Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140704_OR005_01 C20140704_OR005_01 TB412665.[MT7]-MSPQEGQK[MT7].2y4_1.heavy 596.815 / 605.338 1562.0 17.515865961710613 43 17 10 6 10 3.9976852487662415 25.014475572048056 0.03890037536621094 3 0.9776046986706182 8.231330756712014 1562.0 24.43774193548387 0.0 - - - - - - - 97.85714285714286 3 7 TRIM22 tripartite motif-containing 22 3 1 C20140704_OR005_01 C20140704_OR005_01 TB412665.[MT7]-MSPQEGQK[MT7].2b4_1.heavy 596.815 / 588.293 N/A 17.515865961710613 43 17 10 6 10 3.9976852487662415 25.014475572048056 0.03890037536621094 3 0.9776046986706182 8.231330756712014 2875.0 8.29326923076923 2.0 - - - - - - - 230.1875 6 16 TRIM22 tripartite motif-containing 22 5 1 C20140704_OR005_01 C20140704_OR005_01 TB412665.[MT7]-MSPQEGQK[MT7].2y6_1.heavy 596.815 / 830.449 2750.0 17.515865961710613 43 17 10 6 10 3.9976852487662415 25.014475572048056 0.03890037536621094 3 0.9776046986706182 8.231330756712014 2750.0 24.01529411764706 0.0 - - - - - - - 155.83333333333334 5 6 TRIM22 tripartite motif-containing 22 7 1 C20140704_OR005_01 C20140704_OR005_01 TB412665.[MT7]-MSPQEGQK[MT7].2y7_1.heavy 596.815 / 917.481 2687.0 17.515865961710613 43 17 10 6 10 3.9976852487662415 25.014475572048056 0.03890037536621094 3 0.9776046986706182 8.231330756712014 2687.0 61.81833548387097 0.0 - - - - - - - 187.28571428571428 5 7 TRIM22 tripartite motif-containing 22 9 2 C20140704_OR005_01 C20140704_OR005_01 TB413212.[MT7]-SSPAADVQGENFC[CAM]AAVK[MT7].3b6_1.heavy 680.342 / 673.327 14548.0 30.05305004119873 42 16 10 6 10 2.940149795097194 34.0118725130106 0.035800933837890625 3 0.9643955822703535 6.520987450673684 14548.0 8.863975628332064 1.0 - - - - - - - 291.77777777777777 29 9 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 11 2 C20140704_OR005_01 C20140704_OR005_01 TB413212.[MT7]-SSPAADVQGENFC[CAM]AAVK[MT7].3b5_1.heavy 680.342 / 558.3 4142.0 30.05305004119873 42 16 10 6 10 2.940149795097194 34.0118725130106 0.035800933837890625 3 0.9643955822703535 6.520987450673684 4142.0 23.284510451045108 0.0 - - - - - - - 145.88888888888889 8 9 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 13 2 C20140704_OR005_01 C20140704_OR005_01 TB413212.[MT7]-SSPAADVQGENFC[CAM]AAVK[MT7].3y4_1.heavy 680.342 / 532.357 6971.0 30.05305004119873 42 16 10 6 10 2.940149795097194 34.0118725130106 0.035800933837890625 3 0.9643955822703535 6.520987450673684 6971.0 16.219653465346536 1.0 - - - - - - - 230.85714285714286 13 7 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 15 2 C20140704_OR005_01 C20140704_OR005_01 TB413212.[MT7]-SSPAADVQGENFC[CAM]AAVK[MT7].3y5_1.heavy 680.342 / 692.388 5961.0 30.05305004119873 42 16 10 6 10 2.940149795097194 34.0118725130106 0.035800933837890625 3 0.9643955822703535 6.520987450673684 5961.0 77.51267326732673 0.0 - - - - - - - 286.1666666666667 11 6 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 17 3 C20140704_OR005_01 C20140704_OR005_01 TB450800.[MT7]-LMWIPDTK[MT7].2b3_1.heavy 646.37 / 575.313 66180.0 39.553001403808594 48 18 10 10 10 6.613386696358683 15.12084573174283 0.0 3 0.9892424692955225 11.888196486902551 66180.0 102.5064305953419 0.0 - - - - - - - 276.3333333333333 132 6 DCAF7 DDB1 and CUL4 associated factor 7 19 3 C20140704_OR005_01 C20140704_OR005_01 TB450800.[MT7]-LMWIPDTK[MT7].2y4_1.heavy 646.37 / 604.342 149053.0 39.553001403808594 48 18 10 10 10 6.613386696358683 15.12084573174283 0.0 3 0.9892424692955225 11.888196486902551 149053.0 130.49800882525034 0.0 - - - - - - - 207.0 298 4 DCAF7 DDB1 and CUL4 associated factor 7 21 3 C20140704_OR005_01 C20140704_OR005_01 TB450800.[MT7]-LMWIPDTK[MT7].2y5_1.heavy 646.37 / 717.426 23204.0 39.553001403808594 48 18 10 10 10 6.613386696358683 15.12084573174283 0.0 3 0.9892424692955225 11.888196486902551 23204.0 73.26321247917612 0.0 - - - - - - - 273.0769230769231 46 13 DCAF7 DDB1 and CUL4 associated factor 7 23 3 C20140704_OR005_01 C20140704_OR005_01 TB450800.[MT7]-LMWIPDTK[MT7].2y3_1.heavy 646.37 / 507.289 7103.0 39.553001403808594 48 18 10 10 10 6.613386696358683 15.12084573174283 0.0 3 0.9892424692955225 11.888196486902551 7103.0 34.91559071729957 0.0 - - - - - - - 325.875 14 8 DCAF7 DDB1 and CUL4 associated factor 7 25 4 C20140704_OR005_01 C20140704_OR005_01 TB451048.[MT7]-QLEMILNK[MT7]PGLK[MT7].3b4_1.heavy 606.041 / 646.335 17318.0 35.11819839477539 48 18 10 10 10 3.2618597132029086 25.493919777596677 0.0 3 0.9823259920151071 9.269431937254113 17318.0 80.748874588002 0.0 - - - - - - - 167.6 34 10 AKR1C4;AKR1C1;AKR1C3 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 27 4 C20140704_OR005_01 C20140704_OR005_01 TB451048.[MT7]-QLEMILNK[MT7]PGLK[MT7].3b5_1.heavy 606.041 / 759.419 9050.0 35.11819839477539 48 18 10 10 10 3.2618597132029086 25.493919777596677 0.0 3 0.9823259920151071 9.269431937254113 9050.0 25.90339892665474 1.0 - - - - - - - 298.0 43 6 AKR1C4;AKR1C1;AKR1C3 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 29 4 C20140704_OR005_01 C20140704_OR005_01 TB451048.[MT7]-QLEMILNK[MT7]PGLK[MT7].3b3_1.heavy 606.041 / 515.295 15195.0 35.11819839477539 48 18 10 10 10 3.2618597132029086 25.493919777596677 0.0 3 0.9823259920151071 9.269431937254113 15195.0 28.934009931924557 0.0 - - - - - - - 303.0 30 7 AKR1C4;AKR1C1;AKR1C3 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 31 4 C20140704_OR005_01 C20140704_OR005_01 TB451048.[MT7]-QLEMILNK[MT7]PGLK[MT7].3y4_1.heavy 606.041 / 558.373 77427.0 35.11819839477539 48 18 10 10 10 3.2618597132029086 25.493919777596677 0.0 3 0.9823259920151071 9.269431937254113 77427.0 167.54934222798272 0.0 - - - - - - - 686.2857142857143 154 7 AKR1C4;AKR1C1;AKR1C3 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 33 5 C20140704_OR005_01 C20140704_OR005_01 TB450582.[MT7]-LVADSK[MT7].2y4_1.heavy 460.786 / 564.311 9881.0 20.962600708007812 47 17 10 10 10 3.318334923585339 30.135595804161227 0.0 3 0.9737228883528397 7.5965769486969945 9881.0 18.667731824232362 0.0 - - - - - - - 262.0 19 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 35 5 C20140704_OR005_01 C20140704_OR005_01 TB450582.[MT7]-LVADSK[MT7].2y5_1.heavy 460.786 / 663.379 11193.0 20.962600708007812 47 17 10 10 10 3.318334923585339 30.135595804161227 0.0 3 0.9737228883528397 7.5965769486969945 11193.0 137.76194050033808 0.0 - - - - - - - 199.71428571428572 22 7 CDR2 cerebellar degeneration-related protein 2, 62kDa 37 5 C20140704_OR005_01 C20140704_OR005_01 TB450582.[MT7]-LVADSK[MT7].2b4_1.heavy 460.786 / 543.326 7258.0 20.962600708007812 47 17 10 10 10 3.318334923585339 30.135595804161227 0.0 3 0.9737228883528397 7.5965769486969945 7258.0 41.32015267175572 0.0 - - - - - - - 224.64285714285714 14 14 CDR2 cerebellar degeneration-related protein 2, 62kDa 39 5 C20140704_OR005_01 C20140704_OR005_01 TB450582.[MT7]-LVADSK[MT7].2y3_1.heavy 460.786 / 493.274 4809.0 20.962600708007812 47 17 10 10 10 3.318334923585339 30.135595804161227 0.0 3 0.9737228883528397 7.5965769486969945 4809.0 30.536363358778623 0.0 - - - - - - - 218.5 9 6 CDR2 cerebellar degeneration-related protein 2, 62kDa 41 6 C20140704_OR005_01 C20140704_OR005_01 TB413355.[MT7]-YK[MT7]PVC[CAM]NQVEC[CAM]HPYLNQSK[MT7].4y5_1.heavy 674.847 / 733.432 5334.0 25.440799713134766 44 14 10 10 10 1.8502487862977912 38.23435181809293 0.0 3 0.9356081479589059 4.837138058597504 5334.0 56.708068979083336 0.0 - - - - - - - 168.0 10 6 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 43 6 C20140704_OR005_01 C20140704_OR005_01 TB413355.[MT7]-YK[MT7]PVC[CAM]NQVEC[CAM]HPYLNQSK[MT7].4y4_1.heavy 674.847 / 620.348 15095.0 25.440799713134766 44 14 10 10 10 1.8502487862977912 38.23435181809293 0.0 3 0.9356081479589059 4.837138058597504 15095.0 45.62673957460328 0.0 - - - - - - - 287.57142857142856 30 7 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 45 6 C20140704_OR005_01 C20140704_OR005_01 TB413355.[MT7]-YK[MT7]PVC[CAM]NQVEC[CAM]HPYLNQSK[MT7].4b7_2.heavy 674.847 / 589.815 10969.0 25.440799713134766 44 14 10 10 10 1.8502487862977912 38.23435181809293 0.0 3 0.9356081479589059 4.837138058597504 10969.0 62.19416856116767 0.0 - - - - - - - 234.88888888888889 21 9 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 47 6 C20140704_OR005_01 C20140704_OR005_01 TB413355.[MT7]-YK[MT7]PVC[CAM]NQVEC[CAM]HPYLNQSK[MT7].4y7_1.heavy 674.847 / 993.549 7749.0 25.440799713134766 44 14 10 10 10 1.8502487862977912 38.23435181809293 0.0 3 0.9356081479589059 4.837138058597504 7749.0 49.949292305866294 0.0 - - - - - - - 201.375 15 8 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 49 7 C20140704_OR005_01 C20140704_OR005_01 TB450899.[MT7]-ARC[CAM]LEGIGGHTR.3y7_1.heavy 490.929 / 697.374 3842.0 20.43470001220703 45 15 10 10 10 2.7026565183032227 37.00063227523334 0.0 3 0.9505272625437998 5.525511105609454 3842.0 32.16533752347565 0.0 - - - - - - - 147.0 7 5 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 51 7 C20140704_OR005_01 C20140704_OR005_01 TB450899.[MT7]-ARC[CAM]LEGIGGHTR.3b6_1.heavy 490.929 / 831.426 3106.0 20.43470001220703 45 15 10 10 10 2.7026565183032227 37.00063227523334 0.0 3 0.9505272625437998 5.525511105609454 3106.0 71.58951219512194 0.0 - - - - - - - 109.0 6 6 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 53 7 C20140704_OR005_01 C20140704_OR005_01 TB450899.[MT7]-ARC[CAM]LEGIGGHTR.3b5_1.heavy 490.929 / 774.405 1553.0 20.43470001220703 45 15 10 10 10 2.7026565183032227 37.00063227523334 0.0 3 0.9505272625437998 5.525511105609454 1553.0 15.860044096657067 0.0 - - - - - - - 190.66666666666666 3 3 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 55 7 C20140704_OR005_01 C20140704_OR005_01 TB450899.[MT7]-ARC[CAM]LEGIGGHTR.3y5_1.heavy 490.929 / 527.268 16677.0 20.43470001220703 45 15 10 10 10 2.7026565183032227 37.00063227523334 0.0 3 0.9505272625437998 5.525511105609454 16677.0 284.7292682926829 0.0 - - - - - - - 143.125 33 8 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 57 8 C20140704_OR005_01 C20140704_OR005_01 TB450896.[MT7]-VK[MT7]YEELLK[MT7].3y6_1.heavy 485.305 / 938.531 407.0 30.957324504852295 37 11 10 6 10 1.9569155714583375 51.10082491983941 0.03869819641113281 3 0.8765661465574915 3.4759484780642507 407.0 0.903448275862069 1.0 - - - - - - - 0.0 0 0 CDR2 cerebellar degeneration-related protein 2, 62kDa 59 8 C20140704_OR005_01 C20140704_OR005_01 TB450896.[MT7]-VK[MT7]YEELLK[MT7].3y3_1.heavy 485.305 / 517.383 5796.0 30.957324504852295 37 11 10 6 10 1.9569155714583375 51.10082491983941 0.03869819641113281 3 0.8765661465574915 3.4759484780642507 5796.0 27.58751837196156 0.0 - - - - - - - 178.0 11 4 CDR2 cerebellar degeneration-related protein 2, 62kDa 61 8 C20140704_OR005_01 C20140704_OR005_01 TB450896.[MT7]-VK[MT7]YEELLK[MT7].3b4_1.heavy 485.305 / 808.481 813.0 30.957324504852295 37 11 10 6 10 1.9569155714583375 51.10082491983941 0.03869819641113281 3 0.8765661465574915 3.4759484780642507 813.0 2.6638946006531246 2.0 - - - - - - - 0.0 1 0 CDR2 cerebellar degeneration-related protein 2, 62kDa 63 8 C20140704_OR005_01 C20140704_OR005_01 TB450896.[MT7]-VK[MT7]YEELLK[MT7].3y4_1.heavy 485.305 / 646.426 4169.0 30.957324504852295 37 11 10 6 10 1.9569155714583375 51.10082491983941 0.03869819641113281 3 0.8765661465574915 3.4759484780642507 4169.0 37.829703232644405 0.0 - - - - - - - 216.125 8 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 65 9 C20140704_OR005_01 C20140704_OR005_01 TB450893.[MT7]-SPMDTFLLIK[MT7].2b4_1.heavy 726.922 / 575.262 4433.0 44.5906982421875 44 16 10 10 8 1.9982680151280046 34.97402918075497 0.0 4 0.9664894643130343 6.72281835906145 4433.0 0.5499999999999998 1.0 - - - - - - - 212.77777777777777 8 9 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 67 9 C20140704_OR005_01 C20140704_OR005_01 TB450893.[MT7]-SPMDTFLLIK[MT7].2y9_1.heavy 726.922 / 1221.7 2418.0 44.5906982421875 44 16 10 10 8 1.9982680151280046 34.97402918075497 0.0 4 0.9664894643130343 6.72281835906145 2418.0 -0.8420895522388072 0.0 - - - - - - - 230.14285714285714 4 7 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 69 9 C20140704_OR005_01 C20140704_OR005_01 TB450893.[MT7]-SPMDTFLLIK[MT7].2y3_1.heavy 726.922 / 517.383 3022.0 44.5906982421875 44 16 10 10 8 1.9982680151280046 34.97402918075497 0.0 4 0.9664894643130343 6.72281835906145 3022.0 5.999007444168735 2.0 - - - - - - - 209.66666666666666 6 12 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 71 9 C20140704_OR005_01 C20140704_OR005_01 TB450893.[MT7]-SPMDTFLLIK[MT7].2y6_1.heavy 726.922 / 878.583 1813.0 44.5906982421875 44 16 10 10 8 1.9982680151280046 34.97402918075497 0.0 4 0.9664894643130343 6.72281835906145 1813.0 -0.14400317712470212 2.0 - - - - - - - 187.0 5 7 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 73 10 C20140704_OR005_01 C20140704_OR005_01 TB450586.[MT7]-SLHGTK[MT7].2b3_1.heavy 465.784 / 482.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPA2 carboxypeptidase A2 (pancreatic) 75 10 C20140704_OR005_01 C20140704_OR005_01 TB450586.[MT7]-SLHGTK[MT7].2y4_1.heavy 465.784 / 586.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPA2 carboxypeptidase A2 (pancreatic) 77 10 C20140704_OR005_01 C20140704_OR005_01 TB450586.[MT7]-SLHGTK[MT7].2y5_1.heavy 465.784 / 699.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPA2 carboxypeptidase A2 (pancreatic) 79 10 C20140704_OR005_01 C20140704_OR005_01 TB450586.[MT7]-SLHGTK[MT7].2b4_1.heavy 465.784 / 539.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPA2 carboxypeptidase A2 (pancreatic) 81 11 C20140704_OR005_01 C20140704_OR005_01 TB413218.[MT7]-SVFRVPDLSGMLQVLK[MT7].2b4_1.heavy 1039.11 / 634.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 83 11 C20140704_OR005_01 C20140704_OR005_01 TB413218.[MT7]-SVFRVPDLSGMLQVLK[MT7].2b7_1.heavy 1039.11 / 945.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 85 11 C20140704_OR005_01 C20140704_OR005_01 TB413218.[MT7]-SVFRVPDLSGMLQVLK[MT7].2b10_2.heavy 1039.11 / 601.836 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 87 11 C20140704_OR005_01 C20140704_OR005_01 TB413218.[MT7]-SVFRVPDLSGMLQVLK[MT7].2b10_1.heavy 1039.11 / 1202.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 89 12 C20140704_OR005_01 C20140704_OR005_01 TB451045.[MT7]-LDDFDELSEVAQK[MT7].3b6_1.heavy 599.643 / 879.385 53896.0 38.885398864746094 44 14 10 10 10 1.5938597075895564 54.17052234432789 0.0 3 0.9346283538884339 4.800350003656661 53896.0 438.0211515770576 0.0 - - - - - - - 242.6 107 5 CPA2 carboxypeptidase A2 (pancreatic) 91 12 C20140704_OR005_01 C20140704_OR005_01 TB451045.[MT7]-LDDFDELSEVAQK[MT7].3b4_1.heavy 599.643 / 635.316 15295.0 38.885398864746094 44 14 10 10 10 1.5938597075895564 54.17052234432789 0.0 3 0.9346283538884339 4.800350003656661 15295.0 39.91501311855512 0.0 - - - - - - - 312.14285714285717 30 7 CPA2 carboxypeptidase A2 (pancreatic) 93 12 C20140704_OR005_01 C20140704_OR005_01 TB451045.[MT7]-LDDFDELSEVAQK[MT7].3b5_1.heavy 599.643 / 750.343 35809.0 38.885398864746094 44 14 10 10 10 1.5938597075895564 54.17052234432789 0.0 3 0.9346283538884339 4.800350003656661 35809.0 -0.2959421487603322 0.0 - - - - - - - 121.0 71 2 CPA2 carboxypeptidase A2 (pancreatic) 95 12 C20140704_OR005_01 C20140704_OR005_01 TB451045.[MT7]-LDDFDELSEVAQK[MT7].3y4_1.heavy 599.643 / 589.379 29497.0 38.885398864746094 44 14 10 10 10 1.5938597075895564 54.17052234432789 0.0 3 0.9346283538884339 4.800350003656661 29497.0 51.93266318887106 0.0 - - - - - - - 303.5 58 8 CPA2 carboxypeptidase A2 (pancreatic) 97 13 C20140704_OR005_01 C20140704_OR005_01 TB426977.[MT7]-AAHPLLHLR.2y8_1.heavy 586.363 / 956.579 4327.0 23.795875072479248 10 -1 0 3 8 1.7962284301621223 55.672206452591496 0.07869911193847656 4 0.28514903137350456 1.3617996137136632 4327.0 31.3415597509143 1.0 - - - - - - - 190.22222222222223 35 9 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 99 13 C20140704_OR005_01 C20140704_OR005_01 TB426977.[MT7]-AAHPLLHLR.2y6_1.heavy 586.363 / 748.483 201.0 23.795875072479248 10 -1 0 3 8 1.7962284301621223 55.672206452591496 0.07869911193847656 4 0.28514903137350456 1.3617996137136632 201.0 1.7303960396039604 24.0 - - - - - - - 184.66666666666666 4 6 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 101 13 C20140704_OR005_01 C20140704_OR005_01 TB426977.[MT7]-AAHPLLHLR.2b5_1.heavy 586.363 / 634.379 1308.0 23.795875072479248 10 -1 0 3 8 1.7962284301621223 55.672206452591496 0.07869911193847656 4 0.28514903137350456 1.3617996137136632 1308.0 2.7680567729983734 2.0 - - - - - - - 261.8 2 5 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 103 13 C20140704_OR005_01 C20140704_OR005_01 TB426977.[MT7]-AAHPLLHLR.2y7_1.heavy 586.363 / 885.542 2415.0 23.795875072479248 10 -1 0 3 8 1.7962284301621223 55.672206452591496 0.07869911193847656 4 0.28514903137350456 1.3617996137136632 2415.0 23.91089108910891 0.0 - - - - - - - 161.2 4 5 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 105 14 C20140704_OR005_01 C20140704_OR005_01 TB413404.[MT7]-QEISLLQAQVSNFQRENEALRC[CAM]GQGASLTVVK[MT7].4b8_1.heavy 966.268 / 1027.59 1636.0 42.276100158691406 48 18 10 10 10 3.689125278386143 21.750424194849412 0.0 3 0.9806521052045627 8.858145109159047 1636.0 21.332156862745098 0.0 - - - - - - - 131.42857142857142 3 7 SDCCAG3 serologically defined colon cancer antigen 3 107 14 C20140704_OR005_01 C20140704_OR005_01 TB413404.[MT7]-QEISLLQAQVSNFQRENEALRC[CAM]GQGASLTVVK[MT7].4b4_1.heavy 966.268 / 602.327 2556.0 42.276100158691406 48 18 10 10 10 3.689125278386143 21.750424194849412 0.0 3 0.9806521052045627 8.858145109159047 2556.0 28.35972280419017 0.0 - - - - - - - 204.6 5 5 SDCCAG3 serologically defined colon cancer antigen 3 109 14 C20140704_OR005_01 C20140704_OR005_01 TB413404.[MT7]-QEISLLQAQVSNFQRENEALRC[CAM]GQGASLTVVK[MT7].4b5_1.heavy 966.268 / 715.411 1841.0 42.276100158691406 48 18 10 10 10 3.689125278386143 21.750424194849412 0.0 3 0.9806521052045627 8.858145109159047 1841.0 14.018629220624453 0.0 - - - - - - - 170.55555555555554 3 9 SDCCAG3 serologically defined colon cancer antigen 3 111 14 C20140704_OR005_01 C20140704_OR005_01 TB413404.[MT7]-QEISLLQAQVSNFQRENEALRC[CAM]GQGASLTVVK[MT7].4b3_1.heavy 966.268 / 515.295 3783.0 42.276100158691406 48 18 10 10 10 3.689125278386143 21.750424194849412 0.0 3 0.9806521052045627 8.858145109159047 3783.0 33.95473170731707 0.0 - - - - - - - 223.36363636363637 7 11 SDCCAG3 serologically defined colon cancer antigen 3 113 15 C20140704_OR005_01 C20140704_OR005_01 TB413405.[MT7]-LEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQR.4b8_1.heavy 1000.02 / 1014.52 4736.0 53.097198486328125 47 17 10 10 10 3.273499763776449 30.54834495684696 0.0 3 0.9769389031675121 8.111183562350519 4736.0 56.87843137254902 0.0 - - - - - - - 120.35714285714286 9 28 TRIM22 tripartite motif-containing 22 115 15 C20140704_OR005_01 C20140704_OR005_01 TB413405.[MT7]-LEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQR.4b7_1.heavy 1000.02 / 915.454 5997.0 53.097198486328125 47 17 10 10 10 3.273499763776449 30.54834495684696 0.0 3 0.9769389031675121 8.111183562350519 5997.0 92.60073529411765 0.0 - - - - - - - 119.91304347826087 11 23 TRIM22 tripartite motif-containing 22 117 15 C20140704_OR005_01 C20140704_OR005_01 TB413405.[MT7]-LEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQR.4b5_1.heavy 1000.02 / 702.343 5588.0 53.097198486328125 47 17 10 10 10 3.273499763776449 30.54834495684696 0.0 3 0.9769389031675121 8.111183562350519 5588.0 43.35754368693084 0.0 - - - - - - - 136.13636363636363 11 22 TRIM22 tripartite motif-containing 22 119 15 C20140704_OR005_01 C20140704_OR005_01 TB413405.[MT7]-LEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQR.4b6_1.heavy 1000.02 / 801.411 4157.0 53.097198486328125 47 17 10 10 10 3.273499763776449 30.54834495684696 0.0 3 0.9769389031675121 8.111183562350519 4157.0 46.86813725490196 0.0 - - - - - - - 125.27272727272727 8 22 TRIM22 tripartite motif-containing 22 121 16 C20140704_OR005_01 C20140704_OR005_01 TB450570.[MT7]-QVELLR.2y4_1.heavy 451.283 / 530.33 5304.0 28.739999771118164 47 17 10 10 10 2.9710593549817803 33.658028350165104 0.0 3 0.9743593510872389 7.690693514536285 5304.0 11.365714285714287 0.0 - - - - - - - 224.4 10 10 CDR2 cerebellar degeneration-related protein 2, 62kDa 123 16 C20140704_OR005_01 C20140704_OR005_01 TB450570.[MT7]-QVELLR.2b3_1.heavy 451.283 / 501.279 8569.0 28.739999771118164 47 17 10 10 10 2.9710593549817803 33.658028350165104 0.0 3 0.9743593510872389 7.690693514536285 8569.0 22.89267156862745 0.0 - - - - - - - 218.57142857142858 21 7 CDR2 cerebellar degeneration-related protein 2, 62kDa 125 16 C20140704_OR005_01 C20140704_OR005_01 TB450570.[MT7]-QVELLR.2y5_1.heavy 451.283 / 629.398 14383.0 28.739999771118164 47 17 10 10 10 2.9710593549817803 33.658028350165104 0.0 3 0.9743593510872389 7.690693514536285 14383.0 165.68651960784314 0.0 - - - - - - - 204.0 28 10 CDR2 cerebellar degeneration-related protein 2, 62kDa 127 16 C20140704_OR005_01 C20140704_OR005_01 TB450570.[MT7]-QVELLR.2b4_1.heavy 451.283 / 614.363 8569.0 28.739999771118164 47 17 10 10 10 2.9710593549817803 33.658028350165104 0.0 3 0.9743593510872389 7.690693514536285 8569.0 97.87142156862745 0.0 - - - - - - - 193.8 17 10 CDR2 cerebellar degeneration-related protein 2, 62kDa 129 17 C20140704_OR005_01 C20140704_OR005_01 TB413346.[MT7]-LWVDPNSPVLLEDPVLC[CAM]ALAK[MT7].3b4_1.heavy 879.824 / 658.368 30334.0 51.71049880981445 44 14 10 10 10 2.570062568360344 38.90955855747834 0.0 3 0.9442886169401632 5.204190934110181 30334.0 154.87538102011786 0.0 - - - - - - - 206.68421052631578 60 19 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 131 17 C20140704_OR005_01 C20140704_OR005_01 TB413346.[MT7]-LWVDPNSPVLLEDPVLC[CAM]ALAK[MT7].3b3_1.heavy 879.824 / 543.341 8223.0 51.71049880981445 44 14 10 10 10 2.570062568360344 38.90955855747834 0.0 3 0.9442886169401632 5.204190934110181 8223.0 35.54075628104585 0.0 - - - - - - - 233.1578947368421 16 19 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 133 17 C20140704_OR005_01 C20140704_OR005_01 TB413346.[MT7]-LWVDPNSPVLLEDPVLC[CAM]ALAK[MT7].3y8_1.heavy 879.824 / 1015.61 23481.0 51.71049880981445 44 14 10 10 10 2.570062568360344 38.90955855747834 0.0 3 0.9442886169401632 5.204190934110181 23481.0 121.00836629855903 0.0 - - - - - - - 204.1764705882353 46 17 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 135 17 C20140704_OR005_01 C20140704_OR005_01 TB413346.[MT7]-LWVDPNSPVLLEDPVLC[CAM]ALAK[MT7].3b7_1.heavy 879.824 / 956.496 12380.0 51.71049880981445 44 14 10 10 10 2.570062568360344 38.90955855747834 0.0 3 0.9442886169401632 5.204190934110181 12380.0 146.0505205217183 0.0 - - - - - - - 116.5 24 20 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 137 18 C20140704_OR005_01 C20140704_OR005_01 TB413342.[MT7]-QEISLLQAQVSNFQRENEALR.3y18_2.heavy 873.132 / 1052.05 13669.0 41.89634895324707 36 11 10 5 10 1.3585973679606078 52.654210909009265 0.042301177978515625 3 0.8503118591082727 3.149170385717377 13669.0 155.6705197380557 0.0 - - - - - - - 246.54545454545453 27 11 SDCCAG3 serologically defined colon cancer antigen 3 139 18 C20140704_OR005_01 C20140704_OR005_01 TB413342.[MT7]-QEISLLQAQVSNFQRENEALR.3y20_2.heavy 873.132 / 1173.11 8661.0 41.89634895324707 36 11 10 5 10 1.3585973679606078 52.654210909009265 0.042301177978515625 3 0.8503118591082727 3.149170385717377 8661.0 58.01626794258373 0.0 - - - - - - - 193.71428571428572 17 14 SDCCAG3 serologically defined colon cancer antigen 3 141 18 C20140704_OR005_01 C20140704_OR005_01 TB413342.[MT7]-QEISLLQAQVSNFQRENEALR.3b5_1.heavy 873.132 / 715.411 3339.0 41.89634895324707 36 11 10 5 10 1.3585973679606078 52.654210909009265 0.042301177978515625 3 0.8503118591082727 3.149170385717377 3339.0 15.470473519221251 0.0 - - - - - - - 195.625 6 8 SDCCAG3 serologically defined colon cancer antigen 3 143 18 C20140704_OR005_01 C20140704_OR005_01 TB413342.