594 42 16 10 6 10 2.2615047962676873 39.84127099142324 0.035400390625 3 0.9687092697845031 6.958498185580636 1021.0 11.911666666666665 0.0 - - - - - - - 185.75 2 8 DPYSL5 dihydropyrimidinase-like 5 193 25 C20140704_OR004_04 C20140704_OR004_04 TB428295.[MT7]-EGLEVPLIAVVQWSTPK[MT7].4y4_1.heavy 539.316 / 576.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 195 25 C20140704_OR004_04 C20140704_OR004_04 TB428295.[MT7]-EGLEVPLIAVVQWSTPK[MT7].4b7_1.heavy 539.316 / 882.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 197 25 C20140704_OR004_04 C20140704_OR004_04 TB428295.[MT7]-EGLEVPLIAVVQWSTPK[MT7].4b4_1.heavy 539.316 / 573.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 199 25 C20140704_OR004_04 C20140704_OR004_04 TB428295.[MT7]-EGLEVPLIAVVQWSTPK[MT7].4b5_1.heavy 539.316 / 672.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 201 26 C20140704_OR004_04 C20140704_OR004_04 TB428196.[MT7]-FMFDLFQQFRK[MT7].3y6_1.heavy 598.992 / 997.57 7826.0 47.57680130004883 41 11 10 10 10 0.8292807850972127 65.71751385670247 0.0 3 0.8652799551882774 3.3238810864925314 7826.0 93.9333477252647 1.0 - - - - - - - 184.33333333333334 17 3 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 203 26 C20140704_OR004_04 C20140704_OR004_04 TB428196.[MT7]-FMFDLFQQFRK[MT7].3b4_1.heavy 598.992 / 685.314 14545.0 47.57680130004883 41 11 10 10 10 0.8292807850972127 65.71751385670247 0.0 3 0.8652799551882774 3.3238810864925314 14545.0 57.99588607594937 0.0 - - - - - - - 243.07692307692307 31 13 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 205 26 C20140704_OR004_04 C20140704_OR004_04 TB428196.[MT7]-FMFDLFQQFRK[MT7].3y7_2.heavy 598.992 / 555.831 22134.0 47.57680130004883 41 11 10 10 10 0.8292807850972127 65.71751385670247 0.0 3 0.8652799551882774 3.3238810864925314 22134.0 15.419337882811323 0.0 - - - - - - - 180.57142857142858 44 7 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 207 26 C20140704_OR004_04 C20140704_OR004_04 TB428196.[MT7]-FMFDLFQQFRK[MT7].3y9_2.heavy 598.992 / 686.878 10040.0 47.57680130004883 41 11 10 10 10 0.8292807850972127 65.71751385670247 0.0 3 0.8652799551882774 3.3238810864925314 10040.0 43.76084388185654 0.0 - - - - - - - 266.625 20 8 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 209 27 C20140704_OR004_04 C20140704_OR004_04 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 148934.0 30.061899185180664 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 148934.0 970.6388275862068 0.0 - - - - - - - 322.22222222222223 297 9 211 27 C20140704_OR004_04 C20140704_OR004_04 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 57226.0 30.061899185180664 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 57226.0 172.6411025755457 0.0 - - - - - - - 265.8333333333333 114 6 213 27 C20140704_OR004_04 C20140704_OR004_04 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 73308.0 30.061899185180664 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 73308.0 184.58736729047038 0.0 - - - - - - - 380.625 146 8 215 28 C20140704_OR004_04 C20140704_OR004_04 TB428195.[MT7]-FMFDLFQQFRK[MT7].2y8_1.heavy 897.984 / 1225.68 237.0 47.61062431335449 37 14 10 5 8 4.386371111757192 22.797888608184756 0.04509735107421875 4 0.9390639984783025 4.973876368211508 237.0 -0.11413043478260866 38.0 - - - - - - - 0.0 1 0 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 217 28 C20140704_OR004_04 C20140704_OR004_04 TB428195.[MT7]-FMFDLFQQFRK[MT7].2b4_1.heavy 897.984 / 685.314 2996.0 47.61062431335449 37 14 10 5 8 4.386371111757192 22.797888608184756 0.04509735107421875 4 0.9390639984783025 4.973876368211508 2996.0 23.729620253164562 0.0 - - - - - - - 190.58333333333334 5 12 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 219 28 C20140704_OR004_04 C20140704_OR004_04 TB428195.[MT7]-FMFDLFQQFRK[MT7].2y6_1.heavy 897.984 / 997.57 1183.0 47.61062431335449 37 14 10 5 8 4.386371111757192 22.797888608184756 0.04509735107421875 4 0.9390639984783025 4.973876368211508 1183.0 4.18065586093493 0.0 - - - - - - - 201.55555555555554 2 9 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 221 28 C20140704_OR004_04 C20140704_OR004_04 TB428195.[MT7]-FMFDLFQQFRK[MT7].2y7_1.heavy 897.984 / 1110.65 1813.0 47.61062431335449 37 14 10 5 8 4.386371111757192 22.797888608184756 0.04509735107421875 4 0.9390639984783025 4.973876368211508 1813.0 15.261329113924049 1.0 - - - - - - - 200.23076923076923 4 13 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 223 29 C20140704_OR004_04 C20140704_OR004_04 TB427717.[MT7]-DTPLGK[MT7].2y4_1.heavy 459.779 / 558.373 6373.0 20.956349849700928 41 17 10 6 8 2.353647323214686 34.49907761420891 0.03980064392089844 4 0.9729430037322861 7.485804133688777 6373.0 26.499974489795914 0.0 - - - - - - - 285.09090909090907 12 11 RBL1 retinoblastoma-like 1 (p107) 225 29 C20140704_OR004_04 C20140704_OR004_04 TB427717.[MT7]-DTPLGK[MT7].2y5_1.heavy 459.779 / 659.421 1569.0 20.956349849700928 41 17 10 6 8 2.353647323214686 34.49907761420891 0.03980064392089844 4 0.9729430037322861 7.485804133688777 1569.0 8.485408163265307 1.0 - - - - - - - 176.4 3 10 RBL1 retinoblastoma-like 1 (p107) 227 29 C20140704_OR004_04 C20140704_OR004_04 TB427717.[MT7]-DTPLGK[MT7].2b4_1.heavy 459.779 / 571.321 392.0 20.956349849700928 41 17 10 6 8 2.353647323214686 34.49907761420891 0.03980064392089844 4 0.9729430037322861 7.485804133688777 392.0 0.8333333333333333 16.0 - - - - - - - 0.0 1 0 RBL1 retinoblastoma-like 1 (p107) 229 29 C20140704_OR004_04 C20140704_OR004_04 TB427717.[MT7]-DTPLGK[MT7].2y3_1.heavy 459.779 / 461.32 1079.0 20.956349849700928 41 17 10 6 8 2.353647323214686 34.49907761420891 0.03980064392089844 4 0.9729430037322861 7.485804133688777 1079.0 2.7918731778425654 4.0 - - - - - - - 176.4 2 10 RBL1 retinoblastoma-like 1 (p107) 231 30 C20140704_OR004_04 C20140704_OR004_04 TB427718.[MT7]-APHDFMFVK[MT7].3y3_1.heavy 460.584 / 537.352 9637.0 33.12289810180664 44 14 10 10 10 2.7827078877987192 35.93621897521759 0.0 3 0.9499109476375247 5.491124599431436 9637.0 23.84173488709671 1.0 - - - - - - - 134.0 29 4 DPP8 dipeptidyl-peptidase 8 233 30 C20140704_OR004_04 C20140704_OR004_04 TB427718.[MT7]-APHDFMFVK[MT7].3b4_1.heavy 460.584 / 565.285 9504.0 33.12289810180664 44 14 10 10 10 2.7827078877987192 35.93621897521759 0.0 3 0.9499109476375247 5.491124599431436 9504.0 27.83625352426767 0.0 - - - - - - - 268.0 19 7 DPP8 dipeptidyl-peptidase 8 235 30 C20140704_OR004_04 C20140704_OR004_04 TB427718.[MT7]-APHDFMFVK[MT7].3y4_1.heavy 460.584 / 668.392 4016.0 33.12289810180664 44 14 10 10 10 2.7827078877987192 35.93621897521759 0.0 3 0.9499109476375247 5.491124599431436 4016.0 39.85030845771144 0.0 - - - - - - - 321.6 8 5 DPP8 dipeptidyl-peptidase 8 237 30 C20140704_OR004_04 C20140704_OR004_04 TB427718.[MT7]-APHDFMFVK[MT7].3b4_2.heavy 460.584 / 283.146 33998.0 33.12289810180664 44 14 10 10 10 2.7827078877987192 35.93621897521759 0.0 3 0.9499109476375247 5.491124599431436 33998.0 109.37064012913022 0.0 - - - - - - - 348.4 67 5 DPP8 dipeptidyl-peptidase 8 239 31 C20140704_OR004_04 C20140704_OR004_04 TB428190.[MT7]-QLHFMDQLLDTIR.3y6_1.heavy 591.986 / 730.446 43082.0 45.57092571258545 39 13 10 6 10 1.1706928938625296 50.02430848674207 0.037700653076171875 3 0.9229002429065075 4.415757655519449 43082.0 148.74179297698223 0.0 - - - - - - - 294.22222222222223 86 9 HAUS7 HAUS augmin-like complex, subunit 7 241 31 C20140704_OR004_04 C20140704_OR004_04 TB428190.[MT7]-QLHFMDQLLDTIR.3y4_1.heavy 591.986 / 504.278 61546.0 45.57092571258545 39 13 10 6 10 1.1706928938625296 50.02430848674207 0.037700653076171875 3 0.9229002429065075 4.415757655519449 61546.0 264.5398245614035 0.0 - - - - - - - 213.375 123 8 HAUS7 HAUS augmin-like complex, subunit 7 243 31 C20140704_OR004_04 C20140704_OR004_04 TB428190.[MT7]-QLHFMDQLLDTIR.3b3_1.heavy 591.986 / 523.311 58811.0 45.57092571258545 39 13 10 6 10 1.1706928938625296 50.02430848674207 0.037700653076171875 3 0.9229002429065075 4.415757655519449 58811.0 351.96138872923336 0.0 - - - - - - - 292.85714285714283 117 7 HAUS7 HAUS augmin-like complex, subunit 7 245 31 C20140704_OR004_04 C20140704_OR004_04 TB428190.[MT7]-QLHFMDQLLDTIR.3y5_1.heavy 591.986 / 617.362 87105.0 45.57092571258545 39 13 10 6 10 1.1706928938625296 50.02430848674207 0.037700653076171875 3 0.9229002429065075 4.415757655519449 87105.0 510.017496889637 0.0 - - - - - - - 231.78571428571428 174 14 HAUS7 HAUS augmin-like complex, subunit 7 247 32 C20140704_OR004_04 C20140704_OR004_04 TB413642.[MT7]-LIIAGTSAYAR.3y7_1.heavy 427.255 / 725.358 1195.0 33.28524971008301 41 18 10 5 8 3.5371417251986608 28.271414540050294 0.04419708251953125 4 0.9859035194396926 10.382346744281717 1195.0 10.1904824876261 0.0 - - - - - - - 133.0 2 1 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 249 32 C20140704_OR004_04 C20140704_OR004_04 TB413642.[MT7]-LIIAGTSAYAR.3y6_1.heavy 427.255 / 668.336 265.0 33.28524971008301 41 18 10 5 8 3.5371417251986608 28.271414540050294 0.04419708251953125 4 0.9859035194396926 10.382346744281717 265.0 0.8 5.0 - - - - - - - 0.0 0 0 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 251 32 C20140704_OR004_04 C20140704_OR004_04 TB413642.[MT7]-LIIAGTSAYAR.3b5_1.heavy 427.255 / 612.42 1195.0 33.28524971008301 41 18 10 5 8 3.5371417251986608 28.271414540050294 0.04419708251953125 4 0.9859035194396926 10.382346744281717 1195.0 1.6649549115440214 1.0 - - - - - - - 0.0 2 0 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 253 32 C20140704_OR004_04 C20140704_OR004_04 TB413642.[MT7]-LIIAGTSAYAR.3y5_1.heavy 427.255 / 567.289 3451.0 33.28524971008301 41 18 10 5 8 3.5371417251986608 28.271414540050294 0.04419708251953125 4 0.9859035194396926 10.382346744281717 3451.0 16.26726574992005 0.0 - - - - - - - 221.16666666666666 6 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 255 33 C20140704_OR004_04 C20140704_OR004_04 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 38514.0 16.08530044555664 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 38514.0 51.31931350054151 0.0 - - - - - - - 209.44444444444446 77 9 257 33 C20140704_OR004_04 C20140704_OR004_04 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 42671.0 16.08530044555664 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 42671.0 635.2222699886321 0.0 - - - - - - - 227.5 85 6 259 33 C20140704_OR004_04 C20140704_OR004_04 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 33383.0 16.08530044555664 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 33383.0 263.3307565945348 0.0 - - - - - - - 209.44444444444446 66 9 261 34 C20140704_OR004_04 C20140704_OR004_04 TB414007.[MT7]-IESSLQEDEPENDAK[MT7].3b6_1.heavy 664.66 / 802.443 11575.0 27.205900192260742 50 20 10 10 10 23.506238880712434 4.254189728415164 0.0 3 0.9993913116106783 50.01990116667598 11575.0 21.11218344751279 0.0 - - - - - - - 265.90909090909093 23 11 C3orf1 chromosome 3 open reading frame 1 263 34 C20140704_OR004_04 C20140704_OR004_04 TB414007.[MT7]-IESSLQEDEPENDAK[MT7].3y6_1.heavy 664.66 / 817.417 26423.0 27.205900192260742 50 20 10 10 10 23.506238880712434 4.254189728415164 0.0 3 0.9993913116106783 50.01990116667598 26423.0 117.43555555555557 0.0 - - - - - - - 234.0 52 11 C3orf1 chromosome 3 open reading frame 1 265 34 C20140704_OR004_04 C20140704_OR004_04 TB414007.[MT7]-IESSLQEDEPENDAK[MT7].3b4_1.heavy 664.66 / 561.3 20461.0 27.205900192260742 50 20 10 10 10 23.506238880712434 4.254189728415164 0.0 3 0.9993913116106783 50.01990116667598 20461.0 57.28891864668881 1.0 - - - - - - - 730.875 40 8 C3orf1 chromosome 3 open reading frame 1 267 34 C20140704_OR004_04 C20140704_OR004_04 TB414007.[MT7]-IESSLQEDEPENDAK[MT7].3y4_1.heavy 664.66 / 591.322 15901.0 27.205900192260742 50 20 10 10 10 23.506238880712434 4.254189728415164 0.0 3 0.9993913116106783 50.01990116667598 15901.0 97.09468998808853 0.0 - - - - - - - 304.2 31 10 C3orf1 chromosome 3 open reading frame 1 269 35 C20140704_OR004_04 C20140704_OR004_04 TB451440.[MT7]-LIIAGTSAYAR.2y5_1.heavy 640.378 / 567.289 2976.0 33.29629898071289 45 15 10 10 10 1.7429748863953305 40.75604284568294 0.0 3 0.9594527815890576 6.108060804066939 2976.0 5.90313772124847 0.0 - - - - - - - 165.5 5 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 271 35 C20140704_OR004_04 C20140704_OR004_04 TB451440.[MT7]-LIIAGTSAYAR.2y9_1.heavy 640.378 / 909.479 24236.0 33.29629898071289 45 15 10 10 10 1.7429748863953305 40.75604284568294 0.0 3 0.9594527815890576 6.108060804066939 24236.0 51.21690035556189 0.0 - - - - - - - 354.1666666666667 48 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 273 35 C20140704_OR004_04 C20140704_OR004_04 TB451440.[MT7]-LIIAGTSAYAR.2y10_1.heavy 640.378 / 1022.56 32173.0 33.29629898071289 45 15 10 10 10 1.7429748863953305 40.75604284568294 0.0 3 0.9594527815890576 6.108060804066939 32173.0 137.77614117647062 0.0 - - - - - - - 303.57142857142856 64 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 275 35 C20140704_OR004_04 C20140704_OR004_04 TB451440.[MT7]-LIIAGTSAYAR.2y7_1.heavy 640.378 / 725.358 27212.0 33.29629898071289 45 15 10 10 10 1.7429748863953305 40.75604284568294 0.0 3 0.9594527815890576 6.108060804066939 27212.0 133.78058947657064 0.0 - - - - - - - 222.57142857142858 54 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 277 36 C20140704_OR004_04 C20140704_OR004_04 TB414003.[MT7]-VFAAEAVTADSEVLEER.2b6_1.heavy 990.506 / 733.4 10778.0 39.330101013183594 39 9 10 10 10 2.254865948884136 30.62840485263037 0.0 3 0.8175542205213192 2.8441981795303555 10778.0 35.7547687400319 0.0 - - - - - - - 183.33333333333334 21 3 C3orf1 chromosome 3 open reading frame 1 279 36 C20140704_OR004_04 C20140704_OR004_04 TB414003.[MT7]-VFAAEAVTADSEVLEER.2y10_1.heavy 990.506 / 1148.54 9129.0 39.330101013183594 39 9 10 10 10 2.254865948884136 30.62840485263037 0.0 3 0.8175542205213192 2.8441981795303555 9129.0 5.7071907950205825 1.0 - - - - - - - 220.0 21 8 C3orf1 chromosome 3 open reading frame 1 281 36 C20140704_OR004_04 C20140704_OR004_04 TB414003.[MT7]-VFAAEAVTADSEVLEER.2b5_1.heavy 990.506 / 662.363 15618.0 39.330101013183594 39 9 10 10 10 2.254865948884136 30.62840485263037 0.0 3 0.8175542205213192 2.8441981795303555 15618.0 78.32663636363637 0.0 - - - - - - - 256.6666666666667 31 9 C3orf1 chromosome 3 open reading frame 1 283 36 C20140704_OR004_04 C20140704_OR004_04 TB414003.[MT7]-VFAAEAVTADSEVLEER.2y7_1.heavy 990.506 / 861.431 5499.0 39.330101013183594 39 9 10 10 10 2.254865948884136 30.62840485263037 0.0 3 0.8175542205213192 2.8441981795303555 5499.0 15.473376623376623 0.0 - - - - - - - 256.6666666666667 10 9 C3orf1 chromosome 3 open reading frame 1 285 37 C20140704_OR004_04 C20140704_OR004_04 TB414001.[MT7]-EADAVAPGYAQGANLVK[MT7].3y6_1.heavy 654.689 / 745.469 28276.0 30.529800415039062 47 17 10 10 10 2.5794475313489706 26.900630165961225 0.0 3 0.9781324138683671 8.330428485691668 28276.0 96.15867005346053 0.0 - - - - - - - 268.0 56 7 FAM198B family with sequence similarity 198, member B 287 37 C20140704_OR004_04 C20140704_OR004_04 TB414001.[MT7]-EADAVAPGYAQGANLVK[MT7].3b6_1.heavy 654.689 / 701.359 55543.0 30.529800415039062 47 17 10 10 10 2.5794475313489706 26.900630165961225 0.0 3 0.9781324138683671 8.330428485691668 55543.0 96.54296239496624 0.0 - - - - - - - 247.28571428571428 111 7 FAM198B family with sequence similarity 198, member B 289 37 C20140704_OR004_04 C20140704_OR004_04 TB414001.[MT7]-EADAVAPGYAQGANLVK[MT7].3b4_1.heavy 654.689 / 531.253 53234.0 30.529800415039062 47 17 10 10 10 2.5794475313489706 26.900630165961225 0.0 3 0.9781324138683671 8.330428485691668 53234.0 237.39151601245868 0.0 - - - - - - - 312.8333333333333 106 6 FAM198B family with sequence similarity 198, member B 291 37 C20140704_OR004_04 C20140704_OR004_04 TB414001.[MT7]-EADAVAPGYAQGANLVK[MT7].3b5_1.heavy 654.689 / 630.321 60736.0 30.529800415039062 47 17 10 10 10 2.5794475313489706 26.900630165961225 0.0 3 0.9781324138683671 8.330428485691668 60736.0 168.32147806004622 0.0 - - - - - - - 264.5 121 12 FAM198B family with sequence similarity 198, member B 293 38 C20140704_OR004_04 C20140704_OR004_04 TB451713.[MT7]-AALVGGTTMIIGHVLPDK[MT7].4y4_1.heavy 521.056 / 616.379 8757.0 40.39627456665039 46 20 10 6 10 13.082684382215183 7.6436912393867456 0.0384979248046875 3 0.9964099202377312 20.59113595326207 8757.0 -1.5 1.0 - - - - - - - 236.5 17 2 DPYSL5 dihydropyrimidinase-like 5 295 38 C20140704_OR004_04 C20140704_OR004_04 TB451713.[MT7]-AALVGGTTMIIGHVLPDK[MT7].4b5_1.heavy 521.056 / 556.357 3313.0 40.39627456665039 46 20 10 6 10 13.082684382215183 7.6436912393867456 0.0384979248046875 3 0.9964099202377312 20.59113595326207 3313.0 -1.64662027833002 0.0 - - - - - - - 266.25 6 4 DPYSL5 dihydropyrimidinase-like 5 297 38 C20140704_OR004_04 C20140704_OR004_04 TB451713.[MT7]-AALVGGTTMIIGHVLPDK[MT7].4y3_1.heavy 521.056 / 503.295 17868.0 40.39627456665039 46 20 10 6 10 13.082684382215183 7.6436912393867456 0.0384979248046875 3 0.9964099202377312 20.59113595326207 17868.0 -0.18868004223864787 0.0 - - - - - - - 295.5 35 2 DPYSL5 dihydropyrimidinase-like 5 299 38 C20140704_OR004_04 C20140704_OR004_04 TB451713.[MT7]-AALVGGTTMIIGHVLPDK[MT7].4b6_1.heavy 521.056 / 613.379 2603.0 40.39627456665039 46 20 10 6 10 13.082684382215183 7.6436912393867456 0.0384979248046875 3 0.9964099202377312 20.59113595326207 2603.0 -1.1029661016949177 0.0 - - - - - - - 177.5 5 2 DPYSL5 dihydropyrimidinase-like 5 301 39 C20140704_OR004_04 C20140704_OR004_04 TB451446.[MT7]-FC[CAM]C[CAM]AVFAK[MT7].2b4_1.heavy 645.832 / 683.276 5532.0 33.10204887390137 39 14 10 5 10 1.2098139680997664 48.9684249941009 0.041698455810546875 3 0.9391493368613368 4.977399093673112 5532.0 30.416494845360827 0.0 - - - - - - - 233.1 11 10 LOC100506736;SLFN5;SLFN12 schlafen family member 12-like;schlafen family member 5;schlafen family member 12 303 39 C20140704_OR004_04 C20140704_OR004_04 TB451446.[MT7]-FC[CAM]C[CAM]AVFAK[MT7].2y3_1.heavy 645.832 / 509.32 7133.0 33.10204887390137 39 14 10 5 10 1.2098139680997664 48.9684249941009 0.041698455810546875 3 0.9391493368613368 4.977399093673112 7133.0 30.340672023361797 0.0 - - - - - - - 364.0 14 6 LOC100506736;SLFN5;SLFN12 schlafen family member 12-like;schlafen family member 5;schlafen family member 12 305 39 C20140704_OR004_04 C20140704_OR004_04 TB451446.[MT7]-FC[CAM]C[CAM]AVFAK[MT7].2b5_1.heavy 645.832 / 782.345 4804.0 33.10204887390137 39 14 10 5 10 1.2098139680997664 48.9684249941009 0.041698455810546875 3 0.9391493368613368 4.977399093673112 4804.0 24.189014728663885 0.0 - - - - - - - 229.0 9 7 LOC100506736;SLFN5;SLFN12 schlafen family member 12-like;schlafen family member 5;schlafen family member 12 307 39 C20140704_OR004_04 C20140704_OR004_04 TB451446.[MT7]-FC[CAM]C[CAM]AVFAK[MT7].2y7_1.heavy 645.832 / 999.487 8443.0 33.10204887390137 39 14 10 5 10 1.2098139680997664 48.9684249941009 0.041698455810546875 3 0.9391493368613368 4.977399093673112 8443.0 20.503046964490267 0.0 - - - - - - - 187.42857142857142 16 7 LOC100506736;SLFN5;SLFN12 schlafen family member 12-like;schlafen family member 5;schlafen family member 12 309 40 C20140704_OR004_04 C20140704_OR004_04 TB451448.[MT7]-AFPMPGFDEH.2y8_1.heavy 646.299 / 929.382 13715.0 37.94244956970215 38 15 10 5 8 1.9379135680088093 42.6070725483382 0.042301177978515625 4 0.9576409237424718 5.9750845780810105 13715.0 55.30480774066066 1.0 - - - - - - - 290.8333333333333 27 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 311 40 C20140704_OR004_04 C20140704_OR004_04 TB451448.[MT7]-AFPMPGFDEH.2b4_1.heavy 646.299 / 591.308 13092.0 37.94244956970215 38 15 10 5 8 1.9379135680088093 42.6070725483382 0.042301177978515625 4 0.9576409237424718 5.9750845780810105 13092.0 21.145611253978554 1.0 - - - - - - - 285.0 34 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 313 40 C20140704_OR004_04 C20140704_OR004_04 TB451448.[MT7]-AFPMPGFDEH.2b6_1.heavy 646.299 / 745.382 2743.0 37.94244956970215 38 15 10 5 8 1.9379135680088093 42.6070725483382 0.042301177978515625 4 0.9576409237424718 5.9750845780810105 2743.0 1.5146415313777535 0.0 - - - - - - - 249.25 5 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 315 40 C20140704_OR004_04 C20140704_OR004_04 TB451448.[MT7]-AFPMPGFDEH.2y6_1.heavy 646.299 / 701.289 19450.0 37.94244956970215 38 15 10 5 8 1.9379135680088093 42.6070725483382 0.042301177978515625 4 0.9576409237424718 5.9750845780810105 19450.0 12.161631142458328 1.0 - - - - - - - 332.5 38 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 317 41 C20140704_OR004_04 C20140704_OR004_04 TB428373.[MT7]-VDAAELVREFEALTEENRTLR.4b11_2.heavy 652.098 / 702.368 2323.0 48.678524017333984 43 17 10 6 10 6.435135075697722 15.539689349746498 0.038299560546875 3 0.9748359649955848 7.763495073617583 2323.0 22.275342465753425 0.0 - - - - - - - 145.4 4 10 C21orf7 chromosome 21 open reading frame 7 319 41 C20140704_OR004_04 C20140704_OR004_04 TB428373.[MT7]-VDAAELVREFEALTEENRTLR.4b12_2.heavy 652.098 / 737.886 2250.0 48.678524017333984 43 17 10 6 10 6.435135075697722 15.539689349746498 0.038299560546875 3 0.9748359649955848 7.763495073617583 2250.0 19.311525743977327 0.0 - - - - - - - 177.44444444444446 4 9 C21orf7 chromosome 21 open reading frame 7 321 41 C20140704_OR004_04 C20140704_OR004_04 TB428373.[MT7]-VDAAELVREFEALTEENRTLR.4b4_1.heavy 652.098 / 501.279 2250.0 48.678524017333984 43 17 10 6 10 6.435135075697722 15.539689349746498 0.038299560546875 3 0.9748359649955848 7.763495073617583 2250.0 12.221251186333436 0.0 - - - - - - - 252.0 4 17 C21orf7 chromosome 21 open reading frame 7 323 41 C20140704_OR004_04 C20140704_OR004_04 TB428373.[MT7]-VDAAELVREFEALTEENRTLR.4b5_1.heavy 652.098 / 630.321 4065.0 48.678524017333984 43 17 10 6 10 6.435135075697722 15.539689349746498 0.038299560546875 3 0.9748359649955848 7.763495073617583 4065.0 13.06009354908618 0.0 - - - - - - - 227.0 8 8 C21orf7 chromosome 21 open reading frame 7 325 42 C20140704_OR004_04 C20140704_OR004_04 TB427903.[MT7]-LTADELWK[MT7].3b6_1.heavy 421.911 / 787.432 124.0 36.4977502822876 41 16 10 5 10 3.4580642179784618 28.91791294103227 0.044200897216796875 3 0.9667281893465319 6.747029230382709 124.0 1.999 5.0 - - - - - - - 0.0 0 0 MRPS5 mitochondrial ribosomal protein S5 327 42 C20140704_OR004_04 C20140704_OR004_04 TB427903.[MT7]-LTADELWK[MT7].3y3_1.heavy 421.911 / 590.378 1611.0 36.4977502822876 41 16 10 5 10 3.4580642179784618 28.91791294103227 0.044200897216796875 3 0.9667281893465319 6.747029230382709 1611.0 10.880745967741936 0.0 - - - - - - - 318.85714285714283 3 7 MRPS5 mitochondrial ribosomal protein S5 329 42 C20140704_OR004_04 C20140704_OR004_04 TB427903.[MT7]-LTADELWK[MT7].3b4_1.heavy 421.911 / 545.305 7311.0 36.4977502822876 41 16 10 5 10 3.4580642179784618 28.91791294103227 0.044200897216796875 3 0.9667281893465319 6.747029230382709 7311.0 91.38749999999999 0.0 - - - - - - - 124.0 14 4 MRPS5 mitochondrial ribosomal protein S5 331 42 C20140704_OR004_04 C20140704_OR004_04 TB427903.[MT7]-LTADELWK[MT7].3b5_1.heavy 421.911 / 674.348 6567.0 36.4977502822876 41 16 10 5 10 3.4580642179784618 28.91791294103227 0.044200897216796875 3 0.9667281893465319 6.747029230382709 6567.0 84.20588709677419 0.0 - - - - - - - 124.0 13 2 MRPS5 mitochondrial ribosomal protein S5 333 43 C20140704_OR004_04 C20140704_OR004_04 TB413434.[MT7]-LIDYAR.2y4_1.heavy 447.762 / 524.246 8298.0 29.361900329589844 48 18 10 10 10 4.5161496246639325 22.14275617749079 0.0 3 0.9856210898736973 10.279633186079149 8298.0 110.63999999999999 0.0 - - - - - - - 184.33333333333334 16 3 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 335 43 C20140704_OR004_04 C20140704_OR004_04 TB413434.[MT7]-LIDYAR.2b3_1.heavy 447.762 / 486.304 15075.0 29.361900329589844 48 18 10 10 10 4.5161496246639325 22.14275617749079 0.0 3 0.9856210898736973 10.279633186079149 15075.0 54.17672598714686 1.0 - - - - - - - 323.0 31 3 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 337 43 C20140704_OR004_04 C20140704_OR004_04 TB413434.[MT7]-LIDYAR.2y5_1.heavy 447.762 / 637.33 17564.0 29.361900329589844 48 18 10 10 10 4.5161496246639325 22.14275617749079 0.0 3 0.9856210898736973 10.279633186079149 17564.0 97.6971239180549 0.0 - - - - - - - 323.0 35 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 339 43 C20140704_OR004_04 C20140704_OR004_04 TB413434.[MT7]-LIDYAR.2b4_1.heavy 447.762 / 649.368 3181.0 29.361900329589844 48 18 10 10 10 4.5161496246639325 22.14275617749079 0.0 3 0.9856210898736973 10.279633186079149 3181.0 11.683977459203906 0.0 - - - - - - - 276.5 6 4 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 341 44 C20140704_OR004_04 C20140704_OR004_04 TB451302.[MT7]-VIDATGK[MT7].2y4_1.heavy 496.305 / 520.321 16752.0 21.93382453918457 44 18 10 6 10 3.5631785815022385 22.399591214885078 0.0381011962890625 3 0.9865883229478142 10.644720031109316 16752.0 213.39223273548933 0.0 - - - - - - - 194.625 33 8 DPYSL5 dihydropyrimidinase-like 5 343 44 C20140704_OR004_04 C20140704_OR004_04 TB451302.[MT7]-VIDATGK[MT7].2y5_1.heavy 496.305 / 635.348 13246.0 21.93382453918457 44 18 10 6 10 3.5631785815022385 22.399591214885078 0.0381011962890625 3 0.9865883229478142 10.644720031109316 13246.0 168.72702796215225 0.0 - - - - - - - 185.72727272727272 26 11 DPYSL5 dihydropyrimidinase-like 5 345 44 C20140704_OR004_04 C20140704_OR004_04 TB451302.[MT7]-VIDATGK[MT7].2b4_1.heavy 496.305 / 543.326 2922.0 21.93382453918457 44 18 10 6 10 3.5631785815022385 22.399591214885078 0.0381011962890625 3 0.9865883229478142 10.644720031109316 2922.0 16.056828332957366 1.0 - - - - - - - 243.5 5 8 DPYSL5 dihydropyrimidinase-like 5 347 44 C20140704_OR004_04 C20140704_OR004_04 TB451302.[MT7]-VIDATGK[MT7].2y6_1.heavy 496.305 / 748.432 11298.0 21.93382453918457 44 18 10 6 10 3.5631785815022385 22.399591214885078 0.0381011962890625 3 0.9865883229478142 10.644720031109316 11298.0 73.71985152424577 0.0 - - - - - - - 263.0 22 10 DPYSL5 dihydropyrimidinase-like 5 349 45 C20140704_OR004_04 C20140704_OR004_04 TB428189.[MT7]-QSDDWQWASASAK[MT7].2y5_1.heavy 884.431 / 607.353 2732.0 32.07889938354492 38 8 10 10 10 3.717309401454591 21.51077424215763 0.0 3 0.7951228842391919 2.678585580443997 2732.0 18.02361111111111 0.0 - - - - - - - 287.75 5 4 HAUS7 HAUS augmin-like complex, subunit 7 351 45 C20140704_OR004_04 C20140704_OR004_04 TB428189.[MT7]-QSDDWQWASASAK[MT7].2b4_1.heavy 884.431 / 590.254 1582.0 32.07889938354492 38 8 10 10 10 3.717309401454591 21.51077424215763 0.0 3 0.7951228842391919 2.678585580443997 1582.0 0.19733965220183922 1.0 - - - - - - - 230.2 3 5 HAUS7 HAUS augmin-like complex, subunit 7 353 45 C20140704_OR004_04 C20140704_OR004_04 TB428189.[MT7]-QSDDWQWASASAK[MT7].2b6_1.heavy 884.431 / 904.392 2157.0 32.07889938354492 38 8 10 10 10 3.717309401454591 21.51077424215763 0.0 3 0.7951228842391919 2.678585580443997 2157.0 22.094270833333333 0.0 - - - - - - - 345.0 4 5 HAUS7 HAUS augmin-like complex, subunit 7 355 45 C20140704_OR004_04 C20140704_OR004_04 TB428189.[MT7]-QSDDWQWASASAK[MT7].2y6_1.heavy 884.431 / 678.39 2876.0 32.07889938354492 38 8 10 10 10 3.717309401454591 21.51077424215763 0.0 3 0.7951228842391919 2.678585580443997 2876.0 28.560277777777777 0.0 - - - - - - - 246.71428571428572 5 7 HAUS7 HAUS augmin-like complex, subunit 7 357 46 C20140704_OR004_04 C20140704_OR004_04 TB413649.[MT7]-DTHPYASLSR.3y7_1.heavy 430.89 / 793.42 1077.0 21.603200912475586 43 15 10 10 8 3.2504862521199653 30.76462788752915 0.0 4 0.9597046446898443 6.127250596101388 1077.0 12.088775510204082 0.0 - - - - - - - 196.0 2 1 MRPS5 mitochondrial ribosomal protein S5 359 46 C20140704_OR004_04 C20140704_OR004_04 TB413649.[MT7]-DTHPYASLSR.3y6_1.heavy 430.89 / 696.367 7049.0 21.603200912475586 43 15 10 10 8 3.2504862521199653 30.76462788752915 0.0 4 0.9597046446898443 6.127250596101388 7049.0 137.38357142857143 0.0 - - - - - - - 137.2 14 5 MRPS5 mitochondrial ribosomal protein S5 361 46 C20140704_OR004_04 C20140704_OR004_04 TB413649.[MT7]-DTHPYASLSR.3b3_1.heavy 430.89 / 498.243 5483.0 21.603200912475586 43 15 10 10 8 3.2504862521199653 30.76462788752915 0.0 4 0.9597046446898443 6.127250596101388 5483.0 20.418791101842196 2.0 - - - - - - - 204.16666666666666 15 12 MRPS5 mitochondrial ribosomal protein S5 363 46 C20140704_OR004_04 C20140704_OR004_04 TB413649.[MT7]-DTHPYASLSR.3y5_1.heavy 430.89 / 533.304 15078.0 21.603200912475586 43 15 10 10 8 3.2504862521199653 30.76462788752915 0.0 4 0.9597046446898443 6.127250596101388 15078.0 226.17000000000002 0.0 - - - - - - - 156.8 30 10 MRPS5 mitochondrial ribosomal protein S5 365 47 C20140704_OR004_04 C20140704_OR004_04 TB427907.[MT7]-EYSLQVLK[MT7].2b3_1.heavy 634.379 / 524.247 3448.0 33.713324546813965 33 20 2 5 6 6.324787180650952 15.810808671305825 0.043300628662109375 5 0.9931846200818544 14.940680169119121 3448.0 5.434316200605496 1.0 - - - - - - - 318.4 6 5 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 367 47 C20140704_OR004_04 C20140704_OR004_04 TB427907.[MT7]-EYSLQVLK[MT7].2b4_1.heavy 634.379 / 637.331 2652.0 33.713324546813965 33 20 2 5 6 6.324787180650952 15.810808671305825 0.043300628662109375 5 0.9931846200818544 14.940680169119121 2652.0 11.000507063619986 0.0 - - - - - - - 265.3333333333333 5 9 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 369 47 C20140704_OR004_04 C20140704_OR004_04 TB427907.[MT7]-EYSLQVLK[MT7].2y3_1.heavy 634.379 / 503.367 3979.0 33.713324546813965 33 20 2 5 6 6.324787180650952 15.810808671305825 0.043300628662109375 5 0.9931846200818544 14.940680169119121 3979.0 4.701470697257291 2.0 - - - - - - - 331.5 19 4 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 371 47 C20140704_OR004_04 C20140704_OR004_04 TB427907.[MT7]-EYSLQVLK[MT7].2b5_1.heavy 634.379 / 765.39 3448.0 33.713324546813965 33 20 2 5 6 6.324787180650952 15.810808671305825 0.043300628662109375 5 0.9931846200818544 14.940680169119121 3448.0 8.324890292837019 0.0 - - - - - - - 309.6666666666667 6 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 373 48 C20140704_OR004_04 C20140704_OR004_04 TB428183.[MT7]-DSELYQVLHAC[CAM]K[MT7].3y3_1.heavy 584.306 / 522.283 20271.0 34.933998107910156 46 16 10 10 10 2.940557852847756 34.007152725512924 0.0 3 0.9690728951333298 6.999500454249119 20271.0 81.95944154877141 0.0 - - - - - - - 319.7142857142857 40 14 DPYSL5 dihydropyrimidinase-like 5 375 48 C20140704_OR004_04 C20140704_OR004_04 TB428183.[MT7]-DSELYQVLHAC[CAM]K[MT7].3b4_1.heavy 584.306 / 589.295 21456.0 34.933998107910156 46 16 10 10 10 2.940557852847756 34.007152725512924 0.0 3 0.9690728951333298 6.999500454249119 21456.0 77.38651934763288 0.0 - - - - - - - 241.41666666666666 42 12 DPYSL5 dihydropyrimidinase-like 5 377 48 C20140704_OR004_04 C20140704_OR004_04 TB428183.[MT7]-DSELYQVLHAC[CAM]K[MT7].3b5_1.heavy 584.306 / 752.358 8030.0 34.933998107910156 46 16 10 10 10 2.940557852847756 34.007152725512924 0.0 3 0.9690728951333298 6.999500454249119 8030.0 36.241962571679814 0.0 - - - - - - - 184.4 16 5 DPYSL5 dihydropyrimidinase-like 5 379 48 C20140704_OR004_04 C20140704_OR004_04 TB428183.[MT7]-DSELYQVLHAC[CAM]K[MT7].3y4_1.heavy 584.306 / 659.341 16322.0 34.933998107910156 46 16 10 10 10 2.940557852847756 34.007152725512924 0.0 3 0.9690728951333298 6.999500454249119 16322.0 29.90026448397784 0.0 - - - - - - - 674.625 32 8 DPYSL5 dihydropyrimidinase-like 5 381 49 C20140704_OR004_04 C20140704_OR004_04 TB428186.[MT7]-EAVITPVASATQSVSR.2y12_1.heavy 880.487 / 1203.63 1456.0 30.615274906158447 29 7 10 2 10 0.8271910593433927 78.21718135549946 0.08550071716308594 3 0.7405057146694208 2.3682379055666645 1456.0 5.854020618556701 0.0 - - - - - - - 242.83333333333334 2 6 RBL1 retinoblastoma-like 1 (p107) 383 49 C20140704_OR004_04 C20140704_OR004_04 TB428186.[MT7]-EAVITPVASATQSVSR.2y11_1.heavy 880.487 / 1102.59 5242.0 30.615274906158447 29 7 10 2 10 0.8271910593433927 78.21718135549946 0.08550071716308594 3 0.7405057146694208 2.3682379055666645 5242.0 18.283565328967747 0.0 - - - - - - - 267.0 10 6 RBL1 retinoblastoma-like 1 (p107) 385 49 C20140704_OR004_04 C20140704_OR004_04 TB428186.[MT7]-EAVITPVASATQSVSR.2y9_1.heavy 880.487 / 906.464 1165.0 30.615274906158447 29 7 10 2 10 0.8271910593433927 78.21718135549946 0.08550071716308594 3 0.7405057146694208 2.3682379055666645 1165.0 8.193454750634775 0.0 - - - - - - - 243.0 2 3 RBL1 retinoblastoma-like 1 (p107) 387 49 C20140704_OR004_04 C20140704_OR004_04 TB428186.[MT7]-EAVITPVASATQSVSR.2y7_1.heavy 880.487 / 748.395 291.0 30.615274906158447 29 7 10 2 10 0.8271910593433927 78.21718135549946 0.08550071716308594 3 0.7405057146694208 2.3682379055666645 291.0 -0.02743445692883892 17.0 - - - - - - - 218.5 3 4 RBL1 retinoblastoma-like 1 (p107) 389 50 C20140704_OR004_04 C20140704_OR004_04 TB413656.[MT7]-MEESYDLK[MT7].3y3_1.heavy 434.888 / 519.326 1339.0 27.781532923380535 39 18 10 5 6 2.8896413399248067 27.721386635018234 0.043399810791015625 5 0.9802157934983956 8.759603045913577 1339.0 5.1389344262295085 3.0 - - - - - - - 223.5 3 6 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 391 50 C20140704_OR004_04 C20140704_OR004_04 TB413656.[MT7]-MEESYDLK[MT7].3b6_1.heavy 434.888 / 899.357 N/A 27.781532923380535 39 18 10 5 6 2.8896413399248067 27.721386635018234 0.043399810791015625 5 0.9802157934983956 8.759603045913577 122.0 1.2 5.0 - - - - - - - 0.0 0 0 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 393 50 C20140704_OR004_04 C20140704_OR004_04 TB413656.[MT7]-MEESYDLK[MT7].3b4_1.heavy 434.888 / 621.267 1948.0 27.781532923380535 39 18 10 5 6 2.8896413399248067 27.721386635018234 0.043399810791015625 5 0.9802157934983956 8.759603045913577 1948.0 22.274262295081968 0.0 - - - - - - - 183.0 3 6 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 395 50 C20140704_OR004_04 C20140704_OR004_04 TB413656.[MT7]-MEESYDLK[MT7].3b3_1.heavy 434.888 / 534.235 1583.0 27.781532923380535 39 18 10 5 6 2.8896413399248067 27.721386635018234 0.043399810791015625 5 0.9802157934983956 8.759603045913577 1583.0 7.359963714100869 0.0 - - - - - - - 261.0 3 7 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 397 51 C20140704_OR004_04 C20140704_OR004_04 TB427911.[MT7]-RSVWSNLK[MT7].3b6_1.heavy 426.59 / 874.465 N/A 28.617399215698242 33 20 0 3 10 2.2361727389162995 44.71926441982398 0.050800323486328125 3 0.9976225548393787 25.305856185336232 0.0 0.0 12.0 - - - - - - - 0.0 0 0 MRPS5 mitochondrial ribosomal protein S5 399 51 C20140704_OR004_04 C20140704_OR004_04 TB427911.[MT7]-RSVWSNLK[MT7].3y3_1.heavy 426.59 / 518.342 2551.0 28.617399215698242 33 20 0 3 10 2.2361727389162995 44.71926441982398 0.050800323486328125 3 0.9976225548393787 25.305856185336232 2551.0 13.65665893615932 1.0 - - - - - - - 234.0 7 6 MRPS5 mitochondrial ribosomal protein S5 401 51 C20140704_OR004_04 C20140704_OR004_04 TB427911.[MT7]-RSVWSNLK[MT7].3y4_1.heavy 426.59 / 605.374 2551.0 28.617399215698242 33 20 0 3 10 2.2361727389162995 44.71926441982398 0.050800323486328125 3 0.9976225548393787 25.305856185336232 2551.0 28.335326286764705 0.0 - - - - - - - 191.5 5 6 MRPS5 mitochondrial ribosomal protein S5 403 51 C20140704_OR004_04 C20140704_OR004_04 TB427911.[MT7]-RSVWSNLK[MT7].3b3_1.heavy 426.59 / 487.311 N/A 28.617399215698242 33 20 0 3 10 2.2361727389162995 44.71926441982398 0.050800323486328125 3 0.9976225548393787 25.305856185336232 1275.0 12.962890625 15.0 - - - - - - - 237.0 330 7 MRPS5 mitochondrial ribosomal protein S5 405 52 C20140704_OR004_04 C20140704_OR004_04 TB451595.[MT7]-IYSESAPSWLSK[MT7].2y4_1.heavy 828.448 / 677.41 1190.0 36.58717441558838 42 17 10 5 10 12.93674907594322 7.729917262286312 0.045299530029296875 3 0.9793325268027928 8.56974396846444 1190.0 4.732408999220648 0.0 - - - - - - - 264.0 2 2 FAM198B family with sequence similarity 198, member B 407 52 C20140704_OR004_04 C20140704_OR004_04 TB451595.[MT7]-IYSESAPSWLSK[MT7].2b4_1.heavy 828.448 / 637.331 1190.0 36.58717441558838 42 17 10 5 10 12.93674907594322 7.729917262286312 0.045299530029296875 3 0.9793325268027928 8.56974396846444 1190.0 0.16006051437216334 1.0 - - - - - - - 264.2857142857143 2 7 FAM198B family with sequence similarity 198, member B 409 52 C20140704_OR004_04 C20140704_OR004_04 TB451595.[MT7]-IYSESAPSWLSK[MT7].2y6_1.heavy 828.448 / 861.495 3306.0 36.58717441558838 42 17 10 5 10 12.93674907594322 7.729917262286312 0.045299530029296875 3 0.9793325268027928 8.56974396846444 3306.0 15.489068010075565 0.0 - - - - - - - 231.25 6 8 FAM198B family with sequence similarity 198, member B 411 52 C20140704_OR004_04 C20140704_OR004_04 TB451595.[MT7]-IYSESAPSWLSK[MT7].2y10_1.heavy 828.448 / 1235.64 397.0 36.58717441558838 42 17 10 5 10 12.93674907594322 7.729917262286312 0.045299530029296875 3 0.9793325268027928 8.56974396846444 397.0 2.556439393939394 12.0 - - - - - - - 198.125 2 8 FAM198B family with sequence similarity 198, member B 413 53 C20140704_OR004_04 C20140704_OR004_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 184705.0 18.90250015258789 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 184705.0 1225.2419644633537 0.0 - - - - - - - 198.6 369 10 415 53 C20140704_OR004_04 C20140704_OR004_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 101290.0 18.90250015258789 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 101290.0 1155.2484579870727 0.0 - - - - - - - 205.1818181818182 202 11 417 53 C20140704_OR004_04 C20140704_OR004_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 94158.0 18.90250015258789 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 94158.0 1152.8814778325125 0.0 - - - - - - - 189.6 188 10 419 54 C20140704_OR004_04 C20140704_OR004_04 TB428388.[MT7]-AMQAALDSVVC[CAM]HTPLNNLGFSRK[MT7].4y5_1.heavy 705.124 / 738.438 1374.0 42.855201721191406 48 18 10 10 10 3.702372559682334 27.009707528887926 0.0 3 0.986493483042343 10.60719745948129 1374.0 0.8999999999999999 0.0 - - - - - - - 178.52631578947367 2 19 C7orf43 chromosome 7 open reading frame 43 421 54 C20140704_OR004_04 C20140704_OR004_04 TB428388.