[MT7]-QEISLLQAQVSNFQRENEALR.3b3_1.heavy 873.132 / 515.295 7722.0 41.89634895324707 36 11 10 5 10 1.3585973679606078 52.654210909009265 0.042301177978515625 3 0.8503118591082727 3.149170385717377 7722.0 50.28386217341915 0.0 - - - - - - - 200.6153846153846 15 13 SDCCAG3 serologically defined colon cancer antigen 3 145 19 C20140704_OR005_01 C20140704_OR005_01 TB412751.[MT7]-YALIQHQK[MT7].3y3_1.heavy 430.259 / 556.332 2414.0 24.0252742767334 33 18 2 5 8 6.168326965732865 16.211851374859616 0.04010009765625 4 0.9877255496573111 11.127974272486748 2414.0 6.075284715547773 1.0 - - - - - - - 251.5 28 6 CTCF;CTCFL CCCTC-binding factor (zinc finger protein);CCCTC-binding factor (zinc finger protein)-like 147 19 C20140704_OR005_01 C20140704_OR005_01 TB412751.[MT7]-YALIQHQK[MT7].3b4_1.heavy 430.259 / 605.378 1710.0 24.0252742767334 33 18 2 5 8 6.168326965732865 16.211851374859616 0.04010009765625 4 0.9877255496573111 11.127974272486748 1710.0 24.930234963794888 0.0 - - - - - - - 151.0 3 2 CTCF;CTCFL CCCTC-binding factor (zinc finger protein);CCCTC-binding factor (zinc finger protein)-like 149 19 C20140704_OR005_01 C20140704_OR005_01 TB412751.[MT7]-YALIQHQK[MT7].3b5_1.heavy 430.259 / 733.437 302.0 24.0252742767334 33 18 2 5 8 6.168326965732865 16.211851374859616 0.04010009765625 4 0.9877255496573111 11.127974272486748 302.0 2.397313432835821 2.0 - - - - - - - 0.0 1 0 CTCF;CTCFL CCCTC-binding factor (zinc finger protein);CCCTC-binding factor (zinc finger protein)-like 151 19 C20140704_OR005_01 C20140704_OR005_01 TB412751.[MT7]-YALIQHQK[MT7].3b3_1.heavy 430.259 / 492.294 5532.0 24.0252742767334 33 18 2 5 8 6.168326965732865 16.211851374859616 0.04010009765625 4 0.9877255496573111 11.127974272486748 5532.0 7.98680562164906 0.0 - - - - - - - 201.33333333333334 11 3 CTCF;CTCFL CCCTC-binding factor (zinc finger protein);CCCTC-binding factor (zinc finger protein)-like 153 20 C20140704_OR005_01 C20140704_OR005_01 TB413017.[MT7]-FSIPSMTEDYAGR.3y7_1.heavy 539.928 / 811.358 1760.0 38.020301818847656 40 14 10 10 6 3.4893669891005876 28.658493162903397 0.0 5 0.9383069778672168 4.942946508982222 1760.0 -0.2555114175752843 2.0 - - - - - - - 218.0 5 7 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 155 20 C20140704_OR005_01 C20140704_OR005_01 TB413017.[MT7]-FSIPSMTEDYAGR.3y6_1.heavy 539.928 / 710.31 2111.0 38.020301818847656 40 14 10 10 6 3.4893669891005876 28.658493162903397 0.0 5 0.9383069778672168 4.942946508982222 2111.0 4.687796383769552 0.0 - - - - - - - 235.0 4 4 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 157 20 C20140704_OR005_01 C20140704_OR005_01 TB413017.[MT7]-FSIPSMTEDYAGR.3b10_2.heavy 539.928 / 658.304 2111.0 38.020301818847656 40 14 10 10 6 3.4893669891005876 28.658493162903397 0.0 5 0.9383069778672168 4.942946508982222 2111.0 7.876865671641791 3.0 - - - - - - - 278.5 10 8 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 159 20 C20140704_OR005_01 C20140704_OR005_01 TB413017.[MT7]-FSIPSMTEDYAGR.3y5_1.heavy 539.928 / 581.268 5513.0 38.020301818847656 40 14 10 10 6 3.4893669891005876 28.658493162903397 0.0 5 0.9383069778672168 4.942946508982222 5513.0 18.31405451448041 0.0 - - - - - - - 264.0 11 4 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 161 21 C20140704_OR005_01 C20140704_OR005_01 TB413343.[MT7]-SPTTPGETAHVRVPFVNVQAVK[MT7].4y4_1.heavy 656.371 / 589.379 36887.0 33.51139831542969 46 16 10 10 10 3.1825475762009 31.421368449540324 0.0 3 0.96986653252161 7.0915500655894 36887.0 134.33226957989982 0.0 - - - - - - - 261.0 73 13 CPA2 carboxypeptidase A2 (pancreatic) 163 21 C20140704_OR005_01 C20140704_OR005_01 TB413343.[MT7]-SPTTPGETAHVRVPFVNVQAVK[MT7].4b15_2.heavy 656.371 / 861.458 16980.0 33.51139831542969 46 16 10 10 10 3.1825475762009 31.421368449540324 0.0 3 0.96986653252161 7.0915500655894 16980.0 91.43076923076922 0.0 - - - - - - - 269.1 33 10 CPA2 carboxypeptidase A2 (pancreatic) 165 21 C20140704_OR005_01 C20140704_OR005_01 TB413343.[MT7]-SPTTPGETAHVRVPFVNVQAVK[MT7].4b4_1.heavy 656.371 / 531.289 20493.0 33.51139831542969 46 16 10 10 10 3.1825475762009 31.421368449540324 0.0 3 0.96986653252161 7.0915500655894 20493.0 24.044601518026564 0.0 - - - - - - - 273.0 40 6 CPA2 carboxypeptidase A2 (pancreatic) 167 21 C20140704_OR005_01 C20140704_OR005_01 TB413343.[MT7]-SPTTPGETAHVRVPFVNVQAVK[MT7].4b17_2.heavy 656.371 / 968.014 36887.0 33.51139831542969 46 16 10 10 10 3.1825475762009 31.421368449540324 0.0 3 0.96986653252161 7.0915500655894 36887.0 155.44884727205545 0.0 - - - - - - - 263.25 73 8 CPA2 carboxypeptidase A2 (pancreatic) 169 22 C20140704_OR005_01 C20140704_OR005_01 TB426980.[MT7]-YSFAFELR.2b3_1.heavy 588.812 / 542.273 6967.0 40.4060754776001 46 20 10 6 10 10.780253696258606 9.276219541540659 0.035701751708984375 3 0.9931891899147381 14.945697390631292 6967.0 5.13357894736842 1.0 - - - - - - - 226.35714285714286 13 14 CPA2 carboxypeptidase A2 (pancreatic) 171 22 C20140704_OR005_01 C20140704_OR005_01 TB426980.[MT7]-YSFAFELR.2y5_1.heavy 588.812 / 635.351 3061.0 40.4060754776001 46 20 10 6 10 10.780253696258606 9.276219541540659 0.035701751708984375 3 0.9931891899147381 14.945697390631292 3061.0 33.326475805011604 1.0 - - - - - - - 193.66666666666666 6 12 CPA2 carboxypeptidase A2 (pancreatic) 173 22 C20140704_OR005_01 C20140704_OR005_01 TB426980.[MT7]-YSFAFELR.2b4_1.heavy 588.812 / 613.31 10239.0 40.4060754776001 46 20 10 6 10 10.780253696258606 9.276219541540659 0.035701751708984375 3 0.9931891899147381 14.945697390631292 10239.0 125.18108401285639 0.0 - - - - - - - 190.3 20 10 CPA2 carboxypeptidase A2 (pancreatic) 175 22 C20140704_OR005_01 C20140704_OR005_01 TB426980.[MT7]-YSFAFELR.2y7_1.heavy 588.812 / 869.452 21534.0 40.4060754776001 46 20 10 6 10 10.780253696258606 9.276219541540659 0.035701751708984375 3 0.9931891899147381 14.945697390631292 21534.0 111.89762860835845 0.0 - - - - - - - 145.5 43 8 CPA2 carboxypeptidase A2 (pancreatic) 177 23 C20140704_OR005_01 C20140704_OR005_01 TB451052.[MT7]-ELLREPAGLSLVLK[MT7].3y3_1.heavy 609.383 / 503.367 21837.0 39.93360137939453 43 13 10 10 10 2.0677235803479745 37.78500655359521 0.0 3 0.908230154097832 4.0423486779451325 21837.0 -9.200983146067419 0.0 - - - - - - - 316.5 43 6 CNKSR1 connector enhancer of kinase suppressor of Ras 1 179 23 C20140704_OR005_01 C20140704_OR005_01 TB451052.[MT7]-ELLREPAGLSLVLK[MT7].3b8_1.heavy 609.383 / 1010.58 7121.0 39.93360137939453 43 13 10 10 10 2.0677235803479745 37.78500655359521 0.0 3 0.908230154097832 4.0423486779451325 7121.0 -1.049410526315791 0.0 - - - - - - - 316.3333333333333 14 3 CNKSR1 connector enhancer of kinase suppressor of Ras 1 181 23 C20140704_OR005_01 C20140704_OR005_01 TB451052.[MT7]-ELLREPAGLSLVLK[MT7].3y5_1.heavy 609.383 / 703.483 9732.0 39.93360137939453 43 13 10 10 10 2.0677235803479745 37.78500655359521 0.0 3 0.908230154097832 4.0423486779451325 9732.0 -12.318987341772154 0.0 - - - - - - - 224.22222222222223 19 9 CNKSR1 connector enhancer of kinase suppressor of Ras 1 183 23 C20140704_OR005_01 C20140704_OR005_01 TB451052.[MT7]-ELLREPAGLSLVLK[MT7].3b13_2.heavy 609.383 / 768.468 3442.0 39.93360137939453 43 13 10 10 10 2.0677235803479745 37.78500655359521 0.0 3 0.908230154097832 4.0423486779451325 3442.0 -0.5072421052631579 0.0 - - - - - - - 296.8333333333333 6 6 CNKSR1 connector enhancer of kinase suppressor of Ras 1 185 24 C20140704_OR005_01 C20140704_OR005_01 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 138096.0 29.97249984741211 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 138096.0 525.3984695706382 0.0 - - - - - - - 255.22222222222223 276 9 187 24 C20140704_OR005_01 C20140704_OR005_01 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 61794.0 29.97249984741211 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 61794.0 759.6886584468162 0.0 - - - - - - - 221.75 123 8 189 24 C20140704_OR005_01 C20140704_OR005_01 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 52191.0 29.97249984741211 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 52191.0 293.47015974440893 0.0 - - - - - - - 248.84615384615384 104 13 191 25 C20140704_OR005_01 C20140704_OR005_01 TB413400.[MT7]-K[MT7]LQLDYVDLYLLHFPMALK[MT7]PGETPLPK[MT7].4y8_1.heavy 929.789 / 982.569 5635.0 47.08940124511719 35 10 10 5 10 0.5468161625353779 88.25857597363515 0.04399871826171875 3 0.8236244830968836 2.894295840080029 5635.0 73.13510638297873 0.0 - - - - - - - 188.0 11 8 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 193 25 C20140704_OR005_01 C20140704_OR005_01 TB413400.[MT7]-K[MT7]LQLDYVDLYLLHFPMALK[MT7]PGETPLPK[MT7].4b8_2.heavy 929.789 / 632.363 4508.0 47.08940124511719 35 10 10 5 10 0.5468161625353779 88.25857597363515 0.04399871826171875 3 0.8236244830968836 2.894295840080029 4508.0 29.25404255319149 0.0 - - - - - - - 188.0 9 10 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 195 25 C20140704_OR005_01 C20140704_OR005_01 TB413400.[MT7]-K[MT7]LQLDYVDLYLLHFPMALK[MT7]PGETPLPK[MT7].4b5_1.heavy 929.789 / 886.56 939.0 47.08940124511719 35 10 10 5 10 0.5468161625353779 88.25857597363515 0.04399871826171875 3 0.8236244830968836 2.894295840080029 939.0 4.5451595744680855 1.0 - - - - - - - 0.0 1 0 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 197 25 C20140704_OR005_01 C20140704_OR005_01 TB413400.[MT7]-K[MT7]LQLDYVDLYLLHFPMALK[MT7]PGETPLPK[MT7].4b3_1.heavy 929.789 / 658.449 657.0 47.08940124511719 35 10 10 5 10 0.5468161625353779 88.25857597363515 0.04399871826171875 3 0.8236244830968836 2.894295840080029 657.0 2.2717752216902283 9.0 - - - - - - - 0.0 1 0 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 199 26 C20140704_OR005_01 C20140704_OR005_01 TB426986.[MT7]-FTQSGTMK[MT7].2y4_1.heavy 594.32 / 580.325 1229.0 22.815574645996094 35 14 10 3 8 2.196773373717119 36.76357134322811 0.06890106201171875 4 0.9362681555971528 4.8623941520811735 1229.0 4.086254575680558 5.0 - - - - - - - 249.36363636363637 2 11 CTCF;CTCFL CCCTC-binding factor (zinc finger protein);CCCTC-binding factor (zinc finger protein)-like 201 26 C20140704_OR005_01 C20140704_OR005_01 TB426986.[MT7]-FTQSGTMK[MT7].2y5_1.heavy 594.32 / 667.357 2175.0 22.815574645996094 35 14 10 3 8 2.196773373717119 36.76357134322811 0.06890106201171875 4 0.9362681555971528 4.8623941520811735 2175.0 13.752965159377318 0.0 - - - - - - - 155.0909090909091 4 11 CTCF;CTCFL CCCTC-binding factor (zinc finger protein);CCCTC-binding factor (zinc finger protein)-like 203 26 C20140704_OR005_01 C20140704_OR005_01 TB426986.[MT7]-FTQSGTMK[MT7].2y3_1.heavy 594.32 / 523.303 284.0 22.815574645996094 35 14 10 3 8 2.196773373717119 36.76357134322811 0.06890106201171875 4 0.9362681555971528 4.8623941520811735 284.0 0.48033826638477806 30.0 - - - - - - - 236.58333333333334 3 12 CTCF;CTCFL CCCTC-binding factor (zinc finger protein);CCCTC-binding factor (zinc finger protein)-like 205 26 C20140704_OR005_01 C20140704_OR005_01 TB426986.[MT7]-FTQSGTMK[MT7].2y7_1.heavy 594.32 / 896.463 3216.0 22.815574645996094 35 14 10 3 8 2.196773373717119 36.76357134322811 0.06890106201171875 4 0.9362681555971528 4.8623941520811735 3216.0 48.15133834586466 0.0 - - - - - - - 201.0 6 8 CTCF;CTCFL CCCTC-binding factor (zinc finger protein);CCCTC-binding factor (zinc finger protein)-like 207 27 C20140704_OR005_01 C20140704_OR005_01 TB427110.[MT7]-K[MT7]VDELIAK[MT7].2b3_1.heavy 674.432 / 631.402 2569.0 26.99980068206787 35 11 10 6 8 0.7806936606052488 77.01978849986546 0.03759956359863281 4 0.8677263677033026 3.3551973820513847 2569.0 9.68157565292467 1.0 - - - - - - - 250.88888888888889 6 9 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 209 27 C20140704_OR005_01 C20140704_OR005_01 TB427110.[MT7]-K[MT7]VDELIAK[MT7].2b4_1.heavy 674.432 / 760.444 1644.0 26.99980068206787 35 11 10 6 8 0.7806936606052488 77.01978849986546 0.03759956359863281 4 0.8677263677033026 3.3551973820513847 1644.0 5.070779220779221 1.0 - - - - - - - 205.16666666666666 3 6 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 211 27 C20140704_OR005_01 C20140704_OR005_01 TB427110.[MT7]-K[MT7]VDELIAK[MT7].2b6_1.heavy 674.432 / 986.612 3185.0 26.99980068206787 35 11 10 6 8 0.7806936606052488 77.01978849986546 0.03759956359863281 4 0.8677263677033026 3.3551973820513847 3185.0 21.609153459238872 0.0 - - - - - - - 359.5 6 2 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 213 27 C20140704_OR005_01 C20140704_OR005_01 TB427110.[MT7]-K[MT7]VDELIAK[MT7].2b5_1.heavy 674.432 / 873.528 1438.0 26.99980068206787 35 11 10 6 8 0.7806936606052488 77.01978849986546 0.03759956359863281 4 0.8677263677033026 3.3551973820513847 1438.0 13.96116504854369 1.0 - - - - - - - 205.42857142857142 2 7 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 215 28 C20140704_OR005_01 C20140704_OR005_01 TB413020.[MT7]-GLVQALGLSNFNSR.3y6_1.heavy 540.638 / 724.337 29037.0 41.99850082397461 46 16 10 10 10 2.3801090870695787 33.57143915764269 0.0 3 0.9673031691775084 6.806424693740666 29037.0 299.6260022013713 0.0 - - - - - - - 181.33333333333334 58 9 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 217 28 C20140704_OR005_01 C20140704_OR005_01 TB413020.[MT7]-GLVQALGLSNFNSR.3b4_1.heavy 540.638 / 542.342 30973.0 41.99850082397461 46 16 10 10 10 2.3801090870695787 33.57143915764269 0.0 3 0.9673031691775084 6.806424693740666 30973.0 52.47876303142982 0.0 - - - - - - - 278.1818181818182 61 11 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 219 28 C20140704_OR005_01 C20140704_OR005_01 TB413020.[MT7]-GLVQALGLSNFNSR.3b5_1.heavy 540.638 / 613.379 38206.0 41.99850082397461 46 16 10 10 10 2.3801090870695787 33.57143915764269 0.0 3 0.9673031691775084 6.806424693740666 38206.0 77.86792838423665 0.0 - - - - - - - 669.2857142857143 76 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 221 28 C20140704_OR005_01 C20140704_OR005_01 TB413020.[MT7]-GLVQALGLSNFNSR.3y8_1.heavy 540.638 / 894.443 20173.0 41.99850082397461 46 16 10 10 10 2.3801090870695787 33.57143915764269 0.0 3 0.9673031691775084 6.806424693740666 20173.0 30.006297566775082 0.0 - - - - - - - 102.0 40 4 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 223 29 C20140704_OR005_01 C20140704_OR005_01 TB426956.[MT7]-EDQEAEK[MT7].2b3_1.heavy 568.787 / 517.237 1232.0 14.608875036239624 43 17 10 6 10 4.428778504534583 22.579589360274163 0.039299964904785156 3 0.9714386110385324 7.285067518739389 1232.0 8.648275862068965 0.0 - - - - - - - 145.6 2 10 TRIM22 tripartite motif-containing 22 225 29 C20140704_OR005_01 C20140704_OR005_01 TB426956.[MT7]-EDQEAEK[MT7].2y5_1.heavy 568.787 / 748.396 1418.0 14.608875036239624 43 17 10 6 10 4.428778504534583 22.579589360274163 0.039299964904785156 3 0.9714386110385324 7.285067518739389 1418.0 2.533155080213904 1.0 - - - - - - - 123.53846153846153 2 13 TRIM22 tripartite motif-containing 22 227 29 C20140704_OR005_01 C20140704_OR005_01 TB426956.[MT7]-EDQEAEK[MT7].2b4_1.heavy 568.787 / 646.28 1008.0 14.608875036239624 43 17 10 6 10 4.428778504534583 22.579589360274163 0.039299964904785156 3 0.9714386110385324 7.285067518739389 1008.0 15.707999999999998 0.0 - - - - - - - 112.0 2 13 TRIM22 tripartite motif-containing 22 229 29 C20140704_OR005_01 C20140704_OR005_01 TB426956.[MT7]-EDQEAEK[MT7].2y6_1.heavy 568.787 / 863.423 1642.0 14.608875036239624 43 17 10 6 10 4.428778504534583 22.579589360274163 0.039299964904785156 3 0.9714386110385324 7.285067518739389 1642.0 43.93459459459459 0.0 - - - - - - - 105.18181818181819 3 11 TRIM22 tripartite motif-containing 22 231 30 C20140704_OR005_01 C20140704_OR005_01 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 37334.0 16.068700790405273 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 37334.0 71.1840462082302 0.0 - - - - - - - 220.28571428571428 74 7 233 30 C20140704_OR005_01 C20140704_OR005_01 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 45465.0 16.068700790405273 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 45465.0 369.0524989124656 0.0 - - - - - - - 155.75 90 8 235 30 C20140704_OR005_01 C20140704_OR005_01 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 24395.0 16.068700790405273 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 24395.0 117.77095956004361 0.0 - - - - - - - 207.66666666666666 48 12 237 31 C20140704_OR005_01 C20140704_OR005_01 TB413330.[MT7]-GLDDSLQDYPFEDWQLPGK[MT7].3b4_1.heavy 837.748 / 545.269 9420.0 45.45750045776367 45 15 10 10 10 1.6176591770746258 48.79648866715861 0.0 3 0.9564605957851624 5.892948614652221 9420.0 97.05173517105587 0.0 - - - - - - - 187.5 18 6 CNKSR1 connector enhancer of kinase suppressor of Ras 1 239 31 C20140704_OR005_01 C20140704_OR005_01 TB413330.[MT7]-GLDDSLQDYPFEDWQLPGK[MT7].3y4_1.heavy 837.748 / 558.373 12800.0 45.45750045776367 45 15 10 10 10 1.6176591770746258 48.79648866715861 0.0 3 0.9564605957851624 5.892948614652221 12800.0 64.57914922417467 0.0 - - - - - - - 227.55555555555554 25 9 CNKSR1 connector enhancer of kinase suppressor of Ras 1 241 31 C20140704_OR005_01 C20140704_OR005_01 TB413330.[MT7]-GLDDSLQDYPFEDWQLPGK[MT7].3b8_1.heavy 837.748 / 988.47 22834.0 45.45750045776367 45 15 10 10 10 1.6176591770746258 48.79648866715861 0.0 3 0.9564605957851624 5.892948614652221 22834.0 22.79399920886076 0.0 - - - - - - - 238.91666666666666 45 12 CNKSR1 connector enhancer of kinase suppressor of Ras 1 243 31 C20140704_OR005_01 C20140704_OR005_01 TB413330.[MT7]-GLDDSLQDYPFEDWQLPGK[MT7].3b7_1.heavy 837.748 / 873.443 7065.0 45.45750045776367 45 15 10 10 10 1.6176591770746258 48.79648866715861 0.0 3 0.9564605957851624 5.892948614652221 7065.0 45.15156351791531 0.0 - - - - - - - 221.66666666666666 14 12 CNKSR1 connector enhancer of kinase suppressor of Ras 1 245 32 C20140704_OR005_01 C20140704_OR005_01 TB412784.[MT7]-QLLDMHFK[MT7].3y3_1.heavy 440.584 / 575.342 835.0 34.388298988342285 34 13 10 5 6 1.9853746900962144 50.36832618993135 0.041202545166015625 5 0.9049656722852012 3.971194557547536 835.0 2.9407868175203036 3.0 - - - - - - - 262.2 2 5 CTCF CCCTC-binding factor (zinc finger protein) 247 32 C20140704_OR005_01 C20140704_OR005_01 TB412784.[MT7]-QLLDMHFK[MT7].3b4_1.heavy 440.584 / 614.363 4889.0 34.388298988342285 34 13 10 5 6 1.9853746900962144 50.36832618993135 0.041202545166015625 5 0.9049656722852012 3.971194557547536 4889.0 45.73256273138626 0.0 - - - - - - - 178.5 9 4 CTCF CCCTC-binding factor (zinc finger protein) 249 32 C20140704_OR005_01 C20140704_OR005_01 TB412784.[MT7]-QLLDMHFK[MT7].3b5_1.heavy 440.584 / 745.404 238.0 34.388298988342285 34 13 10 5 6 1.9853746900962144 50.36832618993135 0.041202545166015625 5 0.9049656722852012 3.971194557547536 238.0 2.2 5.0 - - - - - - - 0.0 0 0 CTCF CCCTC-binding factor (zinc finger protein) 251 32 C20140704_OR005_01 C20140704_OR005_01 TB412784.[MT7]-QLLDMHFK[MT7].3y3_2.heavy 440.584 / 288.175 3696.0 34.388298988342285 34 13 10 5 6 1.9853746900962144 50.36832618993135 0.041202545166015625 5 0.9049656722852012 3.971194557547536 3696.0 19.558720884326885 0.0 - - - - - - - 250.3 7 10 CTCF CCCTC-binding factor (zinc finger protein) 253 33 C20140704_OR005_01 C20140704_OR005_01 TB413336.[MT7]-AFITLHSYSQLLMFPYGYK[MT7].3y6_1.heavy 856.459 / 918.484 4106.0 47.458600997924805 42 17 10 5 10 4.201315210292536 23.802070302893803 0.047199249267578125 3 0.9770169598365276 8.12499908345229 4106.0 21.22792589763178 0.0 - - - - - - - 226.57142857142858 8 7 CPA2 carboxypeptidase A2 (pancreatic) 255 33 C20140704_OR005_01 C20140704_OR005_01 TB413336.[MT7]-AFITLHSYSQLLMFPYGYK[MT7].3y3_1.heavy 856.459 / 511.3 5880.0 47.458600997924805 42 17 10 5 10 4.201315210292536 23.802070302893803 0.047199249267578125 3 0.9770169598365276 8.12499908345229 5880.0 18.48 0.0 - - - - - - - 205.4 11 10 CPA2 carboxypeptidase A2 (pancreatic) 257 33 C20140704_OR005_01 C20140704_OR005_01 TB413336.[MT7]-AFITLHSYSQLLMFPYGYK[MT7].3y4_1.heavy 856.459 / 674.363 1773.0 47.458600997924805 42 17 10 5 10 4.201315210292536 23.802070302893803 0.047199249267578125 3 0.9770169598365276 8.12499908345229 1773.0 25.975658099016734 0.0 - - - - - - - 198.375 3 8 CPA2 carboxypeptidase A2 (pancreatic) 259 33 C20140704_OR005_01 C20140704_OR005_01 TB413336.[MT7]-AFITLHSYSQLLMFPYGYK[MT7].3y5_1.heavy 856.459 / 771.416 9613.0 47.458600997924805 42 17 10 5 10 4.201315210292536 23.802070302893803 0.047199249267578125 3 0.9770169598365276 8.12499908345229 9613.0 108.84027611367127 0.0 - - - - - - - 186.5 19 4 CPA2 carboxypeptidase A2 (pancreatic) 261 34 C20140704_OR005_01 C20140704_OR005_01 TB413337.[MT7]-AFITLHSYSQLLMFPYGYK[MT7].4y5_1.heavy 642.596 / 771.416 9498.0 47.482200622558594 50 20 10 10 10 3.5881054841148905 22.101935665031554 0.0 3 0.9900159568455911 12.340908923677222 9498.0 101.312 0.0 - - - - - - - 186.0 18 6 CPA2 carboxypeptidase A2 (pancreatic) 263 34 C20140704_OR005_01 C20140704_OR005_01 TB413337.[MT7]-AFITLHSYSQLLMFPYGYK[MT7].4y4_1.heavy 642.596 / 674.363 10243.0 47.482200622558594 50 20 10 10 10 3.5881054841148905 22.101935665031554 0.0 3 0.9900159568455911 12.340908923677222 10243.0 44.463667618827785 0.0 - - - - - - - 227.33333333333334 20 9 CPA2 carboxypeptidase A2 (pancreatic) 265 34 C20140704_OR005_01 C20140704_OR005_01 TB413337.[MT7]-AFITLHSYSQLLMFPYGYK[MT7].4y3_1.heavy 642.596 / 511.3 16854.0 47.482200622558594 50 20 10 10 10 3.5881054841148905 22.101935665031554 0.0 3 0.9900159568455911 12.340908923677222 16854.0 32.829682891202935 0.0 - - - - - - - 294.6666666666667 33 6 CPA2 carboxypeptidase A2 (pancreatic) 267 34 C20140704_OR005_01 C20140704_OR005_01 TB413337.[MT7]-AFITLHSYSQLLMFPYGYK[MT7].4b10_2.heavy 642.596 / 646.841 11081.0 47.482200622558594 50 20 10 10 10 3.5881054841148905 22.101935665031554 0.0 3 0.9900159568455911 12.340908923677222 11081.0 13.569588996529347 0.0 - - - - - - - 186.0 22 7 CPA2 carboxypeptidase A2 (pancreatic) 269 35 C20140704_OR005_01 C20140704_OR005_01 TB413025.[MT7]-TVTMLQAQLSLER.2y8_1.heavy 817.457 / 944.516 4634.0 38.565399169921875 42 12 10 10 10 2.356205797303933 42.44111448771753 0.0 3 0.8999589569332304 3.868871986464601 4634.0 15.934867256637169 0.0 - - - - - - - 197.75 9 4 CDR2 cerebellar degeneration-related protein 2, 62kDa 271 35 C20140704_OR005_01 C20140704_OR005_01 TB413025.[MT7]-TVTMLQAQLSLER.2y9_1.heavy 817.457 / 1057.6 5312.0 38.565399169921875 42 12 10 10 10 2.356205797303933 42.44111448771753 0.0 3 0.8999589569332304 3.868871986464601 5312.0 15.580075853350191 0.0 - - - - - - - 236.27272727272728 10 11 CDR2 cerebellar degeneration-related protein 2, 62kDa 273 35 C20140704_OR005_01 C20140704_OR005_01 TB413025.[MT7]-TVTMLQAQLSLER.2y10_1.heavy 817.457 / 1188.64 1243.0 38.565399169921875 42 12 10 10 10 2.356205797303933 42.44111448771753 0.0 3 0.8999589569332304 3.868871986464601 1243.0 1.8406666666666671 2.0 - - - - - - - 217.30769230769232 2 13 CDR2 cerebellar degeneration-related protein 2, 62kDa 275 35 C20140704_OR005_01 C20140704_OR005_01 TB413025.[MT7]-TVTMLQAQLSLER.2y7_1.heavy 817.457 / 816.457 1469.0 38.565399169921875 42 12 10 10 10 2.356205797303933 42.44111448771753 0.0 3 0.8999589569332304 3.868871986464601 1469.0 4.766666666666666 0.0 - - - - - - - 301.3333333333333 2 9 CDR2 cerebellar degeneration-related protein 2, 62kDa 277 36 C20140704_OR005_01 C20140704_OR005_01 TB413022.[MT7]-DIVLVAHSALGTQR.3y7_1.heavy 541.981 / 732.4 110529.0 33.1599006652832 50 20 10 10 10 111.23991187520237 0.8989579217950822 0.0 3 0.9999544028073797 182.7644262295757 110529.0 103.05368003745602 0.0 - - - - - - - 280.3333333333333 221 9 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 279 36 C20140704_OR005_01 C20140704_OR005_01 TB413022.