[MT7]-AMQAALDSVVC[CAM]HTPLNNLGFSRK[MT7].4b7_1.heavy 705.124 / 845.431 1008.0 42.855201721191406 48 18 10 10 10 3.702372559682334 27.009707528887926 0.0 3 0.986493483042343 10.60719745948129 1008.0 3.5188363636363635 4.0 - - - - - - - 226.41176470588235 2 17 C7orf43 chromosome 7 open reading frame 43 423 54 C20140704_OR004_04 C20140704_OR004_04 TB428388.[MT7]-AMQAALDSVVC[CAM]HTPLNNLGFSRK[MT7].4b4_1.heavy 705.124 / 546.283 2291.0 42.855201721191406 48 18 10 10 10 3.702372559682334 27.009707528887926 0.0 3 0.986493483042343 10.60719745948129 2291.0 9.164 0.0 - - - - - - - 274.72727272727275 4 11 C7orf43 chromosome 7 open reading frame 43 425 54 C20140704_OR004_04 C20140704_OR004_04 TB428388.[MT7]-AMQAALDSVVC[CAM]HTPLNNLGFSRK[MT7].4b5_1.heavy 705.124 / 617.32 2932.0 42.855201721191406 48 18 10 10 10 3.702372559682334 27.009707528887926 0.0 3 0.986493483042343 10.60719745948129 2932.0 7.419282371294852 0.0 - - - - - - - 236.75 5 12 C7orf43 chromosome 7 open reading frame 43 427 55 C20140704_OR004_04 C20140704_OR004_04 TB428387.[MT7]-NLFPDGTIGNDTTLVLVNAIYFK[MT7].4b5_1.heavy 704.139 / 731.385 409.0 52.52567386627197 45 18 10 7 10 6.014111797346222 16.627559209013352 0.021900177001953125 3 0.9837557742818795 9.669927214643032 409.0 -0.07559565816446545 2.0 - - - - - - - 0.0 0 0 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 429 55 C20140704_OR004_04 C20140704_OR004_04 TB428387.[MT7]-NLFPDGTIGNDTTLVLVNAIYFK[MT7].4y3_1.heavy 704.139 / 601.347 3576.0 52.52567386627197 45 18 10 7 10 6.014111797346222 16.627559209013352 0.021900177001953125 3 0.9837557742818795 9.669927214643032 3576.0 3.4467507443622463 0.0 - - - - - - - 152.8 7 30 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 431 55 C20140704_OR004_04 C20140704_OR004_04 TB428387.[MT7]-NLFPDGTIGNDTTLVLVNAIYFK[MT7].4y6_1.heavy 704.139 / 899.511 710.0 52.52567386627197 45 18 10 7 10 6.014111797346222 16.627559209013352 0.021900177001953125 3 0.9837557742818795 9.669927214643032 710.0 1.8800241504226325 1.0 - - - - - - - 0.0 1 0 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 433 55 C20140704_OR004_04 C20140704_OR004_04 TB428387.[MT7]-NLFPDGTIGNDTTLVLVNAIYFK[MT7].4b3_1.heavy 704.139 / 519.305 3821.0 52.52567386627197 45 18 10 7 10 6.014111797346222 16.627559209013352 0.021900177001953125 3 0.9837557742818795 9.669927214643032 3821.0 26.66187743976309 0.0 - - - - - - - 197.90625 7 32 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 435 56 C20140704_OR004_04 C20140704_OR004_04 TB428386.[MT7]-K[MT7]YEPIFLDIFQNPYEEPPK[MT7].4b8_2.heavy 700.63 / 647.868 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBL1 retinoblastoma-like 1 (p107) 437 56 C20140704_OR004_04 C20140704_OR004_04 TB428386.[MT7]-K[MT7]YEPIFLDIFQNPYEEPPK[MT7].4b5_1.heavy 700.63 / 919.549 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBL1 retinoblastoma-like 1 (p107) 439 56 C20140704_OR004_04 C20140704_OR004_04 TB428386.[MT7]-K[MT7]YEPIFLDIFQNPYEEPPK[MT7].4y3_1.heavy 700.63 / 485.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBL1 retinoblastoma-like 1 (p107) 441 56 C20140704_OR004_04 C20140704_OR004_04 TB428386.[MT7]-K[MT7]YEPIFLDIFQNPYEEPPK[MT7].4b3_1.heavy 700.63 / 709.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBL1 retinoblastoma-like 1 (p107) 443 57 C20140704_OR004_04 C20140704_OR004_04 TB451596.[MT7]-DPEPEDEVPDVK[MT7].3y3_1.heavy 552.945 / 505.31 4374.0 27.919099807739258 39 16 10 5 8 2.86597491064401 29.387791364528965 0.04560089111328125 4 0.9660755291150827 6.681444304646483 4374.0 12.544391838959093 1.0 - - - - - - - 272.14285714285717 16 7 MRPS5 mitochondrial ribosomal protein S5 445 57 C20140704_OR004_04 C20140704_OR004_04 TB451596.[MT7]-DPEPEDEVPDVK[MT7].3b6_1.heavy 552.945 / 827.354 4374.0 27.919099807739258 39 16 10 5 8 2.86597491064401 29.387791364528965 0.04560089111328125 4 0.9660755291150827 6.681444304646483 4374.0 37.064814193100254 0.0 - - - - - - - 280.25 8 8 MRPS5 mitochondrial ribosomal protein S5 447 57 C20140704_OR004_04 C20140704_OR004_04 TB451596.[MT7]-DPEPEDEVPDVK[MT7].3y4_1.heavy 552.945 / 602.363 13796.0 27.919099807739258 39 16 10 5 8 2.86597491064401 29.387791364528965 0.04560089111328125 4 0.9660755291150827 6.681444304646483 13796.0 37.11680154898251 0.0 - - - - - - - 240.14285714285714 27 7 MRPS5 mitochondrial ribosomal protein S5 449 57 C20140704_OR004_04 C20140704_OR004_04 TB451596.[MT7]-DPEPEDEVPDVK[MT7].3b7_1.heavy 552.945 / 956.396 5832.0 27.919099807739258 39 16 10 5 8 2.86597491064401 29.387791364528965 0.04560089111328125 4 0.9660755291150827 6.681444304646483 5832.0 30.20714985682469 0.0 - - - - - - - 112.0 11 3 MRPS5 mitochondrial ribosomal protein S5 451 58 C20140704_OR004_04 C20140704_OR004_04 TB451313.[MT7]-SDAVLSK[MT7].2y4_1.heavy 504.302 / 590.399 971.0 21.962400436401367 40 20 2 10 8 15.280092373687443 6.544463053914619 0.0 4 0.9940074311730783 15.934510892587278 971.0 3.5029640833764546 6.0 - - - - - - - 232.8 6 10 RAD17 RAD17 homolog (S. pombe) 453 58 C20140704_OR004_04 C20140704_OR004_04 TB451313.[MT7]-SDAVLSK[MT7].2y5_1.heavy 504.302 / 661.437 1553.0 21.962400436401367 40 20 2 10 8 15.280092373687443 6.544463053914619 0.0 4 0.9940074311730783 15.934510892587278 1553.0 21.18697594501718 2.0 - - - - - - - 291.0 14 3 RAD17 RAD17 homolog (S. pombe) 455 58 C20140704_OR004_04 C20140704_OR004_04 TB451313.[MT7]-SDAVLSK[MT7].2b4_1.heavy 504.302 / 517.274 2330.0 21.962400436401367 40 20 2 10 8 15.280092373687443 6.544463053914619 0.0 4 0.9940074311730783 15.934510892587278 2330.0 14.052061855670104 0.0 - - - - - - - 255.72727272727272 4 11 RAD17 RAD17 homolog (S. pombe) 457 58 C20140704_OR004_04 C20140704_OR004_04 TB451313.[MT7]-SDAVLSK[MT7].2y6_1.heavy 504.302 / 776.463 1262.0 21.962400436401367 40 20 2 10 8 15.280092373687443 6.544463053914619 0.0 4 0.9940074311730783 15.934510892587278 1262.0 8.94458762886598 0.0 - - - - - - - 194.0 2 8 RAD17 RAD17 homolog (S. pombe) 459 59 C20140704_OR004_04 C20140704_OR004_04 TB451310.[MT7]-HLTVLK[MT7].2y4_1.heavy 499.834 / 604.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 461 59 C20140704_OR004_04 C20140704_OR004_04 TB451310.[MT7]-HLTVLK[MT7].2y5_1.heavy 499.834 / 717.499 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 463 59 C20140704_OR004_04 C20140704_OR004_04 TB451310.[MT7]-HLTVLK[MT7].2y3_1.heavy 499.834 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 465 60 C20140704_OR004_04 C20140704_OR004_04 TB427919.[MT7]-NMAGQDAGC[CAM]GR.2y8_1.heavy 640.783 / 820.337 1153.0 16.22909927368164 50 20 10 10 10 8.34433351223193 11.984180624301551 0.0 3 0.9960317174987666 19.58471956650025 1153.0 19.915454545454544 0.0 - - - - - - - 121.0 2 5 HAUS7 HAUS augmin-like complex, subunit 7 467 60 C20140704_OR004_04 C20140704_OR004_04 TB427919.[MT7]-NMAGQDAGC[CAM]GR.2y5_1.heavy 640.783 / 520.23 2636.0 16.22909927368164 50 20 10 10 10 8.34433351223193 11.984180624301551 0.0 3 0.9960317174987666 19.58471956650025 2636.0 93.93745454545456 0.0 - - - - - - - 153.8 5 5 HAUS7 HAUS augmin-like complex, subunit 7 469 60 C20140704_OR004_04 C20140704_OR004_04 TB427919.[MT7]-NMAGQDAGC[CAM]GR.2y9_1.heavy 640.783 / 891.374 879.0 16.22909927368164 50 20 10 10 10 8.34433351223193 11.984180624301551 0.0 3 0.9960317174987666 19.58471956650025 879.0 23.972727272727273 0.0 - - - - - - - 0.0 1 0 HAUS7 HAUS augmin-like complex, subunit 7 471 60 C20140704_OR004_04 C20140704_OR004_04 TB427919.[MT7]-NMAGQDAGC[CAM]GR.2y10_1.heavy 640.783 / 1022.41 1647.0 16.22909927368164 50 20 10 10 10 8.34433351223193 11.984180624301551 0.0 3 0.9960317174987666 19.58471956650025 1647.0 44.90320909090909 0.0 - - - - - - - 183.0 3 3 HAUS7 HAUS augmin-like complex, subunit 7 473 61 C20140704_OR004_04 C20140704_OR004_04 TB428174.[MT7]-AFLC[CAM]ASQLNEHQR.2y4_1.heavy 859.432 / 569.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 475 61 C20140704_OR004_04 C20140704_OR004_04 TB428174.[MT7]-AFLC[CAM]ASQLNEHQR.2y8_1.heavy 859.432 / 1011.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 477 61 C20140704_OR004_04 C20140704_OR004_04 TB428174.[MT7]-AFLC[CAM]ASQLNEHQR.2y9_1.heavy 859.432 / 1082.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 479 61 C20140704_OR004_04 C20140704_OR004_04 TB428174.[MT7]-AFLC[CAM]ASQLNEHQR.2y10_1.heavy 859.432 / 1242.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 481 62 C20140704_OR004_04 C20140704_OR004_04 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 242399.0 38.048301696777344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 242399.0 524.4395756266688 0.0 - - - - - - - 253.8 484 5 483 62 C20140704_OR004_04 C20140704_OR004_04 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 145400.0 38.048301696777344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 145400.0 1470.7873810878934 0.0 - - - - - - - 209.14285714285714 290 7 485 62 C20140704_OR004_04 C20140704_OR004_04 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 174676.0 38.048301696777344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 174676.0 572.1353590406509 1.0 - - - - - - - 195.42857142857142 384 7 487 63 C20140704_OR004_04 C20140704_OR004_04 TB427893.[MT7]-REIEAPEVR.2y5_1.heavy 621.85 / 571.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 489 63 C20140704_OR004_04 C20140704_OR004_04 TB427893.[MT7]-REIEAPEVR.2b4_1.heavy 621.85 / 672.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 491 63 C20140704_OR004_04 C20140704_OR004_04 TB427893.[MT7]-REIEAPEVR.2b7_1.heavy 621.85 / 969.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 493 63 C20140704_OR004_04 C20140704_OR004_04 TB427893.[MT7]-REIEAPEVR.2b5_1.heavy 621.85 / 743.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 495 64 C20140704_OR004_04 C20140704_OR004_04 TB428064.[MT7]-GALAETGAGAK[MT7]K[MT7].3y7_1.heavy 502.639 / 920.577 365.0 19.516000747680664 50 20 10 10 10 5.848750206864811 17.09766983767365 0.0 3 0.9927661815983174 14.501616645689912 365.0 5.3431057993101785 4.0 - - - - - - - 0.0 1 0 MRPS5 mitochondrial ribosomal protein S5 497 64 C20140704_OR004_04 C20140704_OR004_04 TB428064.[MT7]-GALAETGAGAK[MT7]K[MT7].3y8_2.heavy 502.639 / 525.313 639.0 19.516000747680664 50 20 10 10 10 5.848750206864811 17.09766983767365 0.0 3 0.9927661815983174 14.501616645689912 639.0 8.836180868312015 3.0 - - - - - - - 0.0 1 0 MRPS5 mitochondrial ribosomal protein S5 499 64 C20140704_OR004_04 C20140704_OR004_04 TB428064.[MT7]-GALAETGAGAK[MT7]K[MT7].3b5_1.heavy 502.639 / 586.332 913.0 19.516000747680664 50 20 10 10 10 5.848750206864811 17.09766983767365 0.0 3 0.9927661815983174 14.501616645689912 913.0 5.464671532846715 1.0 - - - - - - - 0.0 1 0 MRPS5 mitochondrial ribosomal protein S5 501 64 C20140704_OR004_04 C20140704_OR004_04 TB428064.[MT7]-GALAETGAGAK[MT7]K[MT7].3b3_1.heavy 502.639 / 386.252 1826.0 19.516000747680664 50 20 10 10 10 5.848750206864811 17.09766983767365 0.0 3 0.9927661815983174 14.501616645689912 1826.0 9.986343289168351 1.0 - - - - - - - 237.5 3 10 MRPS5 mitochondrial ribosomal protein S5 503 65 C20140704_OR004_04 C20140704_OR004_04 TB427744.[MT7]-AFIC[CAM]GK[MT7].2y4_1.heavy 492.283 / 621.351 3790.0 26.00850009918213 44 18 10 6 10 5.0526298638915845 19.79167338471515 0.035999298095703125 3 0.9803462079977763 8.788713769574315 3790.0 20.43304347826087 0.0 - - - - - - - 344.7142857142857 7 7 ZNF571 zinc finger protein 571 505 65 C20140704_OR004_04 C20140704_OR004_04 TB427744.[MT7]-AFIC[CAM]GK[MT7].2y5_1.heavy 492.283 / 768.419 3216.0 26.00850009918213 44 18 10 6 10 5.0526298638915845 19.79167338471515 0.035999298095703125 3 0.9803462079977763 8.788713769574315 3216.0 18.36382608695652 0.0 - - - - - - - 249.16666666666666 6 6 ZNF571 zinc finger protein 571 507 65 C20140704_OR004_04 C20140704_OR004_04 TB427744.[MT7]-AFIC[CAM]GK[MT7].2b4_1.heavy 492.283 / 636.33 574.0 26.00850009918213 44 18 10 6 10 5.0526298638915845 19.79167338471515 0.035999298095703125 3 0.9803462079977763 8.788713769574315 574.0 -0.09999999999999998 13.0 - - - - - - - 0.0 1 0 ZNF571 zinc finger protein 571 509 65 C20140704_OR004_04 C20140704_OR004_04 TB427744.[MT7]-AFIC[CAM]GK[MT7].2y3_1.heavy 492.283 / 508.267 6087.0 26.00850009918213 44 18 10 6 10 5.0526298638915845 19.79167338471515 0.035999298095703125 3 0.9803462079977763 8.788713769574315 6087.0 52.93043478260869 1.0 - - - - - - - 344.625 12 8 ZNF571 zinc finger protein 571 511 66 C20140704_OR004_04 C20140704_OR004_04 TB414021.[MT7]-AHLLADMAHISGLVAAK[MT7].3b6_1.heavy 669.387 / 765.438 12413.0 39.53340148925781 43 13 10 10 10 1.7634797132688556 45.81996612515243 0.0 3 0.9177104817872308 4.272341659917981 12413.0 104.40841121495329 0.0 - - - - - - - 214.0 24 5 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 513 66 C20140704_OR004_04 C20140704_OR004_04 TB414021.[MT7]-AHLLADMAHISGLVAAK[MT7].3y4_1.heavy 669.387 / 532.357 11022.0 39.53340148925781 43 13 10 10 10 1.7634797132688556 45.81996612515243 0.0 3 0.9177104817872308 4.272341659917981 11022.0 39.830280373831776 0.0 - - - - - - - 279.84615384615387 22 13 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 515 66 C20140704_OR004_04 C20140704_OR004_04 TB414021.[MT7]-AHLLADMAHISGLVAAK[MT7].3b8_1.heavy 669.387 / 967.515 21722.0 39.53340148925781 43 13 10 10 10 1.7634797132688556 45.81996612515243 0.0 3 0.9177104817872308 4.272341659917981 21722.0 296.3936448598131 0.0 - - - - - - - 214.0 43 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 517 66 C20140704_OR004_04 C20140704_OR004_04 TB414021.[MT7]-AHLLADMAHISGLVAAK[MT7].3b7_1.heavy 669.387 / 896.478 3959.0 39.53340148925781 43 13 10 10 10 1.7634797132688556 45.81996612515243 0.0 3 0.9177104817872308 4.272341659917981 3959.0 -0.29952380952380947 2.0 - - - - - - - 128.4 12 5 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 519 67 C20140704_OR004_04 C20140704_OR004_04 TB427898.[MT7]-SNNVEDC[CAM]K[MT7].2y5_1.heavy 627.305 / 794.383 288.0 16.47652530670166 34 13 10 5 6 1.0461989792321043 57.16095974112747 0.045299530029296875 6 0.9003702472336764 3.8769874286339725 288.0 3.3722338830584704 3.0 - - - - - - - 0.0 0 0 SLC26A6 solute carrier family 26, member 6 521 67 C20140704_OR004_04 C20140704_OR004_04 TB427898.[MT7]-SNNVEDC[CAM]K[MT7].2b4_1.heavy 627.305 / 559.296 403.0 16.47652530670166 34 13 10 5 6 1.0461989792321043 57.16095974112747 0.045299530029296875 6 0.9003702472336764 3.8769874286339725 403.0 3.7038728323699424 7.0 - - - - - - - 0.0 0 0 SLC26A6 solute carrier family 26, member 6 523 67 C20140704_OR004_04 C20140704_OR004_04 TB427898.[MT7]-SNNVEDC[CAM]K[MT7].2b6_1.heavy 627.305 / 803.365 1209.0 16.47652530670166 34 13 10 5 6 1.0461989792321043 57.16095974112747 0.045299530029296875 6 0.9003702472336764 3.8769874286339725 1209.0 17.431598391555667 0.0 - - - - - - - 153.66666666666666 2 3 SLC26A6 solute carrier family 26, member 6 525 67 C20140704_OR004_04 C20140704_OR004_04 TB427898.[MT7]-SNNVEDC[CAM]K[MT7].2y7_1.heavy 627.305 / 1022.47 806.0 16.47652530670166 34 13 10 5 6 1.0461989792321043 57.16095974112747 0.045299530029296875 6 0.9003702472336764 3.8769874286339725 806.0 18.42104405022922 0.0 - - - - - - - 0.0 1 0 SLC26A6 solute carrier family 26, member 6 527 68 C20140704_OR004_04 C20140704_OR004_04 TB427741.[MT7]-TGTANPK[MT7].2y4_1.heavy 488.787 / 573.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPP8 dipeptidyl-peptidase 8 529 68 C20140704_OR004_04 C20140704_OR004_04 TB427741.[MT7]-TGTANPK[MT7].2y3_1.heavy 488.787 / 502.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPP8 dipeptidyl-peptidase 8 531 68 C20140704_OR004_04 C20140704_OR004_04 TB427741.[MT7]-TGTANPK[MT7].2y6_1.heavy 488.787 / 731.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPP8 dipeptidyl-peptidase 8 533 68 C20140704_OR004_04 C20140704_OR004_04 TB427741.[MT7]-TGTANPK[MT7].2b5_1.heavy 488.787 / 589.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPP8 dipeptidyl-peptidase 8 535 69 C20140704_OR004_04 C20140704_OR004_04 TB428356.[MT7]-IGRC[CAM]PLIFIISDSLSGDNNQR.3y15_2.heavy 840.443 / 839.923 159.0 47.45110034942627 24 9 4 5 6 1.917603863130653 46.29428437939657 0.047199249267578125 5 0.8196088185386626 2.8608745934144064 159.0 1.099581589958159 46.0 - - - - - - - 268.875 3 16 RAD17 RAD17 homolog (S. pombe) 537 69 C20140704_OR004_04 C20140704_OR004_04 TB428356.[MT7]-IGRC[CAM]PLIFIISDSLSGDNNQR.3y11_1.heavy 840.443 / 1192.52 558.0 47.45110034942627 24 9 4 5 6 1.917603863130653 46.29428437939657 0.047199249267578125 5 0.8196088185386626 2.8608745934144064 558.0 4.837738214940557 7.0 - - - - - - - 0.0 1 0 RAD17 RAD17 homolog (S. pombe) 539 69 C20140704_OR004_04 C20140704_OR004_04 TB428356.[MT7]-IGRC[CAM]PLIFIISDSLSGDNNQR.3b8_2.heavy 840.443 / 551.322 1354.0 47.45110034942627 24 9 4 5 6 1.917603863130653 46.29428437939657 0.047199249267578125 5 0.8196088185386626 2.8608745934144064 1354.0 -0.08669456066945605 2.0 - - - - - - - 247.0 4 10 RAD17 RAD17 homolog (S. pombe) 541 69 C20140704_OR004_04 C20140704_OR004_04 TB428356.[MT7]-IGRC[CAM]PLIFIISDSLSGDNNQR.3y9_1.heavy 840.443 / 990.46 797.0 47.45110034942627 24 9 4 5 6 1.917603863130653 46.29428437939657 0.047199249267578125 5 0.8196088185386626 2.8608745934144064 797.0 2.9008183550983757 1.0 - - - - - - - 0.0 1 0 RAD17 RAD17 homolog (S. pombe) 543 70 C20140704_OR004_04 C20140704_OR004_04 TB413453.[MT7]-AVETVK[MT7].2y4_1.heavy 467.794 / 620.374 5761.0 19.155000686645508 45 17 8 10 10 2.3438162345119733 29.071108725853115 0.0 3 0.9761685011455846 7.978484523983592 5761.0 22.715943055555556 0.0 - - - - - - - 252.0 11 10 HAUS7 HAUS augmin-like complex, subunit 7 545 70 C20140704_OR004_04 C20140704_OR004_04 TB413453.[MT7]-AVETVK[MT7].2y5_1.heavy 467.794 / 719.442 6391.0 19.155000686645508 45 17 8 10 10 2.3438162345119733 29.071108725853115 0.0 3 0.9761685011455846 7.978484523983592 6391.0 34.36937777777778 0.0 - - - - - - - 231.42857142857142 12 7 HAUS7 HAUS augmin-like complex, subunit 7 547 70 C20140704_OR004_04 C20140704_OR004_04 TB413453.[MT7]-AVETVK[MT7].2b4_1.heavy 467.794 / 545.305 N/A 19.155000686645508 45 17 8 10 10 2.3438162345119733 29.071108725853115 0.0 3 0.9761685011455846 7.978484523983592 0.0 0.0 34.0 - - - - - - - 225.0 17 4 HAUS7 HAUS augmin-like complex, subunit 7 549 70 C20140704_OR004_04 C20140704_OR004_04 TB413453.[MT7]-AVETVK[MT7].2y3_1.heavy 467.794 / 491.331 4231.0 19.155000686645508 45 17 8 10 10 2.3438162345119733 29.071108725853115 0.0 3 0.9761685011455846 7.978484523983592 4231.0 4.551895805168597 1.0 - - - - - - - 240.0 11 9 HAUS7 HAUS augmin-like complex, subunit 7 551 71 C20140704_OR004_04 C20140704_OR004_04 TB428357.[MT7]-VLYLAMSPDGEAIVTGAGDETLR.3b5_1.heavy 841.436 / 704.446 7302.0 44.15072536468506 40 14 10 6 10 6.835964095781268 14.628514515123591 0.039699554443359375 3 0.9403190105025575 5.0264388779360125 7302.0 29.999365996839018 0.0 - - - - - - - 229.33333333333334 14 12 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 553 71 C20140704_OR004_04 C20140704_OR004_04 TB428357.[MT7]-VLYLAMSPDGEAIVTGAGDETLR.3b3_1.heavy 841.436 / 520.325 2835.0 44.15072536468506 40 14 10 6 10 6.835964095781268 14.628514515123591 0.039699554443359375 3 0.9403190105025575 5.0264388779360125 2835.0 13.993691860465116 0.0 - - - - - - - 205.07692307692307 5 13 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 555 71 C20140704_OR004_04 C20140704_OR004_04 TB428357.[MT7]-VLYLAMSPDGEAIVTGAGDETLR.3y10_1.heavy 841.436 / 1018.52 4982.0 44.15072536468506 40 14 10 6 10 6.835964095781268 14.628514515123591 0.039699554443359375 3 0.9403190105025575 5.0264388779360125 4982.0 64.07083720930233 0.0 - - - - - - - 235.06666666666666 9 15 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 557 71 C20140704_OR004_04 C20140704_OR004_04 TB428357.[MT7]-VLYLAMSPDGEAIVTGAGDETLR.3y9_1.heavy 841.436 / 919.448 4467.0 44.15072536468506 40 14 10 6 10 6.835964095781268 14.628514515123591 0.039699554443359375 3 0.9403190105025575 5.0264388779360125 4467.0 54.01953488372093 0.0 - - - - - - - 215.0 8 14 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 559 72 C20140704_OR004_04 C20140704_OR004_04 TB413593.[MT7]-NGAVQTIAQR.3y3_1.heavy 401.23 / 374.215 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS5 mitochondrial ribosomal protein S5 561 72 C20140704_OR004_04 C20140704_OR004_04 TB413593.[MT7]-NGAVQTIAQR.3y6_1.heavy 401.23 / 716.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS5 mitochondrial ribosomal protein S5 563 72 C20140704_OR004_04 C20140704_OR004_04 TB413593.[MT7]-NGAVQTIAQR.3y4_1.heavy 401.23 / 487.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS5 mitochondrial ribosomal protein S5 565 72 C20140704_OR004_04 C20140704_OR004_04 TB413593.[MT7]-NGAVQTIAQR.3y5_1.heavy 401.23 / 588.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS5 mitochondrial ribosomal protein S5 567 73 C20140704_OR004_04 C20140704_OR004_04 TB413451.[MT7]-VITIANR.2b3_1.heavy 465.796 / 458.31 1832.0 26.883399963378906 48 18 10 10 10 5.411501418663798 18.479159897308477 0.0 3 0.9800141718050754 8.715159077640475 1832.0 9.07218483366887 0.0 - - - - - - - 264.5 3 6 DPYSL5 dihydropyrimidinase-like 5 569 73 C20140704_OR004_04 C20140704_OR004_04 TB413451.[MT7]-VITIANR.2y4_1.heavy 465.796 / 473.283 1588.0 26.883399963378906 48 18 10 10 10 5.411501418663798 18.479159897308477 0.0 3 0.9800141718050754 8.715159077640475 1588.0 6.897357605015253 3.0 - - - - - - - 366.375 3 8 DPYSL5 dihydropyrimidinase-like 5 571 73 C20140704_OR004_04 C20140704_OR004_04 TB413451.[MT7]-VITIANR.2y5_1.heavy 465.796 / 574.331 6107.0 26.883399963378906 48 18 10 10 10 5.411501418663798 18.479159897308477 0.0 3 0.9800141718050754 8.715159077640475 6107.0 56.06426229508197 0.0 - - - - - - - 189.77777777777777 12 9 DPYSL5 dihydropyrimidinase-like 5 573 73 C20140704_OR004_04 C20140704_OR004_04 TB413451.[MT7]-VITIANR.2y6_1.heavy 465.796 / 687.415 7329.0 26.883399963378906 48 18 10 10 10 5.411501418663798 18.479159897308477 0.0 3 0.9800141718050754 8.715159077640475 7329.0 8.199837739681028 1.0 - - - - - - - 195.2 14 5 DPYSL5 dihydropyrimidinase-like 5 575 74 C20140704_OR004_04 C20140704_OR004_04 TB428359.[MT7]-GYSLVSGGTDNHLVLVDLRPK[MT7].4y4_1.heavy 632.857 / 657.453 7326.0 36.89389991760254 35 10 10 5 10 9.25668015792022 10.803009101965976 0.044803619384765625 3 0.8489273064461115 3.1343234670286404 7326.0 20.818238320801374 0.0 - - - - - - - 359.0 14 9 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 577 74 C20140704_OR004_04 C20140704_OR004_04 TB428359.[MT7]-GYSLVSGGTDNHLVLVDLRPK[MT7].4y8_1.heavy 632.857 / 1083.7 7451.0 36.89389991760254 35 10 10 5 10 9.25668015792022 10.803009101965976 0.044803619384765625 3 0.8489273064461115 3.1343234670286404 7451.0 12.309831819759792 0.0 - - - - - - - 232.75 14 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 579 74 C20140704_OR004_04 C20140704_OR004_04 TB428359.[MT7]-GYSLVSGGTDNHLVLVDLRPK[MT7].4b4_1.heavy 632.857 / 565.31 24214.0 36.89389991760254 35 10 10 5 10 9.25668015792022 10.803009101965976 0.044803619384765625 3 0.8489273064461115 3.1343234670286404 24214.0 100.40165390941704 0.0 - - - - - - - 234.66666666666666 48 9 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 581 74 C20140704_OR004_04 C20140704_OR004_04 TB428359.[MT7]-GYSLVSGGTDNHLVLVDLRPK[MT7].4b5_1.heavy 632.857 / 664.379 11424.0 36.89389991760254 35 10 10 5 10 9.25668015792022 10.803009101965976 0.044803619384765625 3 0.8489273064461115 3.1343234670286404 11424.0 30.350667631164633 0.0 - - - - - - - 331.22222222222223 22 9 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 583 75 C20140704_OR004_04 C20140704_OR004_04 TB413591.[MT7]-NVFTMTAK[MT7].2b3_1.heavy 600.338 / 505.289 4612.0 31.324100494384766 50 20 10 10 10 7.16096538887047 13.964597588394911 0.0 3 0.9951946283243603 17.796098958105482 4612.0 34.992680266490474 1.0 - - - - - - - 270.0 16 8 MRPS5 mitochondrial ribosomal protein S5 585 75 C20140704_OR004_04 C20140704_OR004_04 TB413591.[MT7]-NVFTMTAK[MT7].2y4_1.heavy 600.338 / 594.34 N/A 31.324100494384766 50 20 10 10 10 7.16096538887047 13.964597588394911 0.0 3 0.9951946283243603 17.796098958105482 2594.0 0.37596447404940336 18.0 - - - - - - - 288.0 9 3 MRPS5 mitochondrial ribosomal protein S5 587 75 C20140704_OR004_04 C20140704_OR004_04 TB413591.[MT7]-NVFTMTAK[MT7].2y5_1.heavy 600.338 / 695.388 7494.0 31.324100494384766 50 20 10 10 10 7.16096538887047 13.964597588394911 0.0 3 0.9951946283243603 17.796098958105482 7494.0 14.936532925867507 0.0 - - - - - - - 198.0 14 8 MRPS5 mitochondrial ribosomal protein S5 589 75 C20140704_OR004_04 C20140704_OR004_04 TB413591.[MT7]-NVFTMTAK[MT7].2y6_1.heavy 600.338 / 842.456 7638.0 31.324100494384766 50 20 10 10 10 7.16096538887047 13.964597588394911 0.0 3 0.9951946283243603 17.796098958105482 7638.0 32.35541666666667 0.0 - - - - - - - 302.4 15 10 MRPS5 mitochondrial ribosomal protein S5 591 76 C20140704_OR004_04 C20140704_OR004_04 TB428071.[MT7]-HADIVTTTTHK[MT7].2b4_1.heavy 756.425 / 581.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 593 76 C20140704_OR004_04 C20140704_OR004_04 TB428071.[MT7]-HADIVTTTTHK[MT7].2y3_1.heavy 756.425 / 529.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 595 76 C20140704_OR004_04 C20140704_OR004_04 TB428071.[MT7]-HADIVTTTTHK[MT7].2y6_1.heavy 756.425 / 832.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 597 76 C20140704_OR004_04 C20140704_OR004_04 TB428071.[MT7]-HADIVTTTTHK[MT7].2y10_1.heavy 756.425 / 1230.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 599 77 C20140704_OR004_04 C20140704_OR004_04 TB413599.[MT7]-AVETVK[MT7]K[MT7].2y4_1.heavy 603.893 / 763.528 N/A N/A - - - - - - - - - 0.0 - - - - - - - HAUS7 HAUS augmin-like complex, subunit 7 601 77 C20140704_OR004_04 C20140704_OR004_04 TB413599.[MT7]-AVETVK[MT7]K[MT7].2y5_1.heavy 603.893 / 892.571 N/A N/A - - - - - - - - - 0.0 - - - - - - - HAUS7 HAUS augmin-like complex, subunit 7 603 77 C20140704_OR004_04 C20140704_OR004_04 TB413599.[MT7]-AVETVK[MT7]K[MT7].2b4_1.heavy 603.893 / 545.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - HAUS7 HAUS augmin-like complex, subunit 7 605 77 C20140704_OR004_04 C20140704_OR004_04 TB413599.[MT7]-AVETVK[MT7]K[MT7].2y6_1.heavy 603.893 / 991.639 N/A N/A - - - - - - - - - 0.0 - - - - - - - HAUS7 HAUS augmin-like complex, subunit 7 607 78 C20140704_OR004_04 C20140704_OR004_04 TB413596.[MT7]-K[MT7]QEQLK[MT7].2b3_1.heavy 603.383 / 674.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - CENPJ;SLC26A6 centromere protein J;solute carrier family 26, member 6 609 78 C20140704_OR004_04 C20140704_OR004_04 TB413596.[MT7]-K[MT7]QEQLK[MT7].2y5_1.heavy 603.383 / 789.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - CENPJ;SLC26A6 centromere protein J;solute carrier family 26, member 6 611 78 C20140704_OR004_04 C20140704_OR004_04 TB413596.[MT7]-K[MT7]QEQLK[MT7].2b4_1.heavy 603.383 / 802.466 N/A N/A - - - - - - - - - 0.0 - - - - - - - CENPJ;SLC26A6 centromere protein J;solute carrier family 26, member 6 613 78 C20140704_OR004_04 C20140704_OR004_04 TB413596.[MT7]-K[MT7]QEQLK[MT7].2b5_1.heavy 603.383 / 915.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CENPJ;SLC26A6 centromere protein J;solute carrier family 26, member 6 615 79 C20140704_OR004_04 C20140704_OR004_04 TB428354.[MT7]-RSSPDDGNDVSPYSLSPVSNK[MT7].3b9_2.heavy 837.085 / 544.74 4881.0 29.137300491333008 35 12 10 3 10 1.513820458811214 45.75507544337702 0.05120086669921875 3 0.8877564769746066 3.6486585174114414 4881.0 27.640511363636364 0.0 - - - - - - - 330.0 9 2 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 617 79 C20140704_OR004_04 C20140704_OR004_04 TB428354.[MT7]-RSSPDDGNDVSPYSLSPVSNK[MT7].3b9_1.heavy 837.085 / 1088.47 2243.0 29.137300491333008 35 12 10 3 10 1.513820458811214 45.75507544337702 0.05120086669921875 3 0.8877564769746066 3.6486585174114414 2243.0 28.870128787878787 0.0 - - - - - - - 198.0 4 4 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 619 79 C20140704_OR004_04 C20140704_OR004_04 TB428354.[MT7]-RSSPDDGNDVSPYSLSPVSNK[MT7].3y6_1.heavy 837.085 / 775.443 3694.0 29.137300491333008 35 12 10 3 10 1.513820458811214 45.75507544337702 0.05120086669921875 3 0.8877564769746066 3.6486585174114414 3694.0 41.417575757575754 0.0 - - - - - - - 231.0 7 4 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 621 79 C20140704_OR004_04 C20140704_OR004_04 TB428354.[MT7]-RSSPDDGNDVSPYSLSPVSNK[MT7].3b6_1.heavy 837.085 / 802.381 2506.0 29.137300491333008 35 12 10 3 10 1.513820458811214 45.75507544337702 0.05120086669921875 3 0.8877564769746066 3.6486585174114414 2506.0 11.011212121212122 0.0 - - - - - - - 176.0 5 6 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 623 80 C20140704_OR004_04 C20140704_OR004_04 TB414176.[MT7]-TEYFAQHEQGAAAGAADISTLDQK[MT7].4b12_2.heavy 703.351 / 739.345 10194.0 32.12630081176758 43 13 10 10 10 1.0981043835548923 61.38978227875529 0.0 3 0.9176499909725254 4.27075003016733 10194.0 31.775342266277658 1.0 - - - - - - - 287.25 21 4 HAUS7 HAUS augmin-like complex, subunit 7 625 80 C20140704_OR004_04 C20140704_OR004_04 TB414176.[MT7]-TEYFAQHEQGAAAGAADISTLDQK[MT7].4b4_1.heavy 703.351 / 685.331 N/A 32.12630081176758 43 13 10 10 10 1.0981043835548923 61.38978227875529 0.0 3 0.9176499909725254 4.27075003016733 5025.0 5.250386996904025 1.0 - - - - - - - 144.0 10 2 HAUS7 HAUS augmin-like complex, subunit 7 627 80 C20140704_OR004_04 C20140704_OR004_04 TB414176.[MT7]-TEYFAQHEQGAAAGAADISTLDQK[MT7].4b6_1.heavy 703.351 / 884.427 3159.0 32.12630081176758 43 13 10 10 10 1.0981043835548923 61.38978227875529 0.0 3 0.9176499909725254 4.27075003016733 3159.0 43.43625 0.0 - - - - - - - 144.0 6 4 HAUS7 HAUS augmin-like complex, subunit 7 629 80 C20140704_OR004_04 C20140704_OR004_04 TB414176.[MT7]-TEYFAQHEQGAAAGAADISTLDQK[MT7].4b10_2.heavy 703.351 / 668.308 8471.0 32.12630081176758 43 13 10 10 10 1.0981043835548923 61.38978227875529 0.0 3 0.9176499909725254 4.27075003016733 8471.0 37.780069686411146 0.0 - - - - - - - 233.5 16 8 HAUS7 HAUS augmin-like complex, subunit 7 631 81 C20140704_OR004_04 C20140704_OR004_04 TB427758.[MT7]-GVPTEVK[MT7].2y4_1.heavy 509.313 / 620.374 9645.0 21.783849716186523 43 18 10 5 10 3.0423783744405535 25.45559093590167 0.04010009765625 3 0.9888553181415906 11.679503090627197 9645.0 27.212080397250247 0.0 - - - - - - - 172.125 19 8 HAUS7 HAUS augmin-like complex, subunit 7 633 81 C20140704_OR004_04 C20140704_OR004_04 TB427758.[MT7]-GVPTEVK[MT7].2y5_1.heavy 509.313 / 717.426 71550.0 21.783849716186523 43 18 10 5 10 3.0423783744405535 25.45559093590167 0.04010009765625 3 0.9888553181415906 11.679503090627197 71550.0 700.9720812182741 0.0 - - - - - - - 226.3 143 10 HAUS7 HAUS augmin-like complex, subunit 7 635 81 C20140704_OR004_04 C20140704_OR004_04 TB427758.[MT7]-GVPTEVK[MT7].2y3_1.heavy 509.313 / 519.326 10432.0 21.783849716186523 43 18 10 5 10 3.0423783744405535 25.45559093590167 0.04010009765625 3 0.9888553181415906 11.679503090627197 10432.0 26.50406504065041 0.0 - - - - - - - 306.22222222222223 20 9 HAUS7 HAUS augmin-like complex, subunit 7 637 81 C20140704_OR004_04 C20140704_OR004_04 TB427758.[MT7]-GVPTEVK[MT7].2b5_1.heavy 509.313 / 628.342 7578.0 21.783849716186523 43 18 10 5 10 3.0423783744405535 25.45559093590167 0.04010009765625 3 0.9888553181415906 11.679503090627197 7578.0 33.978693815359094 0.0 - - - - - - - 218.44444444444446 15 9 HAUS7 HAUS augmin-like complex, subunit 7 639 82 C20140704_OR004_04 C20140704_OR004_04 TB427886.[MT7]-GGEQPPPGAK[MT7].2b3_1.heavy 613.343 / 388.195 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 641 82 C20140704_OR004_04 C20140704_OR004_04 TB427886.[MT7]-GGEQPPPGAK[MT7].2y3_1.heavy 613.343 / 419.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 643 83 C20140704_OR004_04 C20140704_OR004_04 TB427888.[MT7]-VQDPQTEDR.2y4_1.heavy 616.305 / 520.236 613.0 17.892199516296387 37 12 10 5 10 2.6933745953158392 37.12814406652316 0.041599273681640625 3 0.8956843242505342 3.787371626195123 613.0 0.9980456026058633 4.0 - - - - - - - 0.0 1 0 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 645 83 C20140704_OR004_04 C20140704_OR004_04 TB427888.[MT7]-VQDPQTEDR.2y8_1.heavy 616.305 / 988.433 4369.0 17.892199516296387 37 12 10 5 10 2.6933745953158392 37.12814406652316 0.041599273681640625 3 0.8956843242505342 3.787371626195123 4369.0 30.39446452476573 0.0 - - - - - - - 153.42857142857142 8 7 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 647 83 C20140704_OR004_04 C20140704_OR004_04 TB427888.[MT7]-VQDPQTEDR.2y6_1.heavy 616.305 / 745.347 6822.0 17.892199516296387 37 12 10 5 10 2.6933745953158392 37.12814406652316 0.041599273681640625 3 0.8956843242505342 3.787371626195123 6822.0 27.46600391389433 1.0 - - - - - - - 199.4 15 5 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 649 83 C20140704_OR004_04 C20140704_OR004_04 TB427888.[MT7]-VQDPQTEDR.2y7_1.heavy 616.305 / 860.375 1763.0 17.892199516296387 37 12 10 5 10 2.6933745953158392 37.12814406652316 0.041599273681640625 3 0.8956843242505342 3.787371626195123 1763.0 11.322875816993465 1.0 - - - - - - - 262.85714285714283 3 7 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 651 84 C20140704_OR004_04 C20140704_OR004_04 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1065690.0 35.02163441975912 23 -3 10 6 10 null 0.0 0.03759765625 3 0.0 0.0 1065690.0 1038.7217444843984 0.0 - - - - - - - 202.8 2131 5 653 84 C20140704_OR004_04 C20140704_OR004_04 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 201246.0 35.02163441975912 23 -3 10 6 10 null 0.0 0.03759765625 3 0.0 0.0 201246.0 1536.8228699087736 0.0 - - - - - - - 185.15384615384616 402 13 655 84 C20140704_OR004_04 C20140704_OR004_04 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 337395.0 35.02163441975912 23 -3 10 6 10 null 0.0 0.03759765625 3 0.0 0.0 337395.0 377.2464007071319 0.0 - - - - - - - 617.5 674 8 657 85 C20140704_OR004_04 C20140704_OR004_04 TB428360.[MT7]-GYSLVSGGTDNHLVLVDLRPK[MT7].3b4_1.heavy 843.474 / 565.31 4835.0 36.91630172729492 50 20 10 10 10 11.322859332807194 8.831691453611631 0.0 3 0.9976921489540886 25.68472516417387 4835.0 26.90443548387097 0.0 - - - - - - - 303.1111111111111 9 9 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 659 85 C20140704_OR004_04 C20140704_OR004_04 TB428360.[MT7]-GYSLVSGGTDNHLVLVDLRPK[MT7].3b5_1.heavy 843.474 / 664.379 3471.0 36.91630172729492 50 20 10 10 10 11.322859332807194 8.831691453611631 0.0 3 0.9976921489540886 25.68472516417387 3471.0 19.482387096774193 0.0 - - - - - - - 186.0 6 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 661 85 C20140704_OR004_04 C20140704_OR004_04 TB428360.[MT7]-GYSLVSGGTDNHLVLVDLRPK[MT7].3y4_1.heavy 843.474 / 657.453 9918.0 36.91630172729492 50 20 10 10 10 11.322859332807194 8.831691453611631 0.0 3 0.9976921489540886 25.68472516417387 9918.0 34.037580645161285 0.0 - - - - - - - 325.5 19 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 663 85 C20140704_OR004_04 C20140704_OR004_04 TB428360.[MT7]-GYSLVSGGTDNHLVLVDLRPK[MT7].3y8_1.heavy 843.474 / 1083.7 5827.0 36.91630172729492 50 20 10 10 10 11.322859332807194 8.831691453611631 0.0 3 0.9976921489540886 25.68472516417387 5827.0 43.0367480119904 1.0 - - - - - - - 265.7142857142857 11 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 665 86 C20140704_OR004_04 C20140704_OR004_04 TB413583.[MT7]-YSEGYPGK[MT7].2y5_1.heavy 594.811 / 665.374 4310.0 22.27359962463379 44 14 10 10 10 8.591120704818708 11.639924922008207 0.0 3 0.9490433493326406 5.443776359980123 4310.0 31.518707482993197 0.0 - - - - - - - 203.53846153846155 8 13 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 667 86 C20140704_OR004_04 C20140704_OR004_04 TB413583.[MT7]-YSEGYPGK[MT7].2b4_1.heavy 594.811 / 581.269 4212.0 22.27359962463379 44 14 10 10 10 8.591120704818708 11.639924922008207 0.0 3 0.9490433493326406 5.443776359980123 4212.0 10.601632653061223 0.0 - - - - - - - 294.0 8 11 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 669 86 C20140704_OR004_04 C20140704_OR004_04 TB413583.[MT7]-YSEGYPGK[MT7].2b5_1.heavy 594.811 / 744.332 5681.0 22.27359962463379 44 14 10 10 10 8.591120704818708 11.639924922008207 0.0 3 0.9490433493326406 5.443776359980123 5681.0 71.49557823129251 0.0 - - - - - - - 261.3333333333333 11 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 671 86 C20140704_OR004_04 C20140704_OR004_04 TB413583.[MT7]-YSEGYPGK[MT7].2y7_1.heavy 594.811 / 881.448 7150.0 22.27359962463379 44 14 10 10 10 8.591120704818708 11.639924922008207 0.0 3 0.9490433493326406 5.443776359980123 7150.0 43.775510204081634 0.0 - - - - - - - 257.25 14 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 673 87 C20140704_OR004_04 C20140704_OR004_04 TB428366.[MT7]-IMGLDLPDGGHLTHGYMSDVK[MT7].4y4_1.heavy 636.826 / 592.342 14371.0 37.50239944458008 48 20 10 10 8 7.406032300211319 13.502506598188436 0.0 4 0.9963786048445493 20.5018599202166 14371.0 53.20796724925209 0.0 - - - - - - - 254.72727272727272 28 11 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 675 87 C20140704_OR004_04 C20140704_OR004_04 TB428366.[MT7]-IMGLDLPDGGHLTHGYMSDVK[MT7].4b5_1.heavy 636.826 / 674.366 50298.0 37.50239944458008 48 20 10 10 8 7.406032300211319 13.502506598188436 0.0 4 0.9963786048445493 20.5018599202166 50298.0 179.7094866529774 0.0 - - - - - - - 287.14285714285717 100 14 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 677 87 C20140704_OR004_04 C20140704_OR004_04 TB428366.[MT7]-IMGLDLPDGGHLTHGYMSDVK[MT7].4y7_1.heavy 636.826 / 943.468 9134.0 37.50239944458008 48 20 10 10 8 7.406032300211319 13.502506598188436 0.0 4 0.9963786048445493 20.5018599202166 9134.0 43.006143408990454 1.0 - - - - - - - 255.9 41 10 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 679 87 C20140704_OR004_04 C20140704_OR004_04 TB428366.[MT7]-IMGLDLPDGGHLTHGYMSDVK[MT7].4b6_1.heavy 636.826 / 787.45 6576.0 37.50239944458008 48 20 10 10 8 7.406032300211319 13.502506598188436 0.0 4 0.9963786048445493 20.5018599202166 6576.0 2.511160528095212 1.0 - - - - - - - 254.8181818181818 13 11 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 681 88 C20140704_OR004_04 C20140704_OR004_04 TB414046.[MT7]-RISATSIFFESMPYK[MT7].4b8_1.heavy 517.031 / 1020.6 4034.0 41.255849838256836 39 13 10 6 10 2.8833760826528065 34.681566723684725 0.033298492431640625 3 0.9299276871046143 4.6346817624073084 4034.0 62.926197916666666 0.0 - - - - - - - 192.0 8 2 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 683 88 C20140704_OR004_04 C20140704_OR004_04 TB414046.