[MT7]-DIVLVAHSALGTQR.3y6_1.heavy 541.981 / 645.368 50334.0 33.1599006652832 50 20 10 10 10 111.23991187520237 0.8989579217950822 0.0 3 0.9999544028073797 182.7644262295757 50334.0 152.36565362330344 0.0 - - - - - - - 286.7 100 10 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 281 36 C20140704_OR005_01 C20140704_OR005_01 TB413022.[MT7]-DIVLVAHSALGTQR.3b4_1.heavy 541.981 / 585.373 107433.0 33.1599006652832 50 20 10 10 10 111.23991187520237 0.8989579217950822 0.0 3 0.9999544028073797 182.7644262295757 107433.0 258.0687688725192 0.0 - - - - - - - 315.25 214 4 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 283 36 C20140704_OR005_01 C20140704_OR005_01 TB413022.[MT7]-DIVLVAHSALGTQR.3b5_1.heavy 541.981 / 684.441 37378.0 33.1599006652832 50 20 10 10 10 111.23991187520237 0.8989579217950822 0.0 3 0.9999544028073797 182.7644262295757 37378.0 174.48189954867487 0.0 - - - - - - - 286.625 74 8 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 285 37 C20140704_OR005_01 C20140704_OR005_01 TB427311.[MT7]-AVPREELFVTSK[MT7].2b8_1.heavy 832.485 / 1086.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 287 37 C20140704_OR005_01 C20140704_OR005_01 TB427311.[MT7]-AVPREELFVTSK[MT7].2y4_1.heavy 832.485 / 578.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 289 37 C20140704_OR005_01 C20140704_OR005_01 TB427311.[MT7]-AVPREELFVTSK[MT7].2b6_1.heavy 832.485 / 826.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 291 37 C20140704_OR005_01 C20140704_OR005_01 TB427311.[MT7]-AVPREELFVTSK[MT7].2b9_1.heavy 832.485 / 1185.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 293 38 C20140704_OR005_01 C20140704_OR005_01 TB426850.[MT7]-ASAYLAPR.2y6_1.heavy 496.786 / 690.393 302.0 24.76650047302246 33 11 10 2 10 1.2644762481392595 50.579017915977836 0.08049964904785156 3 0.8666745815414357 3.3416288317833596 302.0 0.811910669975186 13.0 - - - - - - - 201.33333333333334 2 12 TROAP trophinin associated protein (tastin) 295 38 C20140704_OR005_01 C20140704_OR005_01 TB426850.[MT7]-ASAYLAPR.2y5_1.heavy 496.786 / 619.356 1007.0 24.76650047302246 33 11 10 2 10 1.2644762481392595 50.579017915977836 0.08049964904785156 3 0.8666745815414357 3.3416288317833596 1007.0 3.319747001435098 1.0 - - - - - - - 231.7 2 10 TROAP trophinin associated protein (tastin) 297 38 C20140704_OR005_01 C20140704_OR005_01 TB426850.[MT7]-ASAYLAPR.2b4_1.heavy 496.786 / 537.279 4228.0 24.76650047302246 33 11 10 2 10 1.2644762481392595 50.579017915977836 0.08049964904785156 3 0.8666745815414357 3.3416288317833596 4228.0 18.779454094292802 0.0 - - - - - - - 330.85714285714283 8 7 TROAP trophinin associated protein (tastin) 299 38 C20140704_OR005_01 C20140704_OR005_01 TB426850.[MT7]-ASAYLAPR.2y7_1.heavy 496.786 / 777.425 1611.0 24.76650047302246 33 11 10 2 10 1.2644762481392595 50.579017915977836 0.08049964904785156 3 0.8666745815414357 3.3416288317833596 1611.0 7.289468468913709 0.0 - - - - - - - 201.4 3 5 TROAP trophinin associated protein (tastin) 301 39 C20140704_OR005_01 C20140704_OR005_01 TB451195.[MT7]-VIC[CAM]WVC[CAM]ELSQEHQGHQTFR.4y8_1.heavy 640.309 / 1010.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 303 39 C20140704_OR005_01 C20140704_OR005_01 TB451195.[MT7]-VIC[CAM]WVC[CAM]ELSQEHQGHQTFR.4y7_1.heavy 640.309 / 873.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 305 39 C20140704_OR005_01 C20140704_OR005_01 TB451195.[MT7]-VIC[CAM]WVC[CAM]ELSQEHQGHQTFR.4y6_1.heavy 640.309 / 745.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 307 39 C20140704_OR005_01 C20140704_OR005_01 TB451195.[MT7]-VIC[CAM]WVC[CAM]ELSQEHQGHQTFR.4b3_1.heavy 640.309 / 517.292 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 309 40 C20140704_OR005_01 C20140704_OR005_01 TB413224.[MT7]-SEFNIENLVGTVADLFVAGTETTSTTLR.3b4_1.heavy 1043.87 / 622.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 311 40 C20140704_OR005_01 C20140704_OR005_01 TB413224.[MT7]-SEFNIENLVGTVADLFVAGTETTSTTLR.3b8_1.heavy 1043.87 / 1091.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 313 40 C20140704_OR005_01 C20140704_OR005_01 TB413224.[MT7]-SEFNIENLVGTVADLFVAGTETTSTTLR.3b7_1.heavy 1043.87 / 978.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 315 40 C20140704_OR005_01 C20140704_OR005_01 TB413224.[MT7]-SEFNIENLVGTVADLFVAGTETTSTTLR.3y10_1.heavy 1043.87 / 1066.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 317 41 C20140704_OR005_01 C20140704_OR005_01 TB412790.[MT7]-ARHQAETSQR.2y8_1.heavy 664.351 / 956.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - TROAP trophinin associated protein (tastin) 319 41 C20140704_OR005_01 C20140704_OR005_01 TB412790.[MT7]-ARHQAETSQR.2y5_1.heavy 664.351 / 620.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - TROAP trophinin associated protein (tastin) 321 41 C20140704_OR005_01 C20140704_OR005_01 TB412790.[MT7]-ARHQAETSQR.2b9_1.heavy 664.351 / 1153.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - TROAP trophinin associated protein (tastin) 323 41 C20140704_OR005_01 C20140704_OR005_01 TB412790.[MT7]-ARHQAETSQR.2y7_1.heavy 664.351 / 819.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - TROAP trophinin associated protein (tastin) 325 42 C20140704_OR005_01 C20140704_OR005_01 TB427101.[MT7]-VYEQLDVTAR.2b3_1.heavy 669.363 / 536.284 8262.0 30.44659996032715 48 20 10 10 8 12.717372180057136 7.86325968794213 0.0 4 0.9984539148807396 31.3826562002966 8262.0 19.212229954689963 0.0 - - - - - - - 219.625 16 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 327 42 C20140704_OR005_01 C20140704_OR005_01 TB427101.[MT7]-VYEQLDVTAR.2y8_1.heavy 669.363 / 931.484 12806.0 30.44659996032715 48 20 10 10 8 12.717372180057136 7.86325968794213 0.0 4 0.9984539148807396 31.3826562002966 12806.0 6.1569615394082575 1.0 - - - - - - - 678.5714285714286 26 7 CDR2 cerebellar degeneration-related protein 2, 62kDa 329 42 C20140704_OR005_01 C20140704_OR005_01 TB427101.[MT7]-VYEQLDVTAR.2y9_1.heavy 669.363 / 1094.55 34700.0 30.44659996032715 48 20 10 10 8 12.717372180057136 7.86325968794213 0.0 4 0.9984539148807396 31.3826562002966 34700.0 203.47924263674616 0.0 - - - - - - - 162.42857142857142 69 7 CDR2 cerebellar degeneration-related protein 2, 62kDa 331 42 C20140704_OR005_01 C20140704_OR005_01 TB427101.[MT7]-VYEQLDVTAR.2y7_1.heavy 669.363 / 802.442 11050.0 30.44659996032715 48 20 10 10 8 12.717372180057136 7.86325968794213 0.0 4 0.9984539148807396 31.3826562002966 11050.0 26.380712293499244 0.0 - - - - - - - 289.3 22 10 CDR2 cerebellar degeneration-related protein 2, 62kDa 333 43 C20140704_OR005_01 C20140704_OR005_01 TB413226.[MT7]-VNIGSSFENRPMNVLK[MT7].4y8_2.heavy 524.041 / 558.327 23489.0 34.682701110839844 42 12 10 10 10 3.5803202562103764 27.930462317314017 0.0 3 0.8807942139509112 3.538359802118854 23489.0 97.14864788536448 0.0 - - - - - - - 316.1818181818182 46 11 CPA2 carboxypeptidase A2 (pancreatic) 335 43 C20140704_OR005_01 C20140704_OR005_01 TB413226.[MT7]-VNIGSSFENRPMNVLK[MT7].4y10_2.heavy 524.041 / 696.383 12583.0 34.682701110839844 42 12 10 10 10 3.5803202562103764 27.930462317314017 0.0 3 0.8807942139509112 3.538359802118854 12583.0 12.648748767297214 2.0 - - - - - - - 266.44444444444446 25 9 CPA2 carboxypeptidase A2 (pancreatic) 337 43 C20140704_OR005_01 C20140704_OR005_01 TB413226.[MT7]-VNIGSSFENRPMNVLK[MT7].4y9_2.heavy 524.041 / 622.849 32957.0 34.682701110839844 42 12 10 10 10 3.5803202562103764 27.930462317314017 0.0 3 0.8807942139509112 3.538359802118854 32957.0 44.59881178664308 0.0 - - - - - - - 279.8888888888889 65 9 CPA2 carboxypeptidase A2 (pancreatic) 339 43 C20140704_OR005_01 C20140704_OR005_01 TB413226.[MT7]-VNIGSSFENRPMNVLK[MT7].4b4_1.heavy 524.041 / 528.326 12224.0 34.682701110839844 42 12 10 10 10 3.5803202562103764 27.930462317314017 0.0 3 0.8807942139509112 3.538359802118854 12224.0 21.667501405871153 0.0 - - - - - - - 306.3333333333333 24 9 CPA2 carboxypeptidase A2 (pancreatic) 341 44 C20140704_OR005_01 C20140704_OR005_01 TB450594.[MT7]-ESVIISR.2y6_1.heavy 474.286 / 674.42 10340.0 24.472099781036377 40 20 10 2 8 15.213720576774588 6.573014108899894 0.08139991760253906 4 0.9975582645462915 24.970351524164197 10340.0 26.779970528843528 0.0 - - - - - - - 200.875 20 8 TRIM22 tripartite motif-containing 22 343 44 C20140704_OR005_01 C20140704_OR005_01 TB450594.[MT7]-ESVIISR.2y4_1.heavy 474.286 / 488.319 3413.0 24.472099781036377 40 20 10 2 8 15.213720576774588 6.573014108899894 0.08139991760253906 4 0.9975582645462915 24.970351524164197 3413.0 43.09549253731343 1.0 - - - - - - - 178.44444444444446 17 9 TRIM22 tripartite motif-containing 22 345 44 C20140704_OR005_01 C20140704_OR005_01 TB450594.[MT7]-ESVIISR.2y5_1.heavy 474.286 / 587.388 1707.0 24.472099781036377 40 20 10 2 8 15.213720576774588 6.573014108899894 0.08139991760253906 4 0.9975582645462915 24.970351524164197 1707.0 5.731964664400912 6.0 - - - - - - - 209.9090909090909 13 11 TRIM22 tripartite motif-containing 22 347 44 C20140704_OR005_01 C20140704_OR005_01 TB450594.[MT7]-ESVIISR.2b4_1.heavy 474.286 / 573.336 5923.0 24.472099781036377 40 20 10 2 8 15.213720576774588 6.573014108899894 0.08139991760253906 4 0.9975582645462915 24.970351524164197 5923.0 34.23926910299003 1.0 - - - - - - - 175.5 11 8 TRIM22 tripartite motif-containing 22 349 45 C20140704_OR005_01 C20140704_OR005_01 TB426869.[MT7]-LVGISQPR.2y5_1.heavy 507.315 / 600.346 1017.0 27.87310028076172 40 17 10 3 10 2.857151303610854 34.99989653107292 0.07720184326171875 3 0.9709649514788802 7.225112928102718 1017.0 12.278558388872788 4.0 - - - - - - - 188.85714285714286 2 7 TROAP trophinin associated protein (tastin) 351 45 C20140704_OR005_01 C20140704_OR005_01 TB426869.[MT7]-LVGISQPR.2b4_1.heavy 507.315 / 527.367 1830.0 27.87310028076172 40 17 10 3 10 2.857151303610854 34.99989653107292 0.07720184326171875 3 0.9709649514788802 7.225112928102718 1830.0 14.203743842364531 1.0 - - - - - - - 189.0 3 7 TROAP trophinin associated protein (tastin) 353 45 C20140704_OR005_01 C20140704_OR005_01 TB426869.[MT7]-LVGISQPR.2y6_1.heavy 507.315 / 657.368 4981.0 27.87310028076172 40 17 10 3 10 2.857151303610854 34.99989653107292 0.07720184326171875 3 0.9709649514788802 7.225112928102718 4981.0 37.35649438746669 0.0 - - - - - - - 174.28571428571428 9 7 TROAP trophinin associated protein (tastin) 355 45 C20140704_OR005_01 C20140704_OR005_01 TB426869.[MT7]-LVGISQPR.2y7_1.heavy 507.315 / 756.436 5184.0 27.87310028076172 40 17 10 3 10 2.857151303610854 34.99989653107292 0.07720184326171875 3 0.9709649514788802 7.225112928102718 5184.0 61.028253821213525 0.0 - - - - - - - 305.0 10 1 TROAP trophinin associated protein (tastin) 357 46 C20140704_OR005_01 C20140704_OR005_01 TB451038.[MT7]-LALGSFVEEYNNK[MT7].3y3_1.heavy 591.32 / 519.301 3039.0 38.725799560546875 30 14 0 10 6 10.299832049470263 9.708896176141355 0.0 6 0.9437214109878481 5.177649317440005 3039.0 8.638905114493351 3.0 - - - - - - - 287.1818181818182 59 11 DCAF7 DDB1 and CUL4 associated factor 7 359 46 C20140704_OR005_01 C20140704_OR005_01 TB451038.[MT7]-LALGSFVEEYNNK[MT7].3b6_1.heavy 591.32 / 733.437 2689.0 38.725799560546875 30 14 0 10 6 10.299832049470263 9.708896176141355 0.0 6 0.9437214109878481 5.177649317440005 2689.0 9.86730139913359 2.0 - - - - - - - 331.5 13 12 DCAF7 DDB1 and CUL4 associated factor 7 361 46 C20140704_OR005_01 C20140704_OR005_01 TB451038.[MT7]-LALGSFVEEYNNK[MT7].3b5_1.heavy 591.32 / 586.368 1870.0 38.725799560546875 30 14 0 10 6 10.299832049470263 9.708896176141355 0.0 6 0.9437214109878481 5.177649317440005 1870.0 1.7609148382298252 10.0 - - - - - - - 771.2 21 10 DCAF7 DDB1 and CUL4 associated factor 7 363 46 C20140704_OR005_01 C20140704_OR005_01 TB451038.[MT7]-LALGSFVEEYNNK[MT7].3y4_1.heavy 591.32 / 682.364 2104.0 38.725799560546875 30 14 0 10 6 10.299832049470263 9.708896176141355 0.0 6 0.9437214109878481 5.177649317440005 2104.0 3.846153846153846 3.0 - - - - - - - 260.0 4 9 DCAF7 DDB1 and CUL4 associated factor 7 365 47 C20140704_OR005_01 C20140704_OR005_01 TB413223.[MT7]-QLVSGAETLNLVAEILK[MT7].2b3_1.heavy 1043.62 / 485.32 9426.0 52.56254959106445 44 17 10 7 10 10.87750996976328 9.193280473010336 0.0298004150390625 3 0.9787443989883478 8.449935498408873 9426.0 71.83380161737705 0.0 - - - - - - - 136.25 18 20 SDCCAG3 serologically defined colon cancer antigen 3 367 47 C20140704_OR005_01 C20140704_OR005_01 TB413223.[MT7]-QLVSGAETLNLVAEILK[MT7].2y5_1.heavy 1043.62 / 717.463 4229.0 52.56254959106445 44 17 10 7 10 10.87750996976328 9.193280473010336 0.0298004150390625 3 0.9787443989883478 8.449935498408873 4229.0 46.10315466656249 0.0 - - - - - - - 134.9047619047619 8 21 SDCCAG3 serologically defined colon cancer antigen 3 369 47 C20140704_OR005_01 C20140704_OR005_01 TB413223.[MT7]-QLVSGAETLNLVAEILK[MT7].2y3_1.heavy 1043.62 / 517.383 3835.0 52.56254959106445 44 17 10 7 10 10.87750996976328 9.193280473010336 0.0298004150390625 3 0.9787443989883478 8.449935498408873 3835.0 50.14999999999999 0.0 - - - - - - - 118.29411764705883 7 17 SDCCAG3 serologically defined colon cancer antigen 3 371 47 C20140704_OR005_01 C20140704_OR005_01 TB413223.[MT7]-QLVSGAETLNLVAEILK[MT7].2b10_1.heavy 1043.62 / 1157.63 1685.0 52.56254959106445 44 17 10 7 10 10.87750996976328 9.193280473010336 0.0298004150390625 3 0.9787443989883478 8.449935498408873 1685.0 48.54715762273902 0.0 - - - - - - - 139.6315789473684 3 19 SDCCAG3 serologically defined colon cancer antigen 3 373 48 C20140704_OR005_01 C20140704_OR005_01 TB412775.[MT7]-NLLQLC[CAM]PQSLEALAVR.3b4_1.heavy 657.039 / 613.379 18833.0 46.20869827270508 47 17 10 10 10 2.6913655301903203 31.731853485147976 0.0 3 0.9734137419467095 7.552084638236606 18833.0 26.8340075760032 1.0 - - - - - - - 295.7142857142857 40 7 CNKSR1 connector enhancer of kinase suppressor of Ras 1 375 48 C20140704_OR005_01 C20140704_OR005_01 TB412775.[MT7]-NLLQLC[CAM]PQSLEALAVR.3b5_1.heavy 657.039 / 726.463 8973.0 46.20869827270508 47 17 10 10 10 2.6913655301903203 31.731853485147976 0.0 3 0.9734137419467095 7.552084638236606 8973.0 131.18808491001386 0.0 - - - - - - - 234.25 17 8 CNKSR1 connector enhancer of kinase suppressor of Ras 1 377 48 C20140704_OR005_01 C20140704_OR005_01 TB412775.[MT7]-NLLQLC[CAM]PQSLEALAVR.3y8_1.heavy 657.039 / 858.504 11339.0 46.20869827270508 47 17 10 10 10 2.6913655301903203 31.731853485147976 0.0 3 0.9734137419467095 7.552084638236606 11339.0 50.31722842639594 0.0 - - - - - - - 241.11111111111111 22 9 CNKSR1 connector enhancer of kinase suppressor of Ras 1 379 48 C20140704_OR005_01 C20140704_OR005_01 TB412775.[MT7]-NLLQLC[CAM]PQSLEALAVR.3y10_1.heavy 657.039 / 1083.62 24059.0 46.20869827270508 47 17 10 10 10 2.6913655301903203 31.731853485147976 0.0 3 0.9734137419467095 7.552084638236606 24059.0 121.10780405405404 0.0 - - - - - - - 266.2 48 10 CNKSR1 connector enhancer of kinase suppressor of Ras 1 381 49 C20140704_OR005_01 C20140704_OR005_01 TB427103.[MT7]-LNEVQSFSEAQTEMVR.3y7_1.heavy 671.334 / 834.414 40170.0 36.19150161743164 46 16 10 10 10 2.9528447809346745 33.865647339697496 0.0 3 0.9691016390630963 7.002772389202127 40170.0 117.77189865182648 0.0 - - - - - - - 245.9090909090909 80 11 SDCCAG3 serologically defined colon cancer antigen 3 383 49 C20140704_OR005_01 C20140704_OR005_01 TB427103.[MT7]-LNEVQSFSEAQTEMVR.3b4_1.heavy 671.334 / 600.347 75057.0 36.19150161743164 46 16 10 10 10 2.9528447809346745 33.865647339697496 0.0 3 0.9691016390630963 7.002772389202127 75057.0 103.59054122469391 0.0 - - - - - - - 752.375 150 8 SDCCAG3 serologically defined colon cancer antigen 3 385 49 C20140704_OR005_01 C20140704_OR005_01 TB427103.[MT7]-LNEVQSFSEAQTEMVR.3b3_1.heavy 671.334 / 501.279 88202.0 36.19150161743164 46 16 10 10 10 2.9528447809346745 33.865647339697496 0.0 3 0.9691016390630963 7.002772389202127 88202.0 177.38032319156366 0.0 - - - - - - - 382.22222222222223 176 9 SDCCAG3 serologically defined colon cancer antigen 3 387 49 C20140704_OR005_01 C20140704_OR005_01 TB427103.[MT7]-LNEVQSFSEAQTEMVR.3y9_1.heavy 671.334 / 1050.49 51840.0 36.19150161743164 46 16 10 10 10 2.9528447809346745 33.865647339697496 0.0 3 0.9691016390630963 7.002772389202127 51840.0 157.13628567817878 1.0 - - - - - - - 295.0 103 10 SDCCAG3 serologically defined colon cancer antigen 3 389 50 C20140704_OR005_01 C20140704_OR005_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 173826.0 18.868900299072266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 173826.0 2464.6303867924526 0.0 - - - - - - - 275.46153846153845 347 13 391 50 C20140704_OR005_01 C20140704_OR005_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 93672.0 18.868900299072266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 93672.0 305.78281630026083 0.0 - - - - - - - 132.83333333333334 187 6 393 50 C20140704_OR005_01 C20140704_OR005_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 102339.0 18.868900299072266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 102339.0 503.9810050251257 0.0 - - - - - - - 196.0 204 13 395 51 C20140704_OR005_01 C20140704_OR005_01 TB427300.[MT7]-DAGHPLYPFNDPY.2b4_1.heavy 825.389 / 525.254 9093.0 37.998300552368164 35 10 10 5 10 0.6818050725939963 76.92711261249778 0.044002532958984375 3 0.8250021893256302 2.9060232724470163 9093.0 84.65255310307741 0.0 - - - - - - - 262.5 18 4 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 397 51 C20140704_OR005_01 C20140704_OR005_01 TB427300.[MT7]-DAGHPLYPFNDPY.2b6_1.heavy 825.389 / 735.391 4080.0 37.998300552368164 35 10 10 5 10 0.6818050725939963 76.92711261249778 0.044002532958984375 3 0.8250021893256302 2.9060232724470163 4080.0 6.669527896995708 0.0 - - - - - - - 277.0 8 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 399 51 C20140704_OR005_01 C20140704_OR005_01 TB427300.[MT7]-DAGHPLYPFNDPY.2b7_1.heavy 825.389 / 898.454 10026.0 37.998300552368164 35 10 10 5 10 0.6818050725939963 76.92711261249778 0.044002532958984375 3 0.8250021893256302 2.9060232724470163 10026.0 62.39356223175966 0.0 - - - - - - - 175.0 20 6 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 401 51 C20140704_OR005_01 C20140704_OR005_01 TB427300.[MT7]-DAGHPLYPFNDPY.2b5_1.heavy 825.389 / 622.307 1166.0 37.998300552368164 35 10 10 5 10 0.6818050725939963 76.92711261249778 0.044002532958984375 3 0.8250021893256302 2.9060232724470163 1166.0 3.8082801120448186 0.0 - - - - - - - 222.72727272727272 2 11 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 403 52 C20140704_OR005_01 C20140704_OR005_01 TB451188.[MT7]-YEAPWTVYAMNWSVRPDK[MT7].3y7_1.heavy 834.422 / 1031.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCAF7 DDB1 and CUL4 associated factor 7 405 52 C20140704_OR005_01 C20140704_OR005_01 TB451188.[MT7]-YEAPWTVYAMNWSVRPDK[MT7].3y3_1.heavy 834.422 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCAF7 DDB1 and CUL4 associated factor 7 407 52 C20140704_OR005_01 C20140704_OR005_01 TB451188.[MT7]-YEAPWTVYAMNWSVRPDK[MT7].3b3_1.heavy 834.422 / 508.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCAF7 DDB1 and CUL4 associated factor 7 409 52 C20140704_OR005_01 C20140704_OR005_01 TB451188.[MT7]-YEAPWTVYAMNWSVRPDK[MT7].3y8_1.heavy 834.422 / 1145.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCAF7 DDB1 and CUL4 associated factor 7 411 53 C20140704_OR005_01 C20140704_OR005_01 TB451187.[MT7]-YEAPWTVYAMNWSVRPDK[MT7].4y6_1.heavy 626.069 / 845.496 631.0 42.967774391174316 28 11 8 5 4 1.1341138360639051 72.97163155037136 0.040699005126953125 9 0.8637381865083396 3.304576192546462 631.0 1.9216766250226327 11.0 - - - - - - - 182.13333333333333 3 15 DCAF7 DDB1 and CUL4 associated factor 7 413 53 C20140704_OR005_01 C20140704_OR005_01 TB451187.[MT7]-YEAPWTVYAMNWSVRPDK[MT7].4y7_2.heavy 626.069 / 516.291 1998.0 42.967774391174316 28 11 8 5 4 1.1341138360639051 72.97163155037136 0.040699005126953125 9 0.8637381865083396 3.304576192546462 1998.0 2.095154334038055 3.0 - - - - - - - 697.8181818181819 3 11 DCAF7 DDB1 and CUL4 associated factor 7 415 53 C20140704_OR005_01 C20140704_OR005_01 TB451187.[MT7]-YEAPWTVYAMNWSVRPDK[MT7].4y3_1.heavy 626.069 / 503.295 1157.0 42.967774391174316 28 11 8 5 4 1.1341138360639051 72.97163155037136 0.040699005126953125 9 0.8637381865083396 3.304576192546462 1157.0 4.677206198393847 13.0 - - - - - - - 201.33333333333334 5 12 DCAF7 DDB1 and CUL4 associated factor 7 417 53 C20140704_OR005_01 C20140704_OR005_01 TB451187.[MT7]-YEAPWTVYAMNWSVRPDK[MT7].4b3_1.heavy 626.069 / 508.252 2313.0 42.967774391174316 28 11 8 5 4 1.1341138360639051 72.97163155037136 0.040699005126953125 9 0.8637381865083396 3.304576192546462 2313.0 4.395249406175772 0.0 - - - - - - - 689.3333333333334 4 9 DCAF7 DDB1 and CUL4 associated factor 7 419 54 C20140704_OR005_01 C20140704_OR005_01 TB413229.[MT7]-GHTLYWYRQPQDEK[MT7].4y5_1.heavy 528.024 / 760.396 3284.0 27.40180015563965 42 12 10 10 10 2.851743576042478 35.06626642034047 0.0 3 0.8895734548951018 3.679134751153554 3284.0 38.995609099284245 0.0 - - - - - - - 239.5 6 6 CNKSR1 connector enhancer of kinase suppressor of Ras 1 421 54 C20140704_OR005_01 C20140704_OR005_01 TB413229.[MT7]-GHTLYWYRQPQDEK[MT7].4y8_2.heavy 528.024 / 604.313 13240.0 27.40180015563965 42 12 10 10 10 2.851743576042478 35.06626642034047 0.0 3 0.8895734548951018 3.679134751153554 13240.0 16.47985069905738 0.0 - - - - - - - 243.875 26 8 CNKSR1 connector enhancer of kinase suppressor of Ras 1 423 54 C20140704_OR005_01 C20140704_OR005_01 TB413229.[MT7]-GHTLYWYRQPQDEK[MT7].4y9_2.heavy 528.024 / 697.353 9751.0 27.40180015563965 42 12 10 10 10 2.851743576042478 35.06626642034047 0.0 3 0.8895734548951018 3.679134751153554 9751.0 170.40582524271844 0.0 - - - - - - - 132.14285714285714 19 7 CNKSR1 connector enhancer of kinase suppressor of Ras 1 425 54 C20140704_OR005_01 C20140704_OR005_01 TB413229.[MT7]-GHTLYWYRQPQDEK[MT7].4b4_1.heavy 528.024 / 553.321 4208.0 27.40180015563965 42 12 10 10 10 2.851743576042478 35.06626642034047 0.0 3 0.8895734548951018 3.679134751153554 4208.0 29.53615951575574 0.0 - - - - - - - 239.75 8 12 CNKSR1 connector enhancer of kinase suppressor of Ras 1 427 55 C20140704_OR005_01 C20140704_OR005_01 TB450657.[MT7]-YALSVGYR.2y5_1.heavy 536.799 / 581.304 25929.0 30.741600036621094 48 18 10 10 10 3.488131079229038 23.48372869944942 0.0 3 0.9848017805221511 9.998029937880771 25929.0 287.04447846225105 0.0 - - - - - - - 130.85714285714286 51 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 429 55 C20140704_OR005_01 C20140704_OR005_01 TB450657.[MT7]-YALSVGYR.2b4_1.heavy 536.799 / 579.326 7219.0 30.741600036621094 48 18 10 10 10 3.488131079229038 23.48372869944942 0.0 3 0.9848017805221511 9.998029937880771 7219.0 38.89079728361694 0.0 - - - - - - - 203.3 14 10 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 431 55 C20140704_OR005_01 C20140704_OR005_01 TB450657.[MT7]-YALSVGYR.2y6_1.heavy 536.799 / 694.388 18201.0 30.741600036621094 48 18 10 10 10 3.488131079229038 23.48372869944942 0.0 3 0.9848017805221511 9.998029937880771 18201.0 105.66859064846967 0.0 - - - - - - - 203.33333333333334 36 9 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 433 55 C20140704_OR005_01 C20140704_OR005_01 TB450657.[MT7]-YALSVGYR.2y7_1.heavy 536.799 / 765.425 47486.0 30.741600036621094 48 18 10 10 10 3.488131079229038 23.48372869944942 0.0 3 0.9848017805221511 9.998029937880771 47486.0 319.0351574055022 0.0 - - - - - - - 195.53846153846155 94 13 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 435 56 C20140704_OR005_01 C20140704_OR005_01 TB450654.[MT7]-IVSDYGK[MT7].2y5_1.heavy 535.31 / 713.359 17192.0 24.594100952148438 47 17 10 10 10 3.397109437869526 29.436790844958566 0.0 3 0.9705932756899165 7.179083344610547 17192.0 197.79395563676968 0.0 - - - - - - - 211.125 34 8 CPA2;CPA5 carboxypeptidase A2 (pancreatic);carboxypeptidase A5 437 56 C20140704_OR005_01 C20140704_OR005_01 TB450654.