[MT7]-RISATSIFFESMPYK[MT7].4b7_1.heavy 517.031 / 873.527 7876.0 41.255849838256836 39 13 10 6 10 2.8833760826528065 34.681566723684725 0.033298492431640625 3 0.9299276871046143 4.6346817624073084 7876.0 58.79652777777778 0.0 - - - - - - - 168.0 15 4 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 685 88 C20140704_OR004_04 C20140704_OR004_04 TB414046.[MT7]-RISATSIFFESMPYK[MT7].4y3_1.heavy 517.031 / 551.331 21034.0 41.255849838256836 39 13 10 6 10 2.8833760826528065 34.681566723684725 0.033298492431640625 3 0.9299276871046143 4.6346817624073084 21034.0 100.78791666666666 1.0 - - - - - - - 268.8 42 5 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 687 88 C20140704_OR004_04 C20140704_OR004_04 TB414046.[MT7]-RISATSIFFESMPYK[MT7].4b6_1.heavy 517.031 / 760.443 6051.0 41.255849838256836 39 13 10 6 10 2.8833760826528065 34.681566723684725 0.033298492431640625 3 0.9299276871046143 4.6346817624073084 6051.0 48.84921875 0.0 - - - - - - - 160.0 12 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 689 89 C20140704_OR004_04 C20140704_OR004_04 TB427729.[MT7]-ITVPDK[MT7].2y4_1.heavy 480.802 / 602.363 1754.0 26.43169927597046 35 20 2 5 8 6.436030514469014 15.537527327626446 0.04039955139160156 4 0.9901436507001987 12.420725594175556 1754.0 9.969316239316239 0.0 - - - - - - - 273.0 3 6 RAD17 RAD17 homolog (S. pombe) 691 89 C20140704_OR004_04 C20140704_OR004_04 TB427729.[MT7]-ITVPDK[MT7].2y5_1.heavy 480.802 / 703.411 2572.0 26.43169927597046 35 20 2 5 8 6.436030514469014 15.537527327626446 0.04039955139160156 4 0.9901436507001987 12.420725594175556 2572.0 17.586324786324784 1.0 - - - - - - - 260.0 35 9 RAD17 RAD17 homolog (S. pombe) 693 89 C20140704_OR004_04 C20140704_OR004_04 TB427729.[MT7]-ITVPDK[MT7].2y3_1.heavy 480.802 / 503.295 8535.0 26.43169927597046 35 20 2 5 8 6.436030514469014 15.537527327626446 0.04039955139160156 4 0.9901436507001987 12.420725594175556 8535.0 13.833935877497307 2.0 - - - - - - - 701.7142857142857 17 7 RAD17 RAD17 homolog (S. pombe) 695 89 C20140704_OR004_04 C20140704_OR004_04 TB427729.[MT7]-ITVPDK[MT7].2b5_1.heavy 480.802 / 670.389 818.0 26.43169927597046 35 20 2 5 8 6.436030514469014 15.537527327626446 0.04039955139160156 4 0.9901436507001987 12.420725594175556 818.0 -0.11356563938363018 5.0 - - - - - - - 163.8 3 5 RAD17 RAD17 homolog (S. pombe) 697 90 C20140704_OR004_04 C20140704_OR004_04 TB428338.[MT7]-K[MT7]IEALLNLPRNPSVIDK[MT7].3b6_1.heavy 784.816 / 956.638 1361.0 37.00590133666992 37 11 10 10 6 1.4268558411875611 47.532321571504184 0.0 6 0.8743952678823051 3.4451261117690057 1361.0 14.015260545905708 0.0 - - - - - - - 185.5 2 6 C3orf1 chromosome 3 open reading frame 1 699 90 C20140704_OR004_04 C20140704_OR004_04 TB428338.[MT7]-K[MT7]IEALLNLPRNPSVIDK[MT7].3y3_1.heavy 784.816 / 519.326 990.0 37.00590133666992 37 11 10 10 6 1.4268558411875611 47.532321571504184 0.0 6 0.8743952678823051 3.4451261117690057 990.0 3.9106835423135884 2.0 - - - - - - - 0.0 1 0 C3orf1 chromosome 3 open reading frame 1 701 90 C20140704_OR004_04 C20140704_OR004_04 TB428338.[MT7]-K[MT7]IEALLNLPRNPSVIDK[MT7].3y4_1.heavy 784.816 / 618.394 247.0 37.00590133666992 37 11 10 10 6 1.4268558411875611 47.532321571504184 0.0 6 0.8743952678823051 3.4451261117690057 247.0 0.26630727762803225 28.0 - - - - - - - 0.0 1 0 C3orf1 chromosome 3 open reading frame 1 703 90 C20140704_OR004_04 C20140704_OR004_04 TB428338.[MT7]-K[MT7]IEALLNLPRNPSVIDK[MT7].3b3_1.heavy 784.816 / 659.433 866.0 37.00590133666992 37 11 10 10 6 1.4268558411875611 47.532321571504184 0.0 6 0.8743952678823051 3.4451261117690057 866.0 0.1749494949494949 8.0 - - - - - - - 210.3 2 10 C3orf1 chromosome 3 open reading frame 1 705 91 C20140704_OR004_04 C20140704_OR004_04 TB413887.[MT7]-TGLIDYNQLALTAR.3y7_1.heavy 564.985 / 772.468 1838.0 38.38930130004883 48 18 10 10 10 3.8993284046523904 19.778678120135293 0.0 3 0.9876694079167716 11.102560108498054 1838.0 16.99793348898845 0.0 - - - - - - - 281.1111111111111 3 9 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 707 91 C20140704_OR004_04 C20140704_OR004_04 TB413887.[MT7]-TGLIDYNQLALTAR.3b6_1.heavy 564.985 / 807.437 1723.0 38.38930130004883 48 18 10 10 10 3.8993284046523904 19.778678120135293 0.0 3 0.9876694079167716 11.102560108498054 1723.0 6.094557852738484 1.0 - - - - - - - 239.58333333333334 3 12 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 709 91 C20140704_OR004_04 C20140704_OR004_04 TB413887.[MT7]-TGLIDYNQLALTAR.3b7_1.heavy 564.985 / 921.48 2527.0 38.38930130004883 48 18 10 10 10 3.8993284046523904 19.778678120135293 0.0 3 0.9876694079167716 11.102560108498054 2527.0 18.018991183259544 0.0 - - - - - - - 276.0 5 5 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 711 91 C20140704_OR004_04 C20140704_OR004_04 TB413887.[MT7]-TGLIDYNQLALTAR.3y5_1.heavy 564.985 / 531.325 27225.0 38.38930130004883 48 18 10 10 10 3.8993284046523904 19.778678120135293 0.0 3 0.9876694079167716 11.102560108498054 27225.0 148.33885463984424 0.0 - - - - - - - 262.85714285714283 54 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 713 92 C20140704_OR004_04 C20140704_OR004_04 TB451612.[MT7]-TGLIDYNQLALTAR.2y8_1.heavy 846.974 / 886.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 715 92 C20140704_OR004_04 C20140704_OR004_04 TB451612.[MT7]-TGLIDYNQLALTAR.2b7_1.heavy 846.974 / 921.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 717 92 C20140704_OR004_04 C20140704_OR004_04 TB451612.[MT7]-TGLIDYNQLALTAR.2y10_1.heavy 846.974 / 1164.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 719 92 C20140704_OR004_04 C20140704_OR004_04 TB451612.[MT7]-TGLIDYNQLALTAR.2y7_1.heavy 846.974 / 772.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 721 93 C20140704_OR004_04 C20140704_OR004_04 TB413883.[MT7]-AFILGSHLTYHQR.4y4_1.heavy 422.485 / 603.3 724.0 28.237525463104248 31 12 10 5 4 2.6653874061093 37.51799823575038 0.04670143127441406 10 0.8861610605448046 3.622498317148261 724.0 2.746206896551724 3.0 - - - - - - - 290.0 4 6 ZNF571 zinc finger protein 571 723 93 C20140704_OR004_04 C20140704_OR004_04 TB413883.[MT7]-AFILGSHLTYHQR.4y5_1.heavy 422.485 / 704.347 9998.0 28.237525463104248 31 12 10 5 4 2.6653874061093 37.51799823575038 0.04670143127441406 10 0.8861610605448046 3.622498317148261 9998.0 33.786344827586205 0.0 - - - - - - - 232.0 19 5 ZNF571 zinc finger protein 571 725 93 C20140704_OR004_04 C20140704_OR004_04 TB413883.[MT7]-AFILGSHLTYHQR.4y6_1.heavy 422.485 / 817.432 2753.0 28.237525463104248 31 12 10 5 4 2.6653874061093 37.51799823575038 0.04670143127441406 10 0.8861610605448046 3.622498317148261 2753.0 18.986206896551725 0.0 - - - - - - - 232.0 5 5 ZNF571 zinc finger protein 571 727 93 C20140704_OR004_04 C20140704_OR004_04 TB413883.[MT7]-AFILGSHLTYHQR.4b3_1.heavy 422.485 / 476.299 580.0 28.237525463104248 31 12 10 5 4 2.6653874061093 37.51799823575038 0.04670143127441406 10 0.8861610605448046 3.622498317148261 580.0 0.46720368239355575 17.0 - - - - - - - 241.66666666666666 16 6 ZNF571 zinc finger protein 571 729 94 C20140704_OR004_04 C20140704_OR004_04 TB451402.[MT7]-NVFTMTAK[MT7].3y3_1.heavy 400.561 / 463.3 12734.0 31.324100494384766 40 10 10 10 10 1.0178183047436704 63.86444806372342 0.0 3 0.8300264065392932 2.949978746314451 12734.0 69.12742857142857 0.0 - - - - - - - 326.6666666666667 25 6 MRPS5 mitochondrial ribosomal protein S5 731 94 C20140704_OR004_04 C20140704_OR004_04 TB451402.[MT7]-NVFTMTAK[MT7].3b4_1.heavy 400.561 / 606.337 2659.0 31.324100494384766 40 10 10 10 10 1.0178183047436704 63.86444806372342 0.0 3 0.8300264065392932 2.949978746314451 2659.0 24.690714285714286 0.0 - - - - - - - 245.0 5 4 MRPS5 mitochondrial ribosomal protein S5 733 94 C20140704_OR004_04 C20140704_OR004_04 TB451402.[MT7]-NVFTMTAK[MT7].3y4_1.heavy 400.561 / 594.34 2659.0 31.324100494384766 40 10 10 10 10 1.0178183047436704 63.86444806372342 0.0 3 0.8300264065392932 2.949978746314451 2659.0 10.753122619047618 0.0 - - - - - - - 280.0 5 4 MRPS5 mitochondrial ribosomal protein S5 735 94 C20140704_OR004_04 C20140704_OR004_04 TB451402.[MT7]-NVFTMTAK[MT7].3b3_1.heavy 400.561 / 505.289 3218.0 31.324100494384766 40 10 10 10 10 1.0178183047436704 63.86444806372342 0.0 3 0.8300264065392932 2.949978746314451 3218.0 5.390044862370333 1.0 - - - - - - - 233.33333333333334 6 6 MRPS5 mitochondrial ribosomal protein S5 737 95 C20140704_OR004_04 C20140704_OR004_04 TB413472.[MT7]-QTNLTK[MT7].2y4_1.heavy 496.803 / 619.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBL1 retinoblastoma-like 1 (p107) 739 95 C20140704_OR004_04 C20140704_OR004_04 TB413472.[MT7]-QTNLTK[MT7].2y5_1.heavy 496.803 / 720.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBL1 retinoblastoma-like 1 (p107) 741 95 C20140704_OR004_04 C20140704_OR004_04 TB413472.[MT7]-QTNLTK[MT7].2y3_1.heavy 496.803 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBL1 retinoblastoma-like 1 (p107) 743 95 C20140704_OR004_04 C20140704_OR004_04 TB413472.[MT7]-QTNLTK[MT7].2b5_1.heavy 496.803 / 702.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - RBL1 retinoblastoma-like 1 (p107) 745 96 C20140704_OR004_04 C20140704_OR004_04 TB451403.[MT7]-ELMIPGGAK[MT7].2b3_1.heavy 602.354 / 518.276 20733.0 30.963600158691406 48 18 10 10 10 2.837339846803149 35.24427999440064 0.0 3 0.9839441750076218 9.726649339020586 20733.0 94.46690647482014 0.0 - - - - - - - 227.45454545454547 41 11 DPYSL5 dihydropyrimidinase-like 5 747 96 C20140704_OR004_04 C20140704_OR004_04 TB451403.[MT7]-ELMIPGGAK[MT7].2y5_1.heavy 602.354 / 573.348 50093.0 30.963600158691406 48 18 10 10 10 2.837339846803149 35.24427999440064 0.0 3 0.9839441750076218 9.726649339020586 50093.0 206.7620283593592 0.0 - - - - - - - 278.0 100 7 DPYSL5 dihydropyrimidinase-like 5 749 96 C20140704_OR004_04 C20140704_OR004_04 TB451403.[MT7]-ELMIPGGAK[MT7].2b4_1.heavy 602.354 / 631.36 16141.0 30.963600158691406 48 18 10 10 10 2.837339846803149 35.24427999440064 0.0 3 0.9839441750076218 9.726649339020586 16141.0 80.48610278673613 0.0 - - - - - - - 765.5 32 8 DPYSL5 dihydropyrimidinase-like 5 751 96 C20140704_OR004_04 C20140704_OR004_04 TB451403.[MT7]-ELMIPGGAK[MT7].2y6_1.heavy 602.354 / 686.432 5566.0 30.963600158691406 48 18 10 10 10 2.837339846803149 35.24427999440064 0.0 3 0.9839441750076218 9.726649339020586 5566.0 16.23688525218164 0.0 - - - - - - - 250.2 11 5 DPYSL5 dihydropyrimidinase-like 5 753 97 C20140704_OR004_04 C20140704_OR004_04 TB428090.[MT7]-GFVQIWDAAAGK[MT7].3y6_1.heavy 517.624 / 676.375 9871.0 42.53710174560547 45 15 10 10 10 2.8225680340624293 35.42872972173262 0.0 3 0.9505625714480149 5.527500517373008 9871.0 215.95554444444446 0.0 - - - - - - - 164.5 19 6 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 755 97 C20140704_OR004_04 C20140704_OR004_04 TB428090.[MT7]-GFVQIWDAAAGK[MT7].3b4_1.heavy 517.624 / 576.326 20191.0 42.53710174560547 45 15 10 10 10 2.8225680340624293 35.42872972173262 0.0 3 0.9505625714480149 5.527500517373008 20191.0 162.2889997043308 0.0 - - - - - - - 153.85714285714286 40 7 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 757 97 C20140704_OR004_04 C20140704_OR004_04 TB428090.[MT7]-GFVQIWDAAAGK[MT7].3b5_1.heavy 517.624 / 689.41 12294.0 42.53710174560547 45 15 10 10 10 2.8225680340624293 35.42872972173262 0.0 3 0.9505625714480149 5.527500517373008 12294.0 79.91348245332449 0.0 - - - - - - - 256.14285714285717 24 7 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 759 97 C20140704_OR004_04 C20140704_OR004_04 TB428090.[MT7]-GFVQIWDAAAGK[MT7].3y5_1.heavy 517.624 / 561.348 9153.0 42.53710174560547 45 15 10 10 10 2.8225680340624293 35.42872972173262 0.0 3 0.9505625714480149 5.527500517373008 9153.0 39.448386472129314 0.0 - - - - - - - 228.36363636363637 18 11 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 761 98 C20140704_OR004_04 C20140704_OR004_04 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 19029.0 22.65489959716797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 19029.0 198.00859036144578 0.0 - - - - - - - 282.5 38 6 763 98 C20140704_OR004_04 C20140704_OR004_04 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 20822.0 22.65489959716797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 20822.0 395.618 0.0 - - - - - - - 100.0 41 2 765 98 C20140704_OR004_04 C20140704_OR004_04 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 47124.0 22.65489959716797 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 47124.0 268.7027397968513 0.0 - - - - - - - 256.2857142857143 94 7 767 99 C20140704_OR004_04 C20140704_OR004_04 TB428076.[MT7]-SFPDTVYK[MT7]K[MT7].3y3_1.heavy 506.296 / 726.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 769 99 C20140704_OR004_04 C20140704_OR004_04 TB428076.[MT7]-SFPDTVYK[MT7]K[MT7].3b4_1.heavy 506.296 / 591.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 771 99 C20140704_OR004_04 C20140704_OR004_04 TB428076.[MT7]-SFPDTVYK[MT7]K[MT7].3y7_2.heavy 506.296 / 569.839 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 773 99 C20140704_OR004_04 C20140704_OR004_04 TB428076.[MT7]-SFPDTVYK[MT7]K[MT7].3y8_2.heavy 506.296 / 643.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 775 100 C20140704_OR004_04 C20140704_OR004_04 TB414193.[MT7]-K[MT7]YEPIFLDIFQNPYEEPPK[MT7]LPR.4b8_2.heavy 792.189 / 647.868 3930.0 45.62852668762207 36 10 10 6 10 0.9369380994449193 70.20573236786453 0.03910064697265625 3 0.8213752018695247 2.875438418089482 3930.0 19.190350877192984 0.0 - - - - - - - 230.6 7 10 RBL1 retinoblastoma-like 1 (p107) 777 100 C20140704_OR004_04 C20140704_OR004_04 TB414193.[MT7]-K[MT7]YEPIFLDIFQNPYEEPPK[MT7]LPR.4b5_1.heavy 792.189 / 919.549 1282.0 45.62852668762207 36 10 10 6 10 0.9369380994449193 70.20573236786453 0.03910064697265625 3 0.8213752018695247 2.875438418089482 1282.0 7.459590643274853 0.0 - - - - - - - 194.0 2 11 RBL1 retinoblastoma-like 1 (p107) 779 100 C20140704_OR004_04 C20140704_OR004_04 TB414193.[MT7]-K[MT7]YEPIFLDIFQNPYEEPPK[MT7]LPR.4y6_1.heavy 792.189 / 851.558 2905.0 45.62852668762207 36 10 10 6 10 0.9369380994449193 70.20573236786453 0.03910064697265625 3 0.8213752018695247 2.875438418089482 2905.0 20.901183970856103 0.0 - - - - - - - 234.875 5 8 RBL1 retinoblastoma-like 1 (p107) 781 100 C20140704_OR004_04 C20140704_OR004_04 TB414193.[MT7]-K[MT7]YEPIFLDIFQNPYEEPPK[MT7]LPR.4b3_1.heavy 792.189 / 709.412 1196.0 45.62852668762207 36 10 10 6 10 0.9369380994449193 70.20573236786453 0.03910064697265625 3 0.8213752018695247 2.875438418089482 1196.0 7.903391812865497 0.0 - - - - - - - 248.45454545454547 2 11 RBL1 retinoblastoma-like 1 (p107) 783 101 C20140704_OR004_04 C20140704_OR004_04 TB427732.[MT7]-ITSILK[MT7].2y4_1.heavy 481.828 / 604.415 4251.0 32.12630081176758 24 0 10 10 4 0.8569658791866519 71.51012760041966 0.0 9 0.3371678538702695 1.4225645088268208 4251.0 21.828336944055053 0.0 - - - - - - - 285.0 8 7 DPP8 dipeptidyl-peptidase 8 785 101 C20140704_OR004_04 C20140704_OR004_04 TB427732.[MT7]-ITSILK[MT7].2y5_1.heavy 481.828 / 705.463 664.0 32.12630081176758 24 0 10 10 4 0.8569658791866519 71.51012760041966 0.0 9 0.3371678538702695 1.4225645088268208 664.0 2.5076691729323306 9.0 - - - - - - - 266.0 13 7 DPP8 dipeptidyl-peptidase 8 787 101 C20140704_OR004_04 C20140704_OR004_04 TB427732.[MT7]-ITSILK[MT7].2b4_1.heavy 481.828 / 559.357 930.0 32.12630081176758 24 0 10 10 4 0.8569658791866519 71.51012760041966 0.0 9 0.3371678538702695 1.4225645088268208 930.0 7.63781139595978 12.0 - - - - - - - 186.2 12 10 DPP8 dipeptidyl-peptidase 8 789 101 C20140704_OR004_04 C20140704_OR004_04 TB427732.[MT7]-ITSILK[MT7].2y3_1.heavy 481.828 / 517.383 30026.0 32.12630081176758 24 0 10 10 4 0.8569658791866519 71.51012760041966 0.0 9 0.3371678538702695 1.4225645088268208 30026.0 277.6840601503759 0.0 - - - - - - - 285.0 60 7 DPP8 dipeptidyl-peptidase 8 791 102 C20140704_OR004_04 C20140704_OR004_04 TB413466.[MT7]-DIRTPPLQSER.3y7_1.heavy 485.939 / 826.442 N/A 21.119399388631184 30 11 9 6 4 0.7980182747495601 76.73542076075333 0.039600372314453125 10 0.8516141274795297 3.163322385009408 3474.0 8.022707163448185 1.0 - - - - - - - 289.75 8 12 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 793 102 C20140704_OR004_04 C20140704_OR004_04 TB413466.[MT7]-DIRTPPLQSER.3y6_1.heavy 485.939 / 729.389 613.0 21.119399388631184 30 11 9 6 4 0.7980182747495601 76.73542076075333 0.039600372314453125 10 0.8516141274795297 3.163322385009408 613.0 0.0 6.0 - - - - - - - 204.16666666666666 2 6 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 795 102 C20140704_OR004_04 C20140704_OR004_04 TB413466.[MT7]-DIRTPPLQSER.3y5_1.heavy 485.939 / 632.336 1124.0 21.119399388631184 30 11 9 6 4 0.7980182747495601 76.73542076075333 0.039600372314453125 10 0.8516141274795297 3.163322385009408 1124.0 4.3333932870698195 4.0 - - - - - - - 191.375 2 8 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 797 102 C20140704_OR004_04 C20140704_OR004_04 TB413466.[MT7]-DIRTPPLQSER.3y4_1.heavy 485.939 / 519.252 2043.0 21.119399388631184 30 11 9 6 4 0.7980182747495601 76.73542076075333 0.039600372314453125 10 0.8516141274795297 3.163322385009408 2043.0 15.002486108449894 4.0 - - - - - - - 204.25 5 4 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 799 103 C20140704_OR004_04 C20140704_OR004_04 TB427738.[MT7]-EFGDSK[MT7].2y4_1.heavy 485.758 / 550.295 556.0 19.75302505493164 21 16 0 3 2 2.5865920497766166 38.660909055464 0.077301025390625 12 0.9635473473641948 6.4442091826792165 556.0 3.3043257813069133 6.0 - - - - - - - 216.33333333333334 2 9 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 801 103 C20140704_OR004_04 C20140704_OR004_04 TB427738.[MT7]-EFGDSK[MT7].2y5_1.heavy 485.758 / 697.364 1946.0 19.75302505493164 21 16 0 3 2 2.5865920497766166 38.660909055464 0.077301025390625 12 0.9635473473641948 6.4442091826792165 1946.0 5.655372570194384 0.0 - - - - - - - 240.8 3 5 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 803 103 C20140704_OR004_04 C20140704_OR004_04 TB427738.[MT7]-EFGDSK[MT7].2b4_1.heavy 485.758 / 593.269 1668.0 19.75302505493164 21 16 0 3 2 2.5865920497766166 38.660909055464 0.077301025390625 12 0.9635473473641948 6.4442091826792165 1668.0 6.069541778975741 4.0 - - - - - - - 268.7 46 10 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 805 103 C20140704_OR004_04 C20140704_OR004_04 TB427738.[MT7]-EFGDSK[MT7].2b5_1.heavy 485.758 / 680.301 185.0 19.75302505493164 21 16 0 3 2 2.5865920497766166 38.660909055464 0.077301025390625 12 0.9635473473641948 6.4442091826792165 185.0 -0.09999999999999998 15.0 - - - - - - - 0.0 0 0 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 807 104 C20140704_OR004_04 C20140704_OR004_04 TB451603.[MT7]-AFILGSQLTYHQR.3y6_1.heavy 559.978 / 817.432 11579.0 35.18109893798828 43 18 10 5 10 47.35732444725538 2.1116057794053766 0.04000091552734375 3 0.9893320967348155 11.93812147462593 11579.0 92.35460140437836 0.0 - - - - - - - 224.33333333333334 23 3 ZNF571 zinc finger protein 571 809 104 C20140704_OR004_04 C20140704_OR004_04 TB451603.[MT7]-AFILGSQLTYHQR.3b5_1.heavy 559.978 / 646.404 15888.0 35.18109893798828 43 18 10 5 10 47.35732444725538 2.1116057794053766 0.04000091552734375 3 0.9893320967348155 11.93812147462593 15888.0 40.83810708988584 0.0 - - - - - - - 615.7142857142857 31 7 ZNF571 zinc finger protein 571 811 104 C20140704_OR004_04 C20140704_OR004_04 TB451603.[MT7]-AFILGSQLTYHQR.3y4_1.heavy 559.978 / 603.3 22351.0 35.18109893798828 43 18 10 5 10 47.35732444725538 2.1116057794053766 0.04000091552734375 3 0.9893320967348155 11.93812147462593 22351.0 35.51658267112299 0.0 - - - - - - - 235.625 44 8 ZNF571 zinc finger protein 571 813 104 C20140704_OR004_04 C20140704_OR004_04 TB451603.[MT7]-AFILGSQLTYHQR.3y5_1.heavy 559.978 / 704.347 38642.0 35.18109893798828 43 18 10 5 10 47.35732444725538 2.1116057794053766 0.04000091552734375 3 0.9893320967348155 11.93812147462593 38642.0 118.9006485043409 0.0 - - - - - - - 711.7142857142857 77 7 ZNF571 zinc finger protein 571 815 105 C20140704_OR004_04 C20140704_OR004_04 TB413898.[MT7]-LAQSQC[CAM]VEQLEK[MT7].3b6_1.heavy 574.31 / 832.41 36381.0 28.541799545288086 48 18 10 10 10 4.69701963801957 21.290096211342124 0.0 3 0.9841345346535143 9.784983429668554 36381.0 24.918163489897722 0.0 - - - - - - - 274.6666666666667 72 6 C21orf7 chromosome 21 open reading frame 7 817 105 C20140704_OR004_04 C20140704_OR004_04 TB413898.[MT7]-LAQSQC[CAM]VEQLEK[MT7].3y3_1.heavy 574.31 / 533.341 87340.0 28.541799545288086 48 18 10 10 10 4.69701963801957 21.290096211342124 0.0 3 0.9841345346535143 9.784983429668554 87340.0 174.65209003561785 0.0 - - - - - - - 228.6 174 5 C21orf7 chromosome 21 open reading frame 7 819 105 C20140704_OR004_04 C20140704_OR004_04 TB413898.[MT7]-LAQSQC[CAM]VEQLEK[MT7].3b5_1.heavy 574.31 / 672.38 48043.0 28.541799545288086 48 18 10 10 10 4.69701963801957 21.290096211342124 0.0 3 0.9841345346535143 9.784983429668554 48043.0 182.8644983051048 0.0 - - - - - - - 199.42857142857142 96 7 C21orf7 chromosome 21 open reading frame 7 821 105 C20140704_OR004_04 C20140704_OR004_04 TB413898.[MT7]-LAQSQC[CAM]VEQLEK[MT7].3y5_1.heavy 574.31 / 790.443 58818.0 28.541799545288086 48 18 10 10 10 4.69701963801957 21.290096211342124 0.0 3 0.9841345346535143 9.784983429668554 58818.0 13.346095022752797 1.0 - - - - - - - 253.66666666666666 124 6 C21orf7 chromosome 21 open reading frame 7 823 106 C20140704_OR004_04 C20140704_OR004_04 TB451419.[MT7]-LRIQYQK[MT7].3y3_1.heavy 412.927 / 582.337 17183.0 25.691600799560547 47 17 10 10 10 16.293116278407048 6.137561304495694 0.0 3 0.9758351585145296 7.9230416544479505 17183.0 195.60548762376237 0.0 - - - - - - - 216.42857142857142 34 7 C21orf7 chromosome 21 open reading frame 7 825 106 C20140704_OR004_04 C20140704_OR004_04 TB451419.[MT7]-LRIQYQK[MT7].3b4_1.heavy 412.927 / 655.437 7985.0 25.691600799560547 47 17 10 10 10 16.293116278407048 6.137561304495694 0.0 3 0.9758351585145296 7.9230416544479505 7985.0 65.63248349834984 0.0 - - - - - - - 202.0 15 4 C21orf7 chromosome 21 open reading frame 7 827 106 C20140704_OR004_04 C20140704_OR004_04 TB451419.[MT7]-LRIQYQK[MT7].3b5_1.heavy 412.927 / 818.5 1415.0 25.691600799560547 47 17 10 10 10 16.293116278407048 6.137561304495694 0.0 3 0.9758351585145296 7.9230416544479505 1415.0 19.613861386138613 0.0 - - - - - - - 202.0 2 4 C21orf7 chromosome 21 open reading frame 7 829 106 C20140704_OR004_04 C20140704_OR004_04 TB451419.[MT7]-LRIQYQK[MT7].3b3_1.heavy 412.927 / 527.379 14353.0 25.691600799560547 47 17 10 10 10 16.293116278407048 6.137561304495694 0.0 3 0.9758351585145296 7.9230416544479505 14353.0 191.84702970297027 0.0 - - - - - - - 202.0 28 7 C21orf7 chromosome 21 open reading frame 7 831 107 C20140704_OR004_04 C20140704_OR004_04 TB451417.[MT7]-GALAETGAGAK[MT7].3y3_1.heavy 411.906 / 419.273 31313.0 21.096274375915527 43 17 10 6 10 3.6410855694694466 27.464336690821384 0.039699554443359375 3 0.9728057839740363 7.466807633121275 31313.0 211.72491103202847 0.0 - - - - - - - 234.5 62 8 MRPS5 mitochondrial ribosomal protein S5 833 107 C20140704_OR004_04 C20140704_OR004_04 TB451417.[MT7]-GALAETGAGAK[MT7].3b4_1.heavy 411.906 / 457.289 17625.0 21.096274375915527 43 17 10 6 10 3.6410855694694466 27.464336690821384 0.039699554443359375 3 0.9728057839740363 7.466807633121275 17625.0 175.9 0.0 - - - - - - - 234.57142857142858 35 14 MRPS5 mitochondrial ribosomal protein S5 835 107 C20140704_OR004_04 C20140704_OR004_04 TB451417.[MT7]-GALAETGAGAK[MT7].3b5_1.heavy 411.906 / 586.332 6375.0 21.096274375915527 43 17 10 6 10 3.6410855694694466 27.464336690821384 0.039699554443359375 3 0.9728057839740363 7.466807633121275 6375.0 94.87898936170212 0.0 - - - - - - - 156.5 12 6 MRPS5 mitochondrial ribosomal protein S5 837 107 C20140704_OR004_04 C20140704_OR004_04 TB451417.[MT7]-GALAETGAGAK[MT7].3y5_1.heavy 411.906 / 547.332 5344.0 21.096274375915527 43 17 10 6 10 3.6410855694694466 27.464336690821384 0.039699554443359375 3 0.9728057839740363 7.466807633121275 5344.0 72.76936170212765 1.0 - - - - - - - 257.8333333333333 10 12 MRPS5 mitochondrial ribosomal protein S5 839 108 C20140704_OR004_04 C20140704_OR004_04 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 141252.0 32.359100341796875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 141252.0 1031.6152393621132 0.0 - - - - - - - 271.6666666666667 282 3 841 108 C20140704_OR004_04 C20140704_OR004_04 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 122780.0 32.359100341796875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 122780.0 481.41928441479683 0.0 - - - - - - - 271.7142857142857 245 7 843 108 C20140704_OR004_04 C20140704_OR004_04 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 248006.0 32.359100341796875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 248006.0 311.3042556495697 0.0 - - - - - - - 226.33333333333334 496 3 845 109 C20140704_OR004_04 C20140704_OR004_04 TB413890.[MT7]-GRLQVTEHLPEK[MT7].4b7_1.heavy 424.5 / 928.533 N/A 25.4552001953125 41 15 10 6 10 1.9623509742301248 50.959283692476205 0.037799835205078125 3 0.9582462152530538 6.018546545121863 0.0 0.0 4.0 - - - - - - - 0.0 0 0 C3orf1 chromosome 3 open reading frame 1 847 109 C20140704_OR004_04 C20140704_OR004_04 TB413890.[MT7]-GRLQVTEHLPEK[MT7].4b7_2.heavy 424.5 / 464.77 31914.0 25.4552001953125 41 15 10 6 10 1.9623509742301248 50.959283692476205 0.037799835205078125 3 0.9582462152530538 6.018546545121863 31914.0 286.9986275114349 0.0 - - - - - - - 279.2 63 5 C3orf1 chromosome 3 open reading frame 1 849 109 C20140704_OR004_04 C20140704_OR004_04 TB413890.[MT7]-GRLQVTEHLPEK[MT7].4b4_1.heavy 424.5 / 599.375 2901.0 25.4552001953125 41 15 10 6 10 1.9623509742301248 50.959283692476205 0.037799835205078125 3 0.9582462152530538 6.018546545121863 2901.0 7.195902169676497 0.0 - - - - - - - 286.5 5 6 C3orf1 chromosome 3 open reading frame 1 851 109 C20140704_OR004_04 C20140704_OR004_04 TB413890.[MT7]-GRLQVTEHLPEK[MT7].4y3_1.heavy 424.5 / 517.31 38899.0 25.4552001953125 41 15 10 6 10 1.9623509742301248 50.959283692476205 0.037799835205078125 3 0.9582462152530538 6.018546545121863 38899.0 163.61965621840244 0.0 - - - - - - - 214.71428571428572 77 7 C3orf1 chromosome 3 open reading frame 1 853 110 C20140704_OR004_04 C20140704_OR004_04 TB451604.[MT7]-AFIYGSQLSEHQR.3y6_1.heavy 560.626 / 769.395 13285.0 29.6028995513916 50 20 10 10 10 10.826327358303459 9.236742682023474 0.0 3 0.9983168564026071 30.077438763523887 13285.0 33.405371660859466 0.0 - - - - - - - 295.2 26 10 ZNF571 zinc finger protein 571 855 110 C20140704_OR004_04 C20140704_OR004_04 TB451604.[MT7]-AFIYGSQLSEHQR.3b4_1.heavy 560.626 / 639.362 10579.0 29.6028995513916 50 20 10 10 10 10.826327358303459 9.236742682023474 0.0 3 0.9983168564026071 30.077438763523887 10579.0 28.38268292682927 0.0 - - - - - - - 273.3333333333333 21 9 ZNF571 zinc finger protein 571 857 110 C20140704_OR004_04 C20140704_OR004_04 TB451604.[MT7]-AFIYGSQLSEHQR.3b5_1.heavy 560.626 / 696.384 7626.0 29.6028995513916 50 20 10 10 10 10.826327358303459 9.236742682023474 0.0 3 0.9983168564026071 30.077438763523887 7626.0 25.11 0.0 - - - - - - - 287.0 15 6 ZNF571 zinc finger protein 571 859 110 C20140704_OR004_04 C20140704_OR004_04 TB451604.[MT7]-AFIYGSQLSEHQR.3y5_1.heavy 560.626 / 656.311 25093.0 29.6028995513916 50 20 10 10 10 10.826327358303459 9.236742682023474 0.0 3 0.9983168564026071 30.077438763523887 25093.0 25.222823355506282 0.0 - - - - - - - 225.5 50 6 ZNF571 zinc finger protein 571 861 111 C20140704_OR004_04 C20140704_OR004_04 TB428127.[MT7]-ILITYINAHGVK[MT7].4y4_1.heavy 408.254 / 584.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 863 111 C20140704_OR004_04 C20140704_OR004_04 TB428127.[MT7]-ILITYINAHGVK[MT7].4b7_2.heavy 408.254 / 488.303 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 865 111 C20140704_OR004_04 C20140704_OR004_04 TB428127.[MT7]-ILITYINAHGVK[MT7].4y6_1.heavy 408.254 / 769.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 867 111 C20140704_OR004_04 C20140704_OR004_04 TB428127.[MT7]-ILITYINAHGVK[MT7].4y3_1.heavy 408.254 / 447.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 869 112 C20140704_OR004_04 C20140704_OR004_04 TB428427.[MT7]-ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR.4b8_1.heavy 1067.79 / 1019.52 8399.0 51.44499969482422 43 13 10 10 10 2.6079172746274537 38.3447745727614 0.0 3 0.9209287757857684 4.359624084461631 8399.0 77.05259143997364 0.0 - - - - - - - 150.68421052631578 16 19 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 871 112 C20140704_OR004_04 C20140704_OR004_04 TB428427.[MT7]-ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR.4y10_1.heavy 1067.79 / 1213.63 1336.0 51.44499969482422 43 13 10 10 10 2.6079172746274537 38.3447745727614 0.0 3 0.9209287757857684 4.359624084461631 1336.0 9.800007322520411 0.0 - - - - - - - 155.6315789473684 2 19 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 873 112 C20140704_OR004_04 C20140704_OR004_04 TB428427.[MT7]-ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR.4b4_1.heavy 1067.79 / 529.31 2434.0 51.44499969482422 43 13 10 10 10 2.6079172746274537 38.3447745727614 0.0 3 0.9209287757857684 4.359624084461631 2434.0 28.612161566707464 0.0 - - - - - - - 160.54545454545453 4 11 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 875 112 C20140704_OR004_04 C20140704_OR004_04 TB428427.[MT7]-ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR.4b6_1.heavy 1067.79 / 791.406 2768.0 51.44499969482422 43 13 10 10 10 2.6079172746274537 38.3447745727614 0.0 3 0.9209287757857684 4.359624084461631 2768.0 27.308903180501506 0.0 - - - - - - - 119.1875 5 16 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 877 113 C20140704_OR004_04 C20140704_OR004_04 TB451532.[MT7]-VLELVSITANK[MT7].2y4_1.heavy 737.958 / 577.343 14300.0 40.10772514343262 46 20 10 6 10 8.438920126991187 11.849857386392163 0.03890228271484375 3 0.9928882131790817 14.625653639613612 14300.0 68.859375 0.0 - - - - - - - 257.8 28 10 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 879 113 C20140704_OR004_04 C20140704_OR004_04 TB451532.[MT7]-VLELVSITANK[MT7].2b4_1.heavy 737.958 / 599.388 15238.0 40.10772514343262 46 20 10 6 10 8.438920126991187 11.849857386392163 0.03890228271484375 3 0.9928882131790817 14.625653639613612 15238.0 104.29135246697747 0.0 - - - - - - - 200.71428571428572 30 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 881 113 C20140704_OR004_04 C20140704_OR004_04 TB451532.[MT7]-VLELVSITANK[MT7].2y6_1.heavy 737.958 / 777.459 13831.0 40.10772514343262 46 20 10 6 10 8.438920126991187 11.849857386392163 0.03890228271484375 3 0.9928882131790817 14.625653639613612 13831.0 51.885812467671016 0.0 - - - - - - - 234.33333333333334 27 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 883 113 C20140704_OR004_04 C20140704_OR004_04 TB451532.[MT7]-VLELVSITANK[MT7].2y7_1.heavy 737.958 / 876.527 11604.0 40.10772514343262 46 20 10 6 10 8.438920126991187 11.849857386392163 0.03890228271484375 3 0.9928882131790817 14.625653639613612 11604.0 138.85128205128206 0.0 - - - - - - - 284.57142857142856 23 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 885 114 C20140704_OR004_04 C20140704_OR004_04 TB428429.[MT7]-NEALLGELFSSPHLQMLLNPEC[CAM]DPWPLDMQPLLNK[MT7].4y5_1.heavy 1087.81 / 728.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - HAUS7 HAUS augmin-like complex, subunit 7 887 114 C20140704_OR004_04 C20140704_OR004_04 TB428429.[MT7]-NEALLGELFSSPHLQMLLNPEC[CAM]DPWPLDMQPLLNK[MT7].4y8_1.heavy 1087.81 / 1102.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - HAUS7 HAUS augmin-like complex, subunit 7 889 114 C20140704_OR004_04 C20140704_OR004_04 TB428429.[MT7]-NEALLGELFSSPHLQMLLNPEC[CAM]DPWPLDMQPLLNK[MT7].4b7_1.heavy 1087.81 / 871.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - HAUS7 HAUS augmin-like complex, subunit 7 891 114 C20140704_OR004_04 C20140704_OR004_04 TB428429.[MT7]-NEALLGELFSSPHLQMLLNPEC[CAM]DPWPLDMQPLLNK[MT7].4b4_1.heavy 1087.81 / 572.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - HAUS7 HAUS augmin-like complex, subunit 7 893 115 C20140704_OR004_04 C20140704_OR004_04 TB427858.[MT7]-GSELTLHQR.2y8_1.heavy 592.829 / 983.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 895 115 C20140704_OR004_04 C20140704_OR004_04 TB427858.[MT7]-GSELTLHQR.2y5_1.heavy 592.829 / 654.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 897 115 C20140704_OR004_04 C20140704_OR004_04 TB427858.[MT7]-GSELTLHQR.2b4_1.heavy 592.829 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 899 115 C20140704_OR004_04 C20140704_OR004_04 TB427858.[MT7]-GSELTLHQR.2y6_1.heavy 592.829 / 767.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 901 116 C20140704_OR004_04 C20140704_OR004_04 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 211760.0 26.599000930786133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 211760.0 57.71371256868318 0.0 - - - - - - - 2745.0 423 2 903 116 C20140704_OR004_04 C20140704_OR004_04 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 263968.0 26.599000930786133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 263968.0 48.24991816319226 0.0 - - - - - - - 2440.0 527 1 905 116 C20140704_OR004_04 C20140704_OR004_04 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 318860.0 26.599000930786133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 318860.0 54.90228986092241 0.0 - - - - - - - 3172.0 637 1 907 117 C20140704_OR004_04 C20140704_OR004_04 TB413497.[MT7]-QFTVAGK[MT7].2y4_1.heavy 519.813 / 518.342 3362.0 24.89330005645752 43 17 10 6 10 4.1436956918840036 24.13304630353617 0.036800384521484375 3 0.9712646705791994 7.262878699778799 3362.0 10.406190476190476 0.0 - - - - - - - 267.27272727272725 6 11 C7orf43 chromosome 7 open reading frame 43 909 117 C20140704_OR004_04 C20140704_OR004_04 TB413497.[MT7]-QFTVAGK[MT7].2y5_1.heavy 519.813 / 619.39 3677.0 24.89330005645752 43 17 10 6 10 4.1436956918840036 24.13304630353617 0.036800384521484375 3 0.9712646705791994 7.262878699778799 3677.0 19.08538095238095 0.0 - - - - - - - 236.25 7 8 C7orf43 chromosome 7 open reading frame 43 911 117 C20140704_OR004_04 C20140704_OR004_04 TB413497.[MT7]-QFTVAGK[MT7].2y6_1.heavy 519.813 / 766.458 5778.0 24.89330005645752 43 17 10 6 10 4.1436956918840036 24.13304630353617 0.036800384521484375 3 0.9712646705791994 7.262878699778799 5778.0 92.44800000000001 0.0 - - - - - - - 157.5 11 6 C7orf43 chromosome 7 open reading frame 43 913 117 C20140704_OR004_04 C20140704_OR004_04 TB413497.[MT7]-QFTVAGK[MT7].2b5_1.heavy 519.813 / 691.39 1681.0 24.89330005645752 43 17 10 6 10 4.1436956918840036 24.13304630353617 0.036800384521484375 3 0.9712646705791994 7.262878699778799 1681.0 9.605714285714285 0.0 - - - - - - - 240.0 3 7 C7orf43 chromosome 7 open reading frame 43 915 118 C20140704_OR004_04 C20140704_OR004_04 TB428225.[MT7]-GFFDRSEDNLNFK[MT7].4b8_2.heavy 469.991 / 549.752 3783.0 35.15132427215576 37 13 10 6 8 2.2157109300836684 35.50927579948234 0.039096832275390625 4 0.9298496350802827 4.632071754880559 3783.0 7.4163248051498005 0.0 - - - - - - - 260.5 7 2 FAM198B family with sequence similarity 198, member B 917 118 C20140704_OR004_04 C20140704_OR004_04 TB428225.[MT7]-GFFDRSEDNLNFK[MT7].4b4_1.heavy 469.991 / 611.295 783.0 35.15132427215576 37 13 10 6 8 2.2157109300836684 35.50927579948234 0.039096832275390625 4 0.9298496350802827 4.632071754880559 783.0 10.239230769230769 0.0 - - - - - - - 0.0 1 0 FAM198B family with sequence similarity 198, member B 919 118 C20140704_OR004_04 C20140704_OR004_04 TB428225.[MT7]-GFFDRSEDNLNFK[MT7].4y3_1.heavy 469.991 / 552.326 1305.0 35.15132427215576 37 13 10 6 8 2.2157109300836684 35.50927579948234 0.039096832275390625 4 0.9298496350802827 4.632071754880559 1305.0 1.8006134969325154 2.0 - - - - - - - 234.8 2 5 FAM198B family with sequence similarity 198, member B 921 118 C20140704_OR004_04 C20140704_OR004_04 TB428225.[MT7]-GFFDRSEDNLNFK[MT7].4b9_2.heavy 469.991 / 606.774 6784.0 35.15132427215576 37 13 10 6 8 2.2157109300836684 35.50927579948234 0.039096832275390625 4 0.9298496350802827 4.632071754880559 6784.0 78.17695254936635 0.0 - - - - - - - 195.5 13 4 FAM198B family with sequence similarity 198, member B 923 119 C20140704_OR004_04 C20140704_OR004_04 TB428420.[MT7]-TISASTQVQGGDFNLYENMRC[CAM]HGVPLVTISR.4b4_1.heavy 899.453 / 517.31 878.0 39.80930042266846 30 13 6 5 6 1.473672429860758 53.87392832152936 0.040401458740234375 6 0.9023627438172167 3.9170215948496456 878.0 5.823356233778852 6.0 - - - - - - - 236.15384615384616 7 13 DPYSL5 dihydropyrimidinase-like 5 925 119 C20140704_OR004_04 C20140704_OR004_04 TB428420.[MT7]-TISASTQVQGGDFNLYENMRC[CAM]HGVPLVTISR.4y7_1.heavy 899.453 / 785.488 2195.0 39.80930042266846 30 13 6 5 6 1.473672429860758 53.87392832152936 0.040401458740234375 6 0.9023627438172167 3.9170215948496456 2195.0 16.377580116861665 0.0 - - - - - - - 209.36363636363637 4 11 DPYSL5 dihydropyrimidinase-like 5 927 119 C20140704_OR004_04 C20140704_OR004_04 TB428420.[MT7]-TISASTQVQGGDFNLYENMRC[CAM]HGVPLVTISR.4y6_1.heavy 899.453 / 688.435 329.0 39.80930042266846 30 13 6 5 6 1.473672429860758 53.87392832152936 0.040401458740234375 6 0.9023627438172167 3.9170215948496456 329.0 2.794246575342466 14.0 - - - - - - - 0.0 1 0 DPYSL5 dihydropyrimidinase-like 5 929 119 C20140704_OR004_04 C20140704_OR004_04 TB428420.[MT7]-TISASTQVQGGDFNLYENMRC[CAM]HGVPLVTISR.4y19_2.heavy 899.453 / 1153.58 1646.0 39.80930042266846 30 13 6 5 6 1.473672429860758 53.87392832152936 0.040401458740234375 6 0.9023627438172167 3.9170215948496456 1646.0 3.015243319402228 1.0 - - - - - - - 205.625 3 8 DPYSL5 dihydropyrimidinase-like 5 931 120 C20140704_OR004_04 C20140704_OR004_04 TB413710.[MT7]-VDILEMLQK[MT7].2y5_1.heavy 688.907 / 792.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 933 120 C20140704_OR004_04 C20140704_OR004_04 TB413710.[MT7]-VDILEMLQK[MT7].2b4_1.heavy 688.907 / 585.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 935 120 C20140704_OR004_04 C20140704_OR004_04 TB413710.[MT7]-VDILEMLQK[MT7].2b6_1.heavy 688.907 / 845.456 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 937 120 C20140704_OR004_04 C20140704_OR004_04 TB413710.[MT7]-VDILEMLQK[MT7].2b5_1.heavy 688.907 / 714.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 939 121 C20140704_OR004_04 C20140704_OR004_04 TB414052.[MT7]-AALVGGTTMIIGHVLPDK[MT7].3y3_1.heavy 694.406 / 503.295 33704.0 40.41547393798828 46 20 10 6 10 9.506230478896452 10.519416736423235 0.038299560546875 3 0.9931105400565475 14.860045070849193 33704.0 76.07532628332231 0.0 - - - - - - - 291.54545454545456 67 11 DPYSL5 dihydropyrimidinase-like 5 941 121 C20140704_OR004_04 C20140704_OR004_04 TB414052.[MT7]-AALVGGTTMIIGHVLPDK[MT7].3y4_1.heavy 694.406 / 616.379 11850.0 40.41547393798828 46 20 10 6 10 9.506230478896452 10.519416736423235 0.038299560546875 3 0.9931105400565475 14.860045070849193 11850.0 37.864757614757615 0.0 - - - - - - - 740.625 23 8 DPYSL5 dihydropyrimidinase-like 5 943 121 C20140704_OR004_04 C20140704_OR004_04 TB414052.[MT7]-AALVGGTTMIIGHVLPDK[MT7].3b8_1.heavy 694.406 / 815.474 3788.0 40.41547393798828 46 20 10 6 10 9.506230478896452 10.519416736423235 0.038299560546875 3 0.9931105400565475 14.860045070849193 3788.0 23.172498483929658 0.0 - - - - - - - 312.8888888888889 7 9 DPYSL5 dihydropyrimidinase-like 5 945 121 C20140704_OR004_04 C20140704_OR004_04 TB414052.[MT7]-AALVGGTTMIIGHVLPDK[MT7].3y5_1.heavy 694.406 / 715.447 6702.0 40.41547393798828 46 20 10 6 10 9.506230478896452 10.519416736423235 0.038299560546875 3 0.9931105400565475 14.860045070849193 6702.0 97.07536082474226 0.0 - - - - - - - 291.3636363636364 13 11 DPYSL5 dihydropyrimidinase-like 5 947 122 C20140704_OR004_04 C20140704_OR004_04 TB413998.[MT7]-QPLDMSEVFAFHLDR.3y7_1.heavy 650.328 / 905.463 9905.0 43.60499954223633 50 20 10 10 10 63.18524529652413 1.5826479667952018 0.0 3 0.9996618704407518 67.11329515220422 9905.0 132.95133973710819 0.0 - - - - - - - 249.7 19 10 FAM198B family with sequence similarity 198, member B 949 122 C20140704_OR004_04 C20140704_OR004_04 TB413998.[MT7]-QPLDMSEVFAFHLDR.3y6_1.heavy 650.328 / 758.394 7580.0 43.60499954223633 50 20 10 10 10 63.18524529652413 1.5826479667952018 0.0 3 0.9996618704407518 67.11329515220422 7580.0 62.080889787664304 0.0 - - - - - - - 185.46153846153845 15 13 FAM198B family with sequence similarity 198, member B 951 122 C20140704_OR004_04 C20140704_OR004_04 TB413998.[MT7]-QPLDMSEVFAFHLDR.3y5_1.heavy 650.328 / 687.357 5857.0 43.60499954223633 50 20 10 10 10 63.18524529652413 1.5826479667952018 0.0 3 0.9996618704407518 67.11329515220422 5857.0 34.612180063874774 0.0 - - - - - - - 135.14285714285714 11 14 FAM198B family with sequence similarity 198, member B 953 122 C20140704_OR004_04 C20140704_OR004_04 TB413998.[MT7]-QPLDMSEVFAFHLDR.3b7_1.heavy 650.328 / 945.447 6977.0 43.60499954223633 50 20 10 10 10 63.18524529652413 1.5826479667952018 0.0 3 0.9996618704407518 67.11329515220422 6977.0 44.227642736771145 0.0 - - - - - - - 198.69230769230768 13 13 FAM198B family with sequence similarity 198, member B 955 123 C20140704_OR004_04 C20140704_OR004_04 TB428027.[MT7]-K[MT7]IEALLNLPR.3y7_1.heavy 485.648 / 796.504 604.0 37.451148986816406 40 17 10 5 8 5.633325671474059 17.75150343364282 0.0410003662109375 4 0.9737041800287896 7.5938621976023315 604.0 4.160009119407238 4.0 - - - - - - - 0.0 1 0 C3orf1 chromosome 3 open reading frame 1 957 123 C20140704_OR004_04 C20140704_OR004_04 TB428027.[MT7]-K[MT7]IEALLNLPR.3y5_1.heavy 485.648 / 612.383 2658.0 37.451148986816406 40 17 10 5 8 5.633325671474059 17.75150343364282 0.0410003662109375 4 0.9737041800287896 7.5938621976023315 2658.0 8.983833252309188 0.0 - - - - - - - 328.14285714285717 5 7 C3orf1 chromosome 3 open reading frame 1 959 123 C20140704_OR004_04 C20140704_OR004_04 TB428027.[MT7]-K[MT7]IEALLNLPR.3b4_1.heavy 485.648 / 730.47 1088.0 37.451148986816406 40 17 10 5 8 5.633325671474059 17.75150343364282 0.0410003662109375 4 0.9737041800287896 7.5938621976023315 1088.0 0.5001379310344827 1.0 - - - - - - - 362.6666666666667 2 6 C3orf1 chromosome 3 open reading frame 1 961 123 C20140704_OR004_04 C20140704_OR004_04 TB428027.[MT7]-K[MT7]IEALLNLPR.3y4_1.heavy 485.648 / 499.299 3142.0 37.451148986816406 40 17 10 5 8 5.633325671474059 17.75150343364282 0.0410003662109375 4 0.9737041800287896 7.5938621976023315 3142.0 13.416850384724993 0.0 - - - - - - - 201.66666666666666 6 3 C3orf1 chromosome 3 open reading frame 1 963 124 C20140704_OR004_04 C20140704_OR004_04 TB414135.[MT7]-QQGEQIC[CAM]WGGSSSVMSLATK[MT7].3b6_1.heavy 814.738 / 828.433 4571.0 38.132999420166016 38 16 4 10 8 7.906117519034918 12.648433287165048 0.0 4 0.9636759356186528 6.455675564389176 4571.0 11.959766883930278 0.0 - - - - - - - 208.33333333333334 9 9 HAUS7 HAUS augmin-like complex, subunit 7 965 124 C20140704_OR004_04 C20140704_OR004_04 TB414135.[MT7]-QQGEQIC[CAM]WGGSSSVMSLATK[MT7].3b4_1.heavy 814.738 / 587.291 2344.0 38.132999420166016 38 16 4 10 8 7.906117519034918 12.648433287165048 0.0 4 0.9636759356186528 6.455675564389176 2344.0 7.8397879733191305 1.0 - - - - - - - 246.0 5 10 HAUS7 HAUS augmin-like complex, subunit 7 967 124 C20140704_OR004_04 C20140704_OR004_04 TB414135.[MT7]-QQGEQIC[CAM]WGGSSSVMSLATK[MT7].3b5_1.heavy 814.738 / 715.349 7032.0 38.132999420166016 38 16 4 10 8 7.906117519034918 12.648433287165048 0.0 4 0.9636759356186528 6.455675564389176 7032.0 8.527990245884983 1.0 - - - - - - - 736.5714285714286 24 7 HAUS7 HAUS augmin-like complex, subunit 7 969 124 C20140704_OR004_04 C20140704_OR004_04 TB414135.[MT7]-QQGEQIC[CAM]WGGSSSVMSLATK[MT7].3b7_1.heavy 814.738 / 988.464 4805.0 38.132999420166016 38 16 4 10 8 7.906117519034918 12.648433287165048 0.0 4 0.9636759356186528 6.455675564389176 4805.0 19.260980810234543 0.0 - - - - - - - 287.54545454545456 9 11 HAUS7 HAUS augmin-like complex, subunit 7 971 125 C20140704_OR004_04 C20140704_OR004_04 TB428022.[MT7]-K[MT7]PSYIQHQR.3y7_1.heavy 482.28 / 931.474 501.0 17.22806676228841 42 17 10 5 10 5.309179212134547 18.835303161634126 0.040599822998046875 3 0.97820696882851 8.344717972304856 501.0 10.461829836829835 0.0 - - - - - - - 0.0 1 0 ZNF571 zinc finger protein 571 973 125 C20140704_OR004_04 C20140704_OR004_04 TB428022.[MT7]-K[MT7]PSYIQHQR.3y4_1.heavy 482.28 / 568.295 2361.0 17.22806676228841 42 17 10 5 10 5.309179212134547 18.835303161634126 0.040599822998046875 3 0.97820696882851 8.344717972304856 2361.0 37.85531007751938 0.0 - - - - - - - 184.14285714285714 4 7 ZNF571 zinc finger protein 571 975 125 C20140704_OR004_04 C20140704_OR004_04 TB428022.[MT7]-K[MT7]PSYIQHQR.3y8_1.heavy 482.28 / 1028.53 N/A 17.22806676228841 42 17 10 5 10 5.309179212134547 18.835303161634126 0.040599822998046875 3 0.97820696882851 8.344717972304856 0.0 0.0 3.0 - - - - - - - 0.0 0 0 ZNF571 zinc finger protein 571 977 125 C20140704_OR004_04 C20140704_OR004_04 TB428022.[MT7]-K[MT7]PSYIQHQR.3y5_1.heavy 482.28 / 681.379 787.0 17.22806676228841 42 17 10 5 10 5.309179212134547 18.835303161634126 0.040599822998046875 3 0.97820696882851 8.344717972304856 787.0 14.591020671834626 0.0 - - - - - - - 0.0 1 0 ZNF571 zinc finger protein 571 979 126 C20140704_OR004_04 C20140704_OR004_04 TB427994.[MT7]-ETC[CAM]VDLHLPR.3y6_1.heavy 461.911 / 750.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 981 126 C20140704_OR004_04 C20140704_OR004_04 TB427994.[MT7]-ETC[CAM]VDLHLPR.3b5_1.heavy 461.911 / 749.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 983 126 C20140704_OR004_04 C20140704_OR004_04 TB427994.[MT7]-ETC[CAM]VDLHLPR.3b3_1.heavy 461.911 / 535.23 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 985 126 C20140704_OR004_04 C20140704_OR004_04 TB427994.[MT7]-ETC[CAM]VDLHLPR.3y4_1.heavy 461.911 / 522.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 987 127 C20140704_OR004_04 C20140704_OR004_04 TB428020.[MT7]-EFPASAVSVLK[MT7].3b6_1.heavy 479.285 / 747.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 989 127 C20140704_OR004_04 C20140704_OR004_04 TB428020.[MT7]-EFPASAVSVLK[MT7].3b4_1.heavy 479.285 / 589.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 991 127 C20140704_OR004_04 C20140704_OR004_04 TB428020.[MT7]-EFPASAVSVLK[MT7].3b5_1.heavy 479.285 / 676.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 993 127 C20140704_OR004_04 C20140704_OR004_04 TB428020.[MT7]-EFPASAVSVLK[MT7].3y4_1.heavy 479.285 / 590.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 995 128 C20140704_OR004_04 C20140704_OR004_04 TB427993.[MT7]-EFEALTEENR.2b3_1.heavy 691.339 / 550.263 16539.0 31.00790023803711 48 18 10 10 10 8.1388335391295 12.28677297787511 0.0 3 0.9814538275765748 9.048190193648406 16539.0 75.16690344827586 0.0 - - - - - - - 269.2857142857143 33 7 C21orf7 chromosome 21 open reading frame 7 997 128 C20140704_OR004_04 C20140704_OR004_04 TB427993.[MT7]-EFEALTEENR.2b4_1.heavy 691.339 / 621.3 17990.0 31.00790023803711 48 18 10 10 10 8.1388335391295 12.28677297787511 0.0 3 0.9814538275765748 9.048190193648406 17990.0 175.55758620689653 0.0 - - - - - - - 246.5 35 10 C21orf7 chromosome 21 open reading frame 7 999 128 C20140704_OR004_04 C20140704_OR004_04 TB427993.[MT7]-EFEALTEENR.2y9_1.heavy 691.339 / 1108.53 21617.0 31.00790023803711 48 18 10 10 10 8.1388335391295 12.28677297787511 0.0 3 0.9814538275765748 9.048190193648406 21617.0 90.44354022988506 0.0 - - - - - - - 235.625 43 8 C21orf7 chromosome 21 open reading frame 7 1001 128 C20140704_OR004_04 C20140704_OR004_04 TB427993.[MT7]-EFEALTEENR.2y7_1.heavy 691.339 / 832.416 9720.0 31.00790023803711 48 18 10 10 10 8.1388335391295 12.28677297787511 0.0 3 0.9814538275765748 9.048190193648406 9720.0 10.419606708482737 1.0 - - - - - - - 181.25 20 4 C21orf7 chromosome 21 open reading frame 7 1003 129 C20140704_OR004_04 C20140704_OR004_04 TB451627.[MT7]-IILVEDLPNQFYR.2y8_1.heavy 882.494 / 1052.52 4419.0 44.65769958496094 44 14 10 10 10 3.2881283724443646 30.412437920013723 0.0 3 0.9475537398049648 5.365231859503084 4419.0 19.574035722175402 0.0 - - - - - - - 206.14285714285714 8 14 RAD17 RAD17 homolog (S. pombe) 1005 129 C20140704_OR004_04 C20140704_OR004_04 TB451627.[MT7]-IILVEDLPNQFYR.2y9_1.heavy 882.494 / 1181.56 6402.0 44.65769958496094 44 14 10 10 10 3.2881283724443646 30.412437920013723 0.0 3 0.9475537398049648 5.365231859503084 6402.0 16.328326044813128 0.0 - - - - - - - 205.44444444444446 12 18 RAD17 RAD17 homolog (S. pombe) 1007 129 C20140704_OR004_04 C20140704_OR004_04 TB451627.[MT7]-IILVEDLPNQFYR.2y6_1.heavy 882.494 / 824.405 5411.0 44.65769958496094 44 14 10 10 10 3.2881283724443646 30.412437920013723 0.0 3 0.9475537398049648 5.365231859503084 5411.0 56.51488888888889 0.0 - - - - - - - 172.0909090909091 10 11 RAD17 RAD17 homolog (S. pombe) 1009 129 C20140704_OR004_04 C20140704_OR004_04 TB451627.[MT7]-IILVEDLPNQFYR.2y7_1.heavy 882.494 / 937.489 7485.0 44.65769958496094 44 14 10 10 10 3.2881283724443646 30.412437920013723 0.0 3 0.9475537398049648 5.365231859503084 7485.0 40.06802036164406 0.0 - - - - - - - 237.9090909090909 14 11 RAD17 RAD17 homolog (S. pombe) 1011 130 C20140704_OR004_04 C20140704_OR004_04 TB428416.[MT7]-AALVGGTTMIIGHVLPDK[MT7]ETSLVDAYEK[MT7].4y4_1.heavy 840.967 / 654.358 1424.0 41.81607532501221 34 8 10 6 10 0.846192690095704 73.94960420987522 0.035099029541015625 3 0.7748492804359395 2.550458904948261 1424.0 17.787508771929826 0.0 - - - - - - - 261.25 2 8 DPYSL5 dihydropyrimidinase-like 5 1013 130 C20140704_OR004_04 C20140704_OR004_04 TB428416.[MT7]-AALVGGTTMIIGHVLPDK[MT7]ETSLVDAYEK[MT7].4b8_1.heavy 840.967 / 815.474 380.0 41.81607532501221 34 8 10 6 10 0.846192690095704 73.94960420987522 0.035099029541015625 3 0.7748492804359395 2.550458904948261 380.0 0.32000000000000006 19.0 - - - - - - - 0.0 1 0 DPYSL5 dihydropyrimidinase-like 5 1015 130 C20140704_OR004_04 C20140704_OR004_04 TB428416.[MT7]-AALVGGTTMIIGHVLPDK[MT7]ETSLVDAYEK[MT7].4y13_2.heavy 840.967 / 891.972 1709.0 41.81607532501221 34 8 10 6 10 0.846192690095704 73.94960420987522 0.035099029541015625 3 0.7748492804359395 2.550458904948261 1709.0 3.5978947368421053 0.0 - - - - - - - 199.5 3 10 DPYSL5 dihydropyrimidinase-like 5 1017 130 C20140704_OR004_04 C20140704_OR004_04 TB428416.[MT7]-AALVGGTTMIIGHVLPDK[MT7]ETSLVDAYEK[MT7].4b9_1.heavy 840.967 / 946.515 475.0 41.81607532501221 34 8 10 6 10 0.846192690095704 73.94960420987522 0.035099029541015625 3 0.7748492804359395 2.550458904948261 475.0 0.04285714285714287 11.0 - - - - - - - 0.0 1 0 DPYSL5 dihydropyrimidinase-like 5 1019 131 C20140704_OR004_04 C20140704_OR004_04 TB428319.[MT7]-RLPYVPEPYYPESGWDR.4y5_1.heavy 567.786 / 620.279 11504.0 37.87889862060547 41 11 10 10 10 0.834956514569904 73.23576000675067 0.0 3 0.8638770932313686 3.3063021389401968 11504.0 27.897894163141366 0.0 - - - - - - - 242.0 23 10 C3orf1 chromosome 3 open reading frame 1 1021 131 C20140704_OR004_04 C20140704_OR004_04 TB428319.[MT7]-RLPYVPEPYYPESGWDR.4b4_1.heavy 567.786 / 674.411 3269.0 37.87889862060547 41 11 10 10 10 0.834956514569904 73.23576000675067 0.0 3 0.8638770932313686 3.3063021389401968 3269.0 3.951914480445975 0.0 - - - - - - - 229.9 6 10 C3orf1 chromosome 3 open reading frame 1 1023 131 C20140704_OR004_04 C20140704_OR004_04 TB428319.[MT7]-RLPYVPEPYYPESGWDR.4b5_1.heavy 567.786 / 773.479 5812.0 37.87889862060547 41 11 10 10 10 0.834956514569904 73.23576000675067 0.0 3 0.8638770932313686 3.3063021389401968 5812.0 53.15658402203857 0.0 - - - - - - - 211.75 11 8 C3orf1 chromosome 3 open reading frame 1 1025 131 C20140704_OR004_04 C20140704_OR004_04 TB428319.[MT7]-RLPYVPEPYYPESGWDR.4y7_1.heavy 567.786 / 846.374 12593.0 37.87889862060547 41 11 10 10 10 0.834956514569904 73.23576000675067 0.0 3 0.8638770932313686 3.3063021389401968 12593.0 138.6617658402204 0.0 - - - - - - - 242.0 25 5 C3orf1 chromosome 3 open reading frame 1 1027 132 C20140704_OR004_04 C20140704_OR004_04 TB413487.[MT7]-VDAAELVR.2y6_1.heavy 508.796 / 658.388 61759.0 29.76053301493327 45 20 10 5 10 4.569045745535142 21.886408140631925 0.0475006103515625 3 0.9921771397836774 13.944278852411038 61759.0 158.13918560413293 0.0 - - - - - - - 754.0 123 7 C21orf7 chromosome 21 open reading frame 7 1029 132 C20140704_OR004_04 C20140704_OR004_04 TB413487.[MT7]-VDAAELVR.2b5_1.heavy 508.796 / 630.321 44501.0 29.76053301493327 45 20 10 5 10 4.569045745535142 21.886408140631925 0.0475006103515625 3 0.9921771397836774 13.944278852411038 44501.0 80.59393529380924 0.0 - - - - - - - 285.2 89 5 C21orf7 chromosome 21 open reading frame 7 1031 132 C20140704_OR004_04 C20140704_OR004_04 TB413487.[MT7]-VDAAELVR.2b4_1.heavy 508.796 / 501.279 17258.0 29.76053301493327 45 20 10 5 10 4.569045745535142 21.886408140631925 0.0475006103515625 3 0.9921771397836774 13.944278852411038 17258.0 52.28904017213471 0.0 - - - - - - - 320.75 34 4 C21orf7 chromosome 21 open reading frame 7 1033 132 C20140704_OR004_04 C20140704_OR004_04 TB413487.[MT7]-VDAAELVR.2y7_1.heavy 508.796 / 773.415 N/A 29.76053301493327 45 20 10 5 10 4.569045745535142 21.886408140631925 0.0475006103515625 3 0.9921771397836774 13.944278852411038 249605.0 25.924160085166022 1.0 - - - - - - - 332.6666666666667 509 3 C21orf7 chromosome 21 open reading frame 7 1035 133 C20140704_OR004_04 C20140704_OR004_04 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 234794.0 37.669498443603516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 234794.0 112.18624418458442 0.0 - - - - - - - 276.8 469 5 1037 133 C20140704_OR004_04 C20140704_OR004_04 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 553891.0 37.669498443603516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 553891.0 139.8164791400815 0.0 - - - - - - - 403.5 1107 2 1039 133 C20140704_OR004_04 C20140704_OR004_04 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 595888.0 37.669498443603516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 595888.0 127.35256752552772 0.0 - - - - - - - 374.5 1191 4 1041 134 C20140704_OR004_04 C20140704_OR004_04 TB413705.[MT7]-LSLIQFFSK[MT7].2y4_1.heavy 685.918 / 672.384 2584.0 47.90340042114258 39 14 10 5 10 5.607415712034046 17.83352708902793 0.04199981689453125 3 0.9456713384144141 5.270620711164554 2584.0 50.489999999999995 0.0 - - - - - - - 177.33333333333334 5 3 RBL1 retinoblastoma-like 1 (p107) 1043 134 C20140704_OR004_04 C20140704_OR004_04 TB413705.[MT7]-LSLIQFFSK[MT7].2y8_1.heavy 685.918 / 1113.64 3421.0 47.90340042114258 39 14 10 5 10 5.607415712034046 17.83352708902793 0.04199981689453125 3 0.9456713384144141 5.270620711164554 3421.0 34.885197368421046 0.0 - - - - - - - 114.0 6 10 RBL1 retinoblastoma-like 1 (p107) 1045 134 C20140704_OR004_04 C20140704_OR004_04 TB413705.[MT7]-LSLIQFFSK[MT7].2y5_1.heavy 685.918 / 800.442 3421.0 47.90340042114258 39 14 10 5 10 5.607415712034046 17.83352708902793 0.04199981689453125 3 0.9456713384144141 5.270620711164554 3421.0 11.398716599190285 0.0 - - - - - - - 177.33333333333334 6 6 RBL1 retinoblastoma-like 1 (p107) 1047 134 C20140704_OR004_04 C20140704_OR004_04 TB413705.[MT7]-LSLIQFFSK[MT7].2y3_1.heavy 685.918 / 525.315 4105.0 47.90340042114258 39 14 10 5 10 5.607415712034046 17.83352708902793 0.04199981689453125 3 0.9456713384144141 5.270620711164554 4105.0 21.470230263157895 0.0 - - - - - - - 244.28571428571428 8 14 RBL1 retinoblastoma-like 1 (p107) 1049 135 C20140704_OR004_04 C20140704_OR004_04 TB413986.[MT7]-VYWESQGGRQGIEK[MT7].3y10_2.heavy 642.342 / 602.332 3142.0 28.39349937438965 44 14 10 10 10 4.044885798407477 24.72257684985106 0.0 3 0.9402343184844401 5.02283996756855 3142.0 6.986660039761431 1.0 - - - - - - - 220.0 6 4 FAM198B family with sequence similarity 198, member B 1051 135 C20140704_OR004_04 C20140704_OR004_04 TB413986.[MT7]-VYWESQGGRQGIEK[MT7].3y4_1.heavy 642.342 / 590.363 880.0 28.39349937438965 44 14 10 10 10 4.044885798407477 24.72257684985106 0.0 3 0.9402343184844401 5.02283996756855 880.0 4.688888888888888 10.0 - - - - - - - 151.0 4 5 FAM198B family with sequence similarity 198, member B 1053 135 C20140704_OR004_04 C20140704_OR004_04 TB413986.[MT7]-VYWESQGGRQGIEK[MT7].3y12_2.heavy 642.342 / 759.893 6787.0 28.39349937438965 44 14 10 10 10 4.044885798407477 24.72257684985106 0.0 3 0.9402343184844401 5.02283996756855 6787.0 79.80057857459053 0.0 - - - - - - - 201.2 13 5 FAM198B family with sequence similarity 198, member B 1055 135 C20140704_OR004_04 C20140704_OR004_04 TB413986.[MT7]-VYWESQGGRQGIEK[MT7].3y13_2.heavy 642.342 / 841.424 6913.0 28.39349937438965 44 14 10 10 10 4.044885798407477 24.72257684985106 0.0 3 0.9402343184844401 5.02283996756855 6913.0 75.81217321191424 0.0 - - - - - - - 272.3333333333333 13 6 FAM198B family with sequence similarity 198, member B 1057 136 C20140704_OR004_04 C20140704_OR004_04 TB428219.[MT7]-AQVSTLLTLLPPPVLR.2y9_1.heavy 931.583 / 1005.65 3185.0 50.13460159301758 44 14 10 10 10 3.021845041845831 33.09236529842612 0.0 3 0.9421944156962283 5.1081411249004445 3185.0 0.03901382848371418 5.0 - - - - - - - 339.3333333333333 8 6 C7orf43 chromosome 7 open reading frame 43 1059 136 C20140704_OR004_04 C20140704_OR004_04 TB428219.[MT7]-AQVSTLLTLLPPPVLR.2y6_1.heavy 931.583 / 678.43 15394.0 50.13460159301758 44 14 10 10 10 3.021845041845831 33.09236529842612 0.0 3 0.9421944156962283 5.1081411249004445 15394.0 109.57881354588494 1.0 - - - - - - - 1327.0 30 1 C7orf43 chromosome 7 open reading frame 43 1061 136 C20140704_OR004_04 C20140704_OR004_04 TB428219.[MT7]-AQVSTLLTLLPPPVLR.2y10_1.heavy 931.583 / 1118.73 3141.0 50.13460159301758 44 14 10 10 10 3.021845041845831 33.09236529842612 0.0 3 0.9421944156962283 5.1081411249004445 3141.0 0.6164983785050294 1.0 - - - - - - - 766.8888888888889 6 9 C7orf43 chromosome 7 open reading frame 43 1063 136 C20140704_OR004_04 C20140704_OR004_04 TB428219.[MT7]-AQVSTLLTLLPPPVLR.2y7_1.heavy 931.583 / 791.514 2654.0 50.13460159301758 44 14 10 10 10 3.021845041845831 33.09236529842612 0.0 3 0.9421944156962283 5.1081411249004445 2654.0 5.783407634467653 2.0 - - - - - - - 1205.25 5 8 C7orf43 chromosome 7 open reading frame 43 1065 137 C20140704_OR004_04 C20140704_OR004_04 TB451623.[MT7]-GVNSFQMFMTYK[MT7].3y3_1.heavy 580.961 / 555.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 1067 137 C20140704_OR004_04 C20140704_OR004_04 TB451623.[MT7]-GVNSFQMFMTYK[MT7].3b6_1.heavy 580.961 / 777.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 1069 137 C20140704_OR004_04 C20140704_OR004_04 TB451623.[MT7]-GVNSFQMFMTYK[MT7].3b4_1.heavy 580.961 / 502.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 1071 137 C20140704_OR004_04 C20140704_OR004_04 TB451623.[MT7]-GVNSFQMFMTYK[MT7].3y4_1.heavy 580.961 / 686.366 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 1073 138 C20140704_OR004_04 C20140704_OR004_04 TB428110.[MT7]-QIVIQNENTMPR.3y7_1.heavy 529.62 / 861.388 6299.0 28.41819953918457 43 18 10 5 10 6.662062641978521 15.010366214494447 0.04940032958984375 3 0.9820803165885789 9.205481875184482 6299.0 94.2408527131783 0.0 - - - - - - - 129.0 12 3 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1075 138 C20140704_OR004_04 C20140704_OR004_04 TB428110.[MT7]-QIVIQNENTMPR.3b4_1.heavy 529.62 / 598.404 19025.0 28.41819953918457 43 18 10 5 10 6.662062641978521 15.010366214494447 0.04940032958984375 3 0.9820803165885789 9.205481875184482 19025.0 76.21329241170356 0.0 - - - - - - - 193.16666666666666 38 6 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1077 138 C20140704_OR004_04 C20140704_OR004_04 TB428110.[MT7]-QIVIQNENTMPR.3y4_1.heavy 529.62 / 504.26 12598.0 28.41819953918457 43 18 10 5 10 6.662062641978521 15.010366214494447 0.04940032958984375 3 0.9820803165885789 9.205481875184482 12598.0 46.530384468055075 0.0 - - - - - - - 285.77777777777777 25 9 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1079 138 C20140704_OR004_04 C20140704_OR004_04 TB428110.[MT7]-QIVIQNENTMPR.3y5_1.heavy 529.62 / 618.303 21724.0 28.41819953918457 43 18 10 5 10 6.662062641978521 15.010366214494447 0.04940032958984375 3 0.9820803165885789 9.205481875184482 21724.0 86.12383774244756 0.0 - - - - - - - 275.57142857142856 43 7 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1081 139 C20140704_OR004_04 C20140704_OR004_04 TB413981.[MT7]-TYQFLQEYLDAIK[MT7].2b3_1.heavy 960.521 / 537.279 6192.0 47.97010040283203 43 13 10 10 10 0.9882841697463004 64.92338101058924 0.0 3 0.9020620887195591 3.9109029820175625 6192.0 19.322547770700638 1.0 - - - - - - - 224.0 12 7 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1083 139 C20140704_OR004_04 C20140704_OR004_04 TB413981.[MT7]-TYQFLQEYLDAIK[MT7].2y9_1.heavy 960.521 / 1236.7 3449.0 47.97010040283203 43 13 10 10 10 0.9882841697463004 64.92338101058924 0.0 3 0.9020620887195591 3.9109029820175625 3449.0 22.85360392564669 0.0 - - - - - - - 241.23076923076923 6 13 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1085 139 C20140704_OR004_04 C20140704_OR004_04 TB413981.[MT7]-TYQFLQEYLDAIK[MT7].2b4_1.heavy 960.521 / 684.347 6976.0 47.97010040283203 43 13 10 10 10 0.9882841697463004 64.92338101058924 0.0 3 0.9020620887195591 3.9109029820175625 6976.0 68.48372950264263 0.0 - - - - - - - 242.27272727272728 13 11 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1087 139 C20140704_OR004_04 C20140704_OR004_04 TB413981.[MT7]-TYQFLQEYLDAIK[MT7].2b7_1.heavy 960.521 / 1054.53 6819.0 47.97010040283203 43 13 10 10 10 0.9882841697463004 64.92338101058924 0.0 3 0.9020620887195591 3.9109029820175625 6819.0 42.67304140127388 0.0 - - - - - - - 219.5 13 10 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1089 140 C20140704_OR004_04 C20140704_OR004_04 TB428112.[MT7]-ATESHSTSSTFHR.2y8_1.heavy 796.383 / 922.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 1091 140 C20140704_OR004_04 C20140704_OR004_04 TB428112.[MT7]-ATESHSTSSTFHR.2b4_1.heavy 796.383 / 533.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 1093 140 C20140704_OR004_04 C20140704_OR004_04 TB428112.[MT7]-ATESHSTSSTFHR.2y9_1.heavy 796.383 / 1059.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 1095 140 C20140704_OR004_04 C20140704_OR004_04 TB428112.[MT7]-ATESHSTSSTFHR.2y10_1.heavy 796.383 / 1146.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 1097 141 C20140704_OR004_04 C20140704_OR004_04 TB428312.[MT7]-VDAAELVREFEALTEENR.3y7_1.heavy 745.717 / 832.416 802.0 50.23775100708008 38 13 10 5 10 2.1672878938693527 38.46154130255545 0.0402984619140625 3 0.9269029331372367 4.536602621006945 802.0 17.22156752345981 1.0 - - - - - - - 135.45454545454547 2 11 C21orf7 chromosome 21 open reading frame 7 1099 141 C20140704_OR004_04 C20140704_OR004_04 TB428312.[MT7]-VDAAELVREFEALTEENR.3y17_2.heavy 745.717 / 996.487 3550.0 50.23775100708008 38 13 10 5 10 2.1672878938693527 38.46154130255545 0.0402984619140625 3 0.9269029331372367 4.536602621006945 3550.0 86.93844393592677 0.0 - - - - - - - 171.875 7 8 C21orf7 chromosome 21 open reading frame 7 1101 141 C20140704_OR004_04 C20140704_OR004_04 TB428312.[MT7]-VDAAELVREFEALTEENR.3b4_1.heavy 745.717 / 501.279 1088.0 50.23775100708008 38 13 10 5 10 2.1672878938693527 38.46154130255545 0.0402984619140625 3 0.9269029331372367 4.536602621006945 1088.0 1.8141514399578917 0.0 - - - - - - - 211.125 2 16 C21orf7 chromosome 21 open reading frame 7 1103 141 C20140704_OR004_04 C20140704_OR004_04 TB428312.[MT7]-VDAAELVREFEALTEENR.3b5_1.heavy 745.717 / 630.321 2405.0 50.23775100708008 38 13 10 5 10 2.1672878938693527 38.46154130255545 0.0402984619140625 3 0.9269029331372367 4.536602621006945 2405.0 58.48314263920671 0.0 - - - - - - - 125.0909090909091 4 11 C21orf7 chromosome 21 open reading frame 7 1105 142 C20140704_OR004_04 C20140704_OR004_04 TB427980.[MT7]-LSLIQFFSK[MT7].3y3_1.heavy 457.614 / 525.315 1144.0 47.91390037536621 38 13 10 5 10 1.2763901650518281 52.66852732935001 0.04199981689453125 3 0.9142736743368335 4.1845887127435875 1144.0 21.20981912144703 0.0 - - - - - - - 72.0 2 1 RBL1 retinoblastoma-like 1 (p107) 1107 142 C20140704_OR004_04 C20140704_OR004_04 TB427980.[MT7]-LSLIQFFSK[MT7].3b4_1.heavy 457.614 / 571.394 1144.0 47.91390037536621 38 13 10 5 10 1.2763901650518281 52.66852732935001 0.04199981689453125 3 0.9142736743368335 4.1845887127435875 1144.0 5.181842086661483 1.0 - - - - - - - 214.66666666666666 3 3 RBL1 retinoblastoma-like 1 (p107) 1109 142 C20140704_OR004_04 C20140704_OR004_04 TB427980.[MT7]-LSLIQFFSK[MT7].3b5_1.heavy 457.614 / 699.452 1144.0 47.91390037536621 38 13 10 5 10 1.2763901650518281 52.66852732935001 0.04199981689453125 3 0.9142736743368335 4.1845887127435875 1144.0 16.953074935400515 0.0 - - - - - - - 215.0 2 3 RBL1 retinoblastoma-like 1 (p107) 1111 142 C20140704_OR004_04 C20140704_OR004_04 TB427980.[MT7]-LSLIQFFSK[MT7].3y4_1.heavy 457.614 / 672.384 2002.0 47.91390037536621 38 13 10 5 10 1.2763901650518281 52.66852732935001 0.04199981689453125 3 0.9142736743368335 4.1845887127435875 2002.0 37.1171834625323 0.0 - - - - - - - 167.0 4 3 RBL1 retinoblastoma-like 1 (p107) 1113 143 C20140704_OR004_04 C20140704_OR004_04 TB427841.[MT7]-LLTEFNK[MT7].2y4_1.heavy 576.847 / 681.369 6327.0 34.59199905395508 48 18 10 10 10 3.248093484522667 20.729186223404536 0.0 3 0.9805053793650496 8.824638153594195 6327.0 9.613784522521495 0.0 - - - - - - - 645.5714285714286 12 7 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1115 143 C20140704_OR004_04 C20140704_OR004_04 TB427841.[MT7]-LLTEFNK[MT7].2y5_1.heavy 576.847 / 782.417 15108.0 34.59199905395508 48 18 10 10 10 3.248093484522667 20.729186223404536 0.0 3 0.9805053793650496 8.824638153594195 15108.0 61.486046511627904 0.0 - - - - - - - 229.33333333333334 30 9 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1117 143 C20140704_OR004_04 C20140704_OR004_04 TB427841.[MT7]-LLTEFNK[MT7].2y3_1.heavy 576.847 / 552.326 14462.0 34.59199905395508 48 18 10 10 10 3.248093484522667 20.729186223404536 0.0 3 0.9805053793650496 8.824638153594195 14462.0 24.672409638554214 0.0 - - - - - - - 258.0 28 3 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1119 143 C20140704_OR004_04 C20140704_OR004_04 TB427841.[MT7]-LLTEFNK[MT7].2y6_1.heavy 576.847 / 895.5 20143.0 34.59199905395508 48 18 10 10 10 3.248093484522667 20.729186223404536 0.0 3 0.9805053793650496 8.824638153594195 20143.0 19.2439196423169 0.0 - - - - - - - 246.27272727272728 40 11 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1121 144 C20140704_OR004_04 C20140704_OR004_04 TB428016.[MT7]-ASLQHGQAAEK[MT7].2y4_1.heavy 714.396 / 562.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 1123 144 C20140704_OR004_04 C20140704_OR004_04 TB428016.[MT7]-ASLQHGQAAEK[MT7].2b4_1.heavy 714.396 / 544.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 1125 144 C20140704_OR004_04 C20140704_OR004_04 TB428016.[MT7]-ASLQHGQAAEK[MT7].2y6_1.heavy 714.396 / 747.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 1127 144 C20140704_OR004_04 C20140704_OR004_04 TB428016.[MT7]-ASLQHGQAAEK[MT7].2y7_1.heavy 714.396 / 884.471 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 1129 145 C20140704_OR004_04 C20140704_OR004_04 TB428017.[MT7]-Y[MT7]HGYMMAK[MT7].3y6_1.heavy 478.253 / 844.418 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPP8 dipeptidyl-peptidase 8 1131 145 C20140704_OR004_04 C20140704_OR004_04 TB428017.[MT7]-Y[MT7]HGYMMAK[MT7].3b3_2.heavy 478.253 / 323.681 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPP8 dipeptidyl-peptidase 8 1133 145 C20140704_OR004_04 C20140704_OR004_04 TB428017.[MT7]-Y[MT7]HGYMMAK[MT7].3y4_1.heavy 478.253 / 624.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPP8 dipeptidyl-peptidase 8 1135 145 C20140704_OR004_04 C20140704_OR004_04 TB428017.[MT7]-Y[MT7]HGYMMAK[MT7].3y5_1.heavy 478.253 / 787.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPP8 dipeptidyl-peptidase 8 1137 146 C20140704_OR004_04 C20140704_OR004_04 TB414143.[MT7]-TAATAGIIGWVYGGIPAFIHAK[MT7].3b9_1.heavy 834.809 / 900.527 5715.0 50.27804946899414 39 14 10 5 10 1.5454861347468705 43.459851018460995 0.0402984619140625 3 0.9444717981357852 5.212849117192243 5715.0 67.82278379772961 0.0 - - - - - - - 224.58333333333334 11 12 C3orf1 chromosome 3 open reading frame 1 1139 146 C20140704_OR004_04 C20140704_OR004_04 TB414143.[MT7]-TAATAGIIGWVYGGIPAFIHAK[MT7].3y7_1.heavy 834.809 / 927.553 8356.0 50.27804946899414 39 14 10 5 10 1.5454861347468705 43.459851018460995 0.0402984619140625 3 0.9444717981357852 5.212849117192243 8356.0 49.089987171529074 0.0 - - - - - - - 269.625 16 8 C3orf1 chromosome 3 open reading frame 1 1141 146 C20140704_OR004_04 C20140704_OR004_04 TB414143.[MT7]-TAATAGIIGWVYGGIPAFIHAK[MT7].3b6_1.heavy 834.809 / 617.338 7979.0 50.27804946899414 39 14 10 5 10 1.5454861347468705 43.459851018460995 0.0402984619140625 3 0.9444717981357852 5.212849117192243 7979.0 48.00731662489558 0.0 - - - - - - - 166.0 15 13 C3orf1 chromosome 3 open reading frame 1 1143 146 C20140704_OR004_04 C20140704_OR004_04 TB414143.[MT7]-TAATAGIIGWVYGGIPAFIHAK[MT7].3b7_1.heavy 834.809 / 730.422 6901.0 50.27804946899414 39 14 10 5 10 1.5454861347468705 43.459851018460995 0.0402984619140625 3 0.9444717981357852 5.212849117192243 6901.0 138.61321888201195 0.0 - - - - - - - 206.0 13 11 C3orf1 chromosome 3 open reading frame 1 1145 147 C20140704_OR004_04 C20140704_OR004_04 TB427843.[MT7]-QAC[CAM]TPMFR.2b3_1.heavy 577.782 / 504.236 2197.0 26.92340087890625 40 18 2 10 10 5.674630026570057 17.622294234474253 0.0 3 0.9805223439783701 8.828492921670309 2197.0 4.452640941985204 2.0 - - - - - - - 745.8888888888889 50 9 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1147 147 C20140704_OR004_04 C20140704_OR004_04 TB427843.[MT7]-QAC[CAM]TPMFR.2y4_1.heavy 577.782 / 550.281 3174.0 26.92340087890625 40 18 2 10 10 5.674630026570057 17.622294234474253 0.0 3 0.9805223439783701 8.828492921670309 3174.0 0.005281380900871241 2.0 - - - - - - - 284.6666666666667 7 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1149 147 C20140704_OR004_04 C20140704_OR004_04 TB427843.[MT7]-QAC[CAM]TPMFR.2y6_1.heavy 577.782 / 811.359 2319.0 26.92340087890625 40 18 2 10 10 5.674630026570057 17.622294234474253 0.0 3 0.9805223439783701 8.828492921670309 2319.0 4.3073715300049225 0.0 - - - - - - - 284.6666666666667 4 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1151 147 C20140704_OR004_04 C20140704_OR004_04 TB427843.[MT7]-QAC[CAM]TPMFR.2y7_1.heavy 577.782 / 882.396 10743.0 26.92340087890625 40 18 2 10 10 5.674630026570057 17.622294234474253 0.0 3 0.9805223439783701 8.828492921670309 10743.0 86.02323499333725 0.0 - - - - - - - 183.0 21 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1153 148 C20140704_OR004_04 C20140704_OR004_04 TB427986.[MT7]-VDILEMLQK[MT7].3y3_1.heavy 459.607 / 532.357 596.0 45.1371488571167 43 20 10 3 10 4.7982262751670826 20.841034637641766 0.07539749145507812 3 0.9910489910476369 13.034725606324589 596.0 2.2905098039215686 1.0 - - - - - - - 0.0 1 0 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 1155 148 C20140704_OR004_04 C20140704_OR004_04 TB427986.[MT7]-VDILEMLQK[MT7].3b4_1.heavy 459.607 / 585.373 426.0 45.1371488571167 43 20 10 3 10 4.7982262751670826 20.841034637641766 0.07539749145507812 3 0.9910489910476369 13.034725606324589 426.0 4.610823529411765 1.0 - - - - - - - 0.0 1 0 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 1157 148 C20140704_OR004_04 C20140704_OR004_04 TB427986.[MT7]-VDILEMLQK[MT7].3b5_1.heavy 459.607 / 714.415 936.0 45.1371488571167 43 20 10 3 10 4.7982262751670826 20.841034637641766 0.07539749145507812 3 0.9910489910476369 13.034725606324589 936.0 11.011764705882353 0.0 - - - - - - - 0.0 1 0 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 1159 148 C20140704_OR004_04 C20140704_OR004_04 TB427986.[MT7]-VDILEMLQK[MT7].3b3_1.heavy 459.607 / 472.289 1021.0 45.1371488571167 43 20 10 3 10 4.7982262751670826 20.841034637641766 0.07539749145507812 3 0.9910489910476369 13.034725606324589 1021.0 8.282478320905827 0.0 - - - - - - - 191.25 2 4 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 1161 149 C20140704_OR004_04 C20140704_OR004_04 TB427983.[MT7]-AGGPDFLQPSSR.2b7_1.heavy 688.358 / 802.422 1437.0 30.14739990234375 39 17 4 10 8 2.4576794548810397 33.77544975067339 0.0 4 0.9725150186560739 7.427024922573445 1437.0 3.6031220795874406 1.0 - - - - - - - 287.3333333333333 2 6 FAM198B family with sequence similarity 198, member B 1163 149 C20140704_OR004_04 C20140704_OR004_04 TB427983.[MT7]-AGGPDFLQPSSR.2b5_1.heavy 688.358 / 542.269 4887.0 30.14739990234375 39 17 4 10 8 2.4576794548810397 33.77544975067339 0.0 4 0.9725150186560739 7.427024922573445 4887.0 15.193921113689095 1.0 - - - - - - - 255.55555555555554 17 9 FAM198B family with sequence similarity 198, member B 1165 149 C20140704_OR004_04 C20140704_OR004_04 TB427983.[MT7]-AGGPDFLQPSSR.2y11_1.heavy 688.358 / 1160.57 2300.0 30.14739990234375 39 17 4 10 8 2.4576794548810397 33.77544975067339 0.0 4 0.9725150186560739 7.427024922573445 2300.0 30.826388888888886 0.0 - - - - - - - 144.0 4 3 FAM198B family with sequence similarity 198, member B 1167 149 C20140704_OR004_04 C20140704_OR004_04 TB427983.[MT7]-AGGPDFLQPSSR.2y7_1.heavy 688.358 / 834.447 3737.0 30.14739990234375 39 17 4 10 8 2.4576794548810397 33.77544975067339 0.0 4 0.9725150186560739 7.427024922573445 3737.0 16.483077196698382 0.0 - - - - - - - 287.25 7 4 FAM198B family with sequence similarity 198, member B 1169 150 C20140704_OR004_04 C20140704_OR004_04 TB428240.[MT7]-YGFLWPGLNVPLMK[MT7].3b4_1.heavy 641.698 / 625.347 14147.0 51.09975051879883 44 18 10 6 10 3.95093065130593 20.25287043760941 0.0366973876953125 3 0.9854108176422648 10.205104948071044 14147.0 86.02085150170429 0.0 - - - - - - - 99.5 28 12 MRPS5 mitochondrial ribosomal protein S5 1171 150 C20140704_OR004_04 C20140704_OR004_04 TB428240.[MT7]-YGFLWPGLNVPLMK[MT7].3b5_1.heavy 641.698 / 811.426 6690.0 51.09975051879883 44 18 10 6 10 3.95093065130593 20.25287043760941 0.0366973876953125 3 0.9854108176422648 10.205104948071044 6690.0 101.3051864125932 0.0 - - - - - - - 143.07142857142858 13 14 MRPS5 mitochondrial ribosomal protein S5 1173 150 C20140704_OR004_04 C20140704_OR004_04 TB428240.[MT7]-YGFLWPGLNVPLMK[MT7].3b3_1.heavy 641.698 / 512.263 11335.0 51.09975051879883 44 18 10 6 10 3.95093065130593 20.25287043760941 0.0366973876953125 3 0.9854108176422648 10.205104948071044 11335.0 127.48541176470587 0.0 - - - - - - - 152.14285714285714 22 14 MRPS5 mitochondrial ribosomal protein S5 1175 150 C20140704_OR004_04 C20140704_OR004_04 TB428240.[MT7]-YGFLWPGLNVPLMK[MT7].3y4_1.heavy 641.698 / 632.392 10951.0 51.09975051879883 44 18 10 6 10 3.95093065130593 20.25287043760941 0.0366973876953125 3 0.9854108176422648 10.205104948071044 10951.0 206.51492426470588 0.0 - - - - - - - 134.0 21 14 MRPS5 mitochondrial ribosomal protein S5 1177 151 C20140704_OR004_04 C20140704_OR004_04 TB413836.[MT7]-GSALTFSVAFQALR.3y6_1.heavy 537.971 / 705.404 5671.0 44.9296989440918 47 17 10 10 10 2.8201840617620055 28.29744526612115 0.0 3 0.9749500566586129 7.781229339453421 5671.0 75.00886627906976 0.0 - - - - - - - 180.6 11 10 C7orf43 chromosome 7 open reading frame 43 1179 151 C20140704_OR004_04 C20140704_OR004_04 TB413836.[MT7]-GSALTFSVAFQALR.3b3_1.heavy 537.971 / 360.2 7389.0 44.9296989440918 47 17 10 10 10 2.8201840617620055 28.29744526612115 0.0 3 0.9749500566586129 7.781229339453421 7389.0 19.331686046511628 0.0 - - - - - - - 215.0 14 8 C7orf43 chromosome 7 open reading frame 43 1181 151 C20140704_OR004_04 C20140704_OR004_04 TB413836.[MT7]-GSALTFSVAFQALR.3y8_1.heavy 537.971 / 891.505 1289.0 44.9296989440918 47 17 10 10 10 2.8201840617620055 28.29744526612115 0.0 3 0.9749500566586129 7.781229339453421 1289.0 12.740116279069769 0.0 - - - - - - - 143.33333333333334 2 9 C7orf43 chromosome 7 open reading frame 43 1183 151 C20140704_OR004_04 C20140704_OR004_04 TB413836.[MT7]-GSALTFSVAFQALR.3y5_1.heavy 537.971 / 634.367 6959.0 44.9296989440918 47 17 10 10 10 2.8201840617620055 28.29744526612115 0.0 3 0.9749500566586129 7.781229339453421 6959.0 91.03343023255815 0.0 - - - - - - - 132.9090909090909 13 11 C7orf43 chromosome 7 open reading frame 43 1185 152 C20140704_OR004_04 C20140704_OR004_04 TB428050.