[MT7]-IVSDYGK[MT7].2b4_1.heavy 535.31 / 559.321 22061.0 24.594100952148438 47 17 10 10 10 3.397109437869526 29.436790844958566 0.0 3 0.9705932756899165 7.179083344610547 22061.0 70.77549596104953 0.0 - - - - - - - 234.9090909090909 44 11 CPA2;CPA5 carboxypeptidase A2 (pancreatic);carboxypeptidase A5 439 56 C20140704_OR005_01 C20140704_OR005_01 TB450654.[MT7]-IVSDYGK[MT7].2y3_1.heavy 535.31 / 511.3 38260.0 24.594100952148438 47 17 10 10 10 3.397109437869526 29.436790844958566 0.0 3 0.9705932756899165 7.179083344610547 38260.0 110.41476510067113 0.0 - - - - - - - 223.625 76 8 CPA2;CPA5 carboxypeptidase A2 (pancreatic);carboxypeptidase A5 441 56 C20140704_OR005_01 C20140704_OR005_01 TB450654.[MT7]-IVSDYGK[MT7].2y6_1.heavy 535.31 / 812.427 29614.0 24.594100952148438 47 17 10 10 10 3.397109437869526 29.436790844958566 0.0 3 0.9705932756899165 7.179083344610547 29614.0 70.31090543259558 0.0 - - - - - - - 252.23076923076923 59 13 CPA2;CPA5 carboxypeptidase A2 (pancreatic);carboxypeptidase A5 443 57 C20140704_OR005_01 C20140704_OR005_01 TB413312.[MT7]-ITSLQGQPSPDEEENEHLK[MT7].4b5_1.heavy 610.562 / 687.416 5340.0 27.548049926757812 37 14 10 3 10 1.475838250448768 54.328127719183556 0.0764007568359375 3 0.9307801817618933 4.663474238852322 5340.0 2.3034322820037105 0.0 - - - - - - - 320.875 10 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 445 57 C20140704_OR005_01 C20140704_OR005_01 TB413312.[MT7]-ITSLQGQPSPDEEENEHLK[MT7].4y10_2.heavy 610.562 / 692.329 8729.0 27.548049926757812 37 14 10 3 10 1.475838250448768 54.328127719183556 0.0764007568359375 3 0.9307801817618933 4.663474238852322 8729.0 0.0 2.0 - - - - - - - 282.25 17 4 CDR2 cerebellar degeneration-related protein 2, 62kDa 447 57 C20140704_OR005_01 C20140704_OR005_01 TB413312.[MT7]-ITSLQGQPSPDEEENEHLK[MT7].4y3_1.heavy 610.562 / 541.358 12939.0 27.548049926757812 37 14 10 3 10 1.475838250448768 54.328127719183556 0.0764007568359375 3 0.9307801817618933 4.663474238852322 12939.0 14.119314273471272 1.0 - - - - - - - 257.0 25 2 CDR2 cerebellar degeneration-related protein 2, 62kDa 449 57 C20140704_OR005_01 C20140704_OR005_01 TB413312.[MT7]-ITSLQGQPSPDEEENEHLK[MT7].4b4_1.heavy 610.562 / 559.357 5853.0 27.548049926757812 37 14 10 3 10 1.475838250448768 54.328127719183556 0.0764007568359375 3 0.9307801817618933 4.663474238852322 5853.0 6.673343709469831 1.0 - - - - - - - 660.0 11 7 CDR2 cerebellar degeneration-related protein 2, 62kDa 451 58 C20140704_OR005_01 C20140704_OR005_01 TB450655.[MT7]-HPEVTAK[MT7].2y4_1.heavy 535.316 / 562.368 559.0 16.397350311279297 44 20 10 6 8 3.6463115782894424 20.627470438576307 0.035400390625 4 0.9939724774856213 15.8881951083815 559.0 2.9946428571428574 1.0 - - - - - - - 0.0 1 0 CYP2C19;CYP2C8;CYP2C9 cytochrome P450, family 2, subfamily C, polypeptide 19;cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 9 453 58 C20140704_OR005_01 C20140704_OR005_01 TB450655.[MT7]-HPEVTAK[MT7].2y5_1.heavy 535.316 / 691.411 615.0 16.397350311279297 44 20 10 6 8 3.6463115782894424 20.627470438576307 0.035400390625 4 0.9939724774856213 15.8881951083815 615.0 2.020714285714286 1.0 - - - - - - - 0.0 1 0 CYP2C19;CYP2C8;CYP2C9 cytochrome P450, family 2, subfamily C, polypeptide 19;cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 9 455 58 C20140704_OR005_01 C20140704_OR005_01 TB450655.[MT7]-HPEVTAK[MT7].2b4_1.heavy 535.316 / 607.332 280.0 16.397350311279297 44 20 10 6 8 3.6463115782894424 20.627470438576307 0.035400390625 4 0.9939724774856213 15.8881951083815 280.0 6.725 7.0 - - - - - - - 0.0 0 0 CYP2C19;CYP2C8;CYP2C9 cytochrome P450, family 2, subfamily C, polypeptide 19;cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 9 457 58 C20140704_OR005_01 C20140704_OR005_01 TB450655.[MT7]-HPEVTAK[MT7].2y6_1.heavy 535.316 / 788.463 4251.0 16.397350311279297 44 20 10 6 8 3.6463115782894424 20.627470438576307 0.035400390625 4 0.9939724774856213 15.8881951083815 4251.0 54.14964285714286 0.0 - - - - - - - 120.0 8 7 CYP2C19;CYP2C8;CYP2C9 cytochrome P450, family 2, subfamily C, polypeptide 19;cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 9 459 59 C20140704_OR005_01 C20140704_OR005_01 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 204335.0 38.020301818847656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 204335.0 1005.4579365079364 0.0 - - - - - - - 210.0 408 3 461 59 C20140704_OR005_01 C20140704_OR005_01 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 110406.0 38.020301818847656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 110406.0 1163.6441904761905 0.0 - - - - - - - 189.0 220 5 463 59 C20140704_OR005_01 C20140704_OR005_01 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 199297.0 38.020301818847656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 199297.0 485.73675168496055 0.0 - - - - - - - 285.0 398 7 465 60 C20140704_OR005_01 C20140704_OR005_01 TB413181.[MT7]-GLVASLDMQLEQAQGTR.3y7_1.heavy 654.346 / 789.385 39837.0 42.00842571258545 46 20 10 6 10 8.420694958784567 11.875504395949985 0.039699554443359375 3 0.9968083439657972 21.839301887747823 39837.0 415.98327102207475 0.0 - - - - - - - 755.25 79 8 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 467 60 C20140704_OR005_01 C20140704_OR005_01 TB413181.[MT7]-GLVASLDMQLEQAQGTR.3y6_1.heavy 654.346 / 660.342 31951.0 42.00842571258545 46 20 10 6 10 8.420694958784567 11.875504395949985 0.039699554443359375 3 0.9968083439657972 21.839301887747823 31951.0 192.8254399777548 0.0 - - - - - - - 614.3636363636364 63 11 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 469 60 C20140704_OR005_01 C20140704_OR005_01 TB413181.[MT7]-GLVASLDMQLEQAQGTR.3y8_1.heavy 654.346 / 902.469 29391.0 42.00842571258545 46 20 10 6 10 8.420694958784567 11.875504395949985 0.039699554443359375 3 0.9968083439657972 21.839301887747823 29391.0 55.94206434581044 0.0 - - - - - - - 261.77777777777777 58 9 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 471 60 C20140704_OR005_01 C20140704_OR005_01 TB413181.[MT7]-GLVASLDMQLEQAQGTR.3b7_1.heavy 654.346 / 800.463 70559.0 42.00842571258545 46 20 10 6 10 8.420694958784567 11.875504395949985 0.039699554443359375 3 0.9968083439657972 21.839301887747823 70559.0 367.0164443752176 0.0 - - - - - - - 234.14285714285714 141 7 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 473 61 C20140704_OR005_01 C20140704_OR005_01 TB412529.[MT7]-LQVALQR.2b3_1.heavy 486.31 / 485.32 9762.0 28.819700241088867 50 20 10 10 10 8.17712564257356 12.229236087477716 0.0 3 0.9947787975688954 17.07213990957599 9762.0 22.282489257426896 0.0 - - - - - - - 226.11111111111111 19 9 TRIM22 tripartite motif-containing 22 475 61 C20140704_OR005_01 C20140704_OR005_01 TB412529.[MT7]-LQVALQR.2y5_1.heavy 486.31 / 586.367 13524.0 28.819700241088867 50 20 10 10 10 8.17712564257356 12.229236087477716 0.0 3 0.9947787975688954 17.07213990957599 13524.0 105.19297682306387 0.0 - - - - - - - 237.0 27 6 TRIM22 tripartite motif-containing 22 477 61 C20140704_OR005_01 C20140704_OR005_01 TB412529.[MT7]-LQVALQR.2b4_1.heavy 486.31 / 556.357 11999.0 28.819700241088867 50 20 10 10 10 8.17712564257356 12.229236087477716 0.0 3 0.9947787975688954 17.07213990957599 11999.0 38.73692913385827 0.0 - - - - - - - 203.25 23 4 TRIM22 tripartite motif-containing 22 479 61 C20140704_OR005_01 C20140704_OR005_01 TB412529.[MT7]-LQVALQR.2y6_1.heavy 486.31 / 714.426 27353.0 28.819700241088867 50 20 10 10 10 8.17712564257356 12.229236087477716 0.0 3 0.9947787975688954 17.07213990957599 27353.0 278.10202185792355 0.0 - - - - - - - 159.85714285714286 54 7 TRIM22 tripartite motif-containing 22 481 62 C20140704_OR005_01 C20140704_OR005_01 TB413189.[MT7]-QSPHDEDPQAVTYAK[MT7].4y4_1.heavy 494.251 / 626.363 1706.0 21.90559959411621 32 7 10 5 10 0.5083184679744295 102.51958236548032 0.042999267578125 3 0.7155878611123163 2.256898069115057 1706.0 25.278607434944234 0.0 - - - - - - - 144.0 3 10 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 483 62 C20140704_OR005_01 C20140704_OR005_01 TB413189.[MT7]-QSPHDEDPQAVTYAK[MT7].4b7_1.heavy 494.251 / 953.408 1616.0 21.90559959411621 32 7 10 5 10 0.5083184679744295 102.51958236548032 0.042999267578125 3 0.7155878611123163 2.256898069115057 1616.0 25.137777777777778 0.0 - - - - - - - 150.0 3 3 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 485 62 C20140704_OR005_01 C20140704_OR005_01 TB413189.[MT7]-QSPHDEDPQAVTYAK[MT7].4y3_1.heavy 494.251 / 525.315 6554.0 21.90559959411621 32 7 10 5 10 0.5083184679744295 102.51958236548032 0.042999267578125 3 0.7155878611123163 2.256898069115057 6554.0 55.34488888888889 0.0 - - - - - - - 239.66666666666666 13 6 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 487 62 C20140704_OR005_01 C20140704_OR005_01 TB413189.[MT7]-QSPHDEDPQAVTYAK[MT7].4b9_2.heavy 494.251 / 589.763 8081.0 21.90559959411621 32 7 10 5 10 0.5083184679744295 102.51958236548032 0.042999267578125 3 0.7155878611123163 2.256898069115057 8081.0 65.33560264353574 0.0 - - - - - - - 224.66666666666666 16 6 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 489 63 C20140704_OR005_01 C20140704_OR005_01 TB426875.[MT7]-ILQNIK[MT7].2y4_1.heavy 508.839 / 646.4 14604.0 29.9375 48 18 10 10 10 3.5267911777345033 28.354386455122295 0.0 3 0.9829935481302711 9.450136912319584 14604.0 84.029550897144 0.0 - - - - - - - 291.5 29 6 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 491 63 C20140704_OR005_01 C20140704_OR005_01 TB426875.[MT7]-ILQNIK[MT7].2y5_1.heavy 508.839 / 759.484 19437.0 29.9375 48 18 10 10 10 3.5267911777345033 28.354386455122295 0.0 3 0.9829935481302711 9.450136912319584 19437.0 108.58787470767487 0.0 - - - - - - - 198.0 38 13 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 493 63 C20140704_OR005_01 C20140704_OR005_01 TB426875.[MT7]-ILQNIK[MT7].2b4_1.heavy 508.839 / 613.379 9462.0 29.9375 48 18 10 10 10 3.5267911777345033 28.354386455122295 0.0 3 0.9829935481302711 9.450136912319584 9462.0 107.7871844660194 0.0 - - - - - - - 218.75 18 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 495 63 C20140704_OR005_01 C20140704_OR005_01 TB426875.[MT7]-ILQNIK[MT7].2y3_1.heavy 508.839 / 518.342 17483.0 29.9375 48 18 10 10 10 3.5267911777345033 28.354386455122295 0.0 3 0.9829935481302711 9.450136912319584 17483.0 80.92947302166763 0.0 - - - - - - - 205.85714285714286 34 14 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 497 64 C20140704_OR005_01 C20140704_OR005_01 TB412911.[MT7]-YRVVYTDHQR.2b8_1.heavy 740.893 / 1178.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDX1;CDX2;CDX4 caudal type homeobox 1;caudal type homeobox 2;caudal type homeobox 4 499 64 C20140704_OR005_01 C20140704_OR005_01 TB412911.[MT7]-YRVVYTDHQR.2y8_1.heavy 740.893 / 1017.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDX1;CDX2;CDX4 caudal type homeobox 1;caudal type homeobox 2;caudal type homeobox 4 501 64 C20140704_OR005_01 C20140704_OR005_01 TB412911.[MT7]-YRVVYTDHQR.2b7_1.heavy 740.893 / 1041.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDX1;CDX2;CDX4 caudal type homeobox 1;caudal type homeobox 2;caudal type homeobox 4 503 64 C20140704_OR005_01 C20140704_OR005_01 TB412911.[MT7]-YRVVYTDHQR.2y7_1.heavy 740.893 / 918.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDX1;CDX2;CDX4 caudal type homeobox 1;caudal type homeobox 2;caudal type homeobox 4 505 65 C20140704_OR005_01 C20140704_OR005_01 TB450542.[MT7]-VNLVSGHVK[MT7].3b4_1.heavy 414.259 / 570.373 10115.0 25.03339958190918 50 20 10 10 10 25.699951506453502 3.891057925727566 0.0 3 0.9939767925607049 15.893891033849112 10115.0 97.55917500000001 0.0 - - - - - - - 225.0 20 4 DCAF7 DDB1 and CUL4 associated factor 7 507 65 C20140704_OR005_01 C20140704_OR005_01 TB450542.[MT7]-VNLVSGHVK[MT7].3y4_1.heavy 414.259 / 584.364 5909.0 25.03339958190918 50 20 10 10 10 25.699951506453502 3.891057925727566 0.0 3 0.9939767925607049 15.893891033849112 5909.0 12.43011754256247 1.0 - - - - - - - 264.5 11 14 DCAF7 DDB1 and CUL4 associated factor 7 509 65 C20140704_OR005_01 C20140704_OR005_01 TB450542.[MT7]-VNLVSGHVK[MT7].3b3_1.heavy 414.259 / 471.305 50975.0 25.03339958190918 50 20 10 10 10 25.699951506453502 3.891057925727566 0.0 3 0.9939767925607049 15.893891033849112 50975.0 274.97262468827927 0.0 - - - - - - - 218.27272727272728 101 11 DCAF7 DDB1 and CUL4 associated factor 7 511 65 C20140704_OR005_01 C20140704_OR005_01 TB450542.[MT7]-VNLVSGHVK[MT7].3y5_1.heavy 414.259 / 671.396 15723.0 25.03339958190918 50 20 10 10 10 25.699951506453502 3.891057925727566 0.0 3 0.9939767925607049 15.893891033849112 15723.0 67.81666326698225 0.0 - - - - - - - 267.0 31 3 DCAF7 DDB1 and CUL4 associated factor 7 513 66 C20140704_OR005_01 C20140704_OR005_01 TB426876.[MT7]-VIC[CAM]IPK[MT7].2y4_1.heavy 509.322 / 661.382 6263.0 30.61139965057373 32 20 0 6 6 8.850028392297435 11.29939877786543 0.03719902038574219 5 0.9960351593168947 19.593223949538533 6263.0 4.663839811542991 2.0 - - - - - - - 227.42857142857142 121 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 515 66 C20140704_OR005_01 C20140704_OR005_01 TB426876.[MT7]-VIC[CAM]IPK[MT7].2b3_1.heavy 509.322 / 517.292 7961.0 30.61139965057373 32 20 0 6 6 8.850028392297435 11.29939877786543 0.03719902038574219 5 0.9960351593168947 19.593223949538533 7961.0 18.63626206172868 0.0 - - - - - - - 219.78571428571428 15 14 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 517 66 C20140704_OR005_01 C20140704_OR005_01 TB426876.[MT7]-VIC[CAM]IPK[MT7].2y5_1.heavy 509.322 / 774.466 7324.0 30.61139965057373 32 20 0 6 6 8.850028392297435 11.29939877786543 0.03719902038574219 5 0.9960351593168947 19.593223949538533 7324.0 69.02524528301888 1.0 - - - - - - - 166.57142857142858 240 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 519 66 C20140704_OR005_01 C20140704_OR005_01 TB426876.[MT7]-VIC[CAM]IPK[MT7].2y3_1.heavy 509.322 / 501.352 5520.0 30.61139965057373 32 20 0 6 6 8.850028392297435 11.29939877786543 0.03719902038574219 5 0.9960351593168947 19.593223949538533 5520.0 46.867924528301884 2.0 - - - - - - - 727.8571428571429 18 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 521 67 C20140704_OR005_01 C20140704_OR005_01 TB450900.[MT7]-ESVIISRGESSC[CAM]PVC[CAM]QTR.3y6_1.heavy 737.032 / 760.377 3107.0 25.648300170898438 33 3 10 10 10 0.36892160776089883 126.04473083098775 0.0 3 0.5679386945378995 1.8052695254997018 3107.0 38.080878405315616 0.0 - - - - - - - 166.83333333333334 6 6 TRIM22 tripartite motif-containing 22 523 67 C20140704_OR005_01 C20140704_OR005_01 TB450900.[MT7]-ESVIISRGESSC[CAM]PVC[CAM]QTR.3y17_2.heavy 737.032 / 968.472 13931.0 25.648300170898438 33 3 10 10 10 0.36892160776089883 126.04473083098775 0.0 3 0.5679386945378995 1.8052695254997018 13931.0 34.84861682400167 0.0 - - - - - - - 644.2857142857143 27 7 TRIM22 tripartite motif-containing 22 525 67 C20140704_OR005_01 C20140704_OR005_01 TB450900.[MT7]-ESVIISRGESSC[CAM]PVC[CAM]QTR.3b4_1.heavy 737.032 / 573.336 4209.0 25.648300170898438 33 3 10 10 10 0.36892160776089883 126.04473083098775 0.0 3 0.5679386945378995 1.8052695254997018 4209.0 23.55695808383234 0.0 - - - - - - - 214.71428571428572 8 7 TRIM22 tripartite motif-containing 22 527 67 C20140704_OR005_01 C20140704_OR005_01 TB450900.[MT7]-ESVIISRGESSC[CAM]PVC[CAM]QTR.3y9_1.heavy 737.032 / 1094.47 1704.0 25.648300170898438 33 3 10 10 10 0.36892160776089883 126.04473083098775 0.0 3 0.5679386945378995 1.8052695254997018 1704.0 24.452399999999997 0.0 - - - - - - - 187.875 3 8 TRIM22 tripartite motif-containing 22 529 68 C20140704_OR005_01 C20140704_OR005_01 TB427491.[MT7]-SVFRVPDLSGMLQVLK[MT7].4b11_2.heavy 520.057 / 667.356 9339.0 48.563767751057945 30 5 10 5 10 0.3413038105711084 117.91610314210828 0.04180145263671875 3 0.6192605689232702 1.932821218340013 9339.0 136.06241018912317 0.0 - - - - - - - 195.71428571428572 18 7 TRIM22 tripartite motif-containing 22 531 68 C20140704_OR005_01 C20140704_OR005_01 TB427491.[MT7]-SVFRVPDLSGMLQVLK[MT7].4b10_1.heavy 520.057 / 1202.67 N/A 48.563767751057945 30 5 10 5 10 0.3413038105711084 117.91610314210828 0.04180145263671875 3 0.6192605689232702 1.932821218340013 0.0 0.0 1.0 - - - - - - - 0.0 0 0 TRIM22 tripartite motif-containing 22 533 68 C20140704_OR005_01 C20140704_OR005_01 TB427491.[MT7]-SVFRVPDLSGMLQVLK[MT7].4y3_1.heavy 520.057 / 503.367 13109.0 48.563767751057945 30 5 10 5 10 0.3413038105711084 117.91610314210828 0.04180145263671875 3 0.6192605689232702 1.932821218340013 13109.0 67.92964786381843 0.0 - - - - - - - 220.28571428571428 26 7 TRIM22 tripartite motif-containing 22 535 68 C20140704_OR005_01 C20140704_OR005_01 TB427491.[MT7]-SVFRVPDLSGMLQVLK[MT7].4b10_2.heavy 520.057 / 601.836 1371.0 48.563767751057945 30 5 10 5 10 0.3413038105711084 117.91610314210828 0.04180145263671875 3 0.6192605689232702 1.932821218340013 1371.0 4.530547583124411 0.0 - - - - - - - 257.0 2 2 TRIM22 tripartite motif-containing 22 537 69 C20140704_OR005_01 C20140704_OR005_01 TB427490.[MT7]-GISLLHEVDTQYSALK[MT7].4y4_1.heavy 516.291 / 562.368 2568.0 38.54495048522949 19 8 0 5 6 0.6699309194719493 87.57077424249141 0.040897369384765625 6 0.7504716085743922 2.41728337932201 2568.0 3.5309175656445313 1.0 - - - - - - - 277.25 5 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 539 69 C20140704_OR005_01 C20140704_OR005_01 TB427490.[MT7]-GISLLHEVDTQYSALK[MT7].4b4_1.heavy 516.291 / 515.331 934.0 38.54495048522949 19 8 0 5 6 0.6699309194719493 87.57077424249141 0.040897369384765625 6 0.7504716085743922 2.41728337932201 934.0 1.073909726530407 15.0 - - - - - - - 326.7 41 10 CDR2 cerebellar degeneration-related protein 2, 62kDa 541 69 C20140704_OR005_01 C20140704_OR005_01 TB427490.[MT7]-GISLLHEVDTQYSALK[MT7].4b5_1.heavy 516.291 / 628.415 1167.0 38.54495048522949 19 8 0 5 6 0.6699309194719493 87.57077424249141 0.040897369384765625 6 0.7504716085743922 2.41728337932201 1167.0 5.357575796564685 5.0 - - - - - - - 200.14285714285714 7 7 CDR2 cerebellar degeneration-related protein 2, 62kDa 543 69 C20140704_OR005_01 C20140704_OR005_01 TB427490.[MT7]-GISLLHEVDTQYSALK[MT7].4b9_2.heavy 516.291 / 554.81 2919.0 38.54495048522949 19 8 0 5 6 0.6699309194719493 87.57077424249141 0.040897369384765625 6 0.7504716085743922 2.41728337932201 2919.0 24.053562231759656 0.0 - - - - - - - 233.0 5 2 CDR2 cerebellar degeneration-related protein 2, 62kDa 545 70 C20140704_OR005_01 C20140704_OR005_01 TB426770.[MT7]-EDPASR.2y4_1.heavy 409.71 / 430.241 17923.0 13.78920030593872 46 20 10 6 10 3.4491728292314634 20.126569996354135 0.03800010681152344 3 0.9988488792283264 36.37141984914342 17923.0 188.7895971942496 0.0 - - - - - - - 175.16666666666666 35 12 SDCCAG3 serologically defined colon cancer antigen 3 547 70 C20140704_OR005_01 C20140704_OR005_01 TB426770.[MT7]-EDPASR.2y5_1.heavy 409.71 / 545.268 1220.0 13.78920030593872 46 20 10 6 10 3.4491728292314634 20.126569996354135 0.03800010681152344 3 0.9988488792283264 36.37141984914342 1220.0 6.607884194091092 0.0 - - - - - - - 212.0 2 8 SDCCAG3 serologically defined colon cancer antigen 3 549 70 C20140704_OR005_01 C20140704_OR005_01 TB426770.[MT7]-EDPASR.2b4_1.heavy 409.71 / 557.269 881.0 13.78920030593872 46 20 10 6 10 3.4491728292314634 20.126569996354135 0.03800010681152344 3 0.9988488792283264 36.37141984914342 881.0 14.294656862745097 0.0 - - - - - - - 0.0 1 0 SDCCAG3 serologically defined colon cancer antigen 3 551 70 C20140704_OR005_01 C20140704_OR005_01 TB426770.[MT7]-EDPASR.2b5_1.heavy 409.71 / 644.301 237.0 13.78920030593872 46 20 10 6 10 3.4491728292314634 20.126569996354135 0.03800010681152344 3 0.9988488792283264 36.37141984914342 237.0 0.46699507389162564 8.0 - - - - - - - 0.0 1 0 SDCCAG3 serologically defined colon cancer antigen 3 553 71 C20140704_OR005_01 C20140704_OR005_01 TB427332.[MT7]-K[MT7]PAQQSLGSQVK[MT7].3y7_1.heavy 568.344 / 862.511 4240.0 20.172700881958008 47 17 10 10 10 4.500456510032043 22.219968080368808 0.0 3 0.9745601117729696 7.72111010385365 4240.0 29.968689207966648 0.0 - - - - - - - 180.25 8 8 CDX2 caudal type homeobox 2 555 71 C20140704_OR005_01 C20140704_OR005_01 TB427332.[MT7]-K[MT7]PAQQSLGSQVK[MT7].3b4_1.heavy 568.344 / 713.455 4240.0 20.172700881958008 47 17 10 10 10 4.500456510032043 22.219968080368808 0.0 3 0.9745601117729696 7.72111010385365 4240.0 27.699895989830118 0.0 - - - - - - - 159.25 8 8 CDX2 caudal type homeobox 2 557 71 C20140704_OR005_01 C20140704_OR005_01 TB427332.[MT7]-K[MT7]PAQQSLGSQVK[MT7].3b3_1.heavy 568.344 / 585.396 2798.0 20.172700881958008 47 17 10 10 10 4.500456510032043 22.219968080368808 0.0 3 0.9745601117729696 7.72111010385365 2798.0 39.35600867603678 0.0 - - - - - - - 239.0 5 11 CDX2 caudal type homeobox 2 559 71 C20140704_OR005_01 C20140704_OR005_01 TB427332.[MT7]-K[MT7]PAQQSLGSQVK[MT7].3y5_1.heavy 568.344 / 662.395 19504.0 20.172700881958008 47 17 10 10 10 4.500456510032043 22.219968080368808 0.0 3 0.9745601117729696 7.72111010385365 19504.0 98.59864424609006 0.0 - - - - - - - 254.4 39 10 CDX2 caudal type homeobox 2 561 72 C20140704_OR005_01 C20140704_OR005_01 TB427231.[MT7]-YIVPMLTVDGK[MT7].2b3_1.heavy 762.441 / 520.325 20489.0 41.0047492980957 37 13 10 6 8 1.8187669159159134 54.982306487382395 0.035400390625 4 0.9244259972526165 4.460693032696731 20489.0 7.655861746847268 1.0 - - - - - - - 800.7142857142857 40 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 563 72 C20140704_OR005_01 C20140704_OR005_01 TB427231.[MT7]-YIVPMLTVDGK[MT7].2y8_1.heavy 762.441 / 1004.56 22528.0 41.0047492980957 37 13 10 6 8 1.8187669159159134 54.982306487382395 0.035400390625 4 0.9244259972526165 4.460693032696731 22528.0 68.77707554568997 0.0 - - - - - - - 213.27272727272728 45 11 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 565 72 C20140704_OR005_01 C20140704_OR005_01 TB427231.[MT7]-YIVPMLTVDGK[MT7].2y5_1.heavy 762.441 / 663.379 3364.0 41.0047492980957 37 13 10 6 8 1.8187669159159134 54.982306487382395 0.035400390625 4 0.9244259972526165 4.460693032696731 3364.0 4.278690150792922 1.0 - - - - - - - 597.2857142857143 27 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 567 72 C20140704_OR005_01 C20140704_OR005_01 TB427231.[MT7]-YIVPMLTVDGK[MT7].2y6_1.heavy 762.441 / 776.463 1325.0 41.0047492980957 37 13 10 6 8 1.8187669159159134 54.982306487382395 0.035400390625 4 0.9244259972526165 4.460693032696731 1325.0 4.572549019607843 1.0 - - - - - - - 265.2 4 10 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 569 73 C20140704_OR005_01 C20140704_OR005_01 TB427606.[MT7]-LWC[CAM]TFFQPQMVQPALESSLK[MT7].3b4_1.heavy 900.137 / 705.351 5004.0 49.63182544708252 41 15 10 6 10 4.718993341140901 21.190960183856333 0.035900115966796875 3 0.9574107516993936 5.958800531332856 5004.0 4.638105046343975 0.0 - - - - - - - 224.125 10 8 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 571 73 C20140704_OR005_01 C20140704_OR005_01 TB427606.[MT7]-LWC[CAM]TFFQPQMVQPALESSLK[MT7].3y4_1.heavy 900.137 / 578.363 8888.0 49.63182544708252 41 15 10 6 10 4.718993341140901 21.190960183856333 0.035900115966796875 3 0.9574107516993936 5.958800531332856 8888.0 86.39819891809387 0.0 - - - - - - - 186.71428571428572 17 14 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 573 73 C20140704_OR005_01 C20140704_OR005_01 TB427606.[MT7]-LWC[CAM]TFFQPQMVQPALESSLK[MT7].3y8_1.heavy 900.137 / 988.58 25468.0 49.63182544708252 41 15 10 6 10 4.718993341140901 21.190960183856333 0.035900115966796875 3 0.9574107516993936 5.958800531332856 25468.0 158.17064531548758 0.0 - - - - - - - 248.88888888888889 50 9 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 575 73 C20140704_OR005_01 C20140704_OR005_01 TB427606.[MT7]-LWC[CAM]TFFQPQMVQPALESSLK[MT7].3b7_1.heavy 900.137 / 1127.55 13219.0 49.63182544708252 41 15 10 6 10 4.718993341140901 21.190960183856333 0.035900115966796875 3 0.9574107516993936 5.958800531332856 13219.0 75.04677826893936 0.0 - - - - - - - 276.3 26 10 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 577 74 C20140704_OR005_01 C20140704_OR005_01 TB427605.