[MT7]-YSGETVQERK[MT7].2y8_1.heavy 742.901 / 1090.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1187 152 C20140704_OR004_04 C20140704_OR004_04 TB428050.[MT7]-YSGETVQERK[MT7].2b4_1.heavy 742.901 / 581.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1189 152 C20140704_OR004_04 C20140704_OR004_04 TB428050.[MT7]-YSGETVQERK[MT7].2y9_1.heavy 742.901 / 1177.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1191 152 C20140704_OR004_04 C20140704_OR004_04 TB428050.[MT7]-YSGETVQERK[MT7].2y6_1.heavy 742.901 / 904.533 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1193 153 C20140704_OR004_04 C20140704_OR004_04 TB451252.[MT7]-DIGAIAR.2y5_1.heavy 430.26 / 487.299 13065.0 24.993999481201172 48 18 10 10 10 5.8186986344460925 17.185973407869994 0.0 3 0.9876391419120014 11.088931173934366 13065.0 14.228576267263545 0.0 - - - - - - - 265.2 26 10 DPYSL5 dihydropyrimidinase-like 5 1195 153 C20140704_OR004_04 C20140704_OR004_04 TB451252.[MT7]-DIGAIAR.2b4_1.heavy 430.26 / 501.279 16229.0 24.993999481201172 48 18 10 10 10 5.8186986344460925 17.185973407869994 0.0 3 0.9876391419120014 11.088931173934366 16229.0 87.31042892156863 0.0 - - - - - - - 291.42857142857144 32 7 DPYSL5 dihydropyrimidinase-like 5 1197 153 C20140704_OR004_04 C20140704_OR004_04 TB451252.[MT7]-DIGAIAR.2y6_1.heavy 430.26 / 600.383 16331.0 24.993999481201172 48 18 10 10 10 5.8186986344460925 17.185973407869994 0.0 3 0.9876391419120014 11.088931173934366 16331.0 42.695424836601305 0.0 - - - - - - - 218.57142857142858 32 7 DPYSL5 dihydropyrimidinase-like 5 1199 153 C20140704_OR004_04 C20140704_OR004_04 TB451252.[MT7]-DIGAIAR.2b5_1.heavy 430.26 / 614.363 5410.0 24.993999481201172 48 18 10 10 10 5.8186986344460925 17.185973407869994 0.0 3 0.9876391419120014 11.088931173934366 5410.0 32.17712418300653 1.0 - - - - - - - 204.0 22 7 DPYSL5 dihydropyrimidinase-like 5 1201 154 C20140704_OR004_04 C20140704_OR004_04 TB413835.[MT7]-GSALTFSVAFQALR.2b3_1.heavy 806.452 / 360.2 3694.0 44.920023918151855 38 12 10 6 10 0.972174079231101 73.11986936703316 0.038700103759765625 3 0.881234384835388 3.545046699245157 3694.0 17.618077235615058 0.0 - - - - - - - 206.4 7 5 C7orf43 chromosome 7 open reading frame 43 1203 154 C20140704_OR004_04 C20140704_OR004_04 TB413835.[MT7]-GSALTFSVAFQALR.2y9_1.heavy 806.452 / 1038.57 3694.0 44.920023918151855 38 12 10 6 10 0.972174079231101 73.11986936703316 0.038700103759765625 3 0.881234384835388 3.545046699245157 3694.0 17.754108527131784 0.0 - - - - - - - 194.93333333333334 7 15 C7orf43 chromosome 7 open reading frame 43 1205 154 C20140704_OR004_04 C20140704_OR004_04 TB413835.[MT7]-GSALTFSVAFQALR.2y6_1.heavy 806.452 / 705.404 1804.0 44.920023918151855 38 12 10 6 10 0.972174079231101 73.11986936703316 0.038700103759765625 3 0.881234384835388 3.545046699245157 1804.0 20.976744186046513 0.0 - - - - - - - 183.46666666666667 3 15 C7orf43 chromosome 7 open reading frame 43 1207 154 C20140704_OR004_04 C20140704_OR004_04 TB413835.[MT7]-GSALTFSVAFQALR.2y10_1.heavy 806.452 / 1139.62 3608.0 44.920023918151855 38 12 10 6 10 0.972174079231101 73.11986936703316 0.038700103759765625 3 0.881234384835388 3.545046699245157 3608.0 17.470238651365896 0.0 - - - - - - - 136.16666666666666 7 12 C7orf43 chromosome 7 open reading frame 43 1209 155 C20140704_OR004_04 C20140704_OR004_04 TB451514.[MT7]-K[MT7]EITLLEQR.3y7_1.heavy 473.292 / 872.52 240.0 29.18850040435791 41 20 10 3 8 16.907200196228207 5.914639848075425 0.05119895935058594 4 0.9916515612847397 13.497618049283666 240.0 1.2590436590436591 6.0 - - - - - - - 0.0 1 0 C21orf7 chromosome 21 open reading frame 7 1211 155 C20140704_OR004_04 C20140704_OR004_04 TB451514.[MT7]-K[MT7]EITLLEQR.3y6_1.heavy 473.292 / 759.436 3967.0 29.18850040435791 41 20 10 3 8 16.907200196228207 5.914639848075425 0.05119895935058594 4 0.9916515612847397 13.497618049283666 3967.0 21.133103390183024 0.0 - - - - - - - 216.2 7 5 C21orf7 chromosome 21 open reading frame 7 1213 155 C20140704_OR004_04 C20140704_OR004_04 TB451514.[MT7]-K[MT7]EITLLEQR.3y5_1.heavy 473.292 / 658.388 2644.0 29.18850040435791 41 20 10 3 8 16.907200196228207 5.914639848075425 0.05119895935058594 4 0.9916515612847397 13.497618049283666 2644.0 42.74466666666667 1.0 - - - - - - - 168.0 7 5 C21orf7 chromosome 21 open reading frame 7 1215 155 C20140704_OR004_04 C20140704_OR004_04 TB451514.[MT7]-K[MT7]EITLLEQR.3y4_1.heavy 473.292 / 545.304 4928.0 29.18850040435791 41 20 10 3 8 16.907200196228207 5.914639848075425 0.05119895935058594 4 0.9916515612847397 13.497618049283666 4928.0 -1.2319999999999993 0.0 - - - - - - - 154.28571428571428 9 7 C21orf7 chromosome 21 open reading frame 7 1217 156 C20140704_OR004_04 C20140704_OR004_04 TB451513.[MT7]-EITLLEQRK[MT7].3y7_1.heavy 473.292 / 1031.63 N/A 29.666866938273113 33 16 4 5 8 2.5480169456165744 39.24620680880197 0.04669952392578125 4 0.9659319593306589 6.667270168107423 0.0 0.0 6.0 - - - - - - - 0.0 0 0 C21orf7 chromosome 21 open reading frame 7 1219 156 C20140704_OR004_04 C20140704_OR004_04 TB451513.[MT7]-EITLLEQRK[MT7].3b4_1.heavy 473.292 / 601.368 4459.0 29.666866938273113 33 16 4 5 8 2.5480169456165744 39.24620680880197 0.04669952392578125 4 0.9659319593306589 6.667270168107423 4459.0 23.373790322580646 1.0 - - - - - - - 248.0 27 10 C21orf7 chromosome 21 open reading frame 7 1221 156 C20140704_OR004_04 C20140704_OR004_04 TB451513.[MT7]-EITLLEQRK[MT7].3y8_2.heavy 473.292 / 572.862 7184.0 29.666866938273113 33 16 4 5 8 2.5480169456165744 39.24620680880197 0.04669952392578125 4 0.9659319593306589 6.667270168107423 7184.0 65.20375366568915 0.0 - - - - - - - 265.42857142857144 14 7 C21orf7 chromosome 21 open reading frame 7 1223 156 C20140704_OR004_04 C20140704_OR004_04 TB451513.[MT7]-EITLLEQRK[MT7].3y5_1.heavy 473.292 / 817.501 1982.0 29.666866938273113 33 16 4 5 8 2.5480169456165744 39.24620680880197 0.04669952392578125 4 0.9659319593306589 6.667270168107423 1982.0 11.356459595959596 0.0 - - - - - - - 322.0 3 5 C21orf7 chromosome 21 open reading frame 7 1225 157 C20140704_OR004_04 C20140704_OR004_04 TB451517.[MT7]-ASLQHGQAAEK[MT7].3y6_1.heavy 476.6 / 747.412 1900.0 16.772899627685547 44 14 10 10 10 2.468754760700925 40.50625100226972 0.0 3 0.9462481094803807 5.299082642756695 1900.0 43.35532233883059 0.0 - - - - - - - 144.0 3 4 FAM198B family with sequence similarity 198, member B 1227 157 C20140704_OR004_04 C20140704_OR004_04 TB451517.[MT7]-ASLQHGQAAEK[MT7].3b4_1.heavy 476.6 / 544.321 6966.0 16.772899627685547 44 14 10 10 10 2.468754760700925 40.50625100226972 0.0 3 0.9462481094803807 5.299082642756695 6966.0 89.04365217391305 0.0 - - - - - - - 167.45454545454547 13 11 FAM198B family with sequence similarity 198, member B 1229 157 C20140704_OR004_04 C20140704_OR004_04 TB451517.[MT7]-ASLQHGQAAEK[MT7].3b3_1.heavy 476.6 / 416.263 1727.0 16.772899627685547 44 14 10 10 10 2.468754760700925 40.50625100226972 0.0 3 0.9462481094803807 5.299082642756695 1727.0 19.66447557471264 0.0 - - - - - - - 147.22222222222223 3 9 FAM198B family with sequence similarity 198, member B 1231 157 C20140704_OR004_04 C20140704_OR004_04 TB451517.[MT7]-ASLQHGQAAEK[MT7].3y4_1.heavy 476.6 / 562.332 5872.0 16.772899627685547 44 14 10 10 10 2.468754760700925 40.50625100226972 0.0 3 0.9462481094803807 5.299082642756695 5872.0 34.49891593396348 1.0 - - - - - - - 177.15384615384616 11 13 FAM198B family with sequence similarity 198, member B 1233 158 C20140704_OR004_04 C20140704_OR004_04 TB428306.[MT7]-DLNC[CAM]PFLEGLYITEPK[MT7].2b8_1.heavy 1099.08 / 1133.54 3054.0 45.62852668762207 40 14 10 6 10 1.3698725919241808 45.857297504375694 0.03910064697265625 3 0.9469433825115936 5.334005406770016 3054.0 11.982519310754604 0.0 - - - - - - - 244.125 6 8 HAUS7 HAUS augmin-like complex, subunit 7 1235 158 C20140704_OR004_04 C20140704_OR004_04 TB428306.[MT7]-DLNC[CAM]PFLEGLYITEPK[MT7].2b4_1.heavy 1099.08 / 647.294 7806.0 45.62852668762207 40 14 10 6 10 1.3698725919241808 45.857297504375694 0.03910064697265625 3 0.9469433825115936 5.334005406770016 7806.0 133.06934117647057 0.0 - - - - - - - 184.0 15 6 HAUS7 HAUS augmin-like complex, subunit 7 1237 158 C20140704_OR004_04 C20140704_OR004_04 TB428306.[MT7]-DLNC[CAM]PFLEGLYITEPK[MT7].2b6_1.heavy 1099.08 / 891.415 2291.0 45.62852668762207 40 14 10 6 10 1.3698725919241808 45.857297504375694 0.03910064697265625 3 0.9469433825115936 5.334005406770016 2291.0 6.663364625421655 0.0 - - - - - - - 339.25 4 4 HAUS7 HAUS augmin-like complex, subunit 7 1239 158 C20140704_OR004_04 C20140704_OR004_04 TB428306.[MT7]-DLNC[CAM]PFLEGLYITEPK[MT7].2b9_1.heavy 1099.08 / 1190.56 764.0 45.62852668762207 40 14 10 6 10 1.3698725919241808 45.857297504375694 0.03910064697265625 3 0.9469433825115936 5.334005406770016 764.0 6.291764705882352 1.0 - - - - - - - 0.0 1 0 HAUS7 HAUS augmin-like complex, subunit 7 1241 159 C20140704_OR004_04 C20140704_OR004_04 TB428305.[MT7]-DLSMIVLLPNEIDGLQK[MT7].3b6_1.heavy 729.416 / 803.445 10479.0 48.34744834899902 40 15 10 5 10 2.2859776863408503 34.76999871347679 0.042499542236328125 3 0.9547860197356579 5.781971084012633 10479.0 230.42157973291438 0.0 - - - - - - - 217.0 20 8 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1243 159 C20140704_OR004_04 C20140704_OR004_04 TB428305.[MT7]-DLSMIVLLPNEIDGLQK[MT7].3b4_1.heavy 729.416 / 591.293 7943.0 48.34744834899902 40 15 10 5 10 2.2859776863408503 34.76999871347679 0.042499542236328125 3 0.9547860197356579 5.781971084012633 7943.0 48.813007397003744 0.0 - - - - - - - 222.16666666666666 15 12 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1245 159 C20140704_OR004_04 C20140704_OR004_04 TB428305.[MT7]-DLSMIVLLPNEIDGLQK[MT7].3y4_1.heavy 729.416 / 589.379 7075.0 48.34744834899902 40 15 10 5 10 2.2859776863408503 34.76999871347679 0.042499542236328125 3 0.9547860197356579 5.781971084012633 7075.0 82.54609962406015 0.0 - - - - - - - 224.45454545454547 14 11 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1247 159 C20140704_OR004_04 C20140704_OR004_04 TB428305.[MT7]-DLSMIVLLPNEIDGLQK[MT7].3y9_1.heavy 729.416 / 1157.63 5206.0 48.34744834899902 40 15 10 5 10 2.2859776863408503 34.76999871347679 0.042499542236328125 3 0.9547860197356579 5.781971084012633 5206.0 31.382644598443562 0.0 - - - - - - - 169.8181818181818 10 11 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1249 160 C20140704_OR004_04 C20140704_OR004_04 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 121004.0 40.44419860839844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 121004.0 262.6794706480302 0.0 - - - - - - - 283.90909090909093 242 11 1251 160 C20140704_OR004_04 C20140704_OR004_04 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 207464.0 40.44419860839844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 207464.0 579.7807620978339 0.0 - - - - - - - 312.2 414 5 1253 160 C20140704_OR004_04 C20140704_OR004_04 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 260159.0 40.44419860839844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 260159.0 704.5329161805325 0.0 - - - - - - - 325.3333333333333 520 3 1255 161 C20140704_OR004_04 C20140704_OR004_04 TB451651.[MT7]-VSGSINMLSLTQGLFR.3y6_1.heavy 623.012 / 721.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS5 mitochondrial ribosomal protein S5 1257 161 C20140704_OR004_04 C20140704_OR004_04 TB451651.[MT7]-VSGSINMLSLTQGLFR.3b6_1.heavy 623.012 / 702.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS5 mitochondrial ribosomal protein S5 1259 161 C20140704_OR004_04 C20140704_OR004_04 TB451651.[MT7]-VSGSINMLSLTQGLFR.3y8_1.heavy 623.012 / 921.515 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS5 mitochondrial ribosomal protein S5 1261 161 C20140704_OR004_04 C20140704_OR004_04 TB451651.[MT7]-VSGSINMLSLTQGLFR.3b7_1.heavy 623.012 / 833.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS5 mitochondrial ribosomal protein S5 1263 162 C20140704_OR004_04 C20140704_OR004_04 TB427877.[MT7]-YSGETVQER.2y5_1.heavy 606.802 / 632.336 989.0 19.733699798583984 37 13 10 6 8 1.8447919262362376 46.77600602945912 0.038600921630859375 4 0.92145180593291 4.374311101306338 989.0 6.14235014959249 0.0 - - - - - - - 0.0 1 0 C3orf1 chromosome 3 open reading frame 1 1265 162 C20140704_OR004_04 C20140704_OR004_04 TB427877.[MT7]-YSGETVQER.2b4_1.heavy 606.802 / 581.269 629.0 19.733699798583984 37 13 10 6 8 1.8447919262362376 46.77600602945912 0.038600921630859375 4 0.92145180593291 4.374311101306338 629.0 1.3977777777777778 5.0 - - - - - - - 0.0 1 0 C3orf1 chromosome 3 open reading frame 1 1267 162 C20140704_OR004_04 C20140704_OR004_04 TB427877.[MT7]-YSGETVQER.2b5_1.heavy 606.802 / 682.316 449.0 19.733699798583984 37 13 10 6 8 1.8447919262362376 46.77600602945912 0.038600921630859375 4 0.92145180593291 4.374311101306338 449.0 9.47888888888889 4.0 - - - - - - - 0.0 1 0 C3orf1 chromosome 3 open reading frame 1 1269 162 C20140704_OR004_04 C20140704_OR004_04 TB427877.[MT7]-YSGETVQER.2y7_1.heavy 606.802 / 818.4 1707.0 19.733699798583984 37 13 10 6 8 1.8447919262362376 46.77600602945912 0.038600921630859375 4 0.92145180593291 4.374311101306338 1707.0 22.759999999999998 0.0 - - - - - - - 135.0 3 2 C3orf1 chromosome 3 open reading frame 1 1271 163 C20140704_OR004_04 C20140704_OR004_04 TB427767.[MT7]-LLNLYPR.2y4_1.heavy 516.82 / 548.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 1273 163 C20140704_OR004_04 C20140704_OR004_04 TB427767.[MT7]-LLNLYPR.2y5_1.heavy 516.82 / 662.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 1275 163 C20140704_OR004_04 C20140704_OR004_04 TB427767.[MT7]-LLNLYPR.2b4_1.heavy 516.82 / 598.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 1277 163 C20140704_OR004_04 C20140704_OR004_04 TB427767.[MT7]-LLNLYPR.2y6_1.heavy 516.82 / 775.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 1279 164 C20140704_OR004_04 C20140704_OR004_04 TB427769.[MT7]-INENEK[MT7].2b3_1.heavy 517.79 / 501.279 775.0 17.752300262451172 36 17 10 5 4 3.196973101482719 31.279587542860828 0.044200897216796875 8 0.9740899749888612 7.6504371590263895 775.0 0.29999999999999993 9.0 - - - - - - - 0.0 1 0 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1281 164 C20140704_OR004_04 C20140704_OR004_04 TB427769.[MT7]-INENEK[MT7].2y4_1.heavy 517.79 / 663.343 698.0 17.752300262451172 36 17 10 5 4 3.196973101482719 31.279587542860828 0.044200897216796875 8 0.9740899749888612 7.6504371590263895 698.0 4.280709677419354 2.0 - - - - - - - 0.0 1 0 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1283 164 C20140704_OR004_04 C20140704_OR004_04 TB427769.[MT7]-INENEK[MT7].2y5_1.heavy 517.79 / 777.386 5195.0 17.752300262451172 36 17 10 5 4 3.196973101482719 31.279587542860828 0.044200897216796875 8 0.9740899749888612 7.6504371590263895 5195.0 86.71224152191894 0.0 - - - - - - - 97.25 10 4 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1285 164 C20140704_OR004_04 C20140704_OR004_04 TB427769.[MT7]-INENEK[MT7].2y3_1.heavy 517.79 / 534.3 2946.0 17.752300262451172 36 17 10 5 4 3.196973101482719 31.279587542860828 0.044200897216796875 8 0.9740899749888612 7.6504371590263895 2946.0 46.373482997689 0.0 - - - - - - - 178.5 5 10 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1287 165 C20140704_OR004_04 C20140704_OR004_04 TB451393.[MT7]-MNELMEK[MT7].2b3_1.heavy 591.809 / 519.235 9579.0 29.263599395751953 48 18 10 10 10 3.066774388724621 22.065371115894166 0.0 3 0.9840923336482628 9.771961088025767 9579.0 60.02958510074231 0.0 - - - - - - - 341.1111111111111 19 9 HAUS7 HAUS augmin-like complex, subunit 7 1289 165 C20140704_OR004_04 C20140704_OR004_04 TB451393.[MT7]-MNELMEK[MT7].2b4_1.heavy 591.809 / 632.319 8105.0 29.263599395751953 48 18 10 10 10 3.066774388724621 22.065371115894166 0.0 3 0.9840923336482628 9.771961088025767 8105.0 53.55422399947013 0.0 - - - - - - - 225.16666666666666 16 6 HAUS7 HAUS augmin-like complex, subunit 7 1291 165 C20140704_OR004_04 C20140704_OR004_04 TB451393.[MT7]-MNELMEK[MT7].2y3_1.heavy 591.809 / 551.298 9210.0 29.263599395751953 48 18 10 10 10 3.066774388724621 22.065371115894166 0.0 3 0.9840923336482628 9.771961088025767 9210.0 12.814749617953556 0.0 - - - - - - - 368.2 18 10 HAUS7 HAUS augmin-like complex, subunit 7 1293 165 C20140704_OR004_04 C20140704_OR004_04 TB451393.[MT7]-MNELMEK[MT7].2y6_1.heavy 591.809 / 907.468 9701.0 29.263599395751953 48 18 10 10 10 3.066774388724621 22.065371115894166 0.0 3 0.9840923336482628 9.771961088025767 9701.0 14.240400447128465 0.0 - - - - - - - 270.2 19 5 HAUS7 HAUS augmin-like complex, subunit 7 1295 166 C20140704_OR004_04 C20140704_OR004_04 TB428042.[MT7]-VLELVSITANK[MT7].3b6_1.heavy 492.308 / 785.489 2066.0 40.10772514343262 38 12 10 6 10 1.6464222872694907 46.69174502593124 0.03890228271484375 3 0.8863865189526469 3.6261619492825314 2066.0 27.734852992044274 0.0 - - - - - - - 361.0 4 3 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1297 166 C20140704_OR004_04 C20140704_OR004_04 TB428042.[MT7]-VLELVSITANK[MT7].3b4_1.heavy 492.308 / 599.388 7183.0 40.10772514343262 38 12 10 6 10 1.6464222872694907 46.69174502593124 0.03890228271484375 3 0.8863865189526469 3.6261619492825314 7183.0 68.91304568527919 0.0 - - - - - - - 216.4 14 5 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1299 166 C20140704_OR004_04 C20140704_OR004_04 TB428042.[MT7]-VLELVSITANK[MT7].3b5_1.heavy 492.308 / 698.457 4132.0 40.10772514343262 38 12 10 6 10 1.6464222872694907 46.69174502593124 0.03890228271484375 3 0.8863865189526469 3.6261619492825314 4132.0 30.779365052051965 0.0 - - - - - - - 246.0 8 4 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1301 166 C20140704_OR004_04 C20140704_OR004_04 TB428042.[MT7]-VLELVSITANK[MT7].3y4_1.heavy 492.308 / 577.343 12201.0 40.10772514343262 38 12 10 6 10 1.6464222872694907 46.69174502593124 0.03890228271484375 3 0.8863865189526469 3.6261619492825314 12201.0 132.89461625282166 0.0 - - - - - - - 157.3 24 10 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1303 167 C20140704_OR004_04 C20140704_OR004_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 167070.0 35.44779968261719 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 167070.0 347.988522848034 0.0 - - - - - - - 211.8 334 10 1305 167 C20140704_OR004_04 C20140704_OR004_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 32355.0 35.44779968261719 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 32355.0 26.19477158513245 2.0 - - - - - - - 806.8571428571429 115 7 1307 167 C20140704_OR004_04 C20140704_OR004_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 34238.0 35.44779968261719 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 34238.0 171.0942970831004 0.0 - - - - - - - 248.55555555555554 68 9 1309 168 C20140704_OR004_04 C20140704_OR004_04 TB451256.[MT7]-IPHGVSGVQDR.3y6_1.heavy 436.91 / 661.326 17967.0 22.812724590301514 41 17 10 6 8 4.088455787220082 24.459112487552257 0.03690147399902344 4 0.9723628734667903 7.406458580656804 17967.0 150.39009503806773 0.0 - - - - - - - 234.4 35 5 DPYSL5 dihydropyrimidinase-like 5 1311 168 C20140704_OR004_04 C20140704_OR004_04 TB451256.[MT7]-IPHGVSGVQDR.3y4_1.heavy 436.91 / 517.273 3515.0 22.812724590301514 41 17 10 6 8 4.088455787220082 24.459112487552257 0.03690147399902344 4 0.9723628734667903 7.406458580656804 3515.0 17.665128205128205 3.0 - - - - - - - 219.75 12 8 DPYSL5 dihydropyrimidinase-like 5 1313 168 C20140704_OR004_04 C20140704_OR004_04 TB451256.[MT7]-IPHGVSGVQDR.3y8_1.heavy 436.91 / 817.416 3515.0 22.812724590301514 41 17 10 6 8 4.088455787220082 24.459112487552257 0.03690147399902344 4 0.9723628734667903 7.406458580656804 3515.0 5.651463483944303 0.0 - - - - - - - 195.33333333333334 7 6 DPYSL5 dihydropyrimidinase-like 5 1315 168 C20140704_OR004_04 C20140704_OR004_04 TB451256.[MT7]-IPHGVSGVQDR.3y5_1.heavy 436.91 / 574.294 9765.0 22.812724590301514 41 17 10 6 8 4.088455787220082 24.459112487552257 0.03690147399902344 4 0.9723628734667903 7.406458580656804 9765.0 115.14483924004384 0.0 - - - - - - - 213.1818181818182 19 11 DPYSL5 dihydropyrimidinase-like 5 1317 169 C20140704_OR004_04 C20140704_OR004_04 TB428040.[MT7]-NFEVSTVIFK[MT7].3y3_1.heavy 491.285 / 551.367 5529.0 39.53340148925781 33 5 10 10 8 0.39859844969029223 110.22409421167254 0.0 4 0.6896217224099869 2.155180420235342 5529.0 69.62341275497666 0.0 - - - - - - - 234.75 11 4 RBL1 retinoblastoma-like 1 (p107) 1319 169 C20140704_OR004_04 C20140704_OR004_04 TB428040.[MT7]-NFEVSTVIFK[MT7].3b4_1.heavy 491.285 / 634.332 2608.0 39.53340148925781 33 5 10 10 8 0.39859844969029223 110.22409421167254 0.0 4 0.6896217224099869 2.155180420235342 2608.0 24.90449332485696 1.0 - - - - - - - 104.0 6 1 RBL1 retinoblastoma-like 1 (p107) 1321 169 C20140704_OR004_04 C20140704_OR004_04 TB428040.[MT7]-NFEVSTVIFK[MT7].3b5_1.heavy 491.285 / 721.364 626.0 39.53340148925781 33 5 10 10 8 0.39859844969029223 110.22409421167254 0.0 4 0.6896217224099869 2.155180420235342 626.0 12.038461538461538 0.0 - - - - - - - 0.0 1 0 RBL1 retinoblastoma-like 1 (p107) 1323 169 C20140704_OR004_04 C20140704_OR004_04 TB428040.[MT7]-NFEVSTVIFK[MT7].3b3_1.heavy 491.285 / 535.263 1043.0 39.53340148925781 33 5 10 10 8 0.39859844969029223 110.22409421167254 0.0 4 0.6896217224099869 2.155180420235342 1043.0 7.192203825456382 1.0 - - - - - - - 261.0 2 4 RBL1 retinoblastoma-like 1 (p107) 1325 170 C20140704_OR004_04 C20140704_OR004_04 TB428041.[MT7]-DLNRGQIIGEGR.2y8_1.heavy 736.409 / 829.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS5 mitochondrial ribosomal protein S5 1327 170 C20140704_OR004_04 C20140704_OR004_04 TB428041.[MT7]-DLNRGQIIGEGR.2y5_1.heavy 736.409 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS5 mitochondrial ribosomal protein S5 1329 170 C20140704_OR004_04 C20140704_OR004_04 TB428041.[MT7]-DLNRGQIIGEGR.2b10_1.heavy 736.409 / 1240.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS5 mitochondrial ribosomal protein S5 1331 170 C20140704_OR004_04 C20140704_OR004_04 TB428041.[MT7]-DLNRGQIIGEGR.2y11_2.heavy 736.409 / 606.844 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRPS5 mitochondrial ribosomal protein S5 1333 171 C20140704_OR004_04 C20140704_OR004_04 TB414158.[MT7]-HAVASAAPGQEALVGPSLQPQEAAR.3b6_1.heavy 867.128 / 681.38 7293.0 29.83970069885254 47 17 10 10 10 3.718298032217076 26.89402493655784 0.0 3 0.9749784340631942 7.785659086818455 7293.0 8.733749999999999 0.0 - - - - - - - 286.0 14 7 FAM198B family with sequence similarity 198, member B 1335 171 C20140704_OR004_04 C20140704_OR004_04 TB414158.[MT7]-HAVASAAPGQEALVGPSLQPQEAAR.3y6_1.heavy 867.128 / 671.347 14728.0 29.83970069885254 47 17 10 10 10 3.718298032217076 26.89402493655784 0.0 3 0.9749784340631942 7.785659086818455 14728.0 48.327487896718665 0.0 - - - - - - - 171.6 29 5 FAM198B family with sequence similarity 198, member B 1337 171 C20140704_OR004_04 C20140704_OR004_04 TB414158.[MT7]-HAVASAAPGQEALVGPSLQPQEAAR.3y11_1.heavy 867.128 / 1153.6 20591.0 29.83970069885254 47 17 10 10 10 3.718298032217076 26.89402493655784 0.0 3 0.9749784340631942 7.785659086818455 20591.0 62.74495279720279 0.0 - - - - - - - 300.3 41 10 FAM198B family with sequence similarity 198, member B 1339 171 C20140704_OR004_04 C20140704_OR004_04 TB414158.[MT7]-HAVASAAPGQEALVGPSLQPQEAAR.3y10_1.heavy 867.128 / 1096.57 17302.0 29.83970069885254 47 17 10 10 10 3.718298032217076 26.89402493655784 0.0 3 0.9749784340631942 7.785659086818455 17302.0 119.78307692307692 0.0 - - - - - - - 238.33333333333334 34 3 FAM198B family with sequence similarity 198, member B 1341 172 C20140704_OR004_04 C20140704_OR004_04 TB427760.[MT7]-ALC[CAM]LFPR.2y4_1.heavy 510.793 / 532.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1343 172 C20140704_OR004_04 C20140704_OR004_04 TB427760.[MT7]-ALC[CAM]LFPR.2y5_1.heavy 510.793 / 692.355 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1345 172 C20140704_OR004_04 C20140704_OR004_04 TB427760.[MT7]-ALC[CAM]LFPR.2b4_1.heavy 510.793 / 602.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1347 172 C20140704_OR004_04 C20140704_OR004_04 TB427760.[MT7]-ALC[CAM]LFPR.2y6_1.heavy 510.793 / 805.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1349 173 C20140704_OR004_04 C20140704_OR004_04 TB427968.[MT7]-TSDLIQHQK[MT7].2y4_1.heavy 679.388 / 684.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 1351 173 C20140704_OR004_04 C20140704_OR004_04 TB427968.[MT7]-TSDLIQHQK[MT7].2b4_1.heavy 679.388 / 561.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 1353 173 C20140704_OR004_04 C20140704_OR004_04 TB427968.[MT7]-TSDLIQHQK[MT7].2y3_1.heavy 679.388 / 556.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 1355 173 C20140704_OR004_04 C20140704_OR004_04 TB427968.[MT7]-TSDLIQHQK[MT7].2b5_1.heavy 679.388 / 674.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 1357 174 C20140704_OR004_04 C20140704_OR004_04 TB413962.[MT7]-LDRPC[CAM]FVMTASC[CAM]K[MT7].3y3_1.heavy 624.984 / 538.278 9116.0 31.324100494384766 45 15 10 10 10 1.9504988264318763 35.957219443940446 0.0 3 0.9534656896738529 5.698716354184032 9116.0 90.94898651712205 0.0 - - - - - - - 217.0 18 6 C7orf43 chromosome 7 open reading frame 43 1359 174 C20140704_OR004_04 C20140704_OR004_04 TB413962.[MT7]-LDRPC[CAM]FVMTASC[CAM]K[MT7].3y4_1.heavy 624.984 / 609.315 6656.0 31.324100494384766 45 15 10 10 10 1.9504988264318763 35.957219443940446 0.0 3 0.9534656896738529 5.698716354184032 6656.0 18.659293394777265 0.0 - - - - - - - 289.375 13 8 C7orf43 chromosome 7 open reading frame 43 1361 174 C20140704_OR004_04 C20140704_OR004_04 TB413962.[MT7]-LDRPC[CAM]FVMTASC[CAM]K[MT7].3y5_1.heavy 624.984 / 710.362 10997.0 31.324100494384766 45 15 10 10 10 1.9504988264318763 35.957219443940446 0.0 3 0.9534656896738529 5.698716354184032 10997.0 95.61431034482759 0.0 - - - - - - - 289.5 21 6 C7orf43 chromosome 7 open reading frame 43 1363 174 C20140704_OR004_04 C20140704_OR004_04 TB413962.[MT7]-LDRPC[CAM]FVMTASC[CAM]K[MT7].3b7_2.heavy 624.984 / 516.774 11431.0 31.324100494384766 45 15 10 10 10 1.9504988264318763 35.957219443940446 0.0 3 0.9534656896738529 5.698716354184032 11431.0 99.91453281423804 0.0 - - - - - - - 289.2857142857143 22 7 C7orf43 chromosome 7 open reading frame 43 1365 175 C20140704_OR004_04 C20140704_OR004_04 TB428239.[MT7]-TYQFLQEYLDAIK[MT7].3b4_1.heavy 640.683 / 684.347 40364.0 47.97010040283203 43 13 10 10 10 1.0842234881911417 61.487938043004064 0.0 3 0.9181679554578246 4.284435479512518 40364.0 197.2676691729323 0.0 - - - - - - - 173.71428571428572 80 7 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1367 175 C20140704_OR004_04 C20140704_OR004_04 TB428239.[MT7]-TYQFLQEYLDAIK[MT7].3b5_1.heavy 640.683 / 797.431 20448.0 47.97010040283203 43 13 10 10 10 1.0842234881911417 61.487938043004064 0.0 3 0.9181679554578246 4.284435479512518 20448.0 149.99684210526314 0.0 - - - - - - - 177.33333333333334 40 9 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1369 175 C20140704_OR004_04 C20140704_OR004_04 TB428239.[MT7]-TYQFLQEYLDAIK[MT7].3y4_1.heavy 640.683 / 590.363 45380.0 47.97010040283203 43 13 10 10 10 1.0842234881911417 61.487938043004064 0.0 3 0.9181679554578246 4.284435479512518 45380.0 246.14005847953217 0.0 - - - - - - - 212.8 90 10 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1371 175 C20140704_OR004_04 C20140704_OR004_04 TB428239.[MT7]-TYQFLQEYLDAIK[MT7].3b3_1.heavy 640.683 / 537.279 30482.0 47.97010040283203 43 13 10 10 10 1.0842234881911417 61.487938043004064 0.0 3 0.9181679554578246 4.284435479512518 30482.0 389.0465789473684 0.0 - - - - - - - 177.33333333333334 60 6 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1373 176 C20140704_OR004_04 C20140704_OR004_04 TB413961.[MT7]-AQVSTLLTLLPPPVLR.3b6_1.heavy 621.391 / 744.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 1375 176 C20140704_OR004_04 C20140704_OR004_04 TB413961.[MT7]-AQVSTLLTLLPPPVLR.3y6_1.heavy 621.391 / 678.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 1377 176 C20140704_OR004_04 C20140704_OR004_04 TB413961.[MT7]-AQVSTLLTLLPPPVLR.3b5_1.heavy 621.391 / 631.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 1379 176 C20140704_OR004_04 C20140704_OR004_04 TB413961.[MT7]-AQVSTLLTLLPPPVLR.3y5_1.heavy 621.391 / 581.377 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 1381 177 C20140704_OR004_04 C20140704_OR004_04 TB451389.[MT7]-VLVVEPVK[MT7].2y4_1.heavy 585.889 / 616.379 10174.0 31.787799835205078 50 20 10 10 10 8.614034458601507 11.608962151311738 0.0 3 0.9961915640821603 19.991763952676493 10174.0 9.622046039346829 1.0 - - - - - - - 363.5 22 4 C7orf43 chromosome 7 open reading frame 43 1383 177 C20140704_OR004_04 C20140704_OR004_04 TB451389.[MT7]-VLVVEPVK[MT7].2y5_1.heavy 585.889 / 715.447 17296.0 31.787799835205078 50 20 10 10 10 8.614034458601507 11.608962151311738 0.0 3 0.9961915640821603 19.991763952676493 17296.0 30.603615408223572 0.0 - - - - - - - 269.85714285714283 34 7 C7orf43 chromosome 7 open reading frame 43 1385 177 C20140704_OR004_04 C20140704_OR004_04 TB451389.[MT7]-VLVVEPVK[MT7].2y6_1.heavy 585.889 / 814.516 8866.0 31.787799835205078 50 20 10 10 10 8.614034458601507 11.608962151311738 0.0 3 0.9961915640821603 19.991763952676493 8866.0 34.359407475248304 0.0 - - - - - - - 270.0 17 7 C7orf43 chromosome 7 open reading frame 43 1387 177 C20140704_OR004_04 C20140704_OR004_04 TB451389.[MT7]-VLVVEPVK[MT7].2y7_1.heavy 585.889 / 927.599 10320.0 31.787799835205078 50 20 10 10 10 8.614034458601507 11.608962151311738 0.0 3 0.9961915640821603 19.991763952676493 10320.0 46.20330275229358 0.0 - - - - - - - 323.0 20 9 C7orf43 chromosome 7 open reading frame 43 1389 178 C20140704_OR004_04 C20140704_OR004_04 TB427869.[MT7]-ELMIPGGAK[MT7].3b4_1.heavy 401.905 / 631.36 4771.0 30.963600158691406 46 16 10 10 10 2.857048452140123 35.00115649949626 0.0 3 0.9657568214347322 6.650100031298917 4771.0 24.350259515570936 0.0 - - - - - - - 145.0 9 3 DPYSL5 dihydropyrimidinase-like 5 1391 178 C20140704_OR004_04 C20140704_OR004_04 TB427869.[MT7]-ELMIPGGAK[MT7].3b3_1.heavy 401.905 / 518.276 14458.0 30.963600158691406 46 16 10 10 10 2.857048452140123 35.00115649949626 0.0 3 0.9657568214347322 6.650100031298917 14458.0 46.357676522375705 1.0 - - - - - - - 361.5 34 4 DPYSL5 dihydropyrimidinase-like 5 1393 178 C20140704_OR004_04 C20140704_OR004_04 TB427869.[MT7]-ELMIPGGAK[MT7].3y4_1.heavy 401.905 / 476.295 17783.0 30.963600158691406 46 16 10 10 10 2.857048452140123 35.00115649949626 0.0 3 0.9657568214347322 6.650100031298917 17783.0 88.15221923684085 0.0 - - - - - - - 289.3333333333333 35 3 DPYSL5 dihydropyrimidinase-like 5 1395 178 C20140704_OR004_04 C20140704_OR004_04 TB427869.[MT7]-ELMIPGGAK[MT7].3y5_1.heavy 401.905 / 573.348 11711.0 30.963600158691406 46 16 10 10 10 2.857048452140123 35.00115649949626 0.0 3 0.9657568214347322 6.650100031298917 11711.0 63.591366782006915 0.0 - - - - - - - 289.4 23 5 DPYSL5 dihydropyrimidinase-like 5 1397 179 C20140704_OR004_04 C20140704_OR004_04 TB413963.[MT7]-LDRPC[CAM]FVMTASC[CAM]K[MT7].4b7_1.heavy 468.99 / 1032.54 N/A 31.324100494384766 45 15 10 10 10 4.0478365118058806 16.469703376662398 0.0 2 0.9589697832216603 6.071754913428673 0.0 0.0 8.0 - - - - - - - 0.0 0 0 C7orf43 chromosome 7 open reading frame 43 1399 179 C20140704_OR004_04 C20140704_OR004_04 TB413963.[MT7]-LDRPC[CAM]FVMTASC[CAM]K[MT7].4b7_2.heavy 468.99 / 516.774 5068.0 31.324100494384766 45 15 10 10 10 4.0478365118058806 16.469703376662398 0.0 2 0.9589697832216603 6.071754913428673 5068.0 36.705103448275864 0.0 - - - - - - - 248.42857142857142 10 7 C7orf43 chromosome 7 open reading frame 43 1401 179 C20140704_OR004_04 C20140704_OR004_04 TB413963.[MT7]-LDRPC[CAM]FVMTASC[CAM]K[MT7].4y3_1.heavy 468.99 / 538.278 3185.0 31.324100494384766 45 15 10 10 10 4.0478365118058806 16.469703376662398 0.0 2 0.9589697832216603 6.071754913428673 3185.0 15.110303138586147 0.0 - - - - - - - 232.0 6 5 C7orf43 chromosome 7 open reading frame 43 1403 179 C20140704_OR004_04 C20140704_OR004_04 TB413963.[MT7]-LDRPC[CAM]FVMTASC[CAM]K[MT7].4b6_1.heavy 468.99 / 933.473 N/A 31.324100494384766 45 15 10 10 10 4.0478365118058806 16.469703376662398 0.0 2 0.9589697832216603 6.071754913428673 145.0 1.1 6.0 - - - - - - - 0.0 0 0 C7orf43 chromosome 7 open reading frame 43 1405 180 C20140704_OR004_04 C20140704_OR004_04 TB414082.[MT7]-DLSMIVLLPNEIDGLQK[MT7].4y4_1.heavy 547.314 / 589.379 2040.0 48.33682346343994 39 14 10 5 10 1.273586971685426 48.38901167575138 0.042499542236328125 3 0.9473936161391915 5.356987382622459 2040.0 42.01118541033435 0.0 - - - - - - - 184.75 4 8 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1407 180 C20140704_OR004_04 C20140704_OR004_04 TB414082.[MT7]-DLSMIVLLPNEIDGLQK[MT7].4b4_1.heavy 547.314 / 591.293 1829.0 48.33682346343994 39 14 10 5 10 1.273586971685426 48.38901167575138 0.042499542236328125 3 0.9473936161391915 5.356987382622459 1829.0 38.05505977710233 0.0 - - - - - - - 158.0 3 4 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1409 180 C20140704_OR004_04 C20140704_OR004_04 TB414082.[MT7]-DLSMIVLLPNEIDGLQK[MT7].4b3_1.heavy 547.314 / 460.252 1618.0 48.33682346343994 39 14 10 5 10 1.273586971685426 48.38901167575138 0.042499542236328125 3 0.9473936161391915 5.356987382622459 1618.0 10.885075829383887 0.0 - - - - - - - 217.36363636363637 3 11 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1411 180 C20140704_OR004_04 C20140704_OR004_04 TB414082.[MT7]-DLSMIVLLPNEIDGLQK[MT7].4b6_1.heavy 547.314 / 803.445 1829.0 48.33682346343994 39 14 10 5 10 1.273586971685426 48.38901167575138 0.042499542236328125 3 0.9473936161391915 5.356987382622459 1829.0 25.059675324675325 0.0 - - - - - - - 160.71428571428572 3 7 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1413 181 C20140704_OR004_04 C20140704_OR004_04 TB414084.[MT7]-RVVDFIDEGVNIGLEVK[MT7].3b9_1.heavy 730.751 / 1175.62 1719.0 44.30059814453125 39 9 10 10 10 0.8788201076235983 70.7316430660484 0.0 3 0.8187787988410666 2.85410389037669 1719.0 0.38062543138752625 1.0 - - - - - - - 162.44444444444446 3 9 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1415 181 C20140704_OR004_04 C20140704_OR004_04 TB414084.[MT7]-RVVDFIDEGVNIGLEVK[MT7].3b4_1.heavy 730.751 / 614.374 2837.0 44.30059814453125 39 9 10 10 10 0.8788201076235983 70.7316430660484 0.0 3 0.8187787988410666 2.85410389037669 2837.0 7.6347383720930235 2.0 - - - - - - - 219.77777777777777 5 9 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1417 181 C20140704_OR004_04 C20140704_OR004_04 TB414084.[MT7]-RVVDFIDEGVNIGLEVK[MT7].3b7_1.heavy 730.751 / 989.554 3352.0 44.30059814453125 39 9 10 10 10 0.8788201076235983 70.7316430660484 0.0 3 0.8187787988410666 2.85410389037669 3352.0 48.72093023255814 0.0 - - - - - - - 193.5 6 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1419 181 C20140704_OR004_04 C20140704_OR004_04 TB414084.[MT7]-RVVDFIDEGVNIGLEVK[MT7].3y5_1.heavy 730.751 / 689.431 10659.0 44.30059814453125 39 9 10 10 10 0.8788201076235983 70.7316430660484 0.0 3 0.8187787988410666 2.85410389037669 10659.0 50.816162790697675 0.0 - - - - - - - 207.83333333333334 21 12 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1421 182 C20140704_OR004_04 C20140704_OR004_04 TB427774.[MT7]-QLSEHQR.2y6_1.heavy 521.281 / 769.395 1020.0 14.438950061798096 46 20 10 6 10 10.862418751994431 9.20605274784119 0.03950023651123047 3 0.993121961221464 14.872391892647078 1020.0 18.337992384908276 1.0 - - - - - - - 188.1 2 10 ZNF571 zinc finger protein 571 1423 182 C20140704_OR004_04 C20140704_OR004_04 TB427774.[MT7]-QLSEHQR.2b5_1.heavy 521.281 / 739.385 54.0 14.438950061798096 46 20 10 6 10 10.862418751994431 9.20605274784119 0.03950023651123047 3 0.993121961221464 14.872391892647078 54.0 1.7999999999999998 18.0 - - - - - - - 0.0 0 0 ZNF571 zinc finger protein 571 1425 182 C20140704_OR004_04 C20140704_OR004_04 TB427774.[MT7]-QLSEHQR.2y5_1.heavy 521.281 / 656.311 376.0 14.438950061798096 46 20 10 6 10 10.862418751994431 9.20605274784119 0.03950023651123047 3 0.993121961221464 14.872391892647078 376.0 8.17992260917634 0.0 - - - - - - - 0.0 0 0 ZNF571 zinc finger protein 571 1427 182 C20140704_OR004_04 C20140704_OR004_04 TB427774.[MT7]-QLSEHQR.2b4_1.heavy 521.281 / 602.327 268.0 14.438950061798096 46 20 10 6 10 10.862418751994431 9.20605274784119 0.03950023651123047 3 0.993121961221464 14.872391892647078 268.0 9.628148148148147 1.0 - - - - - - - 0.0 0 0 ZNF571 zinc finger protein 571 1429 183 C20140704_OR004_04 C20140704_OR004_04 TB427865.[MT7]-GSQLTEHQR.2y8_1.heavy 600.316 / 998.501 781.0 15.408100128173828 40 16 6 10 8 3.430712645867662 29.148462818782363 0.0 4 0.9681714205395583 6.899141395187261 781.0 18.13484794275492 0.0 - - - - - - - 0.0 1 0 ZNF571 zinc finger protein 571 1431 183 C20140704_OR004_04 C20140704_OR004_04 TB427865.[MT7]-GSQLTEHQR.2y5_1.heavy 600.316 / 670.327 1084.0 15.408100128173828 40 16 6 10 8 3.430712645867662 29.148462818782363 0.0 4 0.9681714205395583 6.899141395187261 1084.0 18.211934622284232 0.0 - - - - - - - 95.4 2 5 ZNF571 zinc finger protein 571 1433 183 C20140704_OR004_04 C20140704_OR004_04 TB427865.[MT7]-GSQLTEHQR.2b4_1.heavy 600.316 / 530.305 520.0 15.408100128173828 40 16 6 10 8 3.430712645867662 29.148462818782363 0.0 4 0.9681714205395583 6.899141395187261 520.0 13.125581395348838 1.0 - - - - - - - 0.0 1 0 ZNF571 zinc finger protein 571 1435 183 C20140704_OR004_04 C20140704_OR004_04 TB427865.[MT7]-GSQLTEHQR.2b6_1.heavy 600.316 / 760.396 564.0 15.408100128173828 40 16 6 10 8 3.430712645867662 29.148462818782363 0.0 4 0.9681714205395583 6.899141395187261 564.0 10.30259946949602 1.0 - - - - - - - 130.2 3 5 ZNF571 zinc finger protein 571 1437 184 C20140704_OR004_04 C20140704_OR004_04 TB413968.[MT7]-EMGTPLADTPTRPVTR.3y15_2.heavy 629.336 / 806.927 8912.0 27.104350090026855 42 17 10 5 10 3.2602557317064367 30.672440516701254 0.04070091247558594 3 0.9736256058674888 7.582491871525828 8912.0 91.55497267759563 0.0 - - - - - - - 244.0 17 6 DPYSL5 dihydropyrimidinase-like 5 1439 184 C20140704_OR004_04 C20140704_OR004_04 TB413968.