[MT7]-LWC[CAM]TFFQPQMVQPALESSLK[MT7].4y5_1.heavy 675.355 / 707.406 4490.0 49.63182544708252 40 14 10 6 10 2.6841840753333157 37.25526908492006 0.035900115966796875 3 0.9373171204801907 4.903348952020253 4490.0 68.38426923608233 0.0 - - - - - - - 282.57142857142856 8 7 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 579 74 C20140704_OR005_01 C20140704_OR005_01 TB427605.[MT7]-LWC[CAM]TFFQPQMVQPALESSLK[MT7].4y4_1.heavy 675.355 / 578.363 10426.0 49.63182544708252 40 14 10 6 10 2.6841840753333157 37.25526908492006 0.035900115966796875 3 0.9373171204801907 4.903348952020253 10426.0 48.46754812458215 0.0 - - - - - - - 190.0 20 8 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 581 74 C20140704_OR005_01 C20140704_OR005_01 TB427605.[MT7]-LWC[CAM]TFFQPQMVQPALESSLK[MT7].4b7_1.heavy 675.355 / 1127.55 2740.0 49.63182544708252 40 14 10 6 10 2.6841840753333157 37.25526908492006 0.035900115966796875 3 0.9373171204801907 4.903348952020253 2740.0 35.1921052631579 1.0 - - - - - - - 76.0 5 5 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 583 74 C20140704_OR005_01 C20140704_OR005_01 TB427605.[MT7]-LWC[CAM]TFFQPQMVQPALESSLK[MT7].4b4_1.heavy 675.355 / 705.351 4642.0 49.63182544708252 40 14 10 6 10 2.6841840753333157 37.25526908492006 0.035900115966796875 3 0.9373171204801907 4.903348952020253 4642.0 23.800073419325116 0.0 - - - - - - - 271.7142857142857 9 14 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 585 75 C20140704_OR005_01 C20140704_OR005_01 TB427335.[MT7]-K[MT7]PYC[CAM]NAHYPK[MT7].4b5_2.heavy 428.234 / 476.252 2162.0 19.576099395751953 42 16 10 10 6 3.1441097530889364 31.80550548585488 0.0 5 0.964354213138201 6.517179582844974 2162.0 22.462337662337664 1.0 - - - - - - - 200.6 4 15 NEBL;LASP1 nebulette;LIM and SH3 protein 1 587 75 C20140704_OR005_01 C20140704_OR005_01 TB427335.[MT7]-K[MT7]PYC[CAM]NAHYPK[MT7].4b5_1.heavy 428.234 / 951.496 N/A 19.576099395751953 42 16 10 10 6 3.1441097530889364 31.80550548585488 0.0 5 0.964354213138201 6.517179582844974 0.0 0.0 11.0 - - - - - - - 0.0 0 0 NEBL;LASP1 nebulette;LIM and SH3 protein 1 589 75 C20140704_OR005_01 C20140704_OR005_01 TB427335.[MT7]-K[MT7]PYC[CAM]NAHYPK[MT7].4y3_1.heavy 428.234 / 551.331 772.0 19.576099395751953 42 16 10 10 6 3.1441097530889364 31.80550548585488 0.0 5 0.964354213138201 6.517179582844974 772.0 11.721746529332735 2.0 - - - - - - - 216.0 3 10 NEBL;LASP1 nebulette;LIM and SH3 protein 1 591 75 C20140704_OR005_01 C20140704_OR005_01 TB427335.[MT7]-K[MT7]PYC[CAM]NAHYPK[MT7].4b6_2.heavy 428.234 / 511.77 1467.0 19.576099395751953 42 16 10 10 6 3.1441097530889364 31.80550548585488 0.0 5 0.964354213138201 6.517179582844974 1467.0 22.657637120161393 0.0 - - - - - - - 224.63636363636363 2 11 NEBL;LASP1 nebulette;LIM and SH3 protein 1 593 76 C20140704_OR005_01 C20140704_OR005_01 TB427339.[MT7]-HHPEDVEPALRK[MT7].3y10_2.heavy 572.653 / 649.365 17070.0 19.943299611409504 35 9 10 6 10 1.0257985541207966 80.57722132191722 0.03330039978027344 3 0.8039926735605777 2.7407084836006046 17070.0 167.73039381670958 0.0 - - - - - - - 206.0 34 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 595 76 C20140704_OR005_01 C20140704_OR005_01 TB427339.[MT7]-HHPEDVEPALRK[MT7].3y8_1.heavy 572.653 / 1071.63 1649.0 19.943299611409504 35 9 10 6 10 1.0257985541207966 80.57722132191722 0.03330039978027344 3 0.8039926735605777 2.7407084836006046 1649.0 3.4426562117128157 1.0 - - - - - - - 233.5 3 6 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 597 76 C20140704_OR005_01 C20140704_OR005_01 TB427339.[MT7]-HHPEDVEPALRK[MT7].3y5_1.heavy 572.653 / 728.49 9236.0 19.943299611409504 35 9 10 6 10 1.0257985541207966 80.57722132191722 0.03330039978027344 3 0.8039926735605777 2.7407084836006046 9236.0 110.38146341463415 1.0 - - - - - - - 185.25 18 12 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 599 76 C20140704_OR005_01 C20140704_OR005_01 TB427339.[MT7]-HHPEDVEPALRK[MT7].3y9_1.heavy 572.653 / 1200.67 N/A 19.943299611409504 35 9 10 6 10 1.0257985541207966 80.57722132191722 0.03330039978027344 3 0.8039926735605777 2.7407084836006046 0.0 0.0 4.0 - - - - - - - 0.0 0 0 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 601 77 C20140704_OR005_01 C20140704_OR005_01 TB412515.[MT7]-ISSLNK[MT7].2y4_1.heavy 475.3 / 605.374 2946.0 23.290200233459473 42 20 10 6 6 9.665464815134657 10.346113913054147 0.036800384521484375 5 0.9937417570102539 15.59227210975739 2946.0 17.60448979591837 2.0 - - - - - - - 196.27272727272728 11 11 TRIM22;DAAM1 tripartite motif-containing 22;dishevelled associated activator of morphogenesis 1 603 77 C20140704_OR005_01 C20140704_OR005_01 TB412515.[MT7]-ISSLNK[MT7].2y5_1.heavy 475.3 / 692.406 8445.0 23.290200233459473 42 20 10 6 6 9.665464815134657 10.346113913054147 0.036800384521484375 5 0.9937417570102539 15.59227210975739 8445.0 81.16532170119956 0.0 - - - - - - - 238.42857142857142 16 7 TRIM22;DAAM1 tripartite motif-containing 22;dishevelled associated activator of morphogenesis 1 605 77 C20140704_OR005_01 C20140704_OR005_01 TB412515.[MT7]-ISSLNK[MT7].2b4_1.heavy 475.3 / 545.341 589.0 23.290200233459473 42 20 10 6 6 9.665464815134657 10.346113913054147 0.036800384521484375 5 0.9937417570102539 15.59227210975739 589.0 2.8040816326530615 7.0 - - - - - - - 0.0 1 0 TRIM22;DAAM1 tripartite motif-containing 22;dishevelled associated activator of morphogenesis 1 607 77 C20140704_OR005_01 C20140704_OR005_01 TB412515.[MT7]-ISSLNK[MT7].2y3_1.heavy 475.3 / 518.342 2553.0 23.290200233459473 42 20 10 6 6 9.665464815134657 10.346113913054147 0.036800384521484375 5 0.9937417570102539 15.59227210975739 2553.0 29.58136975314143 0.0 - - - - - - - 163.5 5 6 TRIM22;DAAM1 tripartite motif-containing 22;dishevelled associated activator of morphogenesis 1 609 78 C20140704_OR005_01 C20140704_OR005_01 TB450664.[MT7]-YEELLK[MT7].2b3_1.heavy 541.82 / 566.258 2142.0 32.206050872802734 39 13 10 6 10 1.1998294415772706 57.463708153828726 0.0373992919921875 3 0.9148904542855681 4.199946852386769 2142.0 6.5625 0.0 - - - - - - - 224.4 4 10 CDR2 cerebellar degeneration-related protein 2, 62kDa 611 78 C20140704_OR005_01 C20140704_OR005_01 TB450664.[MT7]-YEELLK[MT7].2y5_1.heavy 541.82 / 775.468 3060.0 32.206050872802734 39 13 10 6 10 1.1998294415772706 57.463708153828726 0.0373992919921875 3 0.9148904542855681 4.199946852386769 3060.0 14.4 0.0 - - - - - - - 229.5 6 12 CDR2 cerebellar degeneration-related protein 2, 62kDa 613 78 C20140704_OR005_01 C20140704_OR005_01 TB450664.[MT7]-YEELLK[MT7].2b4_1.heavy 541.82 / 679.342 1938.0 32.206050872802734 39 13 10 6 10 1.1998294415772706 57.463708153828726 0.0373992919921875 3 0.9148904542855681 4.199946852386769 1938.0 2.1714285714285717 0.0 - - - - - - - 229.5 3 12 CDR2 cerebellar degeneration-related protein 2, 62kDa 615 78 C20140704_OR005_01 C20140704_OR005_01 TB450664.[MT7]-YEELLK[MT7].2y3_1.heavy 541.82 / 517.383 4182.0 32.206050872802734 39 13 10 6 10 1.1998294415772706 57.463708153828726 0.0373992919921875 3 0.9148904542855681 4.199946852386769 4182.0 4.383572755417957 1.0 - - - - - - - 340.0 8 9 CDR2 cerebellar degeneration-related protein 2, 62kDa 617 79 C20140704_OR005_01 C20140704_OR005_01 TB451016.[MT7]-IVNESDVFSWVIR.2y9_1.heavy 854.463 / 1108.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 619 79 C20140704_OR005_01 C20140704_OR005_01 TB451016.[MT7]-IVNESDVFSWVIR.2b6_1.heavy 854.463 / 802.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 621 79 C20140704_OR005_01 C20140704_OR005_01 TB451016.[MT7]-IVNESDVFSWVIR.2y10_1.heavy 854.463 / 1237.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 623 79 C20140704_OR005_01 C20140704_OR005_01 TB451016.[MT7]-IVNESDVFSWVIR.2y7_1.heavy 854.463 / 906.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 625 80 C20140704_OR005_01 C20140704_OR005_01 TB427229.[MT7]-EHQASLDVNNPR.3y7_1.heavy 508.594 / 827.437 1866.0 20.016799926757812 41 15 10 6 10 2.253717209026242 36.7596233638925 0.034198760986328125 3 0.9582205494125127 6.0166845432367575 1866.0 6.5059774857544665 0.0 - - - - - - - 183.66666666666666 3 6 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 627 80 C20140704_OR005_01 C20140704_OR005_01 TB427229.[MT7]-EHQASLDVNNPR.3y6_1.heavy 508.594 / 714.353 15179.0 20.016799926757812 41 15 10 6 10 2.253717209026242 36.7596233638925 0.034198760986328125 3 0.9582205494125127 6.0166845432367575 15179.0 112.57056381798002 0.0 - - - - - - - 207.44444444444446 30 9 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 629 80 C20140704_OR005_01 C20140704_OR005_01 TB427229.[MT7]-EHQASLDVNNPR.3y4_1.heavy 508.594 / 500.258 7378.0 20.016799926757812 41 15 10 6 10 2.253717209026242 36.7596233638925 0.034198760986328125 3 0.9582205494125127 6.0166845432367575 7378.0 33.6838419254197 0.0 - - - - - - - 726.8571428571429 14 7 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 631 80 C20140704_OR005_01 C20140704_OR005_01 TB427229.[MT7]-EHQASLDVNNPR.3y5_1.heavy 508.594 / 599.326 5427.0 20.016799926757812 41 15 10 6 10 2.253717209026242 36.7596233638925 0.034198760986328125 3 0.9582205494125127 6.0166845432367575 5427.0 20.610257289879932 0.0 - - - - - - - 273.22222222222223 10 9 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 633 81 C20140704_OR005_01 C20140704_OR005_01 TB427228.[MT7]-EHQASLDVNNPR.2y8_1.heavy 762.388 / 914.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 635 81 C20140704_OR005_01 C20140704_OR005_01 TB427228.[MT7]-EHQASLDVNNPR.2y5_1.heavy 762.388 / 599.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 637 81 C20140704_OR005_01 C20140704_OR005_01 TB427228.[MT7]-EHQASLDVNNPR.2y9_1.heavy 762.388 / 985.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 639 81 C20140704_OR005_01 C20140704_OR005_01 TB427228.[MT7]-EHQASLDVNNPR.2y10_1.heavy 762.388 / 1113.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 641 82 C20140704_OR005_01 C20140704_OR005_01 TB451012.[MT7]-GLEVTAYSPLGSSDR.2y9_1.heavy 848.437 / 981.464 9421.0 35.36269950866699 42 17 10 5 10 3.4720228419673944 28.801653834551328 0.044002532958984375 3 0.9751855127382024 7.818213695126184 9421.0 58.467676404079555 0.0 - - - - - - - 203.375 18 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 643 82 C20140704_OR005_01 C20140704_OR005_01 TB451012.[MT7]-GLEVTAYSPLGSSDR.2b4_1.heavy 848.437 / 543.326 12096.0 35.36269950866699 42 17 10 5 10 3.4720228419673944 28.801653834551328 0.044002532958984375 3 0.9751855127382024 7.818213695126184 12096.0 102.011330472103 0.0 - - - - - - - 203.625 24 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 645 82 C20140704_OR005_01 C20140704_OR005_01 TB451012.[MT7]-GLEVTAYSPLGSSDR.2y10_1.heavy 848.437 / 1052.5 9770.0 35.36269950866699 42 17 10 5 10 3.4720228419673944 28.801653834551328 0.044002532958984375 3 0.9751855127382024 7.818213695126184 9770.0 90.33090527831907 0.0 - - - - - - - 271.5 19 6 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 647 82 C20140704_OR005_01 C20140704_OR005_01 TB451012.[MT7]-GLEVTAYSPLGSSDR.2y11_1.heavy 848.437 / 1153.55 13957.0 35.36269950866699 42 17 10 5 10 3.4720228419673944 28.801653834551328 0.044002532958984375 3 0.9751855127382024 7.818213695126184 13957.0 117.43512999452653 0.0 - - - - - - - 182.71428571428572 27 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 649 83 C20140704_OR005_01 C20140704_OR005_01 TB426880.[MT7]-LAIEAGFR.2y5_1.heavy 510.802 / 579.289 16528.0 34.77299880981445 44 14 10 10 10 1.9257682819482447 44.87081805819331 0.0 3 0.9427461425152974 5.132935508870394 16528.0 78.96810586739491 0.0 - - - - - - - 173.85714285714286 33 7 LOC100508006;AKR1C4;AKR1C1;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 651 83 C20140704_OR005_01 C20140704_OR005_01 TB426880.[MT7]-LAIEAGFR.2b4_1.heavy 510.802 / 571.357 19930.0 34.77299880981445 44 14 10 10 10 1.9257682819482447 44.87081805819331 0.0 3 0.9427461425152974 5.132935508870394 19930.0 46.95442386831276 0.0 - - - - - - - 319.125 39 8 LOC100508006;AKR1C4;AKR1C1;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 653 83 C20140704_OR005_01 C20140704_OR005_01 TB426880.[MT7]-LAIEAGFR.2y6_1.heavy 510.802 / 692.373 13003.0 34.77299880981445 44 14 10 10 10 1.9257682819482447 44.87081805819331 0.0 3 0.9427461425152974 5.132935508870394 13003.0 106.43196296296297 0.0 - - - - - - - 202.66666666666666 26 3 LOC100508006;AKR1C4;AKR1C1;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 655 83 C20140704_OR005_01 C20140704_OR005_01 TB426880.[MT7]-LAIEAGFR.2y7_1.heavy 510.802 / 763.41 33784.0 34.77299880981445 44 14 10 10 10 1.9257682819482447 44.87081805819331 0.0 3 0.9427461425152974 5.132935508870394 33784.0 155.7122633744856 0.0 - - - - - - - 170.4 67 5 LOC100508006;AKR1C4;AKR1C1;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 657 84 C20140704_OR005_01 C20140704_OR005_01 TB413309.[MT7]-NLLQLEAQEHLQLDFWK[MT7].3y6_1.heavy 805.109 / 980.532 2865.0 45.24679946899414 43 13 10 10 10 1.270866636133822 53.47672270142103 0.0 3 0.9084943668065563 4.048272641482183 2865.0 13.380488633773338 1.0 - - - - - - - 204.625 5 8 CPA2 carboxypeptidase A2 (pancreatic) 659 84 C20140704_OR005_01 C20140704_OR005_01 TB413309.[MT7]-NLLQLEAQEHLQLDFWK[MT7].3b6_1.heavy 805.109 / 855.506 1433.0 45.24679946899414 43 13 10 10 10 1.270866636133822 53.47672270142103 0.0 3 0.9084943668065563 4.048272641482183 1433.0 4.574488650294051 1.0 - - - - - - - 235.3 2 10 CPA2 carboxypeptidase A2 (pancreatic) 661 84 C20140704_OR005_01 C20140704_OR005_01 TB413309.[MT7]-NLLQLEAQEHLQLDFWK[MT7].3b4_1.heavy 805.109 / 613.379 1842.0 45.24679946899414 43 13 10 10 10 1.270866636133822 53.47672270142103 0.0 3 0.9084943668065563 4.048272641482183 1842.0 2.5637562950854917 1.0 - - - - - - - 238.75 5 12 CPA2 carboxypeptidase A2 (pancreatic) 663 84 C20140704_OR005_01 C20140704_OR005_01 TB413309.[MT7]-NLLQLEAQEHLQLDFWK[MT7].3b5_1.heavy 805.109 / 726.463 1228.0 45.24679946899414 43 13 10 10 10 1.270866636133822 53.47672270142103 0.0 3 0.9084943668065563 4.048272641482183 1228.0 2.68625 0.0 - - - - - - - 255.66666666666666 2 6 CPA2 carboxypeptidase A2 (pancreatic) 665 85 C20140704_OR005_01 C20140704_OR005_01 TB427616.[MT7]-VELNDGHFMPVLGFGTYAPPEVPR.4y5_1.heavy 697.358 / 597.336 2455.0 44.408724784851074 39 13 10 6 10 4.540350207602974 22.02473276897155 0.039699554443359375 3 0.9244023494240742 4.459986259122606 2455.0 15.339028564613274 0.0 - - - - - - - 187.41666666666666 4 12 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 667 85 C20140704_OR005_01 C20140704_OR005_01 TB427616.[MT7]-VELNDGHFMPVLGFGTYAPPEVPR.4b8_2.heavy 697.358 / 528.765 2250.0 44.408724784851074 39 13 10 6 10 4.540350207602974 22.02473276897155 0.039699554443359375 3 0.9244023494240742 4.459986259122606 2250.0 9.694695093299778 0.0 - - - - - - - 272.8333333333333 4 6 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 669 85 C20140704_OR005_01 C20140704_OR005_01 TB427616.[MT7]-VELNDGHFMPVLGFGTYAPPEVPR.4y6_1.heavy 697.358 / 694.388 3580.0 44.408724784851074 39 13 10 6 10 4.540350207602974 22.02473276897155 0.039699554443359375 3 0.9244023494240742 4.459986259122606 3580.0 18.985293438353654 0.0 - - - - - - - 358.0 7 6 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 671 85 C20140704_OR005_01 C20140704_OR005_01 TB427616.[MT7]-VELNDGHFMPVLGFGTYAPPEVPR.4b6_1.heavy 697.358 / 772.396 716.0 44.408724784851074 39 13 10 6 10 4.540350207602974 22.02473276897155 0.039699554443359375 3 0.9244023494240742 4.459986259122606 716.0 1.6302979264320332 1.0 - - - - - - - 0.0 1 0 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 673 86 C20140704_OR005_01 C20140704_OR005_01 TB426881.[MT7]-YYWEVDVSGK[MT7].3b6_1.heavy 511.932 / 1000.45 972.0 36.793800354003906 43 13 10 10 10 1.305804425029402 53.41159256077857 0.0 3 0.9168217991438392 4.249132774274886 972.0 6.663013698630137 2.0 - - - - - - - 0.0 1 0 TRIM22 tripartite motif-containing 22 675 86 C20140704_OR005_01 C20140704_OR005_01 TB426881.[MT7]-YYWEVDVSGK[MT7].3b4_1.heavy 511.932 / 786.358 1945.0 36.793800354003906 43 13 10 10 10 1.305804425029402 53.41159256077857 0.0 3 0.9168217991438392 4.249132774274886 1945.0 30.801147540983607 0.0 - - - - - - - 139.28571428571428 3 7 TRIM22 tripartite motif-containing 22 677 86 C20140704_OR005_01 C20140704_OR005_01 TB426881.[MT7]-YYWEVDVSGK[MT7].3b3_1.heavy 511.932 / 657.315 2188.0 36.793800354003906 43 13 10 10 10 1.305804425029402 53.41159256077857 0.0 3 0.9168217991438392 4.249132774274886 2188.0 22.631326991837014 0.0 - - - - - - - 260.57142857142856 4 7 TRIM22 tripartite motif-containing 22 679 86 C20140704_OR005_01 C20140704_OR005_01 TB426881.[MT7]-YYWEVDVSGK[MT7].3y5_1.heavy 511.932 / 649.364 2674.0 36.793800354003906 43 13 10 10 10 1.305804425029402 53.41159256077857 0.0 3 0.9168217991438392 4.249132774274886 2674.0 12.600767123287673 0.0 - - - - - - - 234.0 5 13 TRIM22 tripartite motif-containing 22 681 87 C20140704_OR005_01 C20140704_OR005_01 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1040570.0 34.990699768066406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1040570.0 2626.315935053748 0.0 - - - - - - - 270.7857142857143 2081 14 683 87 C20140704_OR005_01 C20140704_OR005_01 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 206995.0 34.990699768066406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 206995.0 853.6972553281868 0.0 - - - - - - - 301.73333333333335 413 15 685 87 C20140704_OR005_01 C20140704_OR005_01 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 296423.0 34.990699768066406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 296423.0 496.40042421205186 0.0 - - - - - - - 333.45454545454544 592 11 687 88 C20140704_OR005_01 C20140704_OR005_01 TB426789.[MT7]-LMWIPDTK[MT7].3y3_1.heavy 431.249 / 507.289 13907.0 39.553001403808594 44 14 10 10 10 1.1440603671664684 52.96046682185502 0.0 3 0.9370673913382813 4.893506301586676 13907.0 99.42855140186916 0.0 - - - - - - - 190.22222222222223 27 9 DCAF7 DDB1 and CUL4 associated factor 7 689 88 C20140704_OR005_01 C20140704_OR005_01 TB426789.[MT7]-LMWIPDTK[MT7].3b4_1.heavy 431.249 / 688.397 2140.0 39.553001403808594 44 14 10 10 10 1.1440603671664684 52.96046682185502 0.0 3 0.9370673913382813 4.893506301586676 2140.0 19.0 0.0 - - - - - - - 214.0 4 7 DCAF7 DDB1 and CUL4 associated factor 7 691 88 C20140704_OR005_01 C20140704_OR005_01 TB426789.[MT7]-LMWIPDTK[MT7].3b3_1.heavy 431.249 / 575.313 16046.0 39.553001403808594 44 14 10 10 10 1.1440603671664684 52.96046682185502 0.0 3 0.9370673913382813 4.893506301586676 16046.0 172.4570093457944 0.0 - - - - - - - 171.2 32 5 DCAF7 DDB1 and CUL4 associated factor 7 693 88 C20140704_OR005_01 C20140704_OR005_01 TB426789.[MT7]-LMWIPDTK[MT7].3y4_1.heavy 431.249 / 604.342 7595.0 39.553001403808594 44 14 10 10 10 1.1440603671664684 52.96046682185502 0.0 3 0.9370673913382813 4.893506301586676 7595.0 137.703738317757 0.0 - - - - - - - 107.0 15 3 DCAF7 DDB1 and CUL4 associated factor 7 695 89 C20140704_OR005_01 C20140704_OR005_01 TB427327.[MT7]-GLEVTAYSPLGSSDR.3y7_1.heavy 565.961 / 731.368 33536.0 35.36269950866699 43 18 10 5 10 6.385093743651519 15.661477186521587 0.044002532958984375 3 0.9829351388142101 9.433903957759163 33536.0 149.03836074753983 0.0 - - - - - - - 295.0 67 10 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 697 89 C20140704_OR005_01 C20140704_OR005_01 TB427327.[MT7]-GLEVTAYSPLGSSDR.3y6_1.heavy 565.961 / 634.315 13144.0 35.36269950866699 43 18 10 5 10 6.385093743651519 15.661477186521587 0.044002532958984375 3 0.9829351388142101 9.433903957759163 13144.0 28.535142469470827 0.0 - - - - - - - 307.1666666666667 26 6 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 699 89 C20140704_OR005_01 C20140704_OR005_01 TB427327.[MT7]-GLEVTAYSPLGSSDR.3b4_1.heavy 565.961 / 543.326 18918.0 35.36269950866699 43 18 10 5 10 6.385093743651519 15.661477186521587 0.044002532958984375 3 0.9829351388142101 9.433903957759163 18918.0 25.29881796093528 0.0 - - - - - - - 257.0 37 11 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 701 89 C20140704_OR005_01 C20140704_OR005_01 TB427327.[MT7]-GLEVTAYSPLGSSDR.3y5_1.heavy 565.961 / 521.231 34519.0 35.36269950866699 43 18 10 5 10 6.385093743651519 15.661477186521587 0.044002532958984375 3 0.9829351388142101 9.433903957759163 34519.0 78.37741148370452 0.0 - - - - - - - 175.71428571428572 69 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 703 90 C20140704_OR005_01 C20140704_OR005_01 TB427088.[MT7]-ENEEMLFNR.2b3_1.heavy 663.317 / 517.237 7355.0 31.4768009185791 41 11 10 10 10 1.0203623877979646 64.94887144171622 0.0 3 0.8659853405790384 3.3328233461884853 7355.0 24.505005329034873 0.0 - - - - - - - 236.88888888888889 14 9 CPA2 carboxypeptidase A2 (pancreatic) 705 90 C20140704_OR005_01 C20140704_OR005_01 TB427088.[MT7]-ENEEMLFNR.2y8_1.heavy 663.317 / 1052.48 20678.0 31.4768009185791 41 11 10 10 10 1.0203623877979646 64.94887144171622 0.0 3 0.8659853405790384 3.3328233461884853 20678.0 101.4756846857411 0.0 - - - - - - - 248.77777777777777 41 9 CPA2 carboxypeptidase A2 (pancreatic) 707 90 C20140704_OR005_01 C20140704_OR005_01 TB427088.[MT7]-ENEEMLFNR.2b4_1.heavy 663.317 / 646.28 7674.0 31.4768009185791 41 11 10 10 10 1.0203623877979646 64.94887144171622 0.0 3 0.8659853405790384 3.3328233461884853 7674.0 13.229914530783761 1.0 - - - - - - - 734.3333333333334 19 9 CPA2 carboxypeptidase A2 (pancreatic) 709 90 C20140704_OR005_01 C20140704_OR005_01 TB427088.[MT7]-ENEEMLFNR.2b5_1.heavy 663.317 / 777.32 7355.0 31.4768009185791 41 11 10 10 10 1.0203623877979646 64.94887144171622 0.0 3 0.8659853405790384 3.3328233461884853 7355.0 130.60280373831773 0.0 - - - - - - - 170.8 14 5 CPA2 carboxypeptidase A2 (pancreatic) 711 91 C20140704_OR005_01 C20140704_OR005_01 TB413164.[MT7]-ENSELEQQLGATGAYR.2b4_1.heavy 955.472 / 604.269 3795.0 31.878600120544434 39 13 10 6 10 1.2177167203011288 54.306303995947374 0.03619956970214844 3 0.909137088775273 4.0627903685936095 3795.0 50.60000000000001 0.0 - - - - - - - 158.0 7 2 CDR2 cerebellar degeneration-related protein 2, 62kDa 713 91 C20140704_OR005_01 C20140704_OR005_01 TB413164.[MT7]-ENSELEQQLGATGAYR.2b6_1.heavy 955.472 / 846.396 3268.0 31.878600120544434 39 13 10 6 10 1.2177167203011288 54.306303995947374 0.03619956970214844 3 0.909137088775273 4.0627903685936095 3268.0 22.845023696682464 0.0 - - - - - - - 316.5 6 2 CDR2 cerebellar degeneration-related protein 2, 62kDa 715 91 C20140704_OR005_01 C20140704_OR005_01 TB413164.[MT7]-ENSELEQQLGATGAYR.2y10_1.heavy 955.472 / 1064.55 4744.0 31.878600120544434 39 13 10 6 10 1.2177167203011288 54.306303995947374 0.03619956970214844 3 0.909137088775273 4.0627903685936095 4744.0 62.25335680433311 0.0 - - - - - - - 195.71428571428572 9 7 CDR2 cerebellar degeneration-related protein 2, 62kDa 717 91 C20140704_OR005_01 C20140704_OR005_01 TB413164.[MT7]-ENSELEQQLGATGAYR.2y11_1.heavy 955.472 / 1193.59 2952.0 31.878600120544434 39 13 10 6 10 1.2177167203011288 54.306303995947374 0.03619956970214844 3 0.909137088775273 4.0627903685936095 2952.0 8.175561570905689 0.0 - - - - - - - 165.42857142857142 5 7 CDR2 cerebellar degeneration-related protein 2, 62kDa 719 92 C20140704_OR005_01 C20140704_OR005_01 TB451201.[MT7]-LEEGEVNVLDNLAAATDQLVQQR.3b6_1.heavy 890.467 / 801.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 721 92 C20140704_OR005_01 C20140704_OR005_01 TB451201.[MT7]-LEEGEVNVLDNLAAATDQLVQQR.3b5_1.heavy 890.467 / 702.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 723 92 C20140704_OR005_01 C20140704_OR005_01 TB451201.[MT7]-LEEGEVNVLDNLAAATDQLVQQR.3b8_1.heavy 890.467 / 1014.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 725 92 C20140704_OR005_01 C20140704_OR005_01 TB451201.