[MT7]-EMGTPLADTPTRPVTR.3b4_1.heavy 629.336 / 563.262 10987.0 27.104350090026855 42 17 10 5 10 3.2602557317064367 30.672440516701254 0.04070091247558594 3 0.9736256058674888 7.582491871525828 10987.0 26.44526977279264 0.0 - - - - - - - 305.0 21 4 DPYSL5 dihydropyrimidinase-like 5 1441 184 C20140704_OR004_04 C20140704_OR004_04 TB413968.[MT7]-EMGTPLADTPTRPVTR.3y14_2.heavy 629.336 / 741.407 5494.0 27.104350090026855 42 17 10 5 10 3.2602557317064367 30.672440516701254 0.04070091247558594 3 0.9736256058674888 7.582491871525828 5494.0 35.826229508196725 1.0 - - - - - - - 244.0 10 8 DPYSL5 dihydropyrimidinase-like 5 1443 184 C20140704_OR004_04 C20140704_OR004_04 TB413968.[MT7]-EMGTPLADTPTRPVTR.3y12_2.heavy 629.336 / 662.373 10865.0 27.104350090026855 42 17 10 5 10 3.2602557317064367 30.672440516701254 0.04070091247558594 3 0.9736256058674888 7.582491871525828 10865.0 117.55573770491804 0.0 - - - - - - - 244.0 21 7 DPYSL5 dihydropyrimidinase-like 5 1445 185 C20140704_OR004_04 C20140704_OR004_04 TB414085.[MT7]-RVVDFIDEGVNIGLEVK[MT7].4b7_1.heavy 548.315 / 989.554 2234.0 44.28719838460287 37 12 10 5 10 1.1797265363087224 58.210350566647676 0.04019927978515625 3 0.890111481855267 3.6883028513698934 2234.0 23.379069767441862 0.0 - - - - - - - 172.0 4 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1447 185 C20140704_OR004_04 C20140704_OR004_04 TB414085.[MT7]-RVVDFIDEGVNIGLEVK[MT7].4b4_1.heavy 548.315 / 614.374 1719.0 44.28719838460287 37 12 10 5 10 1.1797265363087224 58.210350566647676 0.04019927978515625 3 0.890111481855267 3.6883028513698934 1719.0 20.388139534883717 1.0 - - - - - - - 172.0 3 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1449 185 C20140704_OR004_04 C20140704_OR004_04 TB414085.[MT7]-RVVDFIDEGVNIGLEVK[MT7].4b5_1.heavy 548.315 / 761.443 2234.0 44.28719838460287 37 12 10 5 10 1.1797265363087224 58.210350566647676 0.04019927978515625 3 0.890111481855267 3.6883028513698934 2234.0 36.10767441860465 0.0 - - - - - - - 143.33333333333334 4 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1451 185 C20140704_OR004_04 C20140704_OR004_04 TB414085.[MT7]-RVVDFIDEGVNIGLEVK[MT7].4b9_1.heavy 548.315 / 1175.62 N/A 44.28719838460287 37 12 10 5 10 1.1797265363087224 58.210350566647676 0.04019927978515625 3 0.890111481855267 3.6883028513698934 0.0 0.0 7.0 - - - - - - - 0.0 0 0 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1453 186 C20140704_OR004_04 C20140704_OR004_04 TB414160.[MT7]-QPLDMSEVFAFHLDRILGLNR.4b7_1.heavy 654.603 / 945.447 4455.0 50.815850257873535 43 17 10 6 10 7.797619000740823 12.824427558014744 0.036602020263671875 3 0.977617074865527 8.233614679934396 4455.0 30.85644923146816 0.0 - - - - - - - 148.58333333333334 8 12 FAM198B family with sequence similarity 198, member B 1455 186 C20140704_OR004_04 C20140704_OR004_04 TB414160.[MT7]-QPLDMSEVFAFHLDRILGLNR.4y12_2.heavy 654.603 / 712.91 4267.0 50.815850257873535 43 17 10 6 10 7.797619000740823 12.824427558014744 0.036602020263671875 3 0.977617074865527 8.233614679934396 4267.0 59.46563829787234 0.0 - - - - - - - 187.63636363636363 8 11 FAM198B family with sequence similarity 198, member B 1457 186 C20140704_OR004_04 C20140704_OR004_04 TB414160.[MT7]-QPLDMSEVFAFHLDRILGLNR.4b5_1.heavy 654.603 / 729.372 1032.0 50.815850257873535 43 17 10 6 10 7.797619000740823 12.824427558014744 0.036602020263671875 3 0.977617074865527 8.233614679934396 1032.0 7.3054099193958315 1.0 - - - - - - - 112.73333333333333 2 15 FAM198B family with sequence similarity 198, member B 1459 186 C20140704_OR004_04 C20140704_OR004_04 TB414160.[MT7]-QPLDMSEVFAFHLDRILGLNR.4y13_2.heavy 654.603 / 786.444 5721.0 50.815850257873535 43 17 10 6 10 7.797619000740823 12.824427558014744 0.036602020263671875 3 0.977617074865527 8.233614679934396 5721.0 132.743487544484 0.0 - - - - - - - 159.5 11 10 FAM198B family with sequence similarity 198, member B 1461 187 C20140704_OR004_04 C20140704_OR004_04 TB451380.[MT7]-EITLLEQR.2y5_1.heavy 573.336 / 658.388 13835.0 33.4807014465332 47 17 10 10 10 2.823349120378688 35.41892827855001 0.0 3 0.9775485818793468 8.220998548057256 13835.0 26.274158770162764 0.0 - - - - - - - 228.4 27 5 C21orf7 chromosome 21 open reading frame 7 1463 187 C20140704_OR004_04 C20140704_OR004_04 TB451380.[MT7]-EITLLEQR.2b4_1.heavy 573.336 / 601.368 23962.0 33.4807014465332 47 17 10 10 10 2.823349120378688 35.41892827855001 0.0 3 0.9775485818793468 8.220998548057256 23962.0 36.3527601916894 0.0 - - - - - - - 744.8888888888889 47 9 C21orf7 chromosome 21 open reading frame 7 1465 187 C20140704_OR004_04 C20140704_OR004_04 TB451380.[MT7]-EITLLEQR.2y6_1.heavy 573.336 / 759.436 26244.0 33.4807014465332 47 17 10 10 10 2.823349120378688 35.41892827855001 0.0 3 0.9775485818793468 8.220998548057256 26244.0 141.1276586325627 0.0 - - - - - - - 326.0 52 7 C21orf7 chromosome 21 open reading frame 7 1467 187 C20140704_OR004_04 C20140704_OR004_04 TB451380.[MT7]-EITLLEQR.2y7_1.heavy 573.336 / 872.52 44216.0 33.4807014465332 47 17 10 10 10 2.823349120378688 35.41892827855001 0.0 3 0.9775485818793468 8.220998548057256 44216.0 348.95248639158876 0.0 - - - - - - - 244.57142857142858 88 7 C21orf7 chromosome 21 open reading frame 7 1469 188 C20140704_OR004_04 C20140704_OR004_04 TB451244.[MT7]-ILGLNR.2b3_1.heavy 415.272 / 428.299 2891.0 30.443599700927734 35 8 9 10 8 0.8588216681713652 75.80753361746191 0.0 4 0.7667853397033031 2.504137228908808 2891.0 10.067899306066005 1.0 - - - - - - - 236.0 14 7 FAM198B family with sequence similarity 198, member B 1471 188 C20140704_OR004_04 C20140704_OR004_04 TB451244.[MT7]-ILGLNR.2y4_1.heavy 415.272 / 459.267 5920.0 30.443599700927734 35 8 9 10 8 0.8588216681713652 75.80753361746191 0.0 4 0.7667853397033031 2.504137228908808 5920.0 85.58260869565217 0.0 - - - - - - - 260.0 11 9 FAM198B family with sequence similarity 198, member B 1473 188 C20140704_OR004_04 C20140704_OR004_04 TB451244.[MT7]-ILGLNR.2y5_1.heavy 415.272 / 572.352 3304.0 30.443599700927734 35 8 9 10 8 0.8588216681713652 75.80753361746191 0.0 4 0.7667853397033031 2.504137228908808 3304.0 23.776539378695325 2.0 - - - - - - - 262.90909090909093 7 11 FAM198B family with sequence similarity 198, member B 1475 188 C20140704_OR004_04 C20140704_OR004_04 TB451244.[MT7]-ILGLNR.2b4_1.heavy 415.272 / 541.383 1652.0 30.443599700927734 35 8 9 10 8 0.8588216681713652 75.80753361746191 0.0 4 0.7667853397033031 2.504137228908808 1652.0 2.8087067910353265 0.0 - - - - - - - 229.55555555555554 3 9 FAM198B family with sequence similarity 198, member B 1477 189 C20140704_OR004_04 C20140704_OR004_04 TB427770.[MT7]-LMEWTSLQNMR.3y6_1.heavy 518.263 / 748.377 2638.0 41.61759948730469 43 17 10 6 10 3.9041984263790366 25.61345225804657 0.03279876708984375 3 0.9757570853350191 7.910221546485288 2638.0 26.239680851063827 0.0 - - - - - - - 169.4 5 5 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1479 189 C20140704_OR004_04 C20140704_OR004_04 TB427770.[MT7]-LMEWTSLQNMR.3b4_1.heavy 518.263 / 704.356 848.0 41.61759948730469 43 17 10 6 10 3.9041984263790366 25.61345225804657 0.03279876708984375 3 0.9757570853350191 7.910221546485288 848.0 9.56255319148936 2.0 - - - - - - - 0.0 1 0 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1481 189 C20140704_OR004_04 C20140704_OR004_04 TB427770.[MT7]-LMEWTSLQNMR.3y4_1.heavy 518.263 / 548.261 5559.0 41.61759948730469 43 17 10 6 10 3.9041984263790366 25.61345225804657 0.03279876708984375 3 0.9757570853350191 7.910221546485288 5559.0 25.94281121986304 0.0 - - - - - - - 188.25 11 8 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1483 189 C20140704_OR004_04 C20140704_OR004_04 TB427770.[MT7]-LMEWTSLQNMR.3y5_1.heavy 518.263 / 661.345 2450.0 41.61759948730469 43 17 10 6 10 3.9041984263790366 25.61345225804657 0.03279876708984375 3 0.9757570853350191 7.910221546485288 2450.0 8.657243816254416 0.0 - - - - - - - 211.75 4 4 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1485 190 C20140704_OR004_04 C20140704_OR004_04 TB428036.[MT7]-SGNVHHQFQK[MT7].2y5_1.heavy 735.396 / 831.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1487 190 C20140704_OR004_04 C20140704_OR004_04 TB428036.[MT7]-SGNVHHQFQK[MT7].2b4_1.heavy 735.396 / 502.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1489 190 C20140704_OR004_04 C20140704_OR004_04 TB428036.[MT7]-SGNVHHQFQK[MT7].2y3_1.heavy 735.396 / 566.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1491 190 C20140704_OR004_04 C20140704_OR004_04 TB428036.[MT7]-SGNVHHQFQK[MT7].2b5_1.heavy 735.396 / 639.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1493 191 C20140704_OR004_04 C20140704_OR004_04 TB427814.[MT7]-AALEALGSC[CAM]LNNK[MT7].3y3_1.heavy 550.303 / 519.301 38996.0 34.9903507232666 40 14 10 6 10 1.2566406150063367 52.31062236605547 0.037502288818359375 3 0.9463909211552101 5.306200602272516 38996.0 135.5543709268025 0.0 - - - - - - - 658.4 77 10 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1495 191 C20140704_OR004_04 C20140704_OR004_04 TB427814.[MT7]-AALEALGSC[CAM]LNNK[MT7].3b4_1.heavy 550.303 / 529.31 29182.0 34.9903507232666 40 14 10 6 10 1.2566406150063367 52.31062236605547 0.037502288818359375 3 0.9463909211552101 5.306200602272516 29182.0 93.25150226798186 0.0 - - - - - - - 746.2222222222222 58 9 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1497 191 C20140704_OR004_04 C20140704_OR004_04 TB427814.[MT7]-AALEALGSC[CAM]LNNK[MT7].3b5_1.heavy 550.303 / 600.347 63400.0 34.9903507232666 40 14 10 6 10 1.2566406150063367 52.31062236605547 0.037502288818359375 3 0.9463909211552101 5.306200602272516 63400.0 336.5143638850889 0.0 - - - - - - - 272.3333333333333 126 9 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1499 191 C20140704_OR004_04 C20140704_OR004_04 TB427814.[MT7]-AALEALGSC[CAM]LNNK[MT7].3y4_1.heavy 550.303 / 632.385 17948.0 34.9903507232666 40 14 10 6 10 1.2566406150063367 52.31062236605547 0.037502288818359375 3 0.9463909211552101 5.306200602272516 17948.0 35.36718831652802 0.0 - - - - - - - 246.27272727272728 35 11 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1501 192 C20140704_OR004_04 C20140704_OR004_04 TB451377.[MT7]-LIDVIEHR.2y5_1.heavy 569.839 / 653.373 10678.0 33.787601470947266 43 13 10 10 10 1.338974272011659 50.97399343630856 0.0 3 0.9229589132508678 4.417460965418326 10678.0 36.385222482435594 0.0 - - - - - - - 336.45454545454544 21 11 FAM198B family with sequence similarity 198, member B 1503 192 C20140704_OR004_04 C20140704_OR004_04 TB451377.[MT7]-LIDVIEHR.2b4_1.heavy 569.839 / 585.373 4271.0 33.787601470947266 43 13 10 10 10 1.338974272011659 50.97399343630856 0.0 3 0.9229589132508678 4.417460965418326 4271.0 19.10447306791569 0.0 - - - - - - - 773.0 8 7 FAM198B family with sequence similarity 198, member B 1505 192 C20140704_OR004_04 C20140704_OR004_04 TB451377.[MT7]-LIDVIEHR.2y6_1.heavy 569.839 / 768.4 3417.0 33.787601470947266 43 13 10 10 10 1.338974272011659 50.97399343630856 0.0 3 0.9229589132508678 4.417460965418326 3417.0 18.712564033033402 0.0 - - - - - - - 313.2 6 10 FAM198B family with sequence similarity 198, member B 1507 192 C20140704_OR004_04 C20140704_OR004_04 TB451377.[MT7]-LIDVIEHR.2y7_1.heavy 569.839 / 881.484 3702.0 33.787601470947266 43 13 10 10 10 1.338974272011659 50.97399343630856 0.0 3 0.9229589132508678 4.417460965418326 3702.0 19.912315592259336 0.0 - - - - - - - 300.55555555555554 7 9 FAM198B family with sequence similarity 198, member B 1509 193 C20140704_OR004_04 C20140704_OR004_04 TB427817.[MT7]-SIIPTVGK[MT7].2y4_1.heavy 551.857 / 548.352 2839.0 31.052799224853516 46 18 10 10 8 4.838115598621152 20.669204354790466 0.0 4 0.9872809815942695 10.93135952235649 2839.0 0.6498811716622941 5.0 - - - - - - - 255.6 7 5 RBL1 retinoblastoma-like 1 (p107) 1511 193 C20140704_OR004_04 C20140704_OR004_04 TB427817.[MT7]-SIIPTVGK[MT7].2y5_1.heavy 551.857 / 645.405 36909.0 31.052799224853516 46 18 10 10 8 4.838115598621152 20.669204354790466 0.0 4 0.9872809815942695 10.93135952235649 36909.0 113.71610915492957 0.0 - - - - - - - 236.66666666666666 73 6 RBL1 retinoblastoma-like 1 (p107) 1513 193 C20140704_OR004_04 C20140704_OR004_04 TB427817.[MT7]-SIIPTVGK[MT7].2y6_1.heavy 551.857 / 758.489 1704.0 31.052799224853516 46 18 10 10 8 4.838115598621152 20.669204354790466 0.0 4 0.9872809815942695 10.93135952235649 1704.0 -0.28345156878914857 5.0 - - - - - - - 284.0 5 5 RBL1 retinoblastoma-like 1 (p107) 1515 193 C20140704_OR004_04 C20140704_OR004_04 TB427817.[MT7]-SIIPTVGK[MT7].2y7_1.heavy 551.857 / 871.573 994.0 31.052799224853516 46 18 10 10 8 4.838115598621152 20.669204354790466 0.0 4 0.9872809815942695 10.93135952235649 994.0 8.516666666666666 2.0 - - - - - - - 0.0 1 0 RBL1 retinoblastoma-like 1 (p107) 1517 194 C20140704_OR004_04 C20140704_OR004_04 TB413950.[MT7]-SPGETFRGEQSAFK[MT7].3y7_1.heavy 610.319 / 910.475 2192.0 27.06369972229004 45 20 10 5 10 14.322540786543309 6.982001412344005 0.040599822998046875 3 0.9901568332486425 12.429053798181357 2192.0 5.821857217926582 0.0 - - - - - - - 269.5 4 6 C7orf43 chromosome 7 open reading frame 43 1519 194 C20140704_OR004_04 C20140704_OR004_04 TB413950.[MT7]-SPGETFRGEQSAFK[MT7].3y3_1.heavy 610.319 / 509.32 2538.0 27.06369972229004 45 20 10 5 10 14.322540786543309 6.982001412344005 0.040599822998046875 3 0.9901568332486425 12.429053798181357 2538.0 3.6127629447668497 1.0 - - - - - - - 295.0 5 9 C7orf43 chromosome 7 open reading frame 43 1521 194 C20140704_OR004_04 C20140704_OR004_04 TB413950.[MT7]-SPGETFRGEQSAFK[MT7].3y4_1.heavy 610.319 / 596.352 2769.0 27.06369972229004 45 20 10 5 10 14.322540786543309 6.982001412344005 0.040599822998046875 3 0.9901568332486425 12.429053798181357 2769.0 7.571325123817904 1.0 - - - - - - - 275.15384615384613 5 13 C7orf43 chromosome 7 open reading frame 43 1523 194 C20140704_OR004_04 C20140704_OR004_04 TB413950.[MT7]-SPGETFRGEQSAFK[MT7].3y13_2.heavy 610.319 / 799.408 31384.0 27.06369972229004 45 20 10 5 10 14.322540786543309 6.982001412344005 0.040599822998046875 3 0.9901568332486425 12.429053798181357 31384.0 82.06934859497511 0.0 - - - - - - - 259.75 62 4 C7orf43 chromosome 7 open reading frame 43 1525 195 C20140704_OR004_04 C20140704_OR004_04 TB427818.[MT7]-QLC[CAM]EEER.2b3_1.heavy 554.265 / 546.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 1527 195 C20140704_OR004_04 C20140704_OR004_04 TB427818.[MT7]-QLC[CAM]EEER.2y5_1.heavy 554.265 / 722.277 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 1529 195 C20140704_OR004_04 C20140704_OR004_04 TB427818.[MT7]-QLC[CAM]EEER.2b4_1.heavy 554.265 / 675.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 1531 195 C20140704_OR004_04 C20140704_OR004_04 TB427818.[MT7]-QLC[CAM]EEER.2y6_1.heavy 554.265 / 835.361 N/A N/A - - - - - - - - - 0.0 - - - - - - - C7orf43 chromosome 7 open reading frame 43 1533 196 C20140704_OR004_04 C20140704_OR004_04 TB428268.[MT7]-IFLGADAEEEIGTPRK[MT7].4y5_1.heavy 509.283 / 702.438 1169.0 34.95279884338379 32 10 10 6 6 1.775643221600535 44.86855419170159 0.037601470947265625 6 0.8381236286794213 3.025032749150384 1169.0 -0.5 2.0 - - - - - - - 130.0 2 5 RBL1 retinoblastoma-like 1 (p107) 1535 196 C20140704_OR004_04 C20140704_OR004_04 TB428268.[MT7]-IFLGADAEEEIGTPRK[MT7].4b4_1.heavy 509.283 / 575.367 520.0 34.95279884338379 32 10 10 6 6 1.775643221600535 44.86855419170159 0.037601470947265625 6 0.8381236286794213 3.025032749150384 520.0 0.13353876000664253 17.0 - - - - - - - 286.0 3 5 RBL1 retinoblastoma-like 1 (p107) 1537 196 C20140704_OR004_04 C20140704_OR004_04 TB428268.[MT7]-IFLGADAEEEIGTPRK[MT7].4b5_1.heavy 509.283 / 646.404 1039.0 34.95279884338379 32 10 10 6 6 1.775643221600535 44.86855419170159 0.037601470947265625 6 0.8381236286794213 3.025032749150384 1039.0 3.4376774919995254 4.0 - - - - - - - 241.42857142857142 3 7 RBL1 retinoblastoma-like 1 (p107) 1539 196 C20140704_OR004_04 C20140704_OR004_04 TB428268.[MT7]-IFLGADAEEEIGTPRK[MT7].4b6_1.heavy 509.283 / 761.431 1948.0 34.95279884338379 32 10 10 6 6 1.775643221600535 44.86855419170159 0.037601470947265625 6 0.8381236286794213 3.025032749150384 1948.0 6.967846153846153 2.0 - - - - - - - 173.33333333333334 4 3 RBL1 retinoblastoma-like 1 (p107) 1541 197 C20140704_OR004_04 C20140704_OR004_04 TB428269.[MT7]-VVDFIDEGVNIGLEVK[MT7].3b11_2.heavy 678.717 / 673.36 1832.0 47.71120071411133 39 9 10 10 10 3.4712992619082677 22.94672810668107 0.0 3 0.8002736488841777 2.7141639457566122 1832.0 31.265471620227036 1.0 - - - - - - - 218.07142857142858 14 14 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1543 197 C20140704_OR004_04 C20140704_OR004_04 TB428269.[MT7]-VVDFIDEGVNIGLEVK[MT7].3b4_1.heavy 678.717 / 605.341 8398.0 47.71120071411133 39 9 10 10 10 3.4712992619082677 22.94672810668107 0.0 3 0.8002736488841777 2.7141639457566122 8398.0 51.48937704918033 0.0 - - - - - - - 198.4 16 10 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1545 197 C20140704_OR004_04 C20140704_OR004_04 TB428269.[MT7]-VVDFIDEGVNIGLEVK[MT7].3b5_1.heavy 678.717 / 718.426 4275.0 47.71120071411133 39 9 10 10 10 3.4712992619082677 22.94672810668107 0.0 3 0.8002736488841777 2.7141639457566122 4275.0 9.606741573033707 0.0 - - - - - - - 272.57142857142856 8 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1547 197 C20140704_OR004_04 C20140704_OR004_04 TB428269.[MT7]-VVDFIDEGVNIGLEVK[MT7].3y5_1.heavy 678.717 / 689.431 9772.0 47.71120071411133 39 9 10 10 10 3.4712992619082677 22.94672810668107 0.0 3 0.8002736488841777 2.7141639457566122 9772.0 161.8241852447713 0.0 - - - - - - - 207.21428571428572 19 14 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1549 198 C20140704_OR004_04 C20140704_OR004_04 TB428263.[MT7]-VLNSSSQEEISIWDIR.2y8_1.heavy 1010.53 / 1031.55 1327.0 42.58412456512451 38 12 10 6 10 1.92936913303493 51.83041352107584 0.036098480224609375 3 0.8875453876700297 3.645165555862986 1327.0 5.004718047116512 0.0 - - - - - - - 209.875 2 16 C7orf43 chromosome 7 open reading frame 43 1551 198 C20140704_OR004_04 C20140704_OR004_04 TB428263.[MT7]-VLNSSSQEEISIWDIR.2y9_1.heavy 1010.53 / 1160.59 531.0 42.58412456512451 38 12 10 6 10 1.92936913303493 51.83041352107584 0.036098480224609375 3 0.8875453876700297 3.645165555862986 531.0 -0.031865912762520154 9.0 - - - - - - - 0.0 1 0 C7orf43 chromosome 7 open reading frame 43 1553 198 C20140704_OR004_04 C20140704_OR004_04 TB428263.[MT7]-VLNSSSQEEISIWDIR.2y6_1.heavy 1010.53 / 789.425 2478.0 42.58412456512451 38 12 10 6 10 1.92936913303493 51.83041352107584 0.036098480224609375 3 0.8875453876700297 3.645165555862986 2478.0 4.2 0.0 - - - - - - - 208.9090909090909 4 11 C7orf43 chromosome 7 open reading frame 43 1555 198 C20140704_OR004_04 C20140704_OR004_04 TB428263.[MT7]-VLNSSSQEEISIWDIR.2y7_1.heavy 1010.53 / 902.509 885.0 42.58412456512451 38 12 10 6 10 1.92936913303493 51.83041352107584 0.036098480224609375 3 0.8875453876700297 3.645165555862986 885.0 7.037735849056602 0.0 - - - - - - - 0.0 1 0 C7orf43 chromosome 7 open reading frame 43 1557 199 C20140704_OR004_04 C20140704_OR004_04 TB451271.[MT7]-FLLVLR.2y4_1.heavy 452.809 / 500.355 2573.0 42.61119842529297 25 9 0 10 6 0.6849975161779578 74.46235460349155 0.0 6 0.818088366593589 2.848506772733528 2573.0 -7.796969696969697 1.0 - - - - - - - 148.5 51 2 C7orf43 chromosome 7 open reading frame 43 1559 199 C20140704_OR004_04 C20140704_OR004_04 TB451271.[MT7]-FLLVLR.2b3_1.heavy 452.809 / 518.346 990.0 42.61119842529297 25 9 0 10 6 0.6849975161779578 74.46235460349155 0.0 6 0.818088366593589 2.848506772733528 990.0 4.561904761904762 0.0 - - - - - - - 0.0 1 0 C7orf43 chromosome 7 open reading frame 43 1561 199 C20140704_OR004_04 C20140704_OR004_04 TB451271.[MT7]-FLLVLR.2y3_1.heavy 452.809 / 387.271 1286.0 42.61119842529297 25 9 0 10 6 0.6849975161779578 74.46235460349155 0.0 6 0.818088366593589 2.848506772733528 1286.0 17.21161616161616 2.0 - - - - - - - 297.0 4 4 C7orf43 chromosome 7 open reading frame 43 1563 200 C20140704_OR004_04 C20140704_OR004_04 TB428261.[MT7]-EYEEYVLTVGDFDER.2y9_1.heavy 1004.47 / 1051.51 3109.0 41.85949897766113 26 10 0 6 10 0.8370292852116895 70.68866726159305 0.034198760986328125 3 0.8486631382687592 3.1315136752560666 3109.0 13.957882673004159 0.0 - - - - - - - 219.88888888888889 6 9 RBL1 retinoblastoma-like 1 (p107) 1565 200 C20140704_OR004_04 C20140704_OR004_04 TB428261.[MT7]-EYEEYVLTVGDFDER.2b4_1.heavy 1004.47 / 695.3 1696.0 41.85949897766113 26 10 0 6 10 0.8370292852116895 70.68866726159305 0.034198760986328125 3 0.8486631382687592 3.1315136752560666 1696.0 16.779574468085105 0.0 - - - - - - - 202.69230769230768 3 13 RBL1 retinoblastoma-like 1 (p107) 1567 200 C20140704_OR004_04 C20140704_OR004_04 TB428261.[MT7]-EYEEYVLTVGDFDER.2b6_1.heavy 1004.47 / 957.432 2261.0 41.85949897766113 26 10 0 6 10 0.8370292852116895 70.68866726159305 0.034198760986328125 3 0.8486631382687592 3.1315136752560666 2261.0 22.850531914893615 1.0 - - - - - - - 200.0 4 8 RBL1 retinoblastoma-like 1 (p107) 1569 200 C20140704_OR004_04 C20140704_OR004_04 TB428261.[MT7]-EYEEYVLTVGDFDER.2b5_1.heavy 1004.47 / 858.364 1508.0 41.85949897766113 26 10 0 6 10 0.8370292852116895 70.68866726159305 0.034198760986328125 3 0.8486631382687592 3.1315136752560666 1508.0 0.7 3.0 - - - - - - - 242.14285714285714 21 7 RBL1 retinoblastoma-like 1 (p107) 1571 201 C20140704_OR004_04 C20140704_OR004_04 TB427950.[MT7]-NELLGAGIEK[MT7].3b4_1.heavy 444.597 / 614.363 4386.0 31.550500869750977 38 18 0 10 10 4.695857022771323 21.295367281217533 0.0 3 0.9818635193051993 9.150130460994811 4386.0 19.90638473069922 0.0 - - - - - - - 212.0 8 2 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1573 201 C20140704_OR004_04 C20140704_OR004_04 TB427950.[MT7]-NELLGAGIEK[MT7].3b5_1.heavy 444.597 / 671.385 8630.0 31.550500869750977 38 18 0 10 10 4.695857022771323 21.295367281217533 0.0 3 0.9818635193051993 9.150130460994811 8630.0 56.72014134275618 0.0 - - - - - - - 212.0 17 2 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1575 201 C20140704_OR004_04 C20140704_OR004_04 TB427950.[MT7]-NELLGAGIEK[MT7].3y4_1.heavy 444.597 / 590.363 N/A 31.550500869750977 38 18 0 10 10 4.695857022771323 21.295367281217533 0.0 3 0.9818635193051993 9.150130460994811 7923.0 12.66533069346659 2.0 - - - - - - - 282.75 224 4 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1577 201 C20140704_OR004_04 C20140704_OR004_04 TB427950.[MT7]-NELLGAGIEK[MT7].3b3_1.heavy 444.597 / 501.279 20373.0 31.550500869750977 38 18 0 10 10 4.695857022771323 21.295367281217533 0.0 3 0.9818635193051993 9.150130460994811 20373.0 53.59799151343705 0.0 - - - - - - - 169.4 40 5 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1579 202 C20140704_OR004_04 C20140704_OR004_04 TB413629.[MT7]-EYSLQVLK[MT7].3y3_1.heavy 423.255 / 503.367 7964.0 33.70249938964844 40 12 10 10 8 1.7608027366527903 45.10072819822675 0.0 4 0.8997661823429428 3.86508532394636 7964.0 69.39568175463785 0.0 - - - - - - - 133.0 15 1 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1581 202 C20140704_OR004_04 C20140704_OR004_04 TB413629.[MT7]-EYSLQVLK[MT7].3b4_1.heavy 423.255 / 637.331 1726.0 33.70249938964844 40 12 10 10 8 1.7608027366527903 45.10072819822675 0.0 4 0.8997661823429428 3.86508532394636 1726.0 -0.35917138425390027 2.0 - - - - - - - 265.25 3 4 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1583 202 C20140704_OR004_04 C20140704_OR004_04 TB413629.[MT7]-EYSLQVLK[MT7].3b5_1.heavy 423.255 / 765.39 1327.0 33.70249938964844 40 12 10 10 8 1.7608027366527903 45.10072819822675 0.0 4 0.8997661823429428 3.86508532394636 1327.0 13.30163701968489 0.0 - - - - - - - 133.0 2 1 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1585 202 C20140704_OR004_04 C20140704_OR004_04 TB413629.[MT7]-EYSLQVLK[MT7].3b3_1.heavy 423.255 / 524.247 5044.0 33.70249938964844 40 12 10 10 8 1.7608027366527903 45.10072819822675 0.0 4 0.8997661823429428 3.86508532394636 5044.0 37.87546408189148 0.0 - - - - - - - 133.0 10 3 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1587 203 C20140704_OR004_04 C20140704_OR004_04 TB451772.[MT7]-EHGIQVQEWINPVLPDFQK[MT7].4b8_1.heavy 642.098 / 1065.54 415.0 38.12242412567139 20 3 10 5 2 0.41453112551497956 115.23605034575098 0.042301177978515625 13 0.5655626314650808 1.79990041191368 415.0 2.554153697939825 26.0 - - - - - - - 0.0 1 0 RAD17 RAD17 homolog (S. pombe) 1589 203 C20140704_OR004_04 C20140704_OR004_04 TB451772.[MT7]-EHGIQVQEWINPVLPDFQK[MT7].4y5_1.heavy 642.098 / 778.422 1659.0 38.12242412567139 20 3 10 5 2 0.41453112551497956 115.23605034575098 0.042301177978515625 13 0.5655626314650808 1.79990041191368 1659.0 5.867845659163987 1.0 - - - - - - - 197.0 3 10 RAD17 RAD17 homolog (S. pombe) 1591 203 C20140704_OR004_04 C20140704_OR004_04 TB451772.[MT7]-EHGIQVQEWINPVLPDFQK[MT7].4b4_1.heavy 642.098 / 581.316 17112.0 38.12242412567139 20 3 10 5 2 0.41453112551497956 115.23605034575098 0.042301177978515625 13 0.5655626314650808 1.79990041191368 17112.0 59.61966424375187 0.0 - - - - - - - 254.45454545454547 34 11 RAD17 RAD17 homolog (S. pombe) 1593 203 C20140704_OR004_04 C20140704_OR004_04 TB451772.[MT7]-EHGIQVQEWINPVLPDFQK[MT7].4b5_1.heavy 642.098 / 709.375 726.0 38.12242412567139 20 3 10 5 2 0.41453112551497956 115.23605034575098 0.042301177978515625 13 0.5655626314650808 1.79990041191368 726.0 2.3215976283003292 27.0 - - - - - - - 230.44444444444446 4 9 RAD17 RAD17 homolog (S. pombe) 1595 204 C20140704_OR004_04 C20140704_OR004_04 TB427952.[MT7]-DGLAYSALLK[MT7].3y3_1.heavy 446.934 / 517.383 2410.0 37.04909896850586 46 16 10 10 10 4.009235561737769 24.942410706507818 0.0 3 0.9671270758745506 6.788069099532258 2410.0 17.93388429752066 1.0 - - - - - - - 151.0 4 4 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1597 204 C20140704_OR004_04 C20140704_OR004_04 TB427952.[MT7]-DGLAYSALLK[MT7].3b4_1.heavy 446.934 / 501.279 3254.0 37.04909896850586 46 16 10 10 10 4.009235561737769 24.942410706507818 0.0 3 0.9671270758745506 6.788069099532258 3254.0 34.17732614949089 0.0 - - - - - - - 224.0 6 7 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1599 204 C20140704_OR004_04 C20140704_OR004_04 TB427952.[MT7]-DGLAYSALLK[MT7].3b5_1.heavy 446.934 / 664.342 1085.0 37.04909896850586 46 16 10 10 10 4.009235561737769 24.942410706507818 0.0 3 0.9671270758745506 6.788069099532258 1085.0 11.127937999382736 0.0 - - - - - - - 289.4 2 5 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1601 204 C20140704_OR004_04 C20140704_OR004_04 TB427952.[MT7]-DGLAYSALLK[MT7].3y4_1.heavy 446.934 / 588.42 964.0 37.04909896850586 46 16 10 10 10 4.009235561737769 24.942410706507818 0.0 3 0.9671270758745506 6.788069099532258 964.0 3.276574585635359 1.0 - - - - - - - 193.2 2 5 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1603 205 C20140704_OR004_04 C20140704_OR004_04 TB413851.[MT7]-GLELIASENFC[CAM]SR.3y7_1.heavy 547.279 / 899.368 3777.0 38.56650161743164 48 18 10 10 10 3.145227646753836 24.65430158848656 0.0 3 0.9894702612374366 12.01632731502662 3777.0 12.083758741258741 0.0 - - - - - - - 300.25 7 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1605 205 C20140704_OR004_04 C20140704_OR004_04 TB413851.[MT7]-GLELIASENFC[CAM]SR.3b4_1.heavy 547.279 / 557.341 15907.0 38.56650161743164 48 18 10 10 10 3.145227646753836 24.65430158848656 0.0 3 0.9894702612374366 12.01632731502662 15907.0 25.022247191011235 0.0 - - - - - - - 784.8571428571429 31 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1607 205 C20140704_OR004_04 C20140704_OR004_04 TB413851.[MT7]-GLELIASENFC[CAM]SR.3y4_1.heavy 547.279 / 569.25 5951.0 38.56650161743164 48 18 10 10 10 3.145227646753836 24.65430158848656 0.0 3 0.9894702612374366 12.01632731502662 5951.0 13.761807475261088 0.0 - - - - - - - 291.09090909090907 11 11 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1609 205 C20140704_OR004_04 C20140704_OR004_04 TB413851.[MT7]-GLELIASENFC[CAM]SR.3y5_1.heavy 547.279 / 683.293 5493.0 38.56650161743164 48 18 10 10 10 3.145227646753836 24.65430158848656 0.0 3 0.9894702612374366 12.01632731502662 5493.0 10.656587675414423 0.0 - - - - - - - 228.5 10 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1611 206 C20140704_OR004_04 C20140704_OR004_04 TB414096.[MT7]-VDAAELVREFEALTEENR.4y4_1.heavy 559.54 / 547.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - C21orf7 chromosome 21 open reading frame 7 1613 206 C20140704_OR004_04 C20140704_OR004_04 TB414096.[MT7]-VDAAELVREFEALTEENR.4y5_1.heavy 559.54 / 648.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - C21orf7 chromosome 21 open reading frame 7 1615 206 C20140704_OR004_04 C20140704_OR004_04 TB414096.[MT7]-VDAAELVREFEALTEENR.4b11_2.heavy 559.54 / 702.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - C21orf7 chromosome 21 open reading frame 7 1617 206 C20140704_OR004_04 C20140704_OR004_04 TB414096.[MT7]-VDAAELVREFEALTEENR.4b5_1.heavy 559.54 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - C21orf7 chromosome 21 open reading frame 7 1619 207 C20140704_OR004_04 C20140704_OR004_04 TB451370.[MT7]-AFISNSNLIQHQR.3b5_1.heavy 557.973 / 677.374 6977.0 29.162900924682617 45 15 10 10 10 2.9431376172149704 33.97734425161808 0.0 3 0.9565304323743768 5.897715291344077 6977.0 33.97759945287985 0.0 - - - - - - - 240.7 13 10 ZNF571 zinc finger protein 571 1621 207 C20140704_OR004_04 C20140704_OR004_04 TB451370.[MT7]-AFISNSNLIQHQR.3y4_1.heavy 557.973 / 568.295 54976.0 29.162900924682617 45 15 10 10 10 2.9431376172149704 33.97734425161808 0.0 3 0.9565304323743768 5.897715291344077 54976.0 22.270562729432086 0.0 - - - - - - - 481.0 109 1 ZNF571 zinc finger protein 571 1623 207 C20140704_OR004_04 C20140704_OR004_04 TB451370.[MT7]-AFISNSNLIQHQR.3b7_1.heavy 557.973 / 878.449 10105.0 29.162900924682617 45 15 10 10 10 2.9431376172149704 33.97734425161808 0.0 3 0.9565304323743768 5.897715291344077 10105.0 99.92895029118135 0.0 - - - - - - - 320.8333333333333 20 6 ZNF571 zinc finger protein 571 1625 207 C20140704_OR004_04 C20140704_OR004_04 TB451370.[MT7]-AFISNSNLIQHQR.3y5_1.heavy 557.973 / 681.379 29593.0 29.162900924682617 45 15 10 10 10 2.9431376172149704 33.97734425161808 0.0 3 0.9565304323743768 5.897715291344077 29593.0 34.606246292988885 0.0 - - - - - - - 216.4 59 5 ZNF571 zinc finger protein 571 1627 208 C20140704_OR004_04 C20140704_OR004_04 TB413752.[MT7]-K[MT7]IEALLNLPR.2b3_1.heavy 727.969 / 659.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1629 208 C20140704_OR004_04 C20140704_OR004_04 TB413752.[MT7]-K[MT7]IEALLNLPR.2y8_1.heavy 727.969 / 925.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1631 208 C20140704_OR004_04 C20140704_OR004_04 TB413752.[MT7]-K[MT7]IEALLNLPR.2b4_1.heavy 727.969 / 730.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1633 208 C20140704_OR004_04 C20140704_OR004_04 TB413752.[MT7]-K[MT7]IEALLNLPR.2y9_1.heavy 727.969 / 1038.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1635 209 C20140704_OR004_04 C20140704_OR004_04 TB427811.[MT7]-AEMETLVR.2b4_1.heavy 546.796 / 605.272 8244.0 29.313199996948242 50 20 10 10 10 21.68275634549851 4.611959771468847 0.0 3 0.9989576151527716 38.22175220508079 8244.0 20.938026979508166 0.0 - - - - - - - 223.6 16 5 DPYSL5 dihydropyrimidinase-like 5 1637 209 C20140704_OR004_04 C20140704_OR004_04 TB427811.[MT7]-AEMETLVR.2y6_1.heavy 546.796 / 748.402 10899.0 29.313199996948242 50 20 10 10 10 21.68275634549851 4.611959771468847 0.0 3 0.9989576151527716 38.22175220508079 10899.0 45.88438398061054 0.0 - - - - - - - 279.1666666666667 21 6 DPYSL5 dihydropyrimidinase-like 5 1639 209 C20140704_OR004_04 C20140704_OR004_04 TB427811.[MT7]-AEMETLVR.2b5_1.heavy 546.796 / 706.32 7127.0 29.313199996948242 50 20 10 10 10 21.68275634549851 4.611959771468847 0.0 3 0.9989576151527716 38.22175220508079 7127.0 41.278328585726385 0.0 - - - - - - - 251.4 14 5 DPYSL5 dihydropyrimidinase-like 5 1641 209 C20140704_OR004_04 C20140704_OR004_04 TB427811.[MT7]-AEMETLVR.2y7_1.heavy 546.796 / 877.445 13275.0 29.313199996948242 50 20 10 10 10 21.68275634549851 4.611959771468847 0.0 3 0.9989576151527716 38.22175220508079 13275.0 107.81807449710195 0.0 - - - - - - - 140.0 26 4 DPYSL5 dihydropyrimidinase-like 5 1643 210 C20140704_OR004_04 C20140704_OR004_04 TB413750.[MT7]-MREVC[CAM]DEVK[MT7].3y3_1.heavy 485.251 / 519.326 5221.0 22.53330087661743 39 13 10 6 10 9.302433969807325 10.74987474510085 0.03800010681152344 3 0.9062155228318627 3.9980000976858765 5221.0 72.90607291185971 0.0 - - - - - - - 170.36363636363637 10 11 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1645 210 C20140704_OR004_04 C20140704_OR004_04 TB413750.[MT7]-MREVC[CAM]DEVK[MT7].3b6_1.heavy 485.251 / 935.419 1478.0 22.53330087661743 39 13 10 6 10 9.302433969807325 10.74987474510085 0.03800010681152344 3 0.9062155228318627 3.9980000976858765 1478.0 28.365656565656565 0.0 - - - - - - - 279.3333333333333 2 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1647 210 C20140704_OR004_04 C20140704_OR004_04 TB413750.[MT7]-MREVC[CAM]DEVK[MT7].3y4_1.heavy 485.251 / 634.353 3448.0 22.53330087661743 39 13 10 6 10 9.302433969807325 10.74987474510085 0.03800010681152344 3 0.9062155228318627 3.9980000976858765 3448.0 13.232486815415822 0.0 - - - - - - - 257.84615384615387 6 13 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1649 210 C20140704_OR004_04 C20140704_OR004_04 TB413750.[MT7]-MREVC[CAM]DEVK[MT7].3b7_2.heavy 485.251 / 532.735 2758.0 22.53330087661743 39 13 10 6 10 9.302433969807325 10.74987474510085 0.03800010681152344 3 0.9062155228318627 3.9980000976858765 2758.0 12.037728194726165 0.0 - - - - - - - 266.2 5 10 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1651 211 C20140704_OR004_04 C20140704_OR004_04 TB427812.[MT7]-TLTPASSPVSSPSK[MT7].3y3_1.heavy 549.645 / 475.3 16144.0 25.28059959411621 41 20 10 3 8 11.426824193530754 8.751337931375067 0.07320022583007812 4 0.9976174764493735 25.278861156666814 16144.0 22.437847464188927 0.0 - - - - - - - 229.66666666666666 32 15 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1653 211 C20140704_OR004_04 C20140704_OR004_04 TB427812.[MT7]-TLTPASSPVSSPSK[MT7].3b5_1.heavy 549.645 / 628.379 3552.0 25.28059959411621 41 20 10 3 8 11.426824193530754 8.751337931375067 0.07320022583007812 4 0.9976174764493735 25.278861156666814 3552.0 7.962400767415934 1.0 - - - - - - - 242.25 7 8 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1655 211 C20140704_OR004_04 C20140704_OR004_04 TB427812.[MT7]-TLTPASSPVSSPSK[MT7].3y4_1.heavy 549.645 / 562.332 5058.0 25.28059959411621 41 20 10 3 8 11.426824193530754 8.751337931375067 0.07320022583007812 4 0.9976174764493735 25.278861156666814 5058.0 8.233953488372093 1.0 - - - - - - - 254.36363636363637 11 11 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1657 211 C20140704_OR004_04 C20140704_OR004_04 TB427812.[MT7]-TLTPASSPVSSPSK[MT7].3y5_1.heavy 549.645 / 649.364 9686.0 25.28059959411621 41 20 10 3 8 11.426824193530754 8.751337931375067 0.07320022583007812 4 0.9976174764493735 25.278861156666814 9686.0 22.503055813953488 1.0 - - - - - - - 245.85714285714286 19 7 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1659 212 C20140704_OR004_04 C20140704_OR004_04 TB413940.[MT7]-LRELFGK[MT7]DEQQR.4y5_1.heavy 452.507 / 675.306 1689.0 28.591999053955078 41 11 10 10 10 0.9582535865244165 61.46196669889801 0.0 3 0.8787466529171906 3.507730756232338 1689.0 15.677384615384614 0.0 - - - - - - - 195.0 3 10 C3orf1 chromosome 3 open reading frame 1 1661 212 C20140704_OR004_04 C20140704_OR004_04 TB413940.[MT7]-LRELFGK[MT7]DEQQR.4y4_1.heavy 452.507 / 560.279 1949.0 28.591999053955078 41 11 10 10 10 0.9582535865244165 61.46196669889801 0.0 3 0.8787466529171906 3.507730756232338 1949.0 19.789846153846153 0.0 - - - - - - - 195.0 3 4 C3orf1 chromosome 3 open reading frame 1 1663 212 C20140704_OR004_04 C20140704_OR004_04 TB413940.[MT7]-LRELFGK[MT7]DEQQR.4y8_2.heavy 452.507 / 576.3 3509.0 28.591999053955078 41 11 10 10 10 0.9582535865244165 61.46196669889801 0.0 3 0.8787466529171906 3.507730756232338 3509.0 21.611841025641027 0.0 - - - - - - - 303.3333333333333 7 3 C3orf1 chromosome 3 open reading frame 1 1665 212 C20140704_OR004_04 C20140704_OR004_04 TB413940.[MT7]-LRELFGK[MT7]DEQQR.4y7_2.heavy 452.507 / 502.766 5068.0 28.591999053955078 41 11 10 10 10 0.9582535865244165 61.46196669889801 0.0 3 0.8787466529171906 3.507730756232338 5068.0 70.952 0.0 - - - - - - - 216.66666666666666 10 3 C3orf1 chromosome 3 open reading frame 1 1667 213 C20140704_OR004_04 C20140704_OR004_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 237055.0 43.942298889160156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 237055.0 680.0054086283333 0.0 - - - - - - - 228.22222222222223 474 9 1669 213 C20140704_OR004_04 C20140704_OR004_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 275066.0 43.942298889160156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 275066.0 931.882476635514 0.0 - - - - - - - 233.54545454545453 550 11 1671 213 C20140704_OR004_04 C20140704_OR004_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 264450.0 43.942298889160156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 264450.0 236.9553845199654 0.0 - - - - - - - 213.9 528 10 1673 214 C20140704_OR004_04 C20140704_OR004_04 TB428254.[MT7]-EADAVAPGYAQGANLVK[MT7].2b4_1.heavy 981.53 / 531.253 1437.0 30.540475368499756 28 3 10 5 10 0.28799866498229554 134.04586931336712 0.04269981384277344 3 0.5863475641910877 1.8483689222265642 1437.0 15.767083333333332 0.0 - - - - - - - 230.0 2 5 FAM198B family with sequence similarity 198, member B 1675 214 C20140704_OR004_04 C20140704_OR004_04 TB428254.[MT7]-EADAVAPGYAQGANLVK[MT7].2b6_1.heavy 981.53 / 701.359 7760.0 30.540475368499756 28 3 10 5 10 0.28799866498229554 134.04586931336712 0.04269981384277344 3 0.5863475641910877 1.8483689222265642 7760.0 99.15555555555555 0.0 - - - - - - - 144.0 15 3 FAM198B family with sequence similarity 198, member B 1677 214 C20140704_OR004_04 C20140704_OR004_04 TB428254.[MT7]-EADAVAPGYAQGANLVK[MT7].2y10_1.heavy 981.53 / 1164.65 431.0 30.540475368499756 28 3 10 5 10 0.28799866498229554 134.04586931336712 0.04269981384277344 3 0.5863475641910877 1.8483689222265642 431.0 3.9930555555555554 3.0 - - - - - - - 0.0 0 0 FAM198B family with sequence similarity 198, member B 1679 214 C20140704_OR004_04 C20140704_OR004_04 TB428254.[MT7]-EADAVAPGYAQGANLVK[MT7].2b5_1.heavy 981.53 / 630.321 6467.0 30.540475368499756 28 3 10 5 10 0.28799866498229554 134.04586931336712 0.04269981384277344 3 0.5863475641910877 1.8483689222265642 6467.0 27.67584458406356 0.0 - - - - - - - 225.85714285714286 12 7 FAM198B family with sequence similarity 198, member B 1681 215 C20140704_OR004_04 C20140704_OR004_04 TB413845.[MT7]-LVWTPEHAQAGK[MT7].3b6_1.heavy 542.307 / 870.484 2698.0 29.6028995513916 47 17 10 10 10 4.578253968989125 21.842388097591698 0.0 3 0.9714784374700162 7.290176492147645 2698.0 18.675272727272727 1.0 - - - - - - - 142.0 6 1 C7orf43 chromosome 7 open reading frame 43 1683 215 C20140704_OR004_04 C20140704_OR004_04 TB413845.[MT7]-LVWTPEHAQAGK[MT7].3b4_1.heavy 542.307 / 644.389 6249.0 29.6028995513916 47 17 10 10 10 4.578253968989125 21.842388097591698 0.0 3 0.9714784374700162 7.290176492147645 6249.0 22.00352112676056 0.0 - - - - - - - 312.4 12 5 C7orf43 chromosome 7 open reading frame 43 1685 215 C20140704_OR004_04 C20140704_OR004_04 TB413845.[MT7]-LVWTPEHAQAGK[MT7].3y4_1.heavy 542.307 / 547.332 7243.0 29.6028995513916 47 17 10 10 10 4.578253968989125 21.842388097591698 0.0 3 0.9714784374700162 7.290176492147645 7243.0 17.998199195171026 0.0 - - - - - - - 355.0 14 4 C7orf43 chromosome 7 open reading frame 43 1687 215 C20140704_OR004_04 C20140704_OR004_04 TB413845.[MT7]-LVWTPEHAQAGK[MT7].3y5_1.heavy 542.307 / 618.369 9941.0 29.6028995513916 47 17 10 10 10 4.578253968989125 21.842388097591698 0.0 3 0.9714784374700162 7.290176492147645 9941.0 45.50457746478873 0.0 - - - - - - - 284.0 19 5 C7orf43 chromosome 7 open reading frame 43 1689 216 C20140704_OR004_04 C20140704_OR004_04 TB451563.[MT7]-LMEWTSLQNMR.2y4_1.heavy 776.89 / 548.261 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1691 216 C20140704_OR004_04 C20140704_OR004_04 TB451563.[MT7]-LMEWTSLQNMR.2y8_1.heavy 776.89 / 1035.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1693 216 C20140704_OR004_04 C20140704_OR004_04 TB451563.[MT7]-LMEWTSLQNMR.2y9_1.heavy 776.89 / 1164.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1695 216 C20140704_OR004_04 C20140704_OR004_04 TB451563.[MT7]-LMEWTSLQNMR.2y7_1.heavy 776.89 / 849.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1697 217 C20140704_OR004_04 C20140704_OR004_04 TB413632.[MT7]-SGLIFYRK[MT7].3y6_1.heavy 424.595 / 983.616 N/A 29.973899841308594 40 10 10 10 10 0.6924900634029709 90.47622484000235 0.0 3 0.8284080783548944 2.9356121696081012 0.0 0.0 5.0 - - - - - - - 0.0 0 0 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1699 217 C20140704_OR004_04 C20140704_OR004_04 TB413632.[MT7]-SGLIFYRK[MT7].3b4_1.heavy 424.595 / 515.331 6430.0 29.973899841308594 40 10 10 10 10 0.6924900634029709 90.47622484000235 0.0 3 0.8284080783548944 2.9356121696081012 6430.0 16.13669039893824 0.0 - - - - - - - 238.33333333333334 12 3 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1701 217 C20140704_OR004_04 C20140704_OR004_04 TB413632.[MT7]-SGLIFYRK[MT7].3y7_2.heavy 424.595 / 520.822 9288.0 29.973899841308594 40 10 10 10 10 0.6924900634029709 90.47622484000235 0.0 3 0.8284080783548944 2.9356121696081012 9288.0 116.84693706293706 0.0 - - - - - - - 143.0 18 3 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1703 217 C20140704_OR004_04 C20140704_OR004_04 TB413632.[MT7]-SGLIFYRK[MT7].3y4_1.heavy 424.595 / 757.448 1858.0 29.973899841308594 40 10 10 10 10 0.6924900634029709 90.47622484000235 0.0 3 0.8284080783548944 2.9356121696081012 1858.0 20.788811188811188 0.0 - - - - - - - 143.0 3 1 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1705 218 C20140704_OR004_04 C20140704_OR004_04 TB428251.[MT7]-VLHFDQVTENTTEK[MT7].4b5_2.heavy 488.011 / 378.712 12473.0 29.929500579833984 41 11 10 10 10 0.7670148288720579 80.89197710874151 0.0 3 0.857952696080539 3.2349355501860635 12473.0 70.82882142857143 0.0 - - - - - - - 373.3333333333333 24 6 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1707 218 C20140704_OR004_04 C20140704_OR004_04 TB428251.[MT7]-VLHFDQVTENTTEK[MT7].4b5_1.heavy 488.011 / 756.416 4064.0 29.929500579833984 41 11 10 10 10 0.7670148288720579 80.89197710874151 0.0 3 0.857952696080539 3.2349355501860635 4064.0 18.08901104127739 0.0 - - - - - - - 240.0 8 7 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1709 218 C20140704_OR004_04 C20140704_OR004_04 TB428251.[MT7]-VLHFDQVTENTTEK[MT7].4y3_1.heavy 488.011 / 521.305 16818.0 29.929500579833984 41 11 10 10 10 0.7670148288720579 80.89197710874151 0.0 3 0.857952696080539 3.2349355501860635 16818.0 60.33411716324545 0.0 - - - - - - - 245.0 33 4 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1711 218 C20140704_OR004_04 C20140704_OR004_04 TB428251.[MT7]-VLHFDQVTENTTEK[MT7].4b6_1.heavy 488.011 / 884.475 1962.0 29.929500579833984 41 11 10 10 10 0.7670148288720579 80.89197710874151 0.0 3 0.857952696080539 3.2349355501860635 1962.0 20.986392857142857 0.0 - - - - - - - 350.0 3 2 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1713 219 C20140704_OR004_04 C20140704_OR004_04 TB428252.[MT7]-VLHFDQVTENTTEK[MT7].3y7_1.heavy 650.345 / 966.486 30875.0 29.929500579833984 44 14 10 10 10 2.4811522837513413 32.00305537554779 0.0 3 0.949254957157598 5.455212907418329 30875.0 425.63392857142856 0.0 - - - - - - - 192.75 61 8 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1715 219 C20140704_OR004_04 C20140704_OR004_04 TB428252.[MT7]-VLHFDQVTENTTEK[MT7].3b6_1.heavy 650.345 / 884.475 10947.0 29.929500579833984 44 14 10 10 10 2.4811522837513413 32.00305537554779 0.0 3 0.949254957157598 5.455212907418329 10947.0 47.29656249735844 0.0 - - - - - - - 257.3333333333333 21 6 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1717 219 C20140704_OR004_04 C20140704_OR004_04 TB428252.[MT7]-VLHFDQVTENTTEK[MT7].3y3_1.heavy 650.345 / 521.305 47295.0 29.929500579833984 44 14 10 10 10 2.4811522837513413 32.00305537554779 0.0 3 0.949254957157598 5.455212907418329 47295.0 162.33081947743466 0.0 - - - - - - - 337.0 94 5 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1719 219 C20140704_OR004_04 C20140704_OR004_04 TB428252.[MT7]-VLHFDQVTENTTEK[MT7].3b5_1.heavy 650.345 / 756.416 35366.0 29.929500579833984 44 14 10 10 10 2.4811522837513413 32.00305537554779 0.0 3 0.949254957157598 5.455212907418329 35366.0 235.3538078291815 0.0 - - - - - - - 280.8333333333333 70 6 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1721 220 C20140704_OR004_04 C20140704_OR004_04 TB451766.[MT7]-TAATAGIIGWVYGGIPAFIHAK[MT7].4b7_1.heavy 626.358 / 730.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1723 220 C20140704_OR004_04 C20140704_OR004_04 TB451766.[MT7]-TAATAGIIGWVYGGIPAFIHAK[MT7].4y7_1.heavy 626.358 / 927.553 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1725 220 C20140704_OR004_04 C20140704_OR004_04 TB451766.[MT7]-TAATAGIIGWVYGGIPAFIHAK[MT7].4b9_1.heavy 626.358 / 900.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1727 220 C20140704_OR004_04 C20140704_OR004_04 TB451766.[MT7]-TAATAGIIGWVYGGIPAFIHAK[MT7].4b6_1.heavy 626.358 / 617.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - C3orf1 chromosome 3 open reading frame 1 1729 221 C20140704_OR004_04 C20140704_OR004_04 TB451463.[MT7]-NELLGAGIEK[MT7].2y4_1.heavy 666.392 / 590.363 3535.0 31.550500869750977 48 18 10 10 10 5.638847634685877 17.734119890893396 0.0 3 0.9857965082670108 10.343069025989 3535.0 3.154090909090909 1.0 - - - - - - - 254.4 8 5 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1731 221 C20140704_OR004_04 C20140704_OR004_04 TB451463.[MT7]-NELLGAGIEK[MT7].2b3_1.heavy 666.392 / 501.279 9473.0 31.550500869750977 48 18 10 10 10 5.638847634685877 17.734119890893396 0.0 3 0.9857965082670108 10.343069025989 9473.0 36.17506217081139 0.0 - - - - - - - 311.1 18 10 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1733 221 C20140704_OR004_04 C20140704_OR004_04 TB451463.[MT7]-NELLGAGIEK[MT7].2y6_1.heavy 666.392 / 718.422 13433.0 31.550500869750977 48 18 10 10 10 5.638847634685877 17.734119890893396 0.0 3 0.9857965082670108 10.343069025989 13433.0 50.31889228757463 0.0 - - - - - - - 282.7142857142857 26 7 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1735 221 C20140704_OR004_04 C20140704_OR004_04 TB451463.[MT7]-NELLGAGIEK[MT7].2y7_1.heavy 666.392 / 831.506 7635.0 31.550500869750977 48 18 10 10 10 5.638847634685877 17.734119890893396 0.0 3 0.9857965082670108 10.343069025989 7635.0 75.71284113976392 0.0 - - - - - - - 169.4 15 5 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1737 222 C20140704_OR004_04 C20140704_OR004_04 TB413635.[MT7]-HLVFIDNK[MT7].2y5_1.heavy 637.379 / 780.437 2141.0 29.6028995513916 43 14 9 10 10 1.6956836479185797 41.162533709239085 0.0 3 0.935971814571504 4.851006136724842 2141.0 11.763389080177078 0.0 - - - - - - - 285.0 4 2 FAM198B family with sequence similarity 198, member B 1739 222 C20140704_OR004_04 C20140704_OR004_04 TB413635.[MT7]-HLVFIDNK[MT7].2y3_1.heavy 637.379 / 520.285 999.0 29.6028995513916 43 14 9 10 10 1.6956836479185797 41.162533709239085 0.0 3 0.935971814571504 4.851006136724842 999.0 5.360595671421544 16.0 - - - - - - - 285.4 7 5 FAM198B family with sequence similarity 198, member B 1741 222 C20140704_OR004_04 C20140704_OR004_04 TB413635.[MT7]-HLVFIDNK[MT7].2y6_1.heavy 637.379 / 879.506 2569.0 29.6028995513916 43 14 9 10 10 1.6956836479185797 41.162533709239085 0.0 3 0.935971814571504 4.851006136724842 2569.0 20.66765581178891 0.0 - - - - - - - 214.0 5 4 FAM198B family with sequence similarity 198, member B 1743 222 C20140704_OR004_04 C20140704_OR004_04 TB413635.[MT7]-HLVFIDNK[MT7].2y7_1.heavy 637.379 / 992.59 2855.0 29.6028995513916 43 14 9 10 10 1.6956836479185797 41.162533709239085 0.0 3 0.935971814571504 4.851006136724842 2855.0 6.821820394883138 1.0 - - - - - - - 214.0 5 6 FAM198B family with sequence similarity 198, member B 1745 223 C20140704_OR004_04 C20140704_OR004_04 TB427699.[MT7]-C[CAM]AFMETSAK[MT7].3y3_1.heavy 444.889 / 449.284 11951.0 26.762300491333008 38 8 10 10 10 1.0686101797272156 73.55874094016134 0.0 3 0.7885857152048871 2.635291943432163 11951.0 108.77533447965283 0.0 - - - - - - - 206.875 23 8 DIRAS1;DIRAS2 DIRAS family, GTP-binding RAS-like 1;DIRAS family, GTP-binding RAS-like 2 1747 223 C20140704_OR004_04 C20140704_OR004_04 TB427699.[MT7]-C[CAM]AFMETSAK[MT7].3b4_1.heavy 444.889 / 654.286 3195.0 26.762300491333008 38 8 10 10 10 1.0686101797272156 73.55874094016134 0.0 3 0.7885857152048871 2.635291943432163 3195.0 37.31270113709505 1.0 - - - - - - - 217.0 7 6 DIRAS1;DIRAS2 DIRAS family, GTP-binding RAS-like 1;DIRAS family, GTP-binding RAS-like 2 1749 223 C20140704_OR004_04 C20140704_OR004_04 TB427699.[MT7]-C[CAM]AFMETSAK[MT7].3y4_1.heavy 444.889 / 550.332 4615.0 26.762300491333008 38 8 10 10 10 1.0686101797272156 73.55874094016134 0.0 3 0.7885857152048871 2.635291943432163 4615.0 18.205496828752644 0.0 - - - - - - - 189.1 9 10 DIRAS1;DIRAS2 DIRAS family, GTP-binding RAS-like 1;DIRAS family, GTP-binding RAS-like 2 1751 223 C20140704_OR004_04 C20140704_OR004_04 TB427699.[MT7]-C[CAM]AFMETSAK[MT7].3b3_1.heavy 444.889 / 523.245 4970.0 26.762300491333008 38 8 10 10 10 1.0686101797272156 73.55874094016134 0.0 3 0.7885857152048871 2.635291943432163 4970.0 50.471286562254164 0.0 - - - - - - - 223.55555555555554 9 9 DIRAS1;DIRAS2 DIRAS family, GTP-binding RAS-like 1;DIRAS family, GTP-binding RAS-like 2 1753 224 C20140704_OR004_04 C20140704_OR004_04 TB414103.[MT7]-LGHELMLC[CAM]APDDQELLK[MT7].4b4_1.heavy 568.299 / 581.316 2893.0 38.3031005859375 37 7 10 10 10 0.8274003631509749 70.1434992958776 0.0 3 0.7454714681391789 2.3923222035443295 2893.0 3.8305411380453593 1.0 - - - - - - - 297.5 6 14 HAUS7 HAUS augmin-like complex, subunit 7 1755 224 C20140704_OR004_04 C20140704_OR004_04 TB414103.[MT7]-LGHELMLC[CAM]APDDQELLK[MT7].4b5_1.heavy 568.299 / 694.4 5901.0 38.3031005859375 37 7 10 10 10 0.8274003631509749 70.1434992958776 0.0 3 0.7454714681391789 2.3923222035443295 5901.0 12.740571068271004 0.0 - - - - - - - 264.35714285714283 11 14 HAUS7 HAUS augmin-like complex, subunit 7 1757 224 C20140704_OR004_04 C20140704_OR004_04 TB414103.[MT7]-LGHELMLC[CAM]APDDQELLK[MT7].4y3_1.heavy 568.299 / 517.383 14233.0 38.3031005859375 37 7 10 10 10 0.8274003631509749 70.1434992958776 0.0 3 0.7454714681391789 2.3923222035443295 14233.0 44.25828698470961 0.0 - - - - - - - 315.54545454545456 28 11 HAUS7 HAUS augmin-like complex, subunit 7 1759 224 C20140704_OR004_04 C20140704_OR004_04 TB414103.[MT7]-LGHELMLC[CAM]APDDQELLK[MT7].4b6_1.heavy 568.299 / 825.441 4629.0 38.3031005859375 37 7 10 10 10 0.8274003631509749 70.1434992958776 0.0 3 0.7454714681391789 2.3923222035443295 4629.0 47.50025013400035 0.0 - - - - - - - 231.66666666666666 9 3 HAUS7 HAUS augmin-like complex, subunit 7 1761 225 C20140704_OR004_04 C20140704_OR004_04 TB451561.[MT7]-GFVQIWDAAAGK[MT7].2y8_1.heavy 775.932 / 975.538 N/A N/A - - - - - - - - - 0.0 - - - - - - - FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1763 225 C20140704_OR004_04 C20140704_OR004_04 TB451561.[MT7]-GFVQIWDAAAGK[MT7].2y5_1.heavy 775.932 / 561.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1765 225 C20140704_OR004_04 C20140704_OR004_04 TB451561.[MT7]-GFVQIWDAAAGK[MT7].2b4_1.heavy 775.932 / 576.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1767 225 C20140704_OR004_04 C20140704_OR004_04 TB451561.[MT7]-GFVQIWDAAAGK[MT7].2y7_1.heavy 775.932 / 862.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1769 226 C20140704_OR004_04 C20140704_OR004_04 TB451267.[MT7]-DQGYLR.2y4_1.heavy 448.241 / 508.288 2973.0 21.623250007629395 43 18 10 5 10 5.893383592827853 16.968181083902003 0.04009819030761719 3 0.9878397905492954 11.180230695300937 2973.0 13.1230078125 0.0 - - - - - - - 303.8333333333333 5 6 C7orf43 chromosome 7 open reading frame 43 1771 226 C20140704_OR004_04 C20140704_OR004_04 TB451267.[MT7]-DQGYLR.2y5_1.heavy 448.241 / 636.346 7192.0 21.623250007629395 43 18 10 5 10 5.893383592827853 16.968181083902003 0.04009819030761719 3 0.9878397905492954 11.180230695300937 7192.0 97.76625 0.0 - - - - - - - 181.33333333333334 14 9 C7orf43 chromosome 7 open reading frame 43 1773 226 C20140704_OR004_04 C20140704_OR004_04 TB451267.[MT7]-DQGYLR.2b4_1.heavy 448.241 / 608.28 5082.0 21.623250007629395 43 18 10 5 10 5.893383592827853 16.968181083902003 0.04009819030761719 3 0.9878397905492954 11.180230695300937 5082.0 98.46375 0.0 - - - - - - - 156.0 10 8 C7orf43 chromosome 7 open reading frame 43 1775 226 C20140704_OR004_04 C20140704_OR004_04 TB451267.[MT7]-DQGYLR.2b5_1.heavy 448.241 / 721.364 767.0 21.623250007629395 43 18 10 5 10 5.893383592827853 16.968181083902003 0.04009819030761719 3 0.9878397905492954 11.180230695300937 767.0 8.482274305555555 2.0 - - - - - - - 160.0 2 9 C7orf43 chromosome 7 open reading frame 43 1777 227 C20140704_OR004_04 C20140704_OR004_04 TB451266.[MT7]-SVQMMR.2y4_1.heavy 448.234 / 565.258 3046.0 22.84040069580078 40 14 8 10 8 1.1356958013024587 58.07921982914118 0.0 4 0.9379511408855686 4.928603204632045 3046.0 27.831472081218276 0.0 - - - - - - - 226.0 6 10 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1779 227 C20140704_OR004_04 C20140704_OR004_04 TB451266.[MT7]-SVQMMR.2b3_1.heavy 448.234 / 459.268 5895.0 22.84040069580078 40 14 8 10 8 1.1356958013024587 58.07921982914118 0.0 4 0.9379511408855686 4.928603204632045 5895.0 30.469472194414713 1.0 - - - - - - - 245.6 15 10 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1781 227 C20140704_OR004_04 C20140704_OR004_04 TB451266.[MT7]-SVQMMR.2y5_1.heavy 448.234 / 664.327 3832.0 22.84040069580078 40 14 8 10 8 1.1356958013024587 58.07921982914118 0.0 4 0.9379511408855686 4.928603204632045 3832.0 29.197446442398693 0.0 - - - - - - - 204.66666666666666 7 12 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1783 227 C20140704_OR004_04 C20140704_OR004_04 TB451266.[MT7]-SVQMMR.2b4_1.heavy 448.234 / 590.309 4716.0 22.84040069580078 40 14 8 10 8 1.1356958013024587 58.07921982914118 0.0 4 0.9379511408855686 4.928603204632045 4716.0 51.954603266968704 0.0 - - - - - - - 235.8 9 10 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 1785 228 C20140704_OR004_04 C20140704_OR004_04 TB451763.[MT7]-RYYGGAEVVDEIELLC[CAM]QRR.4b7_1.heavy 618.321 / 941.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1787 228 C20140704_OR004_04 C20140704_OR004_04 TB451763.[MT7]-RYYGGAEVVDEIELLC[CAM]QRR.4y10_2.heavy 618.321 / 666.34 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1789 228 C20140704_OR004_04 C20140704_OR004_04 TB451763.[MT7]-RYYGGAEVVDEIELLC[CAM]QRR.4b5_1.heavy 618.321 / 741.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1791 228 C20140704_OR004_04 C20140704_OR004_04 TB451763.[MT7]-RYYGGAEVVDEIELLC[CAM]QRR.4b6_1.heavy 618.321 / 812.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1793 229 C20140704_OR004_04 C20140704_OR004_04 TB413948.[MT7]-GFVQIWDAAAGK[MT7]K[MT7].3y3_1.heavy 608.356 / 620.433 2388.0 38.885101318359375 46 18 10 10 8 5.106695198405094 19.582136022379338 0.0 4 0.9871611583270355 10.88012030169788 2388.0 10.289880172551527 0.0 - - - - - - - 189.44444444444446 4 9 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1795 229 C20140704_OR004_04 C20140704_OR004_04 TB413948.[MT7]-GFVQIWDAAAGK[MT7]K[MT7].3b4_1.heavy 608.356 / 576.326 7164.0 38.885101318359375 46 18 10 10 8 5.106695198405094 19.582136022379338 0.0 4 0.9871611583270355 10.88012030169788 7164.0 17.360999999999997 0.0 - - - - - - - 332.38461538461536 14 13 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1797 229 C20140704_OR004_04 C20140704_OR004_04 TB413948.[MT7]-GFVQIWDAAAGK[MT7]K[MT7].3b5_1.heavy 608.356 / 689.41 4207.0 38.885101318359375 46 18 10 10 8 5.106695198405094 19.582136022379338 0.0 4 0.9871611583270355 10.88012030169788 4207.0 52.294060205580024 2.0 - - - - - - - 237.63636363636363 9 11 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1799 229 C20140704_OR004_04 C20140704_OR004_04 TB413948.[MT7]-GFVQIWDAAAGK[MT7]K[MT7].3y4_1.heavy 608.356 / 691.471 3070.0 38.885101318359375 46 18 10 10 8 5.106695198405094 19.582136022379338 0.0 4 0.9871611583270355 10.88012030169788 3070.0 13.858503625746668 0.0 - - - - - - - 238.8 6 10 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1801 230 C20140704_OR004_04 C20140704_OR004_04 TB413944.[MT7]-NTC[CAM]PGDRSAITPGGLR.3y15_2.heavy 605.98 / 779.394 2676.0 24.21674919128418 39 13 10 6 10 1.8396622570850838 45.19640761475977 0.03820037841796875 3 0.922792412603017 4.412632181775714 2676.0 13.683106796116505 0.0 - - - - - - - 196.63636363636363 5 11 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1803 230 C20140704_OR004_04 C20140704_OR004_04 TB413944.[MT7]-NTC[CAM]PGDRSAITPGGLR.3y8_1.heavy 605.98 / 784.468 618.0 24.21674919128418 39 13 10 6 10 1.8396622570850838 45.19640761475977 0.03820037841796875 3 0.922792412603017 4.412632181775714 618.0 5.397 5.0 - - - - - - - 154.5 3 10 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1805 230 C20140704_OR004_04 C20140704_OR004_04 TB413944.[MT7]-NTC[CAM]PGDRSAITPGGLR.3y13_2.heavy 605.98 / 648.855 2161.0 24.21674919128418 39 13 10 6 10 1.8396622570850838 45.19640761475977 0.03820037841796875 3 0.922792412603017 4.412632181775714 2161.0 1.9989832793959008 0.0 - - - - - - - 262.1818181818182 4 11 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1807 230 C20140704_OR004_04 C20140704_OR004_04 TB413944.[MT7]-NTC[CAM]PGDRSAITPGGLR.3y9_1.heavy 605.98 / 871.5 1132.0 24.21674919128418 39 13 10 6 10 1.8396622570850838 45.19640761475977 0.03820037841796875 3 0.922792412603017 4.412632181775714 1132.0 15.386407766990292 0.0 - - - - - - - 223.16666666666666 2 6 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1809 231 C20140704_OR004_04 C20140704_OR004_04 TB427801.[MT7]-VIPSPFK[MT7].2y4_1.heavy 538.341 / 622.368 7793.0 33.997501373291016 44 14 10 10 10 2.166222819594289 39.88734655411624 0.0 3 0.9441993551233809 5.199987321812803 7793.0 13.709545101292045 0.0 - - - - - - - 667.8571428571429 15 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1811 231 C20140704_OR004_04 C20140704_OR004_04 TB427801.[MT7]-VIPSPFK[MT7].2y5_1.heavy 538.341 / 719.421 43900.0 33.997501373291016 44 14 10 10 10 2.166222819594289 39.88734655411624 0.0 3 0.9441993551233809 5.199987321812803 43900.0 67.3766410814582 1.0 - - - - - - - 185.71428571428572 88 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1813 231 C20140704_OR004_04 C20140704_OR004_04 TB427801.[MT7]-VIPSPFK[MT7].2b4_1.heavy 538.341 / 541.347 3247.0 33.997501373291016 44 14 10 10 10 2.166222819594289 39.88734655411624 0.0 3 0.9441993551233809 5.199987321812803 3247.0 6.824905276394164 1.0 - - - - - - - 667.8571428571429 77 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1815 231 C20140704_OR004_04 C20140704_OR004_04 TB427801.[MT7]-VIPSPFK[MT7].2y3_1.heavy 538.341 / 535.336 32730.0 33.997501373291016 44 14 10 10 10 2.166222819594289 39.88734655411624 0.0 3 0.9441993551233809 5.199987321812803 32730.0 40.822152880196896 0.0 - - - - - - - 612.4285714285714 65 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 1817 232 C20140704_OR004_04 C20140704_OR004_04 TB451363.[MT7]-GAAGFSIGK[MT7].2y5_1.heavy 548.324 / 695.421 1083.0 28.617399215698242 37 14 10 3 10 2.3202881196917176 36.19759798280653 0.050800323486328125 3 0.9390710763360388 4.97416825812413 1083.0 5.55 2.0 - - - - - - - 240.625 2 8 MRPS5 mitochondrial ribosomal protein S5 1819 232 C20140704_OR004_04 C20140704_OR004_04 TB451363.[MT7]-GAAGFSIGK[MT7].2b6_1.heavy 548.324 / 635.327 2406.0 28.617399215698242 37 14 10 3 10 2.3202881196917176 36.19759798280653 0.050800323486328125 3 0.9390710763360388 4.97416825812413 2406.0 7.712668952040056 0.0 - - - - - - - 253.88888888888889 4 9 MRPS5 mitochondrial ribosomal protein S5 1821 232 C20140704_OR004_04 C20140704_OR004_04 TB451363.[MT7]-GAAGFSIGK[MT7].2y6_1.heavy 548.324 / 752.442 3609.0 28.617399215698242 37 14 10 3 10 2.3202881196917176 36.19759798280653 0.050800323486328125 3 0.9390710763360388 4.97416825812413 3609.0 23.773910529764024 0.0 - - - - - - - 240.83333333333334 7 6 MRPS5 mitochondrial ribosomal protein S5 1823 232 C20140704_OR004_04 C20140704_OR004_04 TB451363.[MT7]-GAAGFSIGK[MT7].2y7_1.heavy 548.324 / 823.479 5413.0 28.617399215698242 37 14 10 3 10 2.3202881196917176 36.19759798280653 0.050800323486328125 3 0.9390710763360388 4.97416825812413 5413.0 65.77206777316735 0.0 - - - - - - - 150.25 10 4 MRPS5 mitochondrial ribosomal protein S5 1825 233 C20140704_OR004_04 C20140704_OR004_04 TB427802.[MT7]-APDGSTLK[MT7].2y5_1.heavy 538.813 / 649.4 2493.0 20.562724590301514 29 18 6 3 2 7.3122740187752315 13.675636299082441 0.07619857788085938 11 0.9877545881029979 11.14118783344872 2493.0 7.144415375144844 1.0 - - - - - - - 287.75 12 8 SLC26A6 solute carrier family 26, member 6 1827 233 C20140704_OR004_04 C20140704_OR004_04 TB427802.[MT7]-APDGSTLK[MT7].2y3_1.heavy 538.813 / 505.347 575.0 20.562724590301514 29 18 6 3 2 7.3122740187752315 13.675636299082441 0.07619857788085938 11 0.9877545881029979 11.14118783344872 575.0 0.4 13.0 - - - - - - - 296.54545454545456 2 11 SLC26A6 solute carrier family 26, member 6 1829 233 C20140704_OR004_04 C20140704_OR004_04 TB427802.[MT7]-APDGSTLK[MT7].2y6_1.heavy 538.813 / 764.427 479.0 20.562724590301514 29 18 6 3 2 7.3122740187752315 13.675636299082441 0.07619857788085938 11 0.9877545881029979 11.14118783344872 479.0 0.6652777777777779 3.0 - - - - - - - 0.0 1 0 SLC26A6 solute carrier family 26, member 6 1831 233 C20140704_OR004_04 C20140704_OR004_04 TB427802.[MT7]-APDGSTLK[MT7].2y7_1.heavy 538.813 / 861.48 4123.0 20.562724590301514 29 18 6 3 2 7.3122740187752315 13.675636299082441 0.07619857788085938 11 0.9877545881029979 11.14118783344872 4123.0 39.297343749999996 0.0 - - - - - - - 156.0 8 8 SLC26A6 solute carrier family 26, member 6 1833 234 C20140704_OR004_04 C20140704_OR004_04 TB413740.[MT7]-EITLLEQRK[MT7].2y6_1.heavy 709.434 / 930.585 427.0 29.63516680399577 30 9 10 5 6 0.9997278476317883 85.78799887768989 0.04840087890625 5 0.8059992184578197 2.7553420876225694 427.0 1.0211260179707418 4.0 - - - - - - - 0.0 1 0 C21orf7 chromosome 21 open reading frame 7 1835 234 C20140704_OR004_04 C20140704_OR004_04 TB413740.[MT7]-EITLLEQRK[MT7].2y8_1.heavy 709.434 / 1144.72 1280.0 29.63516680399577 30 9 10 5 6 0.9997278476317883 85.78799887768989 0.04840087890625 5 0.8059992184578197 2.7553420876225694 1280.0 8.247887323943662 0.0 - - - - - - - 206.54545454545453 2 11 C21orf7 chromosome 21 open reading frame 7 1837 234 C20140704_OR004_04 C20140704_OR004_04 TB413740.[MT7]-EITLLEQRK[MT7].2y5_1.heavy 709.434 / 817.501 N/A 29.63516680399577 30 9 10 5 6 0.9997278476317883 85.78799887768989 0.04840087890625 5 0.8059992184578197 2.7553420876225694 853.0 9.01056338028169 0.0 - - - - - - - 0.0 1 0 C21orf7 chromosome 21 open reading frame 7 1839 234 C20140704_OR004_04 C20140704_OR004_04 TB413740.[MT7]-EITLLEQRK[MT7].2y7_1.heavy 709.434 / 1031.63 3128.0 29.63516680399577 30 9 10 5 6 0.9997278476317883 85.78799887768989 0.04840087890625 5 0.8059992184578197 2.7553420876225694 3128.0 33.04225352112676 0.0 - - - - - - - 142.0 6 2 C21orf7 chromosome 21 open reading frame 7 1841 235 C20140704_OR004_04 C20140704_OR004_04 TB413736.[MT7]-ESVSVLNLFTR.2y8_1.heavy 704.899 / 949.547 7302.0 44.73609924316406 47 17 10 10 10 2.8026712854210336 30.80368429804737 0.0 3 0.978590904416126 8.419481149721856 7302.0 10.972643541275243 0.0 - - - - - - - 172.0 14 6 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1843 235 C20140704_OR004_04 C20140704_OR004_04 TB413736.[MT7]-ESVSVLNLFTR.2y9_1.heavy 704.899 / 1048.61 2577.0 44.73609924316406 47 17 10 10 10 2.8026712854210336 30.80368429804737 0.0 3 0.978590904416126 8.419481149721856 2577.0 9.439011627906975 0.0 - - - - - - - 250.1818181818182 5 11 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1845 235 C20140704_OR004_04 C20140704_OR004_04 TB413736.[MT7]-ESVSVLNLFTR.2y6_1.heavy 704.899 / 763.446 3866.0 44.73609924316406 47 17 10 10 10 2.8026712854210336 30.80368429804737 0.0 3 0.978590904416126 8.419481149721856 3866.0 14.998316775795889 0.0 - - - - - - - 163.4 7 10 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1847 235 C20140704_OR004_04 C20140704_OR004_04 TB413736.[MT7]-ESVSVLNLFTR.2y10_1.heavy 704.899 / 1135.65 5756.0 44.73609924316406 47 17 10 10 10 2.8026712854210336 30.80368429804737 0.0 3 0.978590904416126 8.419481149721856 5756.0 26.772093023255813 0.0 - - - - - - - 200.66666666666666 11 9 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1849 236 C20140704_OR004_04 C20140704_OR004_04 TB413930.[MT7]-DTQALLSATQAMDLR.2y9_1.heavy 889.465 / 992.483 4699.0 39.52335071563721 33 18 0 5 10 4.58176107366272 21.825668862313393 0.040203094482421875 3 0.9855492722231809 10.253995663806744 4699.0 41.72009345794393 0.0 - - - - - - - 225.66666666666666 9 9 SLC26A6 solute carrier family 26, member 6 1851 236 C20140704_OR004_04 C20140704_OR004_04 TB413930.[MT7]-DTQALLSATQAMDLR.2b4_1.heavy 889.465 / 560.28 6194.0 39.52335071563721 33 18 0 5 10 4.58176107366272 21.825668862313393 0.040203094482421875 3 0.9855492722231809 10.253995663806744 6194.0 71.3503682724507 0.0 - - - - - - - 258.1666666666667 12 12 SLC26A6 solute carrier family 26, member 6 1853 236 C20140704_OR004_04 C20140704_OR004_04 TB413930.[MT7]-DTQALLSATQAMDLR.2b5_1.heavy 889.465 / 673.364 4485.0 39.52335071563721 33 18 0 5 10 4.58176107366272 21.825668862313393 0.040203094482421875 3 0.9855492722231809 10.253995663806744 4485.0 15.125058548009369 0.0 - - - - - - - 277.7 8 10 SLC26A6 solute carrier family 26, member 6 1855 236 C20140704_OR004_04 C20140704_OR004_04 TB413930.[MT7]-DTQALLSATQAMDLR.2y11_1.heavy 889.465 / 1218.65 2136.0 39.52335071563721 33 18 0 5 10 4.58176107366272 21.825668862313393 0.040203094482421875 3 0.9855492722231809 10.253995663806744 2136.0 6.001249511338768 2.0 - - - - - - - 320.3 66 10 SLC26A6 solute carrier family 26, member 6 1857 237 C20140704_OR004_04 C20140704_OR004_04 TB451355.[MT7]-AATYHVDR.2y4_1.heavy 538.784 / 526.273 856.0 17.643699645996094 33 17 2 10 4 7.092715328195145 14.098972730863371 0.0 10 0.9755308696514425 7.873422110535531 856.0 1.0913359007274281 7.0 - - - - - - - 253.44444444444446 8 9 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1859 237 C20140704_OR004_04 C20140704_OR004_04 TB451355.[MT7]-AATYHVDR.2y5_1.heavy 538.784 / 689.337 856.0 17.643699645996094 33 17 2 10 4 7.092715328195145 14.098972730863371 0.0 10 0.9755308696514425 7.873422110535531 856.0 9.633802816901408 0.0 - - - - - - - 0.0 1 0 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1861 237 C20140704_OR004_04 C20140704_OR004_04 TB451355.[MT7]-AATYHVDR.2y6_1.heavy 538.784 / 790.384 214.0 17.643699645996094 33 17 2 10 4 7.092715328195145 14.098972730863371 0.0 10 0.9755308696514425 7.873422110535531 214.0 2.903216783216783 2.0 - - - - - - - 0.0 0 0 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1863 237 C20140704_OR004_04 C20140704_OR004_04 TB451355.[MT7]-AATYHVDR.2y7_1.heavy 538.784 / 861.421 1783.0 17.643699645996094 33 17 2 10 4 7.092715328195145 14.098972730863371 0.0 10 0.9755308696514425 7.873422110535531 1783.0 37.543626317344625 0.0 - - - - - - - 157.0 3 5 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1865 238 C20140704_OR004_04 C20140704_OR004_04 TB413502.[MT7]-IITEGTK[MT7].2y6_1.heavy 525.326 / 792.458 3341.0 23.40440034866333 37 17 10 2 8 3.2011060277629544 26.417917486479695 0.08069992065429688 4 0.9765714662622991 8.047078584936038 3341.0 34.342189808543615 2.0 - - - - - - - 157.33333333333334 6 9 RBL1 retinoblastoma-like 1 (p107) 1867 238 C20140704_OR004_04 C20140704_OR004_04 TB413502.[MT7]-IITEGTK[MT7].2y4_1.heavy 525.326 / 578.327 1924.0 23.40440034866333 37 17 10 2 8 3.2011060277629544 26.417917486479695 0.08069992065429688 4 0.9765714662622991 8.047078584936038 1924.0 6.8211036260133415 0.0 - - - - - - - 151.66666666666666 3 6 RBL1 retinoblastoma-like 1 (p107) 1869 238 C20140704_OR004_04 C20140704_OR004_04 TB413502.[MT7]-IITEGTK[MT7].2y5_1.heavy 525.326 / 679.374 3645.0 23.40440034866333 37 17 10 2 8 3.2011060277629544 26.417917486479695 0.08069992065429688 4 0.9765714662622991 8.047078584936038 3645.0 42.76559405940594 0.0 - - - - - - - 158.85714285714286 7 7 RBL1 retinoblastoma-like 1 (p107) 1871 238 C20140704_OR004_04 C20140704_OR004_04 TB413502.[MT7]-IITEGTK[MT7].2b4_1.heavy 525.326 / 601.368 607.0 23.40440034866333 37 17 10 2 8 3.2011060277629544 26.417917486479695 0.08069992065429688 4 0.9765714662622991 8.047078584936038 607.0 0.024567901234567868 15.0 - - - - - - - 212.4 2 10 RBL1 retinoblastoma-like 1 (p107) 1873 239 C20140704_OR004_04 C20140704_OR004_04 TB428142.[MT7]-IYSESAPSWLSK[MT7].3b4_1.heavy 552.634 / 637.331 12066.0 36.575849533081055 41 16 10 5 10 2.4317687071838248 32.750253354351514 0.045299530029296875 3 0.9684209482007239 6.926490900909048 12066.0 67.38236829354953 0.0 - - - - - - - 337.57142857142856 24 7 FAM198B family with sequence similarity 198, member B 1875 239 C20140704_OR004_04 C20140704_OR004_04 TB428142.[MT7]-IYSESAPSWLSK[MT7].3b5_1.heavy 552.634 / 724.363 7090.0 36.575849533081055 41 16 10 5 10 2.4317687071838248 32.750253354351514 0.045299530029296875 3 0.9684209482007239 6.926490900909048 7090.0 33.37992032438435 0.0 - - - - - - - 217.5 14 8 FAM198B family with sequence similarity 198, member B 1877 239 C20140704_OR004_04 C20140704_OR004_04 TB428142.[MT7]-IYSESAPSWLSK[MT7].3y4_1.heavy 552.634 / 677.41 6344.0 36.575849533081055 41 16 10 5 10 2.4317687071838248 32.750253354351514 0.045299530029296875 3 0.9684209482007239 6.926490900909048 6344.0 58.08862773571206 0.0 - - - - - - - 295.375 12 8 FAM198B family with sequence similarity 198, member B 1879 239 C20140704_OR004_04 C20140704_OR004_04 TB428142.[MT7]-IYSESAPSWLSK[MT7].3y5_1.heavy 552.634 / 764.442 5722.0 36.575849533081055 41 16 10 5 10 2.4317687071838248 32.750253354351514 0.045299530029296875 3 0.9684209482007239 6.926490900909048 5722.0 32.97618473895582 0.0 - - - - - - - 311.0 11 4 FAM198B family with sequence similarity 198, member B 1881 240 C20140704_OR004_04 C20140704_OR004_04 TB427839.[MT7]-VLEIPYK[MT7].2y4_1.heavy 575.36 / 664.415 9581.0 35.00910186767578 44 14 10 10 10 1.9844806207311982 41.96868801013467 0.0 3 0.9499613437824124 5.493912585950445 9581.0 13.020120013886267 0.0 - - - - - - - 666.0 19 7 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1883 240 C20140704_OR004_04 C20140704_OR004_04 TB427839.[MT7]-VLEIPYK[MT7].2b4_1.heavy 575.36 / 599.388 20296.0 35.00910186767578 44 14 10 10 10 1.9844806207311982 41.96868801013467 0.0 3 0.9499613437824124 5.493912585950445 20296.0 40.25770602822149 0.0 - - - - - - - 176.4 40 10 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1885 240 C20140704_OR004_04 C20140704_OR004_04 TB427839.[MT7]-VLEIPYK[MT7].2y3_1.heavy 575.36 / 551.331 47777.0 35.00910186767578 44 14 10 10 10 1.9844806207311982 41.96868801013467 0.0 3 0.9499613437824124 5.493912585950445 47777.0 77.6955698956418 0.0 - - - - - - - 672.0 95 9 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1887 240 C20140704_OR004_04 C20140704_OR004_04 TB427839.[MT7]-VLEIPYK[MT7].2y6_1.heavy 575.36 / 906.542 11976.0 35.00910186767578 44 14 10 10 10 1.9844806207311982 41.96868801013467 0.0 3 0.9499613437824124 5.493912585950445 11976.0 18.360435903258374 0.0 - - - - - - - 126.0 23 4 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1889 241 C20140704_OR004_04 C20140704_OR004_04 TB427936.[MT7]-LLNLYPRK[MT7].2y5_1.heavy 652.918 / 820.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 1891 241 C20140704_OR004_04 C20140704_OR004_04 TB427936.[MT7]-LLNLYPRK[MT7].2y3_1.heavy 652.918 / 544.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 1893 241 C20140704_OR004_04 C20140704_OR004_04 TB427936.[MT7]-LLNLYPRK[MT7].2y6_1.heavy 652.918 / 934.559 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 1895 241 C20140704_OR004_04 C20140704_OR004_04 TB427936.[MT7]-LLNLYPRK[MT7].2y7_1.heavy 652.918 / 1047.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL5 dihydropyrimidinase-like 5 1897 242 C20140704_OR004_04 C20140704_OR004_04 TB451291.[MT7]-RLILFR.2b3_1.heavy 481.325 / 527.379 873.0 33.06035041809082 39 18 10 5 6 16.259834263811243 6.150124188077695 0.041698455810546875 5 0.9867010708428086 10.689848526788964 873.0 3.3000000000000003 4.0 - - - - - - - 353.0 3 7 WDR4;CSGALNACT1 WD repeat domain 4;chondroitin sulfate N-acetylgalactosaminyltransferase 1 1899 242 C20140704_OR004_04 C20140704_OR004_04 TB451291.[MT7]-RLILFR.2y5_1.heavy 481.325 / 661.44 3492.0 33.06035041809082 39 18 10 5 6 16.259834263811243 6.150124188077695 0.041698455810546875 5 0.9867010708428086 10.689848526788964 3492.0 -9.633103448275863 0.0 - - - - - - - 193.66666666666666 6 6 WDR4;CSGALNACT1 WD repeat domain 4;chondroitin sulfate N-acetylgalactosaminyltransferase 1 1901 242 C20140704_OR004_04 C20140704_OR004_04 TB451291.[MT7]-RLILFR.2b4_1.heavy 481.325 / 640.463 1891.0 33.06035041809082 39 18 10 5 6 16.259834263811243 6.150124188077695 0.041698455810546875 5 0.9867010708428086 10.689848526788964 1891.0 10.423326898448988 1.0 - - - - - - - 254.25 3 4 WDR4;CSGALNACT1 WD repeat domain 4;chondroitin sulfate N-acetylgalactosaminyltransferase 1 1903 242 C20140704_OR004_04 C20140704_OR004_04 TB451291.[MT7]-RLILFR.2b5_1.heavy 481.325 / 787.531 1164.0 33.06035041809082 39 18 10 5 6 16.259834263811243 6.150124188077695 0.041698455810546875 5 0.9867010708428086 10.689848526788964 1164.0 -0.8 4.0 - - - - - - - 363.5 4 2 WDR4;CSGALNACT1 WD repeat domain 4;chondroitin sulfate N-acetylgalactosaminyltransferase 1 1905 243 C20140704_OR004_04 C20140704_OR004_04 TB413601.[MT7]-STDAYELK[MT7].2y4_1.heavy 607.829 / 696.405 3061.0 25.189799308776855 43 20 9 6 8 5.5115465605036125 14.366659464679792 0.03619956970214844 4 0.9924005207405295 14.147999454929339 3061.0 33.185148707860144 0.0 - - - - - - - 264.0 6 8 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1907 243 C20140704_OR004_04 C20140704_OR004_04 TB413601.[MT7]-STDAYELK[MT7].2y5_1.heavy 607.829 / 767.442 6333.0 25.189799308776855 43 20 9 6 8 5.5115465605036125 14.366659464679792 0.03619956970214844 4 0.9924005207405295 14.147999454929339 6333.0 23.688545227789596 1.0 - - - - - - - 164.44444444444446 15 9 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1909 243 C20140704_OR004_04 C20140704_OR004_04 TB413601.[MT7]-STDAYELK[MT7].2b4_1.heavy 607.829 / 519.253 5066.0 25.189799308776855 43 20 9 6 8 5.5115465605036125 14.366659464679792 0.03619956970214844 4 0.9924005207405295 14.147999454929339 5066.0 21.70792622598222 0.0 - - - - - - - 246.58333333333334 10 12 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1911 243 C20140704_OR004_04 C20140704_OR004_04 TB413601.[MT7]-STDAYELK[MT7].2y7_1.heavy 607.829 / 983.517 3589.0 25.189799308776855 43 20 9 6 8 5.5115465605036125 14.366659464679792 0.03619956970214844 4 0.9924005207405295 14.147999454929339 3589.0 26.57368853439383 0.0 - - - - - - - 290.5 7 4 SERPINB3;SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 3;serpin peptidase inhibitor, clade B (ovalbumin), member 4 1913 244 C20140704_OR004_04 C20140704_OR004_04 TB428405.[MT7]-NAPSDQLINIFESC[CAM]VRNPVENIMK[MT7].4b7_1.heavy 769.9 / 870.444 1246.0 48.184499740600586 29 14 4 5 6 1.8265778693942452 44.280492745142595 0.04360198974609375 5 0.9391455229668819 4.9772415004261195 1246.0 8.959563632086567 1.0 - - - - - - - 291.875 9 8 RBL1 retinoblastoma-like 1 (p107) 1915 244 C20140704_OR004_04 C20140704_OR004_04 TB428405.[MT7]-NAPSDQLINIFESC[CAM]VRNPVENIMK[MT7].4b4_1.heavy 769.9 / 514.274 156.0 48.184499740600586 29 14 4 5 6 1.8265778693942452 44.280492745142595 0.04360198974609375 5 0.9391455229668819 4.9772415004261195 156.0 0.27206466267441515 32.0 - - - - - - - 259.5 2 6 RBL1 retinoblastoma-like 1 (p107) 1917 244 C20140704_OR004_04 C20140704_OR004_04 TB428405.