[MT7]-LEEGEVNVLDNLAAATDQLVQQR.3b7_1.heavy 890.467 / 915.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 727 93 C20140704_OR005_01 C20140704_OR005_01 TB451200.[MT7]-LWVDPNSPVLLEDPVLC[CAM]ALAK[MT7].4y4_1.heavy 660.12 / 546.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 729 93 C20140704_OR005_01 C20140704_OR005_01 TB451200.[MT7]-LWVDPNSPVLLEDPVLC[CAM]ALAK[MT7].4y5_1.heavy 660.12 / 706.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 731 93 C20140704_OR005_01 C20140704_OR005_01 TB451200.[MT7]-LWVDPNSPVLLEDPVLC[CAM]ALAK[MT7].4b4_1.heavy 660.12 / 658.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 733 93 C20140704_OR005_01 C20140704_OR005_01 TB451200.[MT7]-LWVDPNSPVLLEDPVLC[CAM]ALAK[MT7].4b3_1.heavy 660.12 / 543.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 735 94 C20140704_OR005_01 C20140704_OR005_01 TB412547.[MT7]-SNSLASK[MT7].2y4_1.heavy 497.792 / 562.368 2166.0 17.434924602508545 35 15 6 6 8 4.441229847690284 22.51628567524066 0.03890037536621094 4 0.9596746552051563 6.124956253111219 2166.0 17.059390206344318 2.0 - - - - - - - 176.88888888888889 6 9 RASA4B;RASA4;RASAL1 RAS p21 protein activator 4B;RAS p21 protein activator 4;RAS protein activator like 1 (GAP1 like) 737 94 C20140704_OR005_01 C20140704_OR005_01 TB412547.[MT7]-SNSLASK[MT7].2y5_1.heavy 497.792 / 649.4 1019.0 17.434924602508545 35 15 6 6 8 4.441229847690284 22.51628567524066 0.03890037536621094 4 0.9596746552051563 6.124956253111219 1019.0 14.683228346456692 0.0 - - - - - - - 183.0 2 8 RASA4B;RASA4;RASAL1 RAS p21 protein activator 4B;RAS p21 protein activator 4;RAS protein activator like 1 (GAP1 like) 739 94 C20140704_OR005_01 C20140704_OR005_01 TB412547.[MT7]-SNSLASK[MT7].2y6_1.heavy 497.792 / 763.443 1784.0 17.434924602508545 35 15 6 6 8 4.441229847690284 22.51628567524066 0.03890037536621094 4 0.9596746552051563 6.124956253111219 1784.0 20.98307086614173 0.0 - - - - - - - 165.5 3 10 RASA4B;RASA4;RASAL1 RAS p21 protein activator 4B;RAS p21 protein activator 4;RAS protein activator like 1 (GAP1 like) 741 94 C20140704_OR005_01 C20140704_OR005_01 TB412547.[MT7]-SNSLASK[MT7].2b5_1.heavy 497.792 / 617.338 637.0 17.434924602508545 35 15 6 6 8 4.441229847690284 22.51628567524066 0.03890037536621094 4 0.9596746552051563 6.124956253111219 637.0 6.4671875 5.0 - - - - - - - 140.2 2 10 RASA4B;RASA4;RASAL1 RAS p21 protein activator 4B;RAS p21 protein activator 4;RAS protein activator like 1 (GAP1 like) 743 95 C20140704_OR005_01 C20140704_OR005_01 TB427084.[MT7]-LEDDIRQER.2b8_1.heavy 659.348 / 1143.58 586.0 23.935199737548828 43 18 10 5 10 3.1441187251950407 24.991361877981937 0.04000091552734375 3 0.9890769253105793 11.797603737493821 586.0 0.0 2.0 - - - - - - - 0.0 1 0 TRIM22 tripartite motif-containing 22 745 95 C20140704_OR005_01 C20140704_OR005_01 TB427084.[MT7]-LEDDIRQER.2b3_1.heavy 659.348 / 502.263 1562.0 23.935199737548828 43 18 10 5 10 3.1441187251950407 24.991361877981937 0.04000091552734375 3 0.9890769253105793 11.797603737493821 1562.0 11.644987081120073 0.0 - - - - - - - 239.8181818181818 3 11 TRIM22 tripartite motif-containing 22 747 95 C20140704_OR005_01 C20140704_OR005_01 TB427084.[MT7]-LEDDIRQER.2y5_1.heavy 659.348 / 701.405 1758.0 23.935199737548828 43 18 10 5 10 3.1441187251950407 24.991361877981937 0.04000091552734375 3 0.9890769253105793 11.797603737493821 1758.0 9.851202046035805 0.0 - - - - - - - 195.44444444444446 3 9 TRIM22 tripartite motif-containing 22 749 95 C20140704_OR005_01 C20140704_OR005_01 TB427084.[MT7]-LEDDIRQER.2b4_1.heavy 659.348 / 617.29 2929.0 23.935199737548828 43 18 10 5 10 3.1441187251950407 24.991361877981937 0.04000091552734375 3 0.9890769253105793 11.797603737493821 2929.0 10.596382252559728 0.0 - - - - - - - 284.8333333333333 5 12 TRIM22 tripartite motif-containing 22 751 96 C20140704_OR005_01 C20140704_OR005_01 TB413167.[MT7]-K[MT7]C[CAM]QEEQDSLSHK[MT7].4b8_2.heavy 481.001 / 647.303 4135.0 17.368499755859375 42 16 10 6 10 3.6966423753010313 27.051575415611204 0.037799835205078125 3 0.9681499456069598 6.8968026379470695 4135.0 25.165777953326092 0.0 - - - - - - - 135.8 8 5 CDR2 cerebellar degeneration-related protein 2, 62kDa 753 96 C20140704_OR005_01 C20140704_OR005_01 TB413167.[MT7]-K[MT7]C[CAM]QEEQDSLSHK[MT7].4b7_2.heavy 481.001 / 603.787 7962.0 17.368499755859375 42 16 10 6 10 3.6966423753010313 27.051575415611204 0.037799835205078125 3 0.9681499456069598 6.8968026379470695 7962.0 114.6298590667084 0.0 - - - - - - - 185.125 15 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 755 96 C20140704_OR005_01 C20140704_OR005_01 TB413167.[MT7]-K[MT7]C[CAM]QEEQDSLSHK[MT7].4y3_1.heavy 481.001 / 515.306 5493.0 17.368499755859375 42 16 10 6 10 3.6966423753010313 27.051575415611204 0.037799835205078125 3 0.9681499456069598 6.8968026379470695 5493.0 50.34434574898785 0.0 - - - - - - - 168.27272727272728 10 11 CDR2 cerebellar degeneration-related protein 2, 62kDa 757 96 C20140704_OR005_01 C20140704_OR005_01 TB413167.[MT7]-K[MT7]C[CAM]QEEQDSLSHK[MT7].4b3_1.heavy 481.001 / 705.396 247.0 17.368499755859375 42 16 10 6 10 3.6966423753010313 27.051575415611204 0.037799835205078125 3 0.9681499456069598 6.8968026379470695 247.0 5.392800944138473 7.0 - - - - - - - 0.0 0 0 CDR2 cerebellar degeneration-related protein 2, 62kDa 759 97 C20140704_OR005_01 C20140704_OR005_01 TB426895.[MT7]-ELLEQK[MT7].2b3_1.heavy 524.318 / 500.32 4423.0 25.11240005493164 50 20 10 10 10 58.23527694316096 1.7171722235922808 0.0 3 0.9996800316340843 68.99176687720384 4423.0 18.542144496206838 0.0 - - - - - - - 290.55555555555554 8 9 CNKSR1;DOCK2;FER connector enhancer of kinase suppressor of Ras 1;dedicator of cytokinesis 2;fer (fps/fes related) tyrosine kinase 761 97 C20140704_OR005_01 C20140704_OR005_01 TB426895.[MT7]-ELLEQK[MT7].2y4_1.heavy 524.318 / 661.4 7740.0 25.11240005493164 50 20 10 10 10 58.23527694316096 1.7171722235922808 0.0 3 0.9996800316340843 68.99176687720384 7740.0 49.09701492537314 0.0 - - - - - - - 301.7 15 10 CNKSR1;DOCK2;FER connector enhancer of kinase suppressor of Ras 1;dedicator of cytokinesis 2;fer (fps/fes related) tyrosine kinase 763 97 C20140704_OR005_01 C20140704_OR005_01 TB426895.[MT7]-ELLEQK[MT7].2y5_1.heavy 524.318 / 774.484 7037.0 25.11240005493164 50 20 10 10 10 58.23527694316096 1.7171722235922808 0.0 3 0.9996800316340843 68.99176687720384 7037.0 76.57935553256817 0.0 - - - - - - - 188.75 14 8 CNKSR1;DOCK2;FER connector enhancer of kinase suppressor of Ras 1;dedicator of cytokinesis 2;fer (fps/fes related) tyrosine kinase 765 97 C20140704_OR005_01 C20140704_OR005_01 TB426895.[MT7]-ELLEQK[MT7].2y3_1.heavy 524.318 / 548.316 6132.0 25.11240005493164 50 20 10 10 10 58.23527694316096 1.7171722235922808 0.0 3 0.9996800316340843 68.99176687720384 6132.0 26.40745378475416 0.0 - - - - - - - 279.3333333333333 12 9 CNKSR1;DOCK2;FER connector enhancer of kinase suppressor of Ras 1;dedicator of cytokinesis 2;fer (fps/fes related) tyrosine kinase 767 98 C20140704_OR005_01 C20140704_OR005_01 TB412601.[MT7]-LLDFC[CAM]K[MT7].2y4_1.heavy 542.309 / 713.341 16218.0 35.77840042114258 50 20 10 10 10 10.459911277780595 9.560310536517113 0.0 3 0.9981717351397064 28.85869075744975 16218.0 76.50922666534201 0.0 - - - - - - - 314.1111111111111 32 9 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 769 98 C20140704_OR005_01 C20140704_OR005_01 TB412601.[MT7]-LLDFC[CAM]K[MT7].2y5_1.heavy 542.309 / 826.425 16956.0 35.77840042114258 50 20 10 10 10 10.459911277780595 9.560310536517113 0.0 3 0.9981717351397064 28.85869075744975 16956.0 132.33951219512193 0.0 - - - - - - - 259.6666666666667 33 9 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 771 98 C20140704_OR005_01 C20140704_OR005_01 TB412601.[MT7]-LLDFC[CAM]K[MT7].2b4_1.heavy 542.309 / 633.373 2949.0 35.77840042114258 50 20 10 10 10 10.459911277780595 9.560310536517113 0.0 3 0.9981717351397064 28.85869075744975 2949.0 11.749610709462143 1.0 - - - - - - - 217.6153846153846 5 13 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 773 98 C20140704_OR005_01 C20140704_OR005_01 TB412601.[MT7]-LLDFC[CAM]K[MT7].2y3_1.heavy 542.309 / 598.314 26293.0 35.77840042114258 50 20 10 10 10 10.459911277780595 9.560310536517113 0.0 3 0.9981717351397064 28.85869075744975 26293.0 91.8548293068892 0.0 - - - - - - - 328.0 52 3 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 775 99 C20140704_OR005_01 C20140704_OR005_01 TB450925.[MT7]-ALELEAEVAEMR.3b4_1.heavy 502.265 / 571.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDR2 cerebellar degeneration-related protein 2, 62kDa 777 99 C20140704_OR005_01 C20140704_OR005_01 TB450925.[MT7]-ALELEAEVAEMR.3b5_1.heavy 502.265 / 700.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDR2 cerebellar degeneration-related protein 2, 62kDa 779 99 C20140704_OR005_01 C20140704_OR005_01 TB450925.[MT7]-ALELEAEVAEMR.3y4_1.heavy 502.265 / 506.239 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDR2 cerebellar degeneration-related protein 2, 62kDa 781 99 C20140704_OR005_01 C20140704_OR005_01 TB450925.[MT7]-ALELEAEVAEMR.3y5_1.heavy 502.265 / 605.308 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDR2 cerebellar degeneration-related protein 2, 62kDa 783 100 C20140704_OR005_01 C20140704_OR005_01 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 18215.0 22.587400436401367 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 18215.0 121.52930277485072 0.0 - - - - - - - 222.57142857142858 36 14 785 100 C20140704_OR005_01 C20140704_OR005_01 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 19676.0 22.587400436401367 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 19676.0 161.44410256410256 0.0 - - - - - - - 133.75 39 8 787 100 C20140704_OR005_01 C20140704_OR005_01 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 63996.0 22.587400436401367 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 63996.0 815.2011297839289 0.0 - - - - - - - 231.125 127 8 789 101 C20140704_OR005_01 C20140704_OR005_01 TB426891.[MT7]-SPAQILLR.2b4_1.heavy 521.331 / 528.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 791 101 C20140704_OR005_01 C20140704_OR005_01 TB426891.[MT7]-SPAQILLR.2y6_1.heavy 521.331 / 713.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 793 101 C20140704_OR005_01 C20140704_OR005_01 TB426891.[MT7]-SPAQILLR.2b5_1.heavy 521.331 / 641.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 795 101 C20140704_OR005_01 C20140704_OR005_01 TB426891.[MT7]-SPAQILLR.2y7_1.heavy 521.331 / 810.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 797 102 C20140704_OR005_01 C20140704_OR005_01 TB412939.[MT7]-ALELEAEVAEMR.2y8_1.heavy 752.893 / 934.43 9755.0 39.8287239074707 40 14 10 6 10 2.6723044088609407 37.42088650844408 0.0381011962890625 3 0.9351869505314225 4.82122165663466 9755.0 30.68036529680365 1.0 - - - - - - - 229.0909090909091 19 11 CDR2 cerebellar degeneration-related protein 2, 62kDa 799 102 C20140704_OR005_01 C20140704_OR005_01 TB412939.[MT7]-ALELEAEVAEMR.2y9_1.heavy 752.893 / 1047.51 18634.0 39.8287239074707 40 14 10 6 10 2.6723044088609407 37.42088650844408 0.0381011962890625 3 0.9351869505314225 4.82122165663466 18634.0 37.4494242607043 0.0 - - - - - - - 365.0 37 6 CDR2 cerebellar degeneration-related protein 2, 62kDa 801 102 C20140704_OR005_01 C20140704_OR005_01 TB412939.[MT7]-ALELEAEVAEMR.2y10_1.heavy 752.893 / 1176.56 4713.0 39.8287239074707 40 14 10 6 10 2.6723044088609407 37.42088650844408 0.0381011962890625 3 0.9351869505314225 4.82122165663466 4713.0 5.864875215859779 1.0 - - - - - - - 178.25 10 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 803 102 C20140704_OR005_01 C20140704_OR005_01 TB412939.[MT7]-ALELEAEVAEMR.2y7_1.heavy 752.893 / 805.387 8111.0 39.8287239074707 40 14 10 6 10 2.6723044088609407 37.42088650844408 0.0381011962890625 3 0.9351869505314225 4.82122165663466 8111.0 26.627649391404013 0.0 - - - - - - - 255.83333333333334 16 12 CDR2 cerebellar degeneration-related protein 2, 62kDa 805 103 C20140704_OR005_01 C20140704_OR005_01 TB413173.[MT7]-NADGTIC[CAM]YDSTHYK[MT7].3y7_1.heavy 644.971 / 1057.51 3722.0 25.013599395751953 44 18 10 6 10 3.426972529530593 24.280825112953885 0.039600372314453125 3 0.9819742173763016 9.178268608422453 3722.0 23.275651571687018 0.0 - - - - - - - 176.25 7 4 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 807 103 C20140704_OR005_01 C20140704_OR005_01 TB413173.[MT7]-NADGTIC[CAM]YDSTHYK[MT7].3y3_1.heavy 644.971 / 591.337 5532.0 25.013599395751953 44 18 10 6 10 3.426972529530593 24.280825112953885 0.039600372314453125 3 0.9819742173763016 9.178268608422453 5532.0 27.740117967690544 0.0 - - - - - - - 213.875 11 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 809 103 C20140704_OR005_01 C20140704_OR005_01 TB413173.[MT7]-NADGTIC[CAM]YDSTHYK[MT7].3b4_1.heavy 644.971 / 502.238 3722.0 25.013599395751953 44 18 10 6 10 3.426972529530593 24.280825112953885 0.039600372314453125 3 0.9819742173763016 9.178268608422453 3722.0 11.412760653470482 0.0 - - - - - - - 239.125 7 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 811 103 C20140704_OR005_01 C20140704_OR005_01 TB413173.[MT7]-NADGTIC[CAM]YDSTHYK[MT7].3b5_1.heavy 644.971 / 603.286 5331.0 25.013599395751953 44 18 10 6 10 3.426972529530593 24.280825112953885 0.039600372314453125 3 0.9819742173763016 9.178268608422453 5331.0 60.49467858726171 0.0 - - - - - - - 287.2857142857143 10 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 813 104 C20140704_OR005_01 C20140704_OR005_01 TB412536.[MT7]-FSLTTLR.2y4_1.heavy 491.296 / 490.298 2930.0 35.3406982421875 43 13 10 10 10 2.7232400021892675 28.737233114522386 0.0 3 0.9089984449994063 4.05964576436787 2930.0 22.86845791255836 1.0 - - - - - - - 231.8 5 10 CYP2C8;CYP2E1 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily E, polypeptide 1 815 104 C20140704_OR005_01 C20140704_OR005_01 TB412536.[MT7]-FSLTTLR.2y5_2.heavy 491.296 / 302.195 488.0 35.3406982421875 43 13 10 10 10 2.7232400021892675 28.737233114522386 0.0 3 0.9089984449994063 4.05964576436787 488.0 3.5199999999999996 15.0 - - - - - - - 366.0 2 5 CYP2C8;CYP2E1 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily E, polypeptide 1 817 104 C20140704_OR005_01 C20140704_OR005_01 TB412536.[MT7]-FSLTTLR.2y5_1.heavy 491.296 / 603.382 1953.0 35.3406982421875 43 13 10 10 10 2.7232400021892675 28.737233114522386 0.0 3 0.9089984449994063 4.05964576436787 1953.0 6.225571682155164 2.0 - - - - - - - 305.0 4 4 CYP2C8;CYP2E1 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily E, polypeptide 1 819 104 C20140704_OR005_01 C20140704_OR005_01 TB412536.[MT7]-FSLTTLR.2b4_1.heavy 491.296 / 593.341 1099.0 35.3406982421875 43 13 10 10 10 2.7232400021892675 28.737233114522386 0.0 3 0.9089984449994063 4.05964576436787 1099.0 4.931987704918033 0.0 - - - - - - - 261.42857142857144 2 7 CYP2C8;CYP2E1 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily E, polypeptide 1 821 105 C20140704_OR005_01 C20140704_OR005_01 TB427632.[MT7]-TLADLQLEYLDLYLMHWPYAFER.3b4_1.heavy 1015.52 / 545.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 823 105 C20140704_OR005_01 C20140704_OR005_01 TB427632.[MT7]-TLADLQLEYLDLYLMHWPYAFER.3b5_1.heavy 1015.52 / 658.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 825 105 C20140704_OR005_01 C20140704_OR005_01 TB427632.[MT7]-TLADLQLEYLDLYLMHWPYAFER.3y8_1.heavy 1015.52 / 1105.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 827 105 C20140704_OR005_01 C20140704_OR005_01 TB427632.[MT7]-TLADLQLEYLDLYLMHWPYAFER.3b8_1.heavy 1015.52 / 1028.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 829 106 C20140704_OR005_01 C20140704_OR005_01 TB413177.[MT7]-GSSVEMLQDVIDVMK[MT7].3b6_1.heavy 647.009 / 735.346 29750.0 49.448073387145996 44 18 10 6 10 4.98561418946464 20.05770928109824 0.036899566650390625 3 0.9891241931883881 11.823259773136488 29750.0 97.5904471276792 0.0 - - - - - - - 238.625 59 8 TRIM22 tripartite motif-containing 22 831 106 C20140704_OR005_01 C20140704_OR005_01 TB413177.[MT7]-GSSVEMLQDVIDVMK[MT7].3b5_1.heavy 647.009 / 604.306 42464.0 49.448073387145996 44 18 10 6 10 4.98561418946464 20.05770928109824 0.036899566650390625 3 0.9891241931883881 11.823259773136488 42464.0 169.0776631251483 0.0 - - - - - - - 196.1818181818182 84 11 TRIM22 tripartite motif-containing 22 833 106 C20140704_OR005_01 C20140704_OR005_01 TB413177.[MT7]-GSSVEMLQDVIDVMK[MT7].3y4_1.heavy 647.009 / 636.351 24182.0 49.448073387145996 44 18 10 6 10 4.98561418946464 20.05770928109824 0.036899566650390625 3 0.9891241931883881 11.823259773136488 24182.0 68.69548192771084 1.0 - - - - - - - 230.55555555555554 48 9 TRIM22 tripartite motif-containing 22 835 106 C20140704_OR005_01 C20140704_OR005_01 TB413177.[MT7]-GSSVEMLQDVIDVMK[MT7].3y5_1.heavy 647.009 / 749.435 14958.0 49.448073387145996 44 18 10 6 10 4.98561418946464 20.05770928109824 0.036899566650390625 3 0.9891241931883881 11.823259773136488 14958.0 77.3866585741462 0.0 - - - - - - - 234.0 29 11 TRIM22 tripartite motif-containing 22 837 107 C20140704_OR005_01 C20140704_OR005_01 TB413073.[MT7]-IVNESDVFSWVIR.3y6_1.heavy 569.978 / 807.451 16529.0 47.8302001953125 39 14 10 5 10 1.835916913875247 38.01531024846739 0.0446014404296875 3 0.9494219622578217 5.464289337860939 16529.0 68.65363411400348 0.0 - - - - - - - 207.42857142857142 33 7 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 839 107 C20140704_OR005_01 C20140704_OR005_01 TB413073.[MT7]-IVNESDVFSWVIR.3b6_1.heavy 569.978 / 802.406 17619.0 47.8302001953125 39 14 10 5 10 1.835916913875247 38.01531024846739 0.0446014404296875 3 0.9494219622578217 5.464289337860939 17619.0 83.1521179597335 0.0 - - - - - - - 231.0909090909091 35 11 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 841 107 C20140704_OR005_01 C20140704_OR005_01 TB413073.[MT7]-IVNESDVFSWVIR.3y4_1.heavy 569.978 / 573.351 15802.0 47.8302001953125 39 14 10 5 10 1.835916913875247 38.01531024846739 0.0446014404296875 3 0.9494219622578217 5.464289337860939 15802.0 167.48383516483517 0.0 - - - - - - - 246.57142857142858 31 7 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 843 107 C20140704_OR005_01 C20140704_OR005_01 TB413073.[MT7]-IVNESDVFSWVIR.3y5_1.heavy 569.978 / 660.383 25610.0 47.8302001953125 39 14 10 5 10 1.835916913875247 38.01531024846739 0.0446014404296875 3 0.9494219622578217 5.464289337860939 25610.0 176.4453866317169 0.0 - - - - - - - 249.75 51 8 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 845 108 C20140704_OR005_01 C20140704_OR005_01 TB450783.[MT7]-QMNEQHAK[MT7].3y3_1.heavy 425.224 / 499.311 4201.0 14.331149578094482 39 13 10 6 10 1.5465434916180345 43.488888254863454 0.03789997100830078 3 0.9228584673390112 4.4145460118202395 4201.0 37.02739988503545 0.0 - - - - - - - 112.9375 8 16 CDR2 cerebellar degeneration-related protein 2, 62kDa 847 108 C20140704_OR005_01 C20140704_OR005_01 TB450783.[MT7]-QMNEQHAK[MT7].3b4_1.heavy 425.224 / 647.294 2630.0 14.331149578094482 39 13 10 6 10 1.5465434916180345 43.488888254863454 0.03789997100830078 3 0.9228584673390112 4.4145460118202395 2630.0 50.279411764705884 0.0 - - - - - - - 123.625 5 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 849 108 C20140704_OR005_01 C20140704_OR005_01 TB450783.[MT7]-QMNEQHAK[MT7].3b5_1.heavy 425.224 / 775.352 786.0 14.331149578094482 39 13 10 6 10 1.5465434916180345 43.488888254863454 0.03789997100830078 3 0.9228584673390112 4.4145460118202395 786.0 30.823529411764707 0.0 - - - - - - - 0.0 1 0 CDR2 cerebellar degeneration-related protein 2, 62kDa 851 108 C20140704_OR005_01 C20140704_OR005_01 TB450783.[MT7]-QMNEQHAK[MT7].3b3_1.heavy 425.224 / 518.251 2493.0 14.331149578094482 39 13 10 6 10 1.5465434916180345 43.488888254863454 0.03789997100830078 3 0.9228584673390112 4.4145460118202395 2493.0 74.75140866873065 0.0 - - - - - - - 158.27272727272728 4 11 CDR2 cerebellar degeneration-related protein 2, 62kDa 853 109 C20140704_OR005_01 C20140704_OR005_01 TB413071.[MT7]-K[MT7]PAQQSLGSQVK[MT7].4y5_1.heavy 426.51 / 662.395 1102.0 20.172700881958008 48 20 10 10 8 5.271250137115348 18.970831851801336 0.0 4 0.9912257901812938 13.165589225213823 1102.0 1.3646963878221183 3.0 - - - - - - - 215.8181818181818 2 11 CDX2 caudal type homeobox 2 855 109 C20140704_OR005_01 C20140704_OR005_01 TB413071.[MT7]-K[MT7]PAQQSLGSQVK[MT7].4b3_1.heavy 426.51 / 585.396 1356.0 20.172700881958008 48 20 10 10 8 5.271250137115348 18.970831851801336 0.0 4 0.9912257901812938 13.165589225213823 1356.0 8.774117647058823 1.0 - - - - - - - 185.625 2 16 CDX2 caudal type homeobox 2 857 109 C20140704_OR005_01 C20140704_OR005_01 TB413071.[MT7]-K[MT7]PAQQSLGSQVK[MT7].4b4_1.heavy 426.51 / 713.455 N/A 20.172700881958008 48 20 10 10 8 5.271250137115348 18.970831851801336 0.0 4 0.9912257901812938 13.165589225213823 339.0 0.0 9.0 - - - - - - - 0.0 1 0 CDX2 caudal type homeobox 2 859 109 C20140704_OR005_01 C20140704_OR005_01 TB413071.[MT7]-K[MT7]PAQQSLGSQVK[MT7].4b6_2.heavy 426.51 / 464.776 5764.0 20.172700881958008 48 20 10 10 8 5.271250137115348 18.970831851801336 0.0 4 0.9912257901812938 13.165589225213823 5764.0 57.271167990131836 0.0 - - - - - - - 238.9090909090909 11 11 CDX2 caudal type homeobox 2 861 110 C20140704_OR005_01 C20140704_OR005_01 TB427202.[MT7]-QDASTLISDLQR.3y6_1.heavy 497.603 / 731.405 4637.0 36.41059875488281 50 20 10 10 10 4.19733431609657 23.824644993491447 0.0 3 0.9902273904584838 12.473914940146356 4637.0 68.22471311475411 0.0 - - - - - - - 183.0 9 6 TRIM22 tripartite motif-containing 22 863 110 C20140704_OR005_01 C20140704_OR005_01 TB427202.[MT7]-QDASTLISDLQR.3b4_1.heavy 497.603 / 546.264 3416.0 36.41059875488281 50 20 10 10 10 4.19733431609657 23.824644993491447 0.0 3 0.9902273904584838 12.473914940146356 3416.0 21.0 1.0 - - - - - - - 244.0 6 11 TRIM22 tripartite motif-containing 22 865 110 C20140704_OR005_01 C20140704_OR005_01 TB427202.[MT7]-QDASTLISDLQR.3b5_1.heavy 497.603 / 647.312 4149.0 36.41059875488281 50 20 10 10 10 4.19733431609657 23.824644993491447 0.0 3 0.9902273904584838 12.473914940146356 4149.0 18.704508196721314 0.0 - - - - - - - 264.3333333333333 8 6 TRIM22 tripartite motif-containing 22 867 110 C20140704_OR005_01 C20140704_OR005_01 TB427202.[MT7]-QDASTLISDLQR.3y5_1.heavy 497.603 / 618.321 10615.0 36.41059875488281 50 20 10 10 10 4.19733431609657 23.824644993491447 0.0 3 0.9902273904584838 12.473914940146356 10615.0 40.60382513661202 0.0 - - - - - - - 341.6 21 5 TRIM22 tripartite motif-containing 22 869 111 C20140704_OR005_01 C20140704_OR005_01 TB412809.[MT7]-K[MT7]VDELIAK[MT7].3y3_1.heavy 449.957 / 475.336 28464.0 27.037400245666504 39 13 10 6 10 2.29871929724881 43.50248423967363 0.03759956359863281 3 0.9098953146680152 4.080115316414905 28464.0 40.814185256789635 0.0 - - - - - - - 205.71428571428572 56 7 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 871 111 C20140704_OR005_01 C20140704_OR005_01 TB412809.[MT7]-K[MT7]VDELIAK[MT7].3b4_1.heavy 449.957 / 760.444 7912.0 27.037400245666504 39 13 10 6 10 2.29871929724881 43.50248423967363 0.03759956359863281 3 0.9098953146680152 4.080115316414905 7912.0 93.56730115985167 0.0 - - - - - - - 188.5 15 6 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 873 111 C20140704_OR005_01 C20140704_OR005_01 TB412809.[MT7]-K[MT7]VDELIAK[MT7].3b5_1.heavy 449.957 / 873.528 1541.0 27.037400245666504 39 13 10 6 10 2.29871929724881 43.50248423967363 0.03759956359863281 3 0.9098953146680152 4.080115316414905 1541.0 15.563686675985041 0.0 - - - - - - - 161.71428571428572 3 7 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 875 111 C20140704_OR005_01 C20140704_OR005_01 TB412809.[MT7]-K[MT7]VDELIAK[MT7].3b3_1.heavy 449.957 / 631.402 10995.0 27.037400245666504 39 13 10 6 10 2.29871929724881 43.50248423967363 0.03759956359863281 3 0.9098953146680152 4.080115316414905 10995.0 82.30653763712016 0.0 - - - - - - - 226.2 21 10 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 877 112 C20140704_OR005_01 C20140704_OR005_01 TB450915.