[MT7]-NAPSDQLINIFESC[CAM]VRNPVENIMK[MT7].4b5_1.heavy 769.9 / 629.301 857.0 48.184499740600586 29 14 4 5 6 1.8265778693942452 44.280492745142595 0.04360198974609375 5 0.9391455229668819 4.9772415004261195 857.0 4.865146167317796 2.0 - - - - - - - 242.22222222222223 3 9 RBL1 retinoblastoma-like 1 (p107) 1919 244 C20140704_OR004_04 C20140704_OR004_04 TB428405.[MT7]-NAPSDQLINIFESC[CAM]VRNPVENIMK[MT7].4b6_1.heavy 769.9 / 757.36 2726.0 48.184499740600586 29 14 4 5 6 1.8265778693942452 44.280492745142595 0.04360198974609375 5 0.9391455229668819 4.9772415004261195 2726.0 23.066153846153846 0.0 - - - - - - - 243.375 5 8 RBL1 retinoblastoma-like 1 (p107) 1921 245 C20140704_OR004_04 C20140704_OR004_04 TB451752.[MT7]-K[MT7]IEALLNLPRNPSVIDK[MT7].4b4_1.heavy 588.864 / 730.47 5812.0 34.61149978637695 26 10 2 6 8 0.9611535566792048 63.78472296038879 0.03900146484375 4 0.8290393326591338 2.941192071314498 5812.0 9.048869120445199 1.0 - - - - - - - 242.0 24 6 C3orf1 chromosome 3 open reading frame 1 1923 245 C20140704_OR004_04 C20140704_OR004_04 TB451752.[MT7]-K[MT7]IEALLNLPRNPSVIDK[MT7].4b5_1.heavy 588.864 / 843.554 7793.0 34.61149978637695 26 10 2 6 8 0.9611535566792048 63.78472296038879 0.03900146484375 4 0.8290393326591338 2.941192071314498 7793.0 61.00580808080808 0.0 - - - - - - - 211.2 15 10 C3orf1 chromosome 3 open reading frame 1 1925 245 C20140704_OR004_04 C20140704_OR004_04 TB451752.[MT7]-K[MT7]IEALLNLPRNPSVIDK[MT7].4y3_1.heavy 588.864 / 519.326 2113.0 34.61149978637695 26 10 2 6 8 0.9611535566792048 63.78472296038879 0.03900146484375 4 0.8290393326591338 2.941192071314498 2113.0 1.243986543313709 2.0 - - - - - - - 676.875 48 8 C3orf1 chromosome 3 open reading frame 1 1927 245 C20140704_OR004_04 C20140704_OR004_04 TB451752.[MT7]-K[MT7]IEALLNLPRNPSVIDK[MT7].4b3_1.heavy 588.864 / 659.433 793.0 34.61149978637695 26 10 2 6 8 0.9611535566792048 63.78472296038879 0.03900146484375 4 0.8290393326591338 2.941192071314498 793.0 4.978169533169534 23.0 - - - - - - - 773.8571428571429 12 7 C3orf1 chromosome 3 open reading frame 1 1929 246 C20140704_OR004_04 C20140704_OR004_04 TB413608.[MT7]-GSQLTYHLR.3y3_1.heavy 406.895 / 425.262 6627.0 24.920900344848633 46 16 10 10 10 3.4248975262340102 29.197953875705938 0.0 3 0.967918572715446 6.871753518281068 6627.0 73.84371428571428 0.0 - - - - - - - 163.44444444444446 13 9 ZNF571 zinc finger protein 571 1931 246 C20140704_OR004_04 C20140704_OR004_04 TB413608.[MT7]-GSQLTYHLR.3y4_1.heavy 406.895 / 588.325 4628.0 24.920900344848633 46 16 10 10 10 3.4248975262340102 29.197953875705938 0.0 3 0.967918572715446 6.871753518281068 4628.0 85.50780952380953 1.0 - - - - - - - 192.83333333333334 9 6 ZNF571 zinc finger protein 571 1933 246 C20140704_OR004_04 C20140704_OR004_04 TB413608.[MT7]-GSQLTYHLR.3b3_1.heavy 406.895 / 417.221 7047.0 24.920900344848633 46 16 10 10 10 3.4248975262340102 29.197953875705938 0.0 3 0.967918572715446 6.871753518281068 7047.0 27.116722090261284 0.0 - - - - - - - 210.25 14 8 ZNF571 zinc finger protein 571 1935 246 C20140704_OR004_04 C20140704_OR004_04 TB413608.[MT7]-GSQLTYHLR.3y5_1.heavy 406.895 / 689.373 1893.0 24.920900344848633 46 16 10 10 10 3.4248975262340102 29.197953875705938 0.0 3 0.967918572715446 6.871753518281068 1893.0 7.793142857142858 1.0 - - - - - - - 184.0 3 4 ZNF571 zinc finger protein 571 1937 247 C20140704_OR004_04 C20140704_OR004_04 TB413606.[MT7]-LQSIVAGLK[MT7].2y4_1.heavy 608.897 / 532.357 3804.0 38.24947547912598 43 18 10 5 10 3.681110109200168 27.165718229962977 0.04290008544921875 3 0.984497784978439 9.8992626289093 3804.0 2.502884142921665 0.0 - - - - - - - 204.88888888888889 7 9 RBL1 retinoblastoma-like 1 (p107) 1939 247 C20140704_OR004_04 C20140704_OR004_04 TB413606.[MT7]-LQSIVAGLK[MT7].2y8_1.heavy 608.897 / 959.601 1844.0 38.24947547912598 43 18 10 5 10 3.681110109200168 27.165718229962977 0.04290008544921875 3 0.984497784978439 9.8992626289093 1844.0 7.383549783549783 2.0 - - - - - - - 256.3333333333333 3 9 RBL1 retinoblastoma-like 1 (p107) 1941 247 C20140704_OR004_04 C20140704_OR004_04 TB413606.[MT7]-LQSIVAGLK[MT7].2y5_1.heavy 608.897 / 631.426 3458.0 38.24947547912598 43 18 10 5 10 3.681110109200168 27.165718229962977 0.04290008544921875 3 0.984497784978439 9.8992626289093 3458.0 27.123501739968976 0.0 - - - - - - - 274.9230769230769 6 13 RBL1 retinoblastoma-like 1 (p107) 1943 247 C20140704_OR004_04 C20140704_OR004_04 TB413606.[MT7]-LQSIVAGLK[MT7].2y7_1.heavy 608.897 / 831.542 2536.0 38.24947547912598 43 18 10 5 10 3.681110109200168 27.165718229962977 0.04290008544921875 3 0.984497784978439 9.8992626289093 2536.0 5.903967499655185 0.0 - - - - - - - 307.5 5 12 RBL1 retinoblastoma-like 1 (p107) 1945 248 C20140704_OR004_04 C20140704_OR004_04 TB451757.[MT7]-NLLLGTAC[CAM]AIYLGFLVSQVGR.3y6_1.heavy 803.786 / 645.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 1947 248 C20140704_OR004_04 C20140704_OR004_04 TB451757.[MT7]-NLLLGTAC[CAM]AIYLGFLVSQVGR.3b5_1.heavy 803.786 / 655.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 1949 248 C20140704_OR004_04 C20140704_OR004_04 TB451757.[MT7]-NLLLGTAC[CAM]AIYLGFLVSQVGR.3b8_1.heavy 803.786 / 987.541 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 1951 248 C20140704_OR004_04 C20140704_OR004_04 TB451757.[MT7]-NLLLGTAC[CAM]AIYLGFLVSQVGR.3y9_1.heavy 803.786 / 962.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 1953 249 C20140704_OR004_04 C20140704_OR004_04 TB413602.[MT7]-FWNVFSK[MT7].2y4_1.heavy 608.342 / 624.384 3880.0 41.78985023498535 43 17 10 6 10 2.507997993573385 31.716825117378974 0.034900665283203125 3 0.9789021046772425 8.48157045691857 3880.0 7.379775481642499 0.0 - - - - - - - 267.3529411764706 7 17 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1955 249 C20140704_OR004_04 C20140704_OR004_04 TB413602.[MT7]-FWNVFSK[MT7].2b3_1.heavy 608.342 / 592.3 5867.0 41.78985023498535 43 17 10 6 10 2.507997993573385 31.716825117378974 0.034900665283203125 3 0.9789021046772425 8.48157045691857 5867.0 23.969043861477534 0.0 - - - - - - - 258.8 11 15 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1957 249 C20140704_OR004_04 C20140704_OR004_04 TB413602.[MT7]-FWNVFSK[MT7].2y3_1.heavy 608.342 / 525.315 10031.0 41.78985023498535 43 17 10 6 10 2.507997993573385 31.716825117378974 0.034900665283203125 3 0.9789021046772425 8.48157045691857 10031.0 26.852481910490425 0.0 - - - - - - - 210.38888888888889 20 18 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1959 249 C20140704_OR004_04 C20140704_OR004_04 TB413602.[MT7]-FWNVFSK[MT7].2y6_1.heavy 608.342 / 924.506 8328.0 41.78985023498535 43 17 10 6 10 2.507997993573385 31.716825117378974 0.034900665283203125 3 0.9789021046772425 8.48157045691857 8328.0 52.829685471374134 0.0 - - - - - - - 196.76923076923077 16 13 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1961 250 C20140704_OR004_04 C20140704_OR004_04 TB451351.[MT7]-TPPLQSER.2y4_1.heavy 536.299 / 519.252 1396.0 20.458399772644043 44 20 10 6 8 38.539639204254776 2.594731088944912 0.03719902038574219 4 0.999231146274967 44.50539692477901 1396.0 0.0 10.0 - - - - - - - 344.1 3 10 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1963 250 C20140704_OR004_04 C20140704_OR004_04 TB451351.[MT7]-TPPLQSER.2y5_1.heavy 536.299 / 632.336 930.0 20.458399772644043 44 20 10 6 8 38.539639204254776 2.594731088944912 0.03719902038574219 4 0.999231146274967 44.50539692477901 930.0 3.5444444444444447 2.0 - - - - - - - 0.0 1 0 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1965 250 C20140704_OR004_04 C20140704_OR004_04 TB451351.[MT7]-TPPLQSER.2y6_1.heavy 536.299 / 729.389 5304.0 20.458399772644043 44 20 10 6 8 38.539639204254776 2.594731088944912 0.03719902038574219 4 0.999231146274967 44.50539692477901 5304.0 18.62992471384907 0.0 - - - - - - - 175.66666666666666 10 9 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1967 250 C20140704_OR004_04 C20140704_OR004_04 TB451351.[MT7]-TPPLQSER.2y7_1.heavy 536.299 / 826.442 13957.0 20.458399772644043 44 20 10 6 8 38.539639204254776 2.594731088944912 0.03719902038574219 4 0.999231146274967 44.50539692477901 13957.0 28.814451612903227 1.0 - - - - - - - 334.8 27 5 FZR1 fizzy/cell division cycle 20 related 1 (Drosophila) 1969 251 C20140704_OR004_04 C20140704_OR004_04 TB451693.[MT7]-VLNSSSQEEISIWDIR.3y7_1.heavy 674.02 / 902.509 4667.0 42.57509994506836 50 20 10 10 10 6.441503176700384 15.524326738161186 0.0 3 0.9923596471645814 14.110056752254616 4667.0 -1.3501446480231438 0.0 - - - - - - - 233.25 9 4 C7orf43 chromosome 7 open reading frame 43 1971 251 C20140704_OR004_04 C20140704_OR004_04 TB451693.[MT7]-VLNSSSQEEISIWDIR.3y6_1.heavy 674.02 / 789.425 15038.0 42.57509994506836 50 20 10 10 10 6.441503176700384 15.524326738161186 0.0 3 0.9923596471645814 14.110056752254616 15038.0 -5.435421686746988 0.0 - - - - - - - 311.0 30 3 C7orf43 chromosome 7 open reading frame 43 1973 251 C20140704_OR004_04 C20140704_OR004_04 TB451693.[MT7]-VLNSSSQEEISIWDIR.3y4_1.heavy 674.02 / 589.309 8297.0 42.57509994506836 50 20 10 10 10 6.441503176700384 15.524326738161186 0.0 3 0.9923596471645814 14.110056752254616 8297.0 -5.997831325301206 0.0 - - - - - - - 298.0 16 8 C7orf43 chromosome 7 open reading frame 43 1975 251 C20140704_OR004_04 C20140704_OR004_04 TB451693.[MT7]-VLNSSSQEEISIWDIR.3y5_1.heavy 674.02 / 702.393 5185.0 42.57509994506836 50 20 10 10 10 6.441503176700384 15.524326738161186 0.0 3 0.9923596471645814 14.110056752254616 5185.0 -1.667202572347266 0.0 - - - - - - - 228.1 10 10 C7orf43 chromosome 7 open reading frame 43 1977 252 C20140704_OR004_04 C20140704_OR004_04 TB427833.[MT7]-QVISC[CAM]DK[MT7].2y4_1.heavy 569.312 / 653.305 3555.0 19.991100311279297 45 15 10 10 10 1.7189207182318131 39.29861344670613 0.0 3 0.956130084680718 5.870543902679855 3555.0 55.8793093639777 0.0 - - - - - - - 200.71428571428572 7 7 DIRAS1;DIRAS2 DIRAS family, GTP-binding RAS-like 1;DIRAS family, GTP-binding RAS-like 2 1979 252 C20140704_OR004_04 C20140704_OR004_04 TB427833.[MT7]-QVISC[CAM]DK[MT7].2y5_1.heavy 569.312 / 766.389 2151.0 19.991100311279297 45 15 10 10 10 1.7189207182318131 39.29861344670613 0.0 3 0.956130084680718 5.870543902679855 2151.0 9.852406417112299 1.0 - - - - - - - 112.6 4 5 DIRAS1;DIRAS2 DIRAS family, GTP-binding RAS-like 1;DIRAS family, GTP-binding RAS-like 2 1981 252 C20140704_OR004_04 C20140704_OR004_04 TB427833.[MT7]-QVISC[CAM]DK[MT7].2y3_1.heavy 569.312 / 566.273 1029.0 19.991100311279297 45 15 10 10 10 1.7189207182318131 39.29861344670613 0.0 3 0.956130084680718 5.870543902679855 1029.0 3.1827297220067763 4.0 - - - - - - - 280.6 6 5 DIRAS1;DIRAS2 DIRAS family, GTP-binding RAS-like 1;DIRAS family, GTP-binding RAS-like 2 1983 252 C20140704_OR004_04 C20140704_OR004_04 TB427833.[MT7]-QVISC[CAM]DK[MT7].2y6_1.heavy 569.312 / 865.457 3648.0 19.991100311279297 45 15 10 10 10 1.7189207182318131 39.29861344670613 0.0 3 0.956130084680718 5.870543902679855 3648.0 18.044919786096255 0.0 - - - - - - - 240.71428571428572 7 7 DIRAS1;DIRAS2 DIRAS family, GTP-binding RAS-like 1;DIRAS family, GTP-binding RAS-like 2 1985 253 C20140704_OR004_04 C20140704_OR004_04 TB413933.[MT7]-DFRC[CAM]PSQLTQHTR.4y5_1.heavy 448.228 / 642.332 996.0 23.434800148010254 33 15 2 6 10 6.451043623514467 15.501367815200258 0.03980064392089844 3 0.9579391432880292 5.996380777486104 996.0 12.525282943143813 1.0 - - - - - - - 0.0 1 0 ZNF571 zinc finger protein 571 1987 253 C20140704_OR004_04 C20140704_OR004_04 TB413933.[MT7]-DFRC[CAM]PSQLTQHTR.4y4_1.heavy 448.228 / 541.284 1494.0 23.434800148010254 33 15 2 6 10 6.451043623514467 15.501367815200258 0.03980064392089844 3 0.9579391432880292 5.996380777486104 1494.0 7.274527823061796 1.0 - - - - - - - 252.46666666666667 2 15 ZNF571 zinc finger protein 571 1989 253 C20140704_OR004_04 C20140704_OR004_04 TB413933.[MT7]-DFRC[CAM]PSQLTQHTR.4b7_2.heavy 448.228 / 518.244 2590.0 23.434800148010254 33 15 2 6 10 6.451043623514467 15.501367815200258 0.03980064392089844 3 0.9579391432880292 5.996380777486104 2590.0 36.9693216080402 0.0 - - - - - - - 280.72727272727275 5 11 ZNF571 zinc finger protein 571 1991 253 C20140704_OR004_04 C20140704_OR004_04 TB413933.[MT7]-DFRC[CAM]PSQLTQHTR.4b6_2.heavy 448.228 / 454.214 598.0 23.434800148010254 33 15 2 6 10 6.451043623514467 15.501367815200258 0.03980064392089844 3 0.9579391432880292 5.996380777486104 598.0 0.24016064257028108 14.0 - - - - - - - 241.78571428571428 10 14 ZNF571 zinc finger protein 571 1993 254 C20140704_OR004_04 C20140704_OR004_04 TB427835.[MT7]-DVSLFLFR.2b4_1.heavy 570.83 / 559.321 679.0 45.09945106506348 40 14 10 6 10 17.50787596045137 5.711715129001972 0.037700653076171875 3 0.9478911996930989 5.382730948726932 679.0 9.692392156862745 8.0 - - - - - - - 0.0 1 0 RAD17 RAD17 homolog (S. pombe) 1995 254 C20140704_OR004_04 C20140704_OR004_04 TB427835.[MT7]-DVSLFLFR.2y6_1.heavy 570.83 / 782.456 2545.0 45.09945106506348 40 14 10 6 10 17.50787596045137 5.711715129001972 0.037700653076171875 3 0.9478911996930989 5.382730948726932 2545.0 5.5821933962264145 0.0 - - - - - - - 240.41666666666666 5 12 RAD17 RAD17 homolog (S. pombe) 1997 254 C20140704_OR004_04 C20140704_OR004_04 TB427835.[MT7]-DVSLFLFR.2b5_1.heavy 570.83 / 706.389 1273.0 45.09945106506348 40 14 10 6 10 17.50787596045137 5.711715129001972 0.037700653076171875 3 0.9478911996930989 5.382730948726932 1273.0 19.394529411764704 0.0 - - - - - - - 244.0 2 8 RAD17 RAD17 homolog (S. pombe) 1999 254 C20140704_OR004_04 C20140704_OR004_04 TB427835.[MT7]-DVSLFLFR.2y7_1.heavy 570.83 / 881.524 2545.0 45.09945106506348 40 14 10 6 10 17.50787596045137 5.711715129001972 0.037700653076171875 3 0.9478911996930989 5.382730948726932 2545.0 26.21398577129967 0.0 - - - - - - - 178.4 5 10 RAD17 RAD17 homolog (S. pombe) 2001 255 C20140704_OR004_04 C20140704_OR004_04 TB451691.[MT7]-AHLLADMAHISGLVAAK[MT7].4b8_1.heavy 502.292 / 967.515 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 2003 255 C20140704_OR004_04 C20140704_OR004_04 TB451691.[MT7]-AHLLADMAHISGLVAAK[MT7].4b7_1.heavy 502.292 / 896.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 2005 255 C20140704_OR004_04 C20140704_OR004_04 TB451691.[MT7]-AHLLADMAHISGLVAAK[MT7].4b4_1.heavy 502.292 / 579.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 2007 255 C20140704_OR004_04 C20140704_OR004_04 TB451691.[MT7]-AHLLADMAHISGLVAAK[MT7].4b6_1.heavy 502.292 / 765.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 2009 256 C20140704_OR004_04 C20140704_OR004_04 TB428008.[MT7]-ATQLTY[MT7]HQR.3y6_1.heavy 469.265 / 961.534 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 2011 256 C20140704_OR004_04 C20140704_OR004_04 TB428008.[MT7]-ATQLTY[MT7]HQR.3b4_1.heavy 469.265 / 558.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 2013 256 C20140704_OR004_04 C20140704_OR004_04 TB428008.[MT7]-ATQLTY[MT7]HQR.3y8_2.heavy 469.265 / 595.824 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 2015 256 C20140704_OR004_04 C20140704_OR004_04 TB428008.[MT7]-ATQLTY[MT7]HQR.3y5_1.heavy 469.265 / 848.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF571 zinc finger protein 571 2017 257 C20140704_OR004_04 C20140704_OR004_04 TB427831.[MT7]-AMADALLER.2y8_1.heavy 567.309 / 918.471 29895.0 33.74580001831055 47 17 10 10 10 2.994243150227514 26.637501928884078 0.0 3 0.9773571243575097 8.186036615922752 29895.0 144.06602395323415 0.0 - - - - - - - 297.75 59 4 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 2019 257 C20140704_OR004_04 C20140704_OR004_04 TB427831.[MT7]-AMADALLER.2y5_1.heavy 567.309 / 601.367 30953.0 33.74580001831055 47 17 10 10 10 2.994243150227514 26.637501928884078 0.0 3 0.9773571243575097 8.186036615922752 30953.0 63.56026174570146 0.0 - - - - - - - 226.85714285714286 61 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 2021 257 C20140704_OR004_04 C20140704_OR004_04 TB427831.[MT7]-AMADALLER.2b4_1.heavy 567.309 / 533.251 26191.0 33.74580001831055 47 17 10 10 10 2.994243150227514 26.637501928884078 0.0 3 0.9773571243575097 8.186036615922752 26191.0 30.18016668876221 3.0 - - - - - - - 1190.7142857142858 62 7 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 2023 257 C20140704_OR004_04 C20140704_OR004_04 TB427831.[MT7]-AMADALLER.2b5_1.heavy 567.309 / 604.288 15344.0 33.74580001831055 47 17 10 10 10 2.994243150227514 26.637501928884078 0.0 3 0.9773571243575097 8.186036615922752 15344.0 63.01609900339503 0.0 - - - - - - - 297.75 30 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 2025 258 C20140704_OR004_04 C20140704_OR004_04 TB428132.[MT7]-LTWGTYQQLLK[MT7].3y3_1.heavy 546.987 / 517.383 22367.0 41.80730056762695 47 17 10 10 10 3.48039884952954 28.732339114960176 0.0 3 0.97922824126785 8.548129653100428 22367.0 94.73563500790651 0.0 - - - - - - - 230.46153846153845 44 13 FAM198B family with sequence similarity 198, member B 2027 258 C20140704_OR004_04 C20140704_OR004_04 TB428132.[MT7]-LTWGTYQQLLK[MT7].3b4_1.heavy 546.987 / 602.342 8423.0 41.80730056762695 47 17 10 10 10 3.48039884952954 28.732339114960176 0.0 3 0.97922824126785 8.548129653100428 8423.0 54.019277979713394 0.0 - - - - - - - 187.27272727272728 16 11 FAM198B family with sequence similarity 198, member B 2029 258 C20140704_OR004_04 C20140704_OR004_04 TB428132.[MT7]-LTWGTYQQLLK[MT7].3b5_1.heavy 546.987 / 703.39 13009.0 41.80730056762695 47 17 10 10 10 3.48039884952954 28.732339114960176 0.0 3 0.97922824126785 8.548129653100428 13009.0 205.8734565934691 0.0 - - - - - - - 249.55555555555554 26 9 FAM198B family with sequence similarity 198, member B 2031 258 C20140704_OR004_04 C20140704_OR004_04 TB428132.[MT7]-LTWGTYQQLLK[MT7].3y4_1.heavy 546.987 / 645.442 8423.0 41.80730056762695 47 17 10 10 10 3.48039884952954 28.732339114960176 0.0 3 0.97922824126785 8.548129653100428 8423.0 19.457239152274617 0.0 - - - - - - - 210.58333333333334 16 12 FAM198B family with sequence similarity 198, member B 2033 259 C20140704_OR004_04 C20140704_OR004_04 TB451348.[MT7]-MSVIWER.2y4_1.heavy 532.788 / 603.325 62759.0 31.597000122070312 26 2 10 10 4 0.48777338098091416 108.5777742475793 0.0 7 0.41316677847908945 1.524481404509793 62759.0 217.84765664160403 0.0 - - - - - - - 798.0 125 7 DPYSL5 dihydropyrimidinase-like 5 2035 259 C20140704_OR004_04 C20140704_OR004_04 TB451348.[MT7]-MSVIWER.2y5_1.heavy 532.788 / 702.393 798.0 31.597000122070312 26 2 10 10 4 0.48777338098091416 108.5777742475793 0.0 7 0.41316677847908945 1.524481404509793 798.0 2.9614285714285713 6.0 - - - - - - - 247.0 6 7 DPYSL5 dihydropyrimidinase-like 5 2037 259 C20140704_OR004_04 C20140704_OR004_04 TB451348.[MT7]-MSVIWER.2b4_1.heavy 532.788 / 575.334 532.0 31.597000122070312 26 2 10 10 4 0.48777338098091416 108.5777742475793 0.0 7 0.41316677847908945 1.524481404509793 532.0 2.4066666666666667 29.0 - - - - - - - 249.375 13 8 DPYSL5 dihydropyrimidinase-like 5 2039 259 C20140704_OR004_04 C20140704_OR004_04 TB451348.[MT7]-MSVIWER.2y6_1.heavy 532.788 / 789.425 13429.0 31.597000122070312 26 2 10 10 4 0.48777338098091416 108.5777742475793 0.0 7 0.41316677847908945 1.524481404509793 13429.0 118.63966165413532 1.0 - - - - - - - 253.9090909090909 26 11 DPYSL5 dihydropyrimidinase-like 5 2041 260 C20140704_OR004_04 C20140704_OR004_04 TB413510.[MT7]-GVMHSNK[MT7].2y4_1.heavy 530.794 / 629.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - RAD17 RAD17 homolog (S. pombe) 2043 260 C20140704_OR004_04 C20140704_OR004_04 TB413510.[MT7]-GVMHSNK[MT7].2y5_1.heavy 530.794 / 760.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - RAD17 RAD17 homolog (S. pombe) 2045 260 C20140704_OR004_04 C20140704_OR004_04 TB413510.[MT7]-GVMHSNK[MT7].2b4_1.heavy 530.794 / 569.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - RAD17 RAD17 homolog (S. pombe) 2047 260 C20140704_OR004_04 C20140704_OR004_04 TB413510.[MT7]-GVMHSNK[MT7].2y3_1.heavy 530.794 / 492.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - RAD17 RAD17 homolog (S. pombe) 2049 261 C20140704_OR004_04 C20140704_OR004_04 TB451345.[MT7]-K[MT7]PPASK[MT7].2y4_1.heavy 530.348 / 546.337 N/A 14.3016996383667 35 5 10 10 10 0.43650474170162223 109.82587329436302 0.0 3 0.6068778019128926 1.8998436072575995 166.0 4.527272727272727 2.0 - - - - - - - 0.0 0 0 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 2051 261 C20140704_OR004_04 C20140704_OR004_04 TB451345.[MT7]-K[MT7]PPASK[MT7].2y5_1.heavy 530.348 / 643.39 349.0 14.3016996383667 35 5 10 10 10 0.43650474170162223 109.82587329436302 0.0 3 0.6068778019128926 1.8998436072575995 349.0 20.654319631467047 1.0 - - - - - - - 0.0 0 0 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 2053 261 C20140704_OR004_04 C20140704_OR004_04 TB451345.[MT7]-K[MT7]PPASK[MT7].2b4_1.heavy 530.348 / 682.449 332.0 14.3016996383667 35 5 10 10 10 0.43650474170162223 109.82587329436302 0.0 3 0.6068778019128926 1.8998436072575995 332.0 35.73882352941177 0.0 - - - - - - - 0.0 0 0 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 2055 261 C20140704_OR004_04 C20140704_OR004_04 TB451345.[MT7]-K[MT7]PPASK[MT7].2y3_1.heavy 530.348 / 449.284 1412.0 14.3016996383667 35 5 10 10 10 0.43650474170162223 109.82587329436302 0.0 3 0.6068778019128926 1.8998436072575995 1412.0 12.718616541353384 1.0 - - - - - - - 131.0 2 18 EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 2057 262 C20140704_OR004_04 C20140704_OR004_04 TB413727.[MT7]-MSEIMIDAEGR.2y8_1.heavy 698.34 / 904.456 1438.0 34.650400161743164 44 18 10 6 10 5.526717323158654 18.093923418331727 0.038799285888671875 3 0.9866863131518557 10.683909045048994 1438.0 14.819083969465648 0.0 - - - - - - - 239.83333333333334 2 6 DPP8 dipeptidyl-peptidase 8 2059 262 C20140704_OR004_04 C20140704_OR004_04 TB413727.[MT7]-MSEIMIDAEGR.2b4_1.heavy 698.34 / 605.308 2746.0 34.650400161743164 44 18 10 6 10 5.526717323158654 18.093923418331727 0.038799285888671875 3 0.9866863131518557 10.683909045048994 2746.0 4.19236641221374 1.0 - - - - - - - 240.0 5 6 DPP8 dipeptidyl-peptidase 8 2061 262 C20140704_OR004_04 C20140704_OR004_04 TB413727.[MT7]-MSEIMIDAEGR.2y10_1.heavy 698.34 / 1120.53 3008.0 34.650400161743164 44 18 10 6 10 5.526717323158654 18.093923418331727 0.038799285888671875 3 0.9866863131518557 10.683909045048994 3008.0 27.801975385574075 0.0 - - - - - - - 245.25 6 8 DPP8 dipeptidyl-peptidase 8 2063 262 C20140704_OR004_04 C20140704_OR004_04 TB413727.[MT7]-MSEIMIDAEGR.2y7_1.heavy 698.34 / 791.372 1831.0 34.650400161743164 44 18 10 6 10 5.526717323158654 18.093923418331727 0.038799285888671875 3 0.9866863131518557 10.683909045048994 1831.0 4.202636487716106 0.0 - - - - - - - 310.5 3 8 DPP8 dipeptidyl-peptidase 8 2065 263 C20140704_OR004_04 C20140704_OR004_04 TB413512.[MT7]-GTVK[MT7]PK[MT7].2b3_1.heavy 531.356 / 402.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 2067 263 C20140704_OR004_04 C20140704_OR004_04 TB413512.[MT7]-GTVK[MT7]PK[MT7].2y5_1.heavy 531.356 / 860.581 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 2069 263 C20140704_OR004_04 C20140704_OR004_04 TB413512.[MT7]-GTVK[MT7]PK[MT7].2b4_1.heavy 531.356 / 674.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 2071 263 C20140704_OR004_04 C20140704_OR004_04 TB413512.[MT7]-GTVK[MT7]PK[MT7].2y3_1.heavy 531.356 / 660.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM198B family with sequence similarity 198, member B 2073 264 C20140704_OR004_04 C20140704_OR004_04 TB413920.[MT7]-EAVITPVASATQSVSR.3b4_1.heavy 587.327 / 557.341 6393.0 30.63665008544922 39 16 10 5 8 2.4608937698957623 28.749374243991646 0.04270172119140625 4 0.9681029816706913 6.891696183672592 6393.0 7.096848801884863 0.0 - - - - - - - 710.5555555555555 12 9 RBL1 retinoblastoma-like 1 (p107) 2075 264 C20140704_OR004_04 C20140704_OR004_04 TB413920.[MT7]-EAVITPVASATQSVSR.3b5_1.heavy 587.327 / 658.389 3923.0 30.63665008544922 39 16 10 5 8 2.4608937698957623 28.749374243991646 0.04270172119140625 4 0.9681029816706913 6.891696183672592 3923.0 13.979985235288922 1.0 - - - - - - - 261.6 9 10 RBL1 retinoblastoma-like 1 (p107) 2077 264 C20140704_OR004_04 C20140704_OR004_04 TB413920.[MT7]-EAVITPVASATQSVSR.3y8_1.heavy 587.327 / 835.427 2761.0 30.63665008544922 39 16 10 5 8 2.4608937698957623 28.749374243991646 0.04270172119140625 4 0.9681029816706913 6.891696183672592 2761.0 7.59908256880734 0.0 - - - - - - - 314.8333333333333 5 6 RBL1 retinoblastoma-like 1 (p107) 2079 264 C20140704_OR004_04 C20140704_OR004_04 TB413920.[MT7]-EAVITPVASATQSVSR.3y9_1.heavy 587.327 / 906.464 4650.0 30.63665008544922 39 16 10 5 8 2.4608937698957623 28.749374243991646 0.04270172119140625 4 0.9681029816706913 6.891696183672592 4650.0 46.42891930323498 0.0 - - - - - - - 193.66666666666666 9 3 RBL1 retinoblastoma-like 1 (p107) 2081 265 C20140704_OR004_04 C20140704_OR004_04 TB427825.[MT7]-DLANIC[CAM]K[MT7].2y4_1.heavy 561.315 / 678.372 7183.0 26.24169921875 48 18 10 10 10 4.7429166146780215 21.084072971160303 0.0 3 0.9876519697033588 11.094701478903072 7183.0 51.667192982456136 0.0 - - - - - - - 266.0 14 6 C3orf1 chromosome 3 open reading frame 1 2083 265 C20140704_OR004_04 C20140704_OR004_04 TB427825.[MT7]-DLANIC[CAM]K[MT7].2y5_1.heavy 561.315 / 749.41 7183.0 26.24169921875 48 18 10 10 10 4.7429166146780215 21.084072971160303 0.0 3 0.9876519697033588 11.094701478903072 7183.0 10.007275541795664 0.0 - - - - - - - 228.0 14 4 C3orf1 chromosome 3 open reading frame 1 2085 265 C20140704_OR004_04 C20140704_OR004_04 TB427825.[MT7]-DLANIC[CAM]K[MT7].2b4_1.heavy 561.315 / 558.3 8894.0 26.24169921875 48 18 10 10 10 4.7429166146780215 21.084072971160303 0.0 3 0.9876519697033588 11.094701478903072 8894.0 15.90357624831309 0.0 - - - - - - - 635.1428571428571 17 7 C3orf1 chromosome 3 open reading frame 1 2087 265 C20140704_OR004_04 C20140704_OR004_04 TB427825.[MT7]-DLANIC[CAM]K[MT7].2y3_1.heavy 561.315 / 564.33 4903.0 26.24169921875 48 18 10 10 10 4.7429166146780215 21.084072971160303 0.0 3 0.9876519697033588 11.094701478903072 4903.0 30.10614035087719 0.0 - - - - - - - 190.0 9 9 C3orf1 chromosome 3 open reading frame 1 2089 266 C20140704_OR004_04 C20140704_OR004_04 TB427927.[MT7]-DNTAQQISK[MT7].2b4_1.heavy 646.856 / 546.264 1965.0 18.729799270629883 46 16 10 10 10 6.682176919572587 14.96518293418611 0.0 3 0.9653368691257661 6.609459207072227 1965.0 24.71560371517028 0.0 - - - - - - - 256.22222222222223 3 9 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 2091 266 C20140704_OR004_04 C20140704_OR004_04 TB427927.[MT7]-DNTAQQISK[MT7].2b6_1.heavy 646.856 / 802.381 2563.0 18.729799270629883 46 16 10 10 10 6.682176919572587 14.96518293418611 0.0 3 0.9653368691257661 6.609459207072227 2563.0 15.00001370614035 0.0 - - - - - - - 170.66666666666666 5 6 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 2093 266 C20140704_OR004_04 C20140704_OR004_04 TB427927.[MT7]-DNTAQQISK[MT7].2y6_1.heavy 646.856 / 818.485 2478.0 18.729799270629883 46 16 10 10 10 6.682176919572587 14.96518293418611 0.0 3 0.9653368691257661 6.609459207072227 2478.0 32.22766544117647 0.0 - - - - - - - 146.28571428571428 4 7 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 2095 266 C20140704_OR004_04 C20140704_OR004_04 TB427927.[MT7]-DNTAQQISK[MT7].2b5_1.heavy 646.856 / 674.323 2905.0 18.729799270629883 46 16 10 10 10 6.682176919572587 14.96518293418611 0.0 3 0.9653368691257661 6.609459207072227 2905.0 13.107698175203897 0.0 - - - - - - - 136.4 5 5 SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 2097 267 C20140704_OR004_04 C20140704_OR004_04 TB451544.[MT7]-LLVLEGGAPGAVLR.2y12_1.heavy 754.968 / 1138.66 9397.0 41.8765983581543 48 18 10 10 10 6.009120477048855 16.64137046044234 0.0 3 0.9838355276191949 9.693817735488034 9397.0 62.946411483253584 0.0 - - - - - - - 240.1 18 10 FAM198B family with sequence similarity 198, member B 2099 267 C20140704_OR004_04 C20140704_OR004_04 TB451544.[MT7]-LLVLEGGAPGAVLR.2y9_1.heavy 754.968 / 797.463 18584.0 41.8765983581543 48 18 10 10 10 6.009120477048855 16.64137046044234 0.0 3 0.9838355276191949 9.693817735488034 18584.0 138.20743843343473 0.0 - - - - - - - 169.5 37 8 FAM198B family with sequence similarity 198, member B 2101 267 C20140704_OR004_04 C20140704_OR004_04 TB451544.[MT7]-LLVLEGGAPGAVLR.2y10_1.heavy 754.968 / 926.505 21821.0 41.8765983581543 48 18 10 10 10 6.009120477048855 16.64137046044234 0.0 3 0.9838355276191949 9.693817735488034 21821.0 150.8676794258373 0.0 - - - - - - - 278.6666666666667 43 6 FAM198B family with sequence similarity 198, member B 2103 267 C20140704_OR004_04 C20140704_OR004_04 TB451544.[MT7]-LLVLEGGAPGAVLR.2y11_1.heavy 754.968 / 1039.59 31426.0 41.8765983581543 48 18 10 10 10 6.009120477048855 16.64137046044234 0.0 3 0.9838355276191949 9.693817735488034 31426.0 343.05327365163566 0.0 - - - - - - - 169.5 62 8 FAM198B family with sequence similarity 198, member B 2105 268 C20140704_OR004_04 C20140704_OR004_04 TB428277.[MT7]-RISATSIFFESMPYK[MT7].2b8_1.heavy 1033.06 / 1020.6 974.0 39.05617618560791 19 2 2 5 10 1.8002002076885226 44.12633720707862 0.045299530029296875 3 0.4199493794796989 1.5344811332714667 974.0 5.067146507616291 5.0 - - - - - - - 0.0 1 0 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 2107 268 C20140704_OR004_04 C20140704_OR004_04 TB428277.[MT7]-RISATSIFFESMPYK[MT7].2y3_1.heavy 1033.06 / 551.331 292.0 39.05617618560791 19 2 2 5 10 1.8002002076885226 44.12633720707862 0.045299530029296875 3 0.4199493794796989 1.5344811332714667 292.0 1.552061855670103 11.0 - - - - - - - 194.625 7 8 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 2109 268 C20140704_OR004_04 C20140704_OR004_04 TB428277.[MT7]-RISATSIFFESMPYK[MT7].2b7_1.heavy 1033.06 / 873.527 1851.0 39.05617618560791 19 2 2 5 10 1.8002002076885226 44.12633720707862 0.045299530029296875 3 0.4199493794796989 1.5344811332714667 1851.0 17.598354399096173 0.0 - - - - - - - 205.44444444444446 3 9 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 2111 268 C20140704_OR004_04 C20140704_OR004_04 TB428277.[MT7]-RISATSIFFESMPYK[MT7].2b9_1.heavy 1033.06 / 1167.66 1364.0 39.05617618560791 19 2 2 5 10 1.8002002076885226 44.12633720707862 0.045299530029296875 3 0.4199493794796989 1.5344811332714667 1364.0 10.842051282051282 0.0 - - - - - - - 212.54545454545453 2 11 SHMT2 serine hydroxymethyltransferase 2 (mitochondrial) 2113 269 C20140704_OR004_04 C20140704_OR004_04 TB451285.[MT7]-DLYMLR.2y4_1.heavy 477.764 / 582.307 1385.0 34.007850646972656 30 13 2 5 10 1.5609358684003554 53.255856193349416 0.0413970947265625 3 0.9223136726857692 4.398834162414215 1385.0 9.5 5.0 - - - - - - - 231.0 23 6 DPYSL5 dihydropyrimidinase-like 5 2115 269 C20140704_OR004_04 C20140704_OR004_04 TB451285.[MT7]-DLYMLR.2b3_1.heavy 477.764 / 536.284 4987.0 34.007850646972656 30 13 2 5 10 1.5609358684003554 53.255856193349416 0.0413970947265625 3 0.9223136726857692 4.398834162414215 4987.0 17.505219710844713 0.0 - - - - - - - 237.71428571428572 9 7 DPYSL5 dihydropyrimidinase-like 5 2117 269 C20140704_OR004_04 C20140704_OR004_04 TB451285.[MT7]-DLYMLR.2y5_1.heavy 477.764 / 695.391 2771.0 34.007850646972656 30 13 2 5 10 1.5609358684003554 53.255856193349416 0.0413970947265625 3 0.9223136726857692 4.398834162414215 2771.0 13.004693140794224 0.0 - - - - - - - 346.5 5 2 DPYSL5 dihydropyrimidinase-like 5 2119 269 C20140704_OR004_04 C20140704_OR004_04 TB451285.[MT7]-DLYMLR.2b4_1.heavy 477.764 / 667.324 2216.0 34.007850646972656 30 13 2 5 10 1.5609358684003554 53.255856193349416 0.0413970947265625 3 0.9223136726857692 4.398834162414215 2216.0 23.143597122302157 0.0 - - - - - - - 173.5 4 4 DPYSL5 dihydropyrimidinase-like 5 2121 270 C20140704_OR004_04 C20140704_OR004_04 TB451480.[MT7]-TSDLIQHQK[MT7].3b6_1.heavy 453.261 / 802.443 2764.0 20.747400283813477 50 20 10 10 10 4.175980185365609 23.946473776490144 0.0 3 0.9913271206087126 13.242388778724422 2764.0 45.06521739130435 0.0 - - - - - - - 245.66666666666666 5 3 ZNF571 zinc finger protein 571 2123 270 C20140704_OR004_04 C20140704_OR004_04 TB451480.[MT7]-TSDLIQHQK[MT7].3y3_1.heavy 453.261 / 556.332 12253.0 20.747400283813477 50 20 10 10 10 4.175980185365609 23.946473776490144 0.0 3 0.9913271206087126 13.242388778724422 12253.0 166.03702898550725 0.0 - - - - - - - 236.71428571428572 24 7 ZNF571 zinc finger protein 571 2125 270 C20140704_OR004_04 C20140704_OR004_04 TB451480.[MT7]-TSDLIQHQK[MT7].3b4_1.heavy 453.261 / 561.3 31047.0 20.747400283813477 50 20 10 10 10 4.175980185365609 23.946473776490144 0.0 3 0.9913271206087126 13.242388778724422 31047.0 111.05479897089239 0.0 - - - - - - - 322.5 62 6 ZNF571 zinc finger protein 571 2127 270 C20140704_OR004_04 C20140704_OR004_04 TB451480.[MT7]-TSDLIQHQK[MT7].3b5_1.heavy 453.261 / 674.384 5251.0 20.747400283813477 50 20 10 10 10 4.175980185365609 23.946473776490144 0.0 3 0.9913271206087126 13.242388778724422 5251.0 63.042007482031345 0.0 - - - - - - - 210.42857142857142 10 7 ZNF571 zinc finger protein 571 2129 271 C20140704_OR004_04 C20140704_OR004_04 TB451289.[MT7]-LLEGIK[MT7].2b3_1.heavy 480.82 / 500.32 3928.0 32.751800537109375 34 14 6 10 4 1.9708035126660617 50.74072547431281 0.0 7 0.9493927593399863 5.462698979955772 3928.0 26.832087828733965 2.0 - - - - - - - 217.875 7 8 FAM198B family with sequence similarity 198, member B 2131 271 C20140704_OR004_04 C20140704_OR004_04 TB451289.[MT7]-LLEGIK[MT7].2y4_1.heavy 480.82 / 590.363 5528.0 32.751800537109375 34 14 6 10 4 1.9708035126660617 50.74072547431281 0.0 7 0.9493927593399863 5.462698979955772 5528.0 48.07663650743436 1.0 - - - - - - - 290.7142857142857 13 7 FAM198B family with sequence similarity 198, member B 2133 271 C20140704_OR004_04 C20140704_OR004_04 TB451289.[MT7]-LLEGIK[MT7].2y5_1.heavy 480.82 / 703.447 4946.0 32.751800537109375 34 14 6 10 4 1.9708035126660617 50.74072547431281 0.0 7 0.9493927593399863 5.462698979955772 4946.0 16.854884971763425 3.0 - - - - - - - 269.85714285714283 21 7 FAM198B family with sequence similarity 198, member B 2135 271 C20140704_OR004_04 C20140704_OR004_04 TB451289.[MT7]-LLEGIK[MT7].2b4_1.heavy 480.82 / 557.341 1746.0 32.751800537109375 34 14 6 10 4 1.9708035126660617 50.74072547431281 0.0 7 0.9493927593399863 5.462698979955772 1746.0 2.653617606602476 2.0 - - - - - - - 290.85714285714283 3 7 FAM198B family with sequence similarity 198, member B 2137 272 C20140704_OR004_04 C20140704_OR004_04 TB413615.[MT7]-GALAETGAGAK[MT7].2y8_1.heavy 617.356 / 848.459 5023.0 21.106199264526367 47 17 10 10 10 2.7065437149430656 29.53296990380849 0.0 3 0.9729180543079239 7.482339452647234 5023.0 31.23108808290155 0.0 - - - - - - - 193.2 10 5 MRPS5 mitochondrial ribosomal protein S5 2139 272 C20140704_OR004_04 C20140704_OR004_04 TB413615.[MT7]-GALAETGAGAK[MT7].2y5_1.heavy 617.356 / 547.332 3381.0 21.106199264526367 47 17 10 10 10 2.7065437149430656 29.53296990380849 0.0 3 0.9729180543079239 7.482339452647234 3381.0 15.942859757213444 0.0 - - - - - - - 161.11111111111111 6 9 MRPS5 mitochondrial ribosomal protein S5 2141 272 C20140704_OR004_04 C20140704_OR004_04 TB413615.[MT7]-GALAETGAGAK[MT7].2y6_1.heavy 617.356 / 648.38 5217.0 21.106199264526367 47 17 10 10 10 2.7065437149430656 29.53296990380849 0.0 3 0.9729180543079239 7.482339452647234 5217.0 35.14041450777202 0.0 - - - - - - - 248.42857142857142 10 7 MRPS5 mitochondrial ribosomal protein S5 2143 272 C20140704_OR004_04 C20140704_OR004_04 TB413615.[MT7]-GALAETGAGAK[MT7].2y7_1.heavy 617.356 / 777.422 2415.0 21.106199264526367 47 17 10 10 10 2.7065437149430656 29.53296990380849 0.0 3 0.9729180543079239 7.482339452647234 2415.0 23.65 1.0 - - - - - - - 217.25 4 4 MRPS5 mitochondrial ribosomal protein S5 2145 273 C20140704_OR004_04 C20140704_OR004_04 TB427821.[MT7]-AAVEVFGK[MT7].2y4_1.heavy 554.834 / 594.373 32387.0 30.190099716186523 47 17 10 10 10 3.4129117224495316 29.300494162277225 0.0 3 0.9760596677605654 7.9602558310750835 32387.0 98.01189527887227 0.0 - - - - - - - 254.0 64 8 HAUS7 HAUS augmin-like complex, subunit 7 2147 273 C20140704_OR004_04 C20140704_OR004_04 TB427821.[MT7]-AAVEVFGK[MT7].2y5_1.heavy 554.834 / 723.416 43134.0 30.190099716186523 47 17 10 10 10 3.4129117224495316 29.300494162277225 0.0 3 0.9760596677605654 7.9602558310750835 43134.0 95.77084337349397 0.0 - - - - - - - 217.5 86 2 HAUS7 HAUS augmin-like complex, subunit 7 2149 273 C20140704_OR004_04 C20140704_OR004_04 TB427821.[MT7]-AAVEVFGK[MT7].2b4_1.heavy 554.834 / 515.295 81330.0 30.190099716186523 47 17 10 10 10 3.4129117224495316 29.300494162277225 0.0 3 0.9760596677605654 7.9602558310750835 81330.0 99.39934570428912 0.0 - - - - - - - 348.4 162 5 HAUS7 HAUS augmin-like complex, subunit 7 2151 273 C20140704_OR004_04 C20140704_OR004_04 TB427821.[MT7]-AAVEVFGK[MT7].2y7_1.heavy 554.834 / 893.521 24690.0 30.190099716186523 47 17 10 10 10 3.4129117224495316 29.300494162277225 0.0 3 0.9760596677605654 7.9602558310750835 24690.0 78.74408936264338 0.0 - - - - - - - 241.83333333333334 49 6 HAUS7 HAUS augmin-like complex, subunit 7 2153 274 C20140704_OR004_04 C20140704_OR004_04 TB451682.[MT7]-IESSLQEDEPENDAK[MT7].2b8_1.heavy 996.486 / 1046.51 3167.0 27.19575023651123 28 3 10 5 10 0.7921896858294968 73.01046399006735 0.040599822998046875 3 0.5033473304327777 1.6728480018317522 3167.0 -1.9981072555205044 0.0 - - - - - - - 211.33333333333334 6 6 C3orf1 chromosome 3 open reading frame 1 2155 274 C20140704_OR004_04 C20140704_OR004_04 TB451682.[MT7]-IESSLQEDEPENDAK[MT7].2y4_1.heavy 996.486 / 591.322 1267.0 27.19575023651123 28 3 10 5 10 0.7921896858294968 73.01046399006735 0.040599822998046875 3 0.5033473304327777 1.6728480018317522 1267.0 0.0 0.0 - - - - - - - 211.5 2 2 C3orf1 chromosome 3 open reading frame 1 2157 274 C20140704_OR004_04 C20140704_OR004_04 TB451682.[MT7]-IESSLQEDEPENDAK[MT7].2b4_1.heavy 996.486 / 561.3 1478.0 27.19575023651123 28 3 10 5 10 0.7921896858294968 73.01046399006735 0.040599822998046875 3 0.5033473304327777 1.6728480018317522 1478.0 7.203309518269509 1.0 - - - - - - - 158.5 2 2 C3orf1 chromosome 3 open reading frame 1 2159 274 C20140704_OR004_04 C20140704_OR004_04 TB451682.[MT7]-IESSLQEDEPENDAK[MT7].2y6_1.heavy 996.486 / 817.417 211.0 27.19575023651123 28 3 10 5 10 0.7921896858294968 73.01046399006735 0.040599822998046875 3 0.5033473304327777 1.6728480018317522 211.0 0.4196969696969697 3.0 - - - - - - - 0.0 1 0 C3orf1 chromosome 3 open reading frame 1