[MT7]-QDASTLISDLQR.2y9_1.heavy 745.9 / 1032.57 4515.0 36.41059875488281 40 10 10 10 10 2.6739207444316357 29.593086717286027 0.0 3 0.8413708053084245 3.0567165457912058 4515.0 27.599008592200924 0.0 - - - - - - - 249.6 9 10 TRIM22 tripartite motif-containing 22 879 112 C20140704_OR005_01 C20140704_OR005_01 TB450915.[MT7]-QDASTLISDLQR.2y6_1.heavy 745.9 / 731.405 2376.0 36.41059875488281 40 10 10 10 10 2.6739207444316357 29.593086717286027 0.0 3 0.8413708053084245 3.0567165457912058 2376.0 22.770087571870853 0.0 - - - - - - - 248.54545454545453 4 11 TRIM22 tripartite motif-containing 22 881 112 C20140704_OR005_01 C20140704_OR005_01 TB450915.[MT7]-QDASTLISDLQR.2y10_1.heavy 745.9 / 1103.61 4158.0 36.41059875488281 40 10 10 10 10 2.6739207444316357 29.593086717286027 0.0 3 0.8413708053084245 3.0567165457912058 4158.0 41.489702577660275 0.0 - - - - - - - 222.875 8 8 TRIM22 tripartite motif-containing 22 883 112 C20140704_OR005_01 C20140704_OR005_01 TB450915.[MT7]-QDASTLISDLQR.2y11_1.heavy 745.9 / 1218.63 1188.0 36.41059875488281 40 10 10 10 10 2.6739207444316357 29.593086717286027 0.0 3 0.8413708053084245 3.0567165457912058 1188.0 4.824976722806935 1.0 - - - - - - - 178.5 2 4 TRIM22 tripartite motif-containing 22 885 113 C20140704_OR005_01 C20140704_OR005_01 TB427340.[MT7]-HHPEDVEPALRK[MT7].4y5_1.heavy 429.741 / 728.49 5757.0 19.940524578094482 37 11 10 6 10 1.0182036072752076 66.68457368267433 0.03330039978027344 3 0.8594881280855958 3.253001378909837 5757.0 33.58435169293182 0.0 - - - - - - - 246.5 11 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 887 113 C20140704_OR005_01 C20140704_OR005_01 TB427340.[MT7]-HHPEDVEPALRK[MT7].4b8_2.heavy 429.741 / 543.26 2303.0 19.940524578094482 37 11 10 6 10 1.0182036072752076 66.68457368267433 0.03330039978027344 3 0.8594881280855958 3.253001378909837 2303.0 0.9342799188640972 0.0 - - - - - - - 171.08333333333334 4 12 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 889 113 C20140704_OR005_01 C20140704_OR005_01 TB427340.[MT7]-HHPEDVEPALRK[MT7].4y8_2.heavy 429.741 / 536.318 10774.0 19.940524578094482 37 11 10 6 10 1.0182036072752076 66.68457368267433 0.03330039978027344 3 0.8594881280855958 3.253001378909837 10774.0 0.9356491532783325 1.0 - - - - - - - 219.22222222222223 21 9 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 891 113 C20140704_OR005_01 C20140704_OR005_01 TB427340.[MT7]-HHPEDVEPALRK[MT7].4y9_2.heavy 429.741 / 600.839 8718.0 19.940524578094482 37 11 10 6 10 1.0182036072752076 66.68457368267433 0.03330039978027344 3 0.8594881280855958 3.253001378909837 8718.0 4.238897893030794 1.0 - - - - - - - 292.1111111111111 17 9 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 893 114 C20140704_OR005_01 C20140704_OR005_01 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 106163.0 32.31050109863281 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 106163.0 981.310259146032 0.0 - - - - - - - 188.7 212 10 895 114 C20140704_OR005_01 C20140704_OR005_01 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 87415.0 32.31050109863281 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 87415.0 281.7281791547645 0.0 - - - - - - - 222.0 174 9 897 114 C20140704_OR005_01 C20140704_OR005_01 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 182263.0 32.31050109863281 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 182263.0 1594.2625761778988 0.0 - - - - - - - 237.85714285714286 364 7 899 115 C20140704_OR005_01 C20140704_OR005_01 TB426764.[MT7]-AVQTSR.2y4_1.heavy 403.236 / 491.257 1589.0 13.85569953918457 46 18 10 10 8 2.8149732472249442 29.029993925578445 0.0 4 0.981352120869071 9.023404753320992 1589.0 43.135340209916755 2.0 - - - - - - - 151.6 3 10 CDR2 cerebellar degeneration-related protein 2, 62kDa 901 115 C20140704_OR005_01 C20140704_OR005_01 TB426764.[MT7]-AVQTSR.2b3_1.heavy 403.236 / 443.273 1011.0 13.85569953918457 46 18 10 10 8 2.8149732472249442 29.029993925578445 0.0 4 0.981352120869071 9.023404753320992 1011.0 12.169444444444444 0.0 - - - - - - - 123.57142857142857 2 7 CDR2 cerebellar degeneration-related protein 2, 62kDa 903 115 C20140704_OR005_01 C20140704_OR005_01 TB426764.[MT7]-AVQTSR.2y5_1.heavy 403.236 / 590.326 4549.0 13.85569953918457 46 18 10 10 8 2.8149732472249442 29.029993925578445 0.0 4 0.981352120869071 9.023404753320992 4549.0 32.267011227945105 0.0 - - - - - - - 121.45454545454545 9 11 CDR2 cerebellar degeneration-related protein 2, 62kDa 905 115 C20140704_OR005_01 C20140704_OR005_01 TB426764.[MT7]-AVQTSR.2y3_1.heavy 403.236 / 363.199 867.0 13.85569953918457 46 18 10 10 8 2.8149732472249442 29.029993925578445 0.0 4 0.981352120869071 9.023404753320992 867.0 11.439583333333333 3.0 - - - - - - - 141.25 2 12 CDR2 cerebellar degeneration-related protein 2, 62kDa 907 116 C20140704_OR005_01 C20140704_OR005_01 TB450681.[MT7]-ALEALVAK[MT7].2y4_1.heavy 551.857 / 574.404 15801.0 33.55379867553711 50 20 10 10 10 6.086569627702727 16.429615714055885 0.0 3 0.9915211562527824 13.393272839137726 15801.0 32.9075414115739 0.0 - - - - - - - 216.33333333333334 31 12 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 909 116 C20140704_OR005_01 C20140704_OR005_01 TB450681.[MT7]-ALEALVAK[MT7].2y5_1.heavy 551.857 / 645.442 17208.0 33.55379867553711 50 20 10 10 10 6.086569627702727 16.429615714055885 0.0 3 0.9915211562527824 13.393272839137726 17208.0 105.08640492686683 0.0 - - - - - - - 225.25 34 12 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 911 116 C20140704_OR005_01 C20140704_OR005_01 TB450681.[MT7]-ALEALVAK[MT7].2b4_1.heavy 551.857 / 529.31 28572.0 33.55379867553711 50 20 10 10 10 6.086569627702727 16.429615714055885 0.0 3 0.9915211562527824 13.393272839137726 28572.0 81.18613055115623 0.0 - - - - - - - 618.4285714285714 57 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 913 116 C20140704_OR005_01 C20140704_OR005_01 TB450681.[MT7]-ALEALVAK[MT7].2b5_1.heavy 551.857 / 642.394 15152.0 33.55379867553711 50 20 10 10 10 6.086569627702727 16.429615714055885 0.0 3 0.9915211562527824 13.393272839137726 15152.0 31.999182491010707 1.0 - - - - - - - 265.54545454545456 31 11 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 915 117 C20140704_OR005_01 C20140704_OR005_01 TB412858.[MT7]-YGRSPAQILLR.3y7_1.heavy 473.285 / 810.52 889.0 32.58799934387207 36 11 10 5 10 2.0668859023413613 34.615960256737225 0.043598175048828125 3 0.8619482081842497 3.2825669472622634 889.0 7.568738738738738 3.0 - - - - - - - 0.0 1 0 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 917 117 C20140704_OR005_01 C20140704_OR005_01 TB412858.[MT7]-YGRSPAQILLR.3y4_1.heavy 473.285 / 514.371 3222.0 32.58799934387207 36 11 10 5 10 2.0668859023413613 34.615960256737225 0.043598175048828125 3 0.8619482081842497 3.2825669472622634 3222.0 10.061309684009144 0.0 - - - - - - - 222.0 6 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 919 117 C20140704_OR005_01 C20140704_OR005_01 TB412858.[MT7]-YGRSPAQILLR.3y5_1.heavy 473.285 / 642.43 2222.0 32.58799934387207 36 11 10 5 10 2.0668859023413613 34.615960256737225 0.043598175048828125 3 0.8619482081842497 3.2825669472622634 2222.0 20.51790553207876 0.0 - - - - - - - 206.14285714285714 4 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 921 117 C20140704_OR005_01 C20140704_OR005_01 TB412858.[MT7]-YGRSPAQILLR.3b8_2.heavy 473.285 / 509.284 3667.0 32.58799934387207 36 11 10 5 10 2.0668859023413613 34.615960256737225 0.043598175048828125 3 0.8619482081842497 3.2825669472622634 3667.0 7.268025173968844 1.0 - - - - - - - 348.85714285714283 7 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 923 118 C20140704_OR005_01 C20140704_OR005_01 TB427367.[MT7]-LALGSFVEEYNNK[MT7].2y4_1.heavy 886.477 / 682.364 7292.0 40.616549491882324 40 14 10 6 10 1.7021123863878884 41.29885871045889 0.034198760986328125 3 0.9388072967005362 4.963324149262435 7292.0 25.300361497143832 0.0 - - - - - - - 192.27272727272728 14 11 DCAF7 DDB1 and CUL4 associated factor 7 925 118 C20140704_OR005_01 C20140704_OR005_01 TB427367.[MT7]-LALGSFVEEYNNK[MT7].2y3_1.heavy 886.477 / 519.301 5918.0 40.616549491882324 40 14 10 6 10 1.7021123863878884 41.29885871045889 0.034198760986328125 3 0.9388072967005362 4.963324149262435 5918.0 13.15111111111111 1.0 - - - - - - - 233.85714285714286 11 14 DCAF7 DDB1 and CUL4 associated factor 7 927 118 C20140704_OR005_01 C20140704_OR005_01 TB427367.[MT7]-LALGSFVEEYNNK[MT7].2y6_1.heavy 886.477 / 940.449 6235.0 40.616549491882324 40 14 10 6 10 1.7021123863878884 41.29885871045889 0.034198760986328125 3 0.9388072967005362 4.963324149262435 6235.0 22.312661550737932 0.0 - - - - - - - 271.7142857142857 12 7 DCAF7 DDB1 and CUL4 associated factor 7 929 118 C20140704_OR005_01 C20140704_OR005_01 TB427367.[MT7]-LALGSFVEEYNNK[MT7].2y7_1.heavy 886.477 / 1039.52 8666.0 40.616549491882324 40 14 10 6 10 1.7021123863878884 41.29885871045889 0.034198760986328125 3 0.9388072967005362 4.963324149262435 8666.0 15.85577287066246 0.0 - - - - - - - 228.91666666666666 17 12 DCAF7 DDB1 and CUL4 associated factor 7 931 119 C20140704_OR005_01 C20140704_OR005_01 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 187942.0 26.52549934387207 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 187942.0 67.0434277852414 0.0 - - - - - - - 153.25 375 4 933 119 C20140704_OR005_01 C20140704_OR005_01 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 222887.0 26.52549934387207 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 222887.0 51.23177950800963 0.0 - - - - - - - 184.2 445 5 935 119 C20140704_OR005_01 C20140704_OR005_01 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 293493.0 26.52549934387207 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 293493.0 51.29913452883474 0.0 - - - - - - - 205.0 586 1 937 120 C20140704_OR005_01 C20140704_OR005_01 TB427442.[MT7]-GIVSLPPSYQIC[CAM]FIPV.3b6_1.heavy 645.357 / 711.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 939 120 C20140704_OR005_01 C20140704_OR005_01 TB427442.[MT7]-GIVSLPPSYQIC[CAM]FIPV.3b4_1.heavy 645.357 / 501.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 941 120 C20140704_OR005_01 C20140704_OR005_01 TB427442.[MT7]-GIVSLPPSYQIC[CAM]FIPV.3b10_1.heavy 645.357 / 1186.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 943 120 C20140704_OR005_01 C20140704_OR005_01 TB427442.[MT7]-GIVSLPPSYQIC[CAM]FIPV.3b5_1.heavy 645.357 / 614.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 945 121 C20140704_OR005_01 C20140704_OR005_01 TB427361.[MT7]-VFDFTFSPEEMK[MT7].2y5_1.heavy 882.941 / 777.393 11121.0 44.05730056762695 39 13 10 6 10 1.8669056005859228 53.5645722893623 0.037200927734375 3 0.9243585281782785 4.458677425667251 11121.0 37.106343137254896 0.0 - - - - - - - 229.5 22 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 947 121 C20140704_OR005_01 C20140704_OR005_01 TB427361.[MT7]-VFDFTFSPEEMK[MT7].2y3_1.heavy 882.941 / 551.298 3367.0 44.05730056762695 39 13 10 6 10 1.8669056005859228 53.5645722893623 0.037200927734375 3 0.9243585281782785 4.458677425667251 3367.0 35.86515196078432 0.0 - - - - - - - 204.0 6 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 949 121 C20140704_OR005_01 C20140704_OR005_01 TB427361.[MT7]-VFDFTFSPEEMK[MT7].2y6_1.heavy 882.941 / 864.425 9692.0 44.05730056762695 39 13 10 6 10 1.8669056005859228 53.5645722893623 0.037200927734375 3 0.9243585281782785 4.458677425667251 9692.0 16.153333333333332 0.0 - - - - - - - 242.25 19 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 951 121 C20140704_OR005_01 C20140704_OR005_01 TB427361.[MT7]-VFDFTFSPEEMK[MT7].2y7_1.heavy 882.941 / 1011.49 8774.0 44.05730056762695 39 13 10 6 10 1.8669056005859228 53.5645722893623 0.037200927734375 3 0.9243585281782785 4.458677425667251 8774.0 97.54623529411764 0.0 - - - - - - - 255.0 17 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 953 122 C20140704_OR005_01 C20140704_OR005_01 TB450618.[MT7]-INEVVK[MT7].2y4_1.heavy 495.315 / 618.394 1801.0 24.431400299072266 50 20 10 10 10 13.530333652869425 7.39080074191612 0.0 3 0.9976228662228882 25.307514210051856 1801.0 4.194528143332805 1.0 - - - - - - - 214.28571428571428 9 7 TRIM22 tripartite motif-containing 22 955 122 C20140704_OR005_01 C20140704_OR005_01 TB450618.[MT7]-INEVVK[MT7].2b3_1.heavy 495.315 / 501.279 5603.0 24.431400299072266 50 20 10 10 10 13.530333652869425 7.39080074191612 0.0 3 0.9976228662228882 25.307514210051856 5603.0 21.450171663097784 0.0 - - - - - - - 300.0 11 6 TRIM22 tripartite motif-containing 22 957 122 C20140704_OR005_01 C20140704_OR005_01 TB450618.[MT7]-INEVVK[MT7].2y5_1.heavy 495.315 / 732.437 6804.0 24.431400299072266 50 20 10 10 10 13.530333652869425 7.39080074191612 0.0 3 0.9976228662228882 25.307514210051856 6804.0 40.37535062937064 0.0 - - - - - - - 316.6666666666667 13 6 TRIM22 tripartite motif-containing 22 959 122 C20140704_OR005_01 C20140704_OR005_01 TB450618.[MT7]-INEVVK[MT7].2b4_1.heavy 495.315 / 600.347 3602.0 24.431400299072266 50 20 10 10 10 13.530333652869425 7.39080074191612 0.0 3 0.9976228662228882 25.307514210051856 3602.0 43.10393333333334 0.0 - - - - - - - 190.9090909090909 7 11 TRIM22 tripartite motif-containing 22 961 123 C20140704_OR005_01 C20140704_OR005_01 TB413095.[MT7]-VFDFTFSPEEMK[MT7].3y3_1.heavy 588.963 / 551.298 53912.0 44.05730056762695 43 17 10 6 10 3.431025641897729 24.548574355111015 0.037200927734375 3 0.9766624422197168 8.062809802259203 53912.0 147.34423728813556 0.0 - - - - - - - 235.88888888888889 107 9 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 963 123 C20140704_OR005_01 C20140704_OR005_01 TB413095.[MT7]-VFDFTFSPEEMK[MT7].3b4_1.heavy 588.963 / 653.341 33076.0 44.05730056762695 43 17 10 6 10 3.431025641897729 24.548574355111015 0.037200927734375 3 0.9766624422197168 8.062809802259203 33076.0 78.8591107341572 0.0 - - - - - - - 240.0 66 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 965 123 C20140704_OR005_01 C20140704_OR005_01 TB413095.[MT7]-VFDFTFSPEEMK[MT7].3y4_1.heavy 588.963 / 680.341 30850.0 44.05730056762695 43 17 10 6 10 3.431025641897729 24.548574355111015 0.037200927734375 3 0.9766624422197168 8.062809802259203 30850.0 117.85456708768076 0.0 - - - - - - - 273.0 61 10 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 967 123 C20140704_OR005_01 C20140704_OR005_01 TB413095.[MT7]-VFDFTFSPEEMK[MT7].3y5_1.heavy 588.963 / 777.393 48956.0 44.05730056762695 43 17 10 6 10 3.431025641897729 24.548574355111015 0.037200927734375 3 0.9766624422197168 8.062809802259203 48956.0 117.13662568419542 0.0 - - - - - - - 224.77777777777777 97 9 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 969 124 C20140704_OR005_01 C20140704_OR005_01 TB450617.[MT7]-EDVGPGK[MT7].2y4_1.heavy 495.279 / 502.311 19027.0 17.1749005317688 46 20 10 6 10 13.048670097705864 7.663616234544958 0.03679847717285156 3 0.9963194792194304 20.33641707867621 19027.0 348.5327247401693 0.0 - - - - - - - 173.16666666666666 38 12 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 971 124 C20140704_OR005_01 C20140704_OR005_01 TB450617.[MT7]-EDVGPGK[MT7].2y5_1.heavy 495.279 / 601.379 9605.0 17.1749005317688 46 20 10 6 10 13.048670097705864 7.663616234544958 0.03679847717285156 3 0.9963194792194304 20.33641707867621 9605.0 165.26761066690491 0.0 - - - - - - - 183.53846153846155 19 13 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 973 124 C20140704_OR005_01 C20140704_OR005_01 TB450617.[MT7]-EDVGPGK[MT7].2b4_1.heavy 495.279 / 545.269 5200.0 17.1749005317688 46 20 10 6 10 13.048670097705864 7.663616234544958 0.03679847717285156 3 0.9963194792194304 20.33641707867621 5200.0 48.132992175180746 0.0 - - - - - - - 176.66666666666666 10 9 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 975 124 C20140704_OR005_01 C20140704_OR005_01 TB450617.[MT7]-EDVGPGK[MT7].2y6_1.heavy 495.279 / 716.406 5078.0 17.1749005317688 46 20 10 6 10 13.048670097705864 7.663616234544958 0.03679847717285156 3 0.9963194792194304 20.33641707867621 5078.0 44.15652173913044 0.0 - - - - - - - 116.2 10 10 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 977 125 C20140704_OR005_01 C20140704_OR005_01 TB450758.[MT7]-EELFVTSK[MT7].2y4_1.heavy 620.855 / 578.363 3034.0 30.966999053955078 47 20 9 10 8 6.605235745503752 15.139505061279753 0.0 4 0.9953242055534597 18.041194825890926 3034.0 12.237889583766782 0.0 - - - - - - - 695.375 6 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 979 125 C20140704_OR005_01 C20140704_OR005_01 TB450758.[MT7]-EELFVTSK[MT7].2b3_1.heavy 620.855 / 516.279 4652.0 30.966999053955078 47 20 9 10 8 6.605235745503752 15.139505061279753 0.0 4 0.9953242055534597 18.041194825890926 4652.0 21.072178217821783 0.0 - - - - - - - 277.75 9 16 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 981 125 C20140704_OR005_01 C20140704_OR005_01 TB450758.[MT7]-EELFVTSK[MT7].2y5_1.heavy 620.855 / 725.431 3741.0 30.966999053955078 47 20 9 10 8 6.605235745503752 15.139505061279753 0.0 4 0.9953242055534597 18.041194825890926 3741.0 20.491041562397996 2.0 - - - - - - - 213.22222222222223 11 9 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 983 125 C20140704_OR005_01 C20140704_OR005_01 TB450758.[MT7]-EELFVTSK[MT7].2b4_1.heavy 620.855 / 663.347 2932.0 30.966999053955078 47 20 9 10 8 6.605235745503752 15.139505061279753 0.0 4 0.9953242055534597 18.041194825890926 2932.0 18.86930693069307 0.0 - - - - - - - 664.7142857142857 5 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 985 126 C20140704_OR005_01 C20140704_OR005_01 TB413291.[MT7]-FSTGGDK[MT7]PAIWLDAGIHAR.3b6_1.heavy 767.418 / 709.327 3313.0 36.26922607421875 39 14 10 5 10 1.676508700221577 41.19844211297718 0.0435028076171875 3 0.9347110002882066 4.8034212125309494 3313.0 14.60011380356623 0.0 - - - - - - - 236.07692307692307 6 13 CPA2 carboxypeptidase A2 (pancreatic) 987 126 C20140704_OR005_01 C20140704_OR005_01 TB413291.[MT7]-FSTGGDK[MT7]PAIWLDAGIHAR.3y6_1.heavy 767.418 / 624.358 2454.0 36.26922607421875 39 14 10 5 10 1.676508700221577 41.19844211297718 0.0435028076171875 3 0.9347110002882066 4.8034212125309494 2454.0 12.670108695652175 1.0 - - - - - - - 349.2307692307692 4 13 CPA2 carboxypeptidase A2 (pancreatic) 989 126 C20140704_OR005_01 C20140704_OR005_01 TB413291.[MT7]-FSTGGDK[MT7]PAIWLDAGIHAR.3y8_1.heavy 767.418 / 852.469 859.0 36.26922607421875 39 14 10 5 10 1.676508700221577 41.19844211297718 0.0435028076171875 3 0.9347110002882066 4.8034212125309494 859.0 9.68630462916874 1.0 - - - - - - - 0.0 1 0 CPA2 carboxypeptidase A2 (pancreatic) 991 126 C20140704_OR005_01 C20140704_OR005_01 TB413291.[MT7]-FSTGGDK[MT7]PAIWLDAGIHAR.3y9_1.heavy 767.418 / 1038.55 2331.0 36.26922607421875 39 14 10 5 10 1.676508700221577 41.19844211297718 0.0435028076171875 3 0.9347110002882066 4.8034212125309494 2331.0 0.6858867218631008 1.0 - - - - - - - 245.4 4 5 CPA2 carboxypeptidase A2 (pancreatic) 993 127 C20140704_OR005_01 C20140704_OR005_01 TB413292.[MT7]-FSTGGDK[MT7]PAIWLDAGIHAR.4y7_1.heavy 575.815 / 739.385 18399.0 36.28010177612305 35 15 0 10 10 2.262770759677843 44.193606255649726 0.0 3 0.9593177910108217 6.097848949231574 18399.0 76.02865755839576 0.0 - - - - - - - 224.66666666666666 36 6 CPA2 carboxypeptidase A2 (pancreatic) 995 127 C20140704_OR005_01 C20140704_OR005_01 TB413292.[MT7]-FSTGGDK[MT7]PAIWLDAGIHAR.4y6_1.heavy 575.815 / 624.358 16682.0 36.28010177612305 35 15 0 10 10 2.262770759677843 44.193606255649726 0.0 3 0.9593177910108217 6.097848949231574 16682.0 60.02495084020853 0.0 - - - - - - - 265.8333333333333 33 6 CPA2 carboxypeptidase A2 (pancreatic) 997 127 C20140704_OR005_01 C20140704_OR005_01 TB413292.[MT7]-FSTGGDK[MT7]PAIWLDAGIHAR.4b6_1.heavy 575.815 / 709.327 5397.0 36.28010177612305 35 15 0 10 10 2.262770759677843 44.193606255649726 0.0 3 0.9593177910108217 6.097848949231574 5397.0 10.11334303252269 0.0 - - - - - - - 327.22222222222223 10 9 CPA2 carboxypeptidase A2 (pancreatic) 999 127 C20140704_OR005_01 C20140704_OR005_01 TB413292.[MT7]-FSTGGDK[MT7]PAIWLDAGIHAR.4b9_2.heavy 575.815 / 575.311 N/A 36.28010177612305 35 15 0 10 10 2.262770759677843 44.193606255649726 0.0 3 0.9593177910108217 6.097848949231574 33119.0 7.048885927892351 5.0 - - - - - - - 4171.0 370 2 CPA2 carboxypeptidase A2 (pancreatic) 1001 128 C20140704_OR005_01 C20140704_OR005_01 TB450612.[MT7]-IADGSVK[MT7].2y4_1.heavy 489.297 / 534.337 13397.0 20.840299606323242 50 20 10 10 10 8.030506738359957 12.45251430053873 0.0 3 0.9934990362948661 15.298115673607619 13397.0 186.9348837209302 0.0 - - - - - - - 238.66666666666666 26 9 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1003 128 C20140704_OR005_01 C20140704_OR005_01 TB450612.[MT7]-IADGSVK[MT7].2y5_1.heavy 489.297 / 649.364 3435.0 20.840299606323242 50 20 10 10 10 8.030506738359957 12.45251430053873 0.0 3 0.9934990362948661 15.298115673607619 3435.0 31.287790697674417 0.0 - - - - - - - 164.1818181818182 6 11 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1005 128 C20140704_OR005_01 C20140704_OR005_01 TB450612.[MT7]-IADGSVK[MT7].2y6_1.heavy 489.297 / 720.401 10392.0 20.840299606323242 50 20 10 10 10 8.030506738359957 12.45251430053873 0.0 3 0.9934990362948661 15.298115673607619 10392.0 7.399926704826569 0.0 - - - - - - - 291.8 20 5 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1007 128 C20140704_OR005_01 C20140704_OR005_01 TB450612.[MT7]-IADGSVK[MT7].2b5_1.heavy 489.297 / 588.311 859.0 20.840299606323242 50 20 10 10 10 8.030506738359957 12.45251430053873 0.0 3 0.9934990362948661 15.298115673607619 859.0 0.19076585022852457 3.0 - - - - - - - 172.0 4 8 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1009 129 C20140704_OR005_01 C20140704_OR005_01 TB451233.[MT7]-GQNVGPGPPAQTEAPGTIEFVADPAALATILSGEGVK[MT7].4b7_1.heavy 962.763 / 754.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - TROAP trophinin associated protein (tastin) 1011 129 C20140704_OR005_01 C20140704_OR005_01 TB451233.[MT7]-GQNVGPGPPAQTEAPGTIEFVADPAALATILSGEGVK[MT7].4y9_1.heavy 962.763 / 1047.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - TROAP trophinin associated protein (tastin) 1013 129 C20140704_OR005_01 C20140704_OR005_01 TB451233.[MT7]-GQNVGPGPPAQTEAPGTIEFVADPAALATILSGEGVK[MT7].4b4_1.heavy 962.763 / 543.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - TROAP trophinin associated protein (tastin) 1015 129 C20140704_OR005_01 C20140704_OR005_01 TB451233.[MT7]-GQNVGPGPPAQTEAPGTIEFVADPAALATILSGEGVK[MT7].4b5_1.heavy 962.763 / 600.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - TROAP trophinin associated protein (tastin) 1017 130 C20140704_OR005_01 C20140704_OR005_01 TB427168.[MT7]-VVMNSAQASIK[MT7].3y3_1.heavy 479.278 / 491.331 31855.0 26.757099151611328 43 13 10 10 10 1.7034422268399785 46.64800804537208 0.0 3 0.9259585582683522 4.50721372645669 31855.0 77.46838521400778 0.0 - - - - - - - 257.0 63 8 SDCCAG3 serologically defined colon cancer antigen 3 1019 130 C20140704_OR005_01 C20140704_OR005_01 TB427168.[MT7]-VVMNSAQASIK[MT7].3b4_1.heavy 479.278 / 588.33 12742.0 26.757099151611328 43 13 10 10 10 1.7034422268399785 46.64800804537208 0.0 3 0.9259585582683522 4.50721372645669 12742.0 20.402732068454945 0.0 - - - - - - - 298.1 25 10 SDCCAG3 serologically defined colon cancer antigen 3 1021 130 C20140704_OR005_01 C20140704_OR005_01 TB427168.[MT7]-VVMNSAQASIK[MT7].3b5_1.heavy 479.278 / 675.362 11201.0 26.757099151611328 43 13 10 10 10 1.7034422268399785 46.64800804537208 0.0 3 0.9259585582683522 4.50721372645669 11201.0 24.93653284671533 0.0 - - - - - - - 215.0 22 11 SDCCAG3 serologically defined colon cancer antigen 3 1023 130 C20140704_OR005_01 C20140704_OR005_01 TB427168.[MT7]-VVMNSAQASIK[MT7].3y4_1.heavy 479.278 / 562.368 25689.0 26.757099151611328 43 13 10 10 10 1.7034422268399785 46.64800804537208 0.0 3 0.9259585582683522 4.50721372645669 25689.0 51.48038924706751 0.0 - - - - - - - 719.4285714285714 51 7 SDCCAG3 serologically defined colon cancer antigen 3 1025 131 C20140704_OR005_01 C20140704_OR005_01 TB427645.[MT7]-EESDY[MT7]HDLESVVQQVEQNLELMTK[MT7].4b7_2.heavy 824.665 / 582.756 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG3 serologically defined colon cancer antigen 3 1027 131 C20140704_OR005_01 C20140704_OR005_01 TB427645.[MT7]-EESDY[MT7]HDLESVVQQVEQNLELMTK[MT7].4b12_2.heavy 824.665 / 846.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG3 serologically defined colon cancer antigen 3 1029 131 C20140704_OR005_01 C20140704_OR005_01 TB427645.[MT7]-EESDY[MT7]HDLESVVQQVEQNLELMTK[MT7].4b4_1.heavy 824.665 / 605.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG3 serologically defined colon cancer antigen 3 1031 131 C20140704_OR005_01 C20140704_OR005_01 TB427645.[MT7]-EESDY[MT7]HDLESVVQQVEQNLELMTK[MT7].4y3_1.heavy 824.665 / 523.303 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG3 serologically defined colon cancer antigen 3 1033 132 C20140704_OR005_01 C20140704_OR005_01 TB450822.[MT7]-ARHQAETSQR.3y7_1.heavy 443.236 / 819.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - TROAP trophinin associated protein (tastin) 1035 132 C20140704_OR005_01 C20140704_OR005_01 TB450822.[MT7]-ARHQAETSQR.3y6_1.heavy 443.236 / 691.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - TROAP trophinin associated protein (tastin) 1037 132 C20140704_OR005_01 C20140704_OR005_01 TB450822.[MT7]-ARHQAETSQR.3y4_1.heavy 443.236 / 491.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - TROAP trophinin associated protein (tastin) 1039 132 C20140704_OR005_01 C20140704_OR005_01 TB450822.[MT7]-ARHQAETSQR.3y5_1.heavy 443.236 / 620.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - TROAP trophinin associated protein (tastin) 1041 133 C20140704_OR005_01 C20140704_OR005_01 TB427457.[MT7]-QSPHDEDPQAVTYAK[MT7].3y3_1.heavy 658.665 / 525.315 6830.0 21.88409996032715 38 20 0 10 8 9.646474611632597 10.36648143762395 0.0 4 0.990486877089602 12.64316839475132 6830.0 23.147551625504832 0.0 - - - - - - - 202.25 13 4 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1043 133 C20140704_OR005_01 C20140704_OR005_01 TB427457.[MT7]-QSPHDEDPQAVTYAK[MT7].3b4_1.heavy 658.665 / 594.312 3056.0 21.88409996032715 38 20 0 10 8 9.646474611632597 10.36648143762395 0.0 4 0.990486877089602 12.64316839475132 3056.0 11.777632249939511 0.0 - - - - - - - 299.3333333333333 6 6 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1045 133 C20140704_OR005_01 C20140704_OR005_01 TB427457.[MT7]-QSPHDEDPQAVTYAK[MT7].3y4_1.heavy 658.665 / 626.363 11683.0 21.88409996032715 38 20 0 10 8 9.646474611632597 10.36648143762395 0.0 4 0.990486877089602 12.64316839475132 11683.0 44.88876178226491 1.0 - - - - - - - 236.0 82 8 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1047 133 C20140704_OR005_01 C20140704_OR005_01 TB427457.[MT7]-QSPHDEDPQAVTYAK[MT7].3b7_1.heavy 658.665 / 953.408 8178.0 21.88409996032715 38 20 0 10 8 9.646474611632597 10.36648143762395 0.0 4 0.990486877089602 12.64316839475132 8178.0 44.625910863509745 0.0 - - - - - - - 287.4 16 5 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1049 134 C20140704_OR005_01 C20140704_OR005_01 TB427593.[MT7]-QEISLLQAQVSNFQRENEALR.4b5_1.heavy 655.101 / 715.411 7328.0 41.91749954223633 44 14 10 10 10 2.7759403882456 24.718595595145004 0.0 3 0.9337912609465969 4.769566510054149 7328.0 30.08152744630072 0.0 - - - - - - - 298.0769230769231 14 13 SDCCAG3 serologically defined colon cancer antigen 3 1051 134 C20140704_OR005_01 C20140704_OR005_01 TB427593.[MT7]-QEISLLQAQVSNFQRENEALR.4y6_1.heavy 655.101 / 731.368 1466.0 41.91749954223633 44 14 10 10 10 2.7759403882456 24.718595595145004 0.0 3 0.9337912609465969 4.769566510054149 1466.0 11.178416742493177 4.0 - - - - - - - 225.3846153846154 4 13 SDCCAG3 serologically defined colon cancer antigen 3 1053 134 C20140704_OR005_01 C20140704_OR005_01 TB427593.[MT7]-QEISLLQAQVSNFQRENEALR.4b3_1.heavy 655.101 / 515.295 5653.0 41.91749954223633 44 14 10 10 10 2.7759403882456 24.718595595145004 0.0 3 0.9337912609465969 4.769566510054149 5653.0 18.876572501107916 0.0 - - - - - - - 209.375 11 8 SDCCAG3 serologically defined colon cancer antigen 3 1055 134 C20140704_OR005_01 C20140704_OR005_01 TB427593.[MT7]-QEISLLQAQVSNFQRENEALR.4y14_2.heavy 655.101 / 831.421 7851.0 41.91749954223633 44 14 10 10 10 2.7759403882456 24.718595595145004 0.0 3 0.9337912609465969 4.769566510054149 7851.0 74.22815624146409 0.0 - - - - - - - 183.25 15 8 SDCCAG3 serologically defined colon cancer antigen 3 1057 135 C20140704_OR005_01 C20140704_OR005_01 TB427594.[MT7]-SPTTPGETAHVRVPFVNVQAVK[MT7].3y6_1.heavy 874.825 / 802.49 3115.0 33.51139831542969 37 7 10 10 10 1.693298030010123 59.05634934176483 0.0 3 0.7158406186185386 2.257954774345149 3115.0 16.82596441117568 0.0 - - - - - - - 288.5 6 2 CPA2 carboxypeptidase A2 (pancreatic) 1059 135 C20140704_OR005_01 C20140704_OR005_01 TB427594.[MT7]-SPTTPGETAHVRVPFVNVQAVK[MT7].3y4_1.heavy 874.825 / 589.379 2653.0 33.51139831542969 37 7 10 10 10 1.693298030010123 59.05634934176483 0.0 3 0.7158406186185386 2.257954774345149 2653.0 9.54161212121212 0.0 - - - - - - - 192.16666666666666 5 6 CPA2 carboxypeptidase A2 (pancreatic) 1061 135 C20140704_OR005_01 C20140704_OR005_01 TB427594.[MT7]-SPTTPGETAHVRVPFVNVQAVK[MT7].3y21_2.heavy 874.825 / 1196.17 12689.0 33.51139831542969 37 7 10 10 10 1.693298030010123 59.05634934176483 0.0 3 0.7158406186185386 2.257954774345149 12689.0 51.99617216524306 1.0 - - - - - - - 196.0 26 10 CPA2 carboxypeptidase A2 (pancreatic) 1063 135 C20140704_OR005_01 C20140704_OR005_01 TB427594.[MT7]-SPTTPGETAHVRVPFVNVQAVK[MT7].3y9_1.heavy 874.825 / 1145.68 2192.0 33.51139831542969 37 7 10 10 10 1.693298030010123 59.05634934176483 0.0 3 0.7158406186185386 2.257954774345149 2192.0 13.626747049046399 0.0 - - - - - - - 253.6 4 10 CPA2 carboxypeptidase A2 (pancreatic) 1065 136 C20140704_OR005_01 C20140704_OR005_01 TB427081.[MT7]-LFDQESC[CAM]IR.2b3_1.heavy 656.328 / 520.289 2718.0 32.045501708984375 45 17 10 10 8 2.68538794459711 30.445982311678808 0.0 4 0.9765508247088 8.043522057172217 2718.0 5.336196319018405 1.0 - - - - - - - 253.44444444444446 5 9 TROAP trophinin associated protein (tastin) 1067 136 C20140704_OR005_01 C20140704_OR005_01 TB427081.[MT7]-LFDQESC[CAM]IR.2y8_1.heavy 656.328 / 1054.46 4783.0 32.045501708984375 45 17 10 10 8 2.68538794459711 30.445982311678808 0.0 4 0.9765508247088 8.043522057172217 4783.0 47.18944215965412 0.0 - - - - - - - 234.07692307692307 9 13 TROAP trophinin associated protein (tastin) 1069 136 C20140704_OR005_01 C20140704_OR005_01 TB427081.[MT7]-LFDQESC[CAM]IR.2y6_1.heavy 656.328 / 792.367 2174.0 32.045501708984375 45 17 10 10 8 2.68538794459711 30.445982311678808 0.0 4 0.9765508247088 8.043522057172217 2174.0 28.56540227455291 1.0 - - - - - - - 170.85714285714286 5 7 TROAP trophinin associated protein (tastin) 1071 136 C20140704_OR005_01 C20140704_OR005_01 TB427081.[MT7]-LFDQESC[CAM]IR.2y7_1.heavy 656.328 / 907.394 1848.0 32.045501708984375 45 17 10 10 8 2.68538794459711 30.445982311678808 0.0 4 0.9765508247088 8.043522057172217 1848.0 7.918994711233339 0.0 - - - - - - - 256.90909090909093 3 11 TROAP trophinin associated protein (tastin) 1073 137 C20140704_OR005_01 C20140704_OR005_01 TB427277.[MT7]-NTFDHPYPTTK[MT7].3b4_1.heavy 536.947 / 622.295 73041.0 24.055299758911133 40 15 10 5 10 2.5700097859278075 29.979775694820784 0.04000091552734375 3 0.9537751732560782 5.717911519999015 73041.0 1045.9162737932083 0.0 - - - - - - - 173.75 146 8 DCAF7 DDB1 and CUL4 associated factor 7 1075 137 C20140704_OR005_01 C20140704_OR005_01 TB427277.[MT7]-NTFDHPYPTTK[MT7].3b5_1.heavy 536.947 / 759.354 36670.0 24.055299758911133 40 15 10 5 10 2.5700097859278075 29.979775694820784 0.04000091552734375 3 0.9537751732560782 5.717911519999015 36670.0 283.9633975245354 0.0 - - - - - - - 243.0 73 9 DCAF7 DDB1 and CUL4 associated factor 7 1077 137 C20140704_OR005_01 C20140704_OR005_01 TB427277.[MT7]-NTFDHPYPTTK[MT7].3b3_1.heavy 536.947 / 507.268 8149.0 24.055299758911133 40 15 10 5 10 2.5700097859278075 29.979775694820784 0.04000091552734375 3 0.9537751732560782 5.717911519999015 8149.0 34.94612008735832 1.0 - - - - - - - 352.54545454545456 30 11 DCAF7 DDB1 and CUL4 associated factor 7 1079 137 C20140704_OR005_01 C20140704_OR005_01 TB427277.[MT7]-NTFDHPYPTTK[MT7].3y4_1.heavy 536.947 / 590.363 120145.0 24.055299758911133 40 15 10 5 10 2.5700097859278075 29.979775694820784 0.04000091552734375 3 0.9537751732560782 5.717911519999015 120145.0 604.6025815969642 0.0 - - - - - - - 291.6 240 15 DCAF7 DDB1 and CUL4 associated factor 7 1081 138 C20140704_OR005_01 C20140704_OR005_01 TB427377.[MT7]-SSGFAFDPSVNYSK[MT7].2b4_1.heavy 897.451 / 523.263 3351.0 34.61524963378906 39 14 10 5 10 2.270020104605117 34.699548861073815 0.04450225830078125 3 0.9438929659517519 5.185634661283476 3351.0 14.442975144632527 0.0 - - - - - - - 299.0 6 8 TRIM22 tripartite motif-containing 22 1083 138 C20140704_OR005_01 C20140704_OR005_01 TB427377.[MT7]-SSGFAFDPSVNYSK[MT7].2b7_1.heavy 897.451 / 856.396 6702.0 34.61524963378906 39 14 10 5 10 2.270020104605117 34.699548861073815 0.04450225830078125 3 0.9438929659517519 5.185634661283476 6702.0 21.833013822901705 0.0 - - - - - - - 269.375 13 8 TRIM22 tripartite motif-containing 22 1085 138 C20140704_OR005_01 C20140704_OR005_01 TB427377.[MT7]-SSGFAFDPSVNYSK[MT7].2b5_1.heavy 897.451 / 594.3 2394.0 34.61524963378906 39 14 10 5 10 2.270020104605117 34.699548861073815 0.04450225830078125 3 0.9438929659517519 5.185634661283476 2394.0 27.170397489539745 0.0 - - - - - - - 239.2 4 5 TRIM22 tripartite motif-containing 22 1087 138 C20140704_OR005_01 C20140704_OR005_01 TB427377.[MT7]-SSGFAFDPSVNYSK[MT7].2y7_1.heavy 897.451 / 938.506 12207.0 34.61524963378906 39 14 10 5 10 2.270020104605117 34.699548861073815 0.04450225830078125 3 0.9438929659517519 5.185634661283476 12207.0 99.03503347280335 0.0 - - - - - - - 205.14285714285714 24 7 TRIM22 tripartite motif-containing 22 1089 139 C20140704_OR005_01 C20140704_OR005_01 TB412865.[MT7]-RDVC[CAM]EHHGK[MT7].2y4_1.heavy 713.367 / 622.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 1091 139 C20140704_OR005_01 C20140704_OR005_01 TB412865.[MT7]-RDVC[CAM]EHHGK[MT7].2b6_1.heavy 713.367 / 941.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 1093 139 C20140704_OR005_01 C20140704_OR005_01 TB412865.[MT7]-RDVC[CAM]EHHGK[MT7].2b7_1.heavy 713.367 / 1078.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 1095 139 C20140704_OR005_01 C20140704_OR005_01 TB412865.[MT7]-RDVC[CAM]EHHGK[MT7].2b5_1.heavy 713.367 / 804.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 1097 140 C20140704_OR005_01 C20140704_OR005_01 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 230775.0 37.66740036010742 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 230775.0 131.10603449919367 0.0 - - - - - - - 258.0 461 7 1099 140 C20140704_OR005_01 C20140704_OR005_01 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 485586.0 37.66740036010742 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 485586.0 227.66598775527893 0.0 - - - - - - - 271.0 971 5 1101 140 C20140704_OR005_01 C20140704_OR005_01 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 608883.0 37.66740036010742 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 608883.0 383.3398957053723 0.0 - - - - - - - 254.25 1217 4 1103 141 C20140704_OR005_01 C20140704_OR005_01 TB427373.[MT7]-GVYPDLLATSGDYLR.3y7_1.heavy 595.316 / 811.394 45692.0 42.0976505279541 42 16 10 6 10 3.4736315611029425 28.788315122358036 0.039699554443359375 3 0.9655770259199021 6.632609494604424 45692.0 230.81084370579913 0.0 - - - - - - - 201.9 91 10 DCAF7 DDB1 and CUL4 associated factor 7 1105 141 C20140704_OR005_01 C20140704_OR005_01 TB427373.[MT7]-GVYPDLLATSGDYLR.3b6_1.heavy 595.316 / 789.426 62234.0 42.0976505279541 42 16 10 6 10 3.4736315611029425 28.788315122358036 0.039699554443359375 3 0.9655770259199021 6.632609494604424 62234.0 905.7819801980197 0.0 - - - - - - - 222.1 124 10 DCAF7 DDB1 and CUL4 associated factor 7 1107 141 C20140704_OR005_01 C20140704_OR005_01 TB427373.[MT7]-GVYPDLLATSGDYLR.3b5_1.heavy 595.316 / 676.342 87148.0 42.0976505279541 42 16 10 6 10 3.4736315611029425 28.788315122358036 0.039699554443359375 3 0.9655770259199021 6.632609494604424 87148.0 237.81596796155384 0.0 - - - - - - - 286.0 174 6 DCAF7 DDB1 and CUL4 associated factor 7 1109 141 C20140704_OR005_01 C20140704_OR005_01 TB427373.[MT7]-GVYPDLLATSGDYLR.3y8_1.heavy 595.316 / 882.432 36614.0 42.0976505279541 42 16 10 6 10 3.4736315611029425 28.788315122358036 0.039699554443359375 3 0.9655770259199021 6.632609494604424 36614.0 238.09076648392113 0.0 - - - - - - - 252.375 73 8 DCAF7 DDB1 and CUL4 associated factor 7 1111 142 C20140704_OR005_01 C20140704_OR005_01 TB427599.[MT7]-TSVSQASGLLLETPVQPAFSLPK[MT7].3y7_1.heavy 886.837 / 903.542 7362.0 44.22757530212402 39 13 10 6 10 1.205791208832913 57.354097793292695 0.03929901123046875 3 0.9161729783487348 4.2324205918882996 7362.0 67.51492682926829 0.0 - - - - - - - 214.9 14 10 TROAP trophinin associated protein (tastin) 1113 142 C20140704_OR005_01 C20140704_OR005_01 TB427599.[MT7]-TSVSQASGLLLETPVQPAFSLPK[MT7].3b9_1.heavy 886.837 / 975.523 5931.0 44.22757530212402 39 13 10 6 10 1.205791208832913 57.354097793292695 0.03929901123046875 3 0.9161729783487348 4.2324205918882996 5931.0 68.29080612685172 0.0 - - - - - - - 247.16666666666666 11 12 TROAP trophinin associated protein (tastin) 1115 142 C20140704_OR005_01 C20140704_OR005_01 TB427599.[MT7]-TSVSQASGLLLETPVQPAFSLPK[MT7].3y3_1.heavy 886.837 / 501.352 2045.0 44.22757530212402 39 13 10 6 10 1.205791208832913 57.354097793292695 0.03929901123046875 3 0.9161729783487348 4.2324205918882996 2045.0 4.656910569105691 0.0 - - - - - - - 255.75 4 12 TROAP trophinin associated protein (tastin) 1117 142 C20140704_OR005_01 C20140704_OR005_01 TB427599.[MT7]-TSVSQASGLLLETPVQPAFSLPK[MT7].3b8_1.heavy 886.837 / 862.439 5828.0 44.22757530212402 39 13 10 6 10 1.205791208832913 57.354097793292695 0.03929901123046875 3 0.9161729783487348 4.2324205918882996 5828.0 29.857401330376938 0.0 - - - - - - - 179.125 11 8 TROAP trophinin associated protein (tastin) 1119 143 C20140704_OR005_01 C20140704_OR005_01 TB451120.[MT7]-VQEEAHC[CAM]LVEELRK[MT7].4y8_2.heavy 507.775 / 595.838 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1121 143 C20140704_OR005_01 C20140704_OR005_01 TB451120.[MT7]-VQEEAHC[CAM]LVEELRK[MT7].4b4_1.heavy 507.775 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1123 143 C20140704_OR005_01 C20140704_OR005_01 TB451120.[MT7]-VQEEAHC[CAM]LVEELRK[MT7].4b5_1.heavy 507.775 / 701.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1125 143 C20140704_OR005_01 C20140704_OR005_01 TB451120.[MT7]-VQEEAHC[CAM]LVEELRK[MT7].4b3_1.heavy 507.775 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1127 144 C20140704_OR005_01 C20140704_OR005_01 TB427598.[MT7]-TSVSQASGLLLETPVQPAFSLPK[MT7].4b8_1.heavy 665.379 / 862.439 4096.0 44.217750549316406 35 17 2 6 10 3.072564596757931 28.410153256372034 0.03929901123046875 3 0.9761072855394639 7.968216109940914 4096.0 15.984390243902439 1.0 - - - - - - - 196.25 8 12 TROAP trophinin associated protein (tastin) 1129 144 C20140704_OR005_01 C20140704_OR005_01 TB427598.[MT7]-TSVSQASGLLLETPVQPAFSLPK[MT7].4b5_1.heavy 665.379 / 647.348 2662.0 44.217750549316406 35 17 2 6 10 3.072564596757931 28.410153256372034 0.03929901123046875 3 0.9761072855394639 7.968216109940914 2662.0 3.2489452899494737 1.0 - - - - - - - 707.4545454545455 27 11 TROAP trophinin associated protein (tastin) 1131 144 C20140704_OR005_01 C20140704_OR005_01 TB427598.[MT7]-TSVSQASGLLLETPVQPAFSLPK[MT7].4b9_1.heavy 665.379 / 975.523 3584.0 44.217750549316406 35 17 2 6 10 3.072564596757931 28.410153256372034 0.03929901123046875 3 0.9761072855394639 7.968216109940914 3584.0 8.559440954729487 0.0 - - - - - - - 248.71428571428572 7 7 TROAP trophinin associated protein (tastin) 1133 144 C20140704_OR005_01 C20140704_OR005_01 TB427598.[MT7]-TSVSQASGLLLETPVQPAFSLPK[MT7].4y3_1.heavy 665.379 / 501.352 2765.0 44.217750549316406 35 17 2 6 10 3.072564596757931 28.410153256372034 0.03929901123046875 3 0.9761072855394639 7.968216109940914 2765.0 5.133009721091205 2.0 - - - - - - - 204.63636363636363 5 11 TROAP trophinin associated protein (tastin) 1135 145 C20140704_OR005_01 C20140704_OR005_01 TB450761.[MT7]-C[CAM]LEGIGGHTR.3y7_1.heavy 415.216 / 697.374 1971.0 22.31060028076172 48 18 10 10 10 5.207598890570674 19.20270783163976 0.0 3 0.9805189130281807 8.827712921558128 1971.0 42.048 0.0 - - - - - - - 119.66666666666667 3 3 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1137 145 C20140704_OR005_01 C20140704_OR005_01 TB450761.[MT7]-C[CAM]LEGIGGHTR.3b4_1.heavy 415.216 / 604.288 11020.0 22.31060028076172 48 18 10 10 10 5.207598890570674 19.20270783163976 0.0 3 0.9805189130281807 8.827712921558128 11020.0 106.50614525139665 0.0 - - - - - - - 169.33333333333334 22 9 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1139 145 C20140704_OR005_01 C20140704_OR005_01 TB450761.[MT7]-C[CAM]LEGIGGHTR.3b3_1.heavy 415.216 / 547.267 3225.0 22.31060028076172 48 18 10 10 10 5.207598890570674 19.20270783163976 0.0 3 0.9805189130281807 8.827712921558128 3225.0 6.8152554099910985 1.0 - - - - - - - 212.875 50 8 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1141 145 C20140704_OR005_01 C20140704_OR005_01 TB450761.[MT7]-C[CAM]LEGIGGHTR.3y5_1.heavy 415.216 / 527.268 24727.0 22.31060028076172 48 18 10 10 10 5.207598890570674 19.20270783163976 0.0 3 0.9805189130281807 8.827712921558128 24727.0 107.13841056464486 0.0 - - - - - - - 277.8 49 10 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1143 146 C20140704_OR005_01 C20140704_OR005_01 TB427651.[MT7]-ILNSPWIQVC[CAM]NNFPLLIDC[CAM]FPGTHNK[MT7].3b6_1.heavy 1129.25 / 855.484 986.0 50.667799949645996 37 11 10 6 10 2.3410720291625178 42.715473404623715 0.038402557373046875 3 0.8702188876033451 3.3880027806372257 986.0 7.273919058814424 2.0 - - - - - - - 0.0 1 0 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1145 146 C20140704_OR005_01 C20140704_OR005_01 TB427651.[MT7]-ILNSPWIQVC[CAM]NNFPLLIDC[CAM]FPGTHNK[MT7].3y6_1.heavy 1129.25 / 797.439 2431.0 50.667799949645996 37 11 10 6 10 2.3410720291625178 42.715473404623715 0.038402557373046875 3 0.8702188876033451 3.3880027806372257 2431.0 11.352893401015228 1.0 - - - - - - - 131.41666666666666 4 12 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1147 146 C20140704_OR005_01 C20140704_OR005_01 TB427651.[MT7]-ILNSPWIQVC[CAM]NNFPLLIDC[CAM]FPGTHNK[MT7].3b4_1.heavy 1129.25 / 572.352 657.0 50.667799949645996 37 11 10 6 10 2.3410720291625178 42.715473404623715 0.038402557373046875 3 0.8702188876033451 3.3880027806372257 657.0 -0.5 3.0 - - - - - - - 0.0 1 0 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1149 146 C20140704_OR005_01 C20140704_OR005_01 TB427651.[MT7]-ILNSPWIQVC[CAM]NNFPLLIDC[CAM]FPGTHNK[MT7].3y9_1.heavy 1129.25 / 1219.56 920.0 50.667799949645996 37 11 10 6 10 2.3410720291625178 42.715473404623715 0.038402557373046875 3 0.8702188876033451 3.3880027806372257 920.0 10.803859417987368 0.0 - - - - - - - 0.0 1 0 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1151 147 C20140704_OR005_01 C20140704_OR005_01 TB427650.[MT7]-ILNSPWIQVC[CAM]NNFPLLIDC[CAM]FPGTHNK[MT7].4b4_1.heavy 847.191 / 572.352 7175.0 50.65820026397705 38 15 10 3 10 2.3148854546798447 34.35462241810882 0.07680130004882812 3 0.9575266956816203 5.966986748131388 7175.0 85.14587178895555 0.0 - - - - - - - 150.57142857142858 14 14 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1153 147 C20140704_OR005_01 C20140704_OR005_01 TB427650.[MT7]-ILNSPWIQVC[CAM]NNFPLLIDC[CAM]FPGTHNK[MT7].4y3_1.heavy 847.191 / 542.317 1514.0 50.65820026397705 38 15 10 3 10 2.3148854546798447 34.35462241810882 0.07680130004882812 3 0.9575266956816203 5.966986748131388 1514.0 0.0 2.0 - - - - - - - 259.1875 3 16 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1155 147 C20140704_OR005_01 C20140704_OR005_01 TB427650.[MT7]-ILNSPWIQVC[CAM]NNFPLLIDC[CAM]FPGTHNK[MT7].4y6_1.heavy 847.191 / 797.439 4739.0 50.65820026397705 38 15 10 3 10 2.3148854546798447 34.35462241810882 0.07680130004882812 3 0.9575266956816203 5.966986748131388 4739.0 22.136907828333804 0.0 - - - - - - - 242.6875 9 16 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1157 147 C20140704_OR005_01 C20140704_OR005_01 TB427650.[MT7]-ILNSPWIQVC[CAM]NNFPLLIDC[CAM]FPGTHNK[MT7].4b6_1.heavy 847.191 / 855.484 3686.0 50.65820026397705 38 15 10 3 10 2.3148854546798447 34.35462241810882 0.07680130004882812 3 0.9575266956816203 5.966986748131388 3686.0 52.49757575757576 1.0 - - - - - - - 172.625 7 8 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1159 148 C20140704_OR005_01 C20140704_OR005_01 TB413082.[MT7]-HHPEDVEPALRK[MT7].2y8_1.heavy 858.475 / 1071.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1161 148 C20140704_OR005_01 C20140704_OR005_01 TB413082.[MT7]-HHPEDVEPALRK[MT7].2y5_1.heavy 858.475 / 728.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1163 148 C20140704_OR005_01 C20140704_OR005_01 TB413082.[MT7]-HHPEDVEPALRK[MT7].2y9_1.heavy 858.475 / 1200.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1165 148 C20140704_OR005_01 C20140704_OR005_01 TB413082.[MT7]-HHPEDVEPALRK[MT7].2y7_1.heavy 858.475 / 956.601 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1167 149 C20140704_OR005_01 C20140704_OR005_01 TB451127.[MT7]-QLVSGAETLNLVAEILK[MT7].3b6_1.heavy 696.084 / 700.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG3 serologically defined colon cancer antigen 3 1169 149 C20140704_OR005_01 C20140704_OR005_01 TB451127.[MT7]-QLVSGAETLNLVAEILK[MT7].3b8_1.heavy 696.084 / 930.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG3 serologically defined colon cancer antigen 3 1171 149 C20140704_OR005_01 C20140704_OR005_01 TB451127.[MT7]-QLVSGAETLNLVAEILK[MT7].3b7_1.heavy 696.084 / 829.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG3 serologically defined colon cancer antigen 3 1173 149 C20140704_OR005_01 C20140704_OR005_01 TB451127.[MT7]-QLVSGAETLNLVAEILK[MT7].3y5_1.heavy 696.084 / 717.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG3 serologically defined colon cancer antigen 3 1175 150 C20140704_OR005_01 C20140704_OR005_01 TB427172.[MT7]-TLQISYDALK[MT7].2y4_1.heavy 720.421 / 590.363 5160.0 35.649200439453125 46 16 10 10 10 2.4667419781653805 32.846751387375434 0.0 3 0.963466715380511 6.437049962415645 5160.0 14.865176431100606 0.0 - - - - - - - 327.5 10 6 SDCCAG3 serologically defined colon cancer antigen 3 1177 150 C20140704_OR005_01 C20140704_OR005_01 TB427172.[MT7]-TLQISYDALK[MT7].2b4_1.heavy 720.421 / 600.384 12163.0 35.649200439453125 46 16 10 10 10 2.4667419781653805 32.846751387375434 0.0 3 0.963466715380511 6.437049962415645 12163.0 33.43197690680468 0.0 - - - - - - - 286.77777777777777 24 9 SDCCAG3 serologically defined colon cancer antigen 3 1179 150 C20140704_OR005_01 C20140704_OR005_01 TB427172.[MT7]-TLQISYDALK[MT7].2y6_1.heavy 720.421 / 840.458 17324.0 35.649200439453125 46 16 10 10 10 2.4667419781653805 32.846751387375434 0.0 3 0.963466715380511 6.437049962415645 17324.0 135.21170731707315 0.0 - - - - - - - 245.77777777777777 34 9 SDCCAG3 serologically defined colon cancer antigen 3 1181 150 C20140704_OR005_01 C20140704_OR005_01 TB427172.[MT7]-TLQISYDALK[MT7].2y7_1.heavy 720.421 / 953.542 9829.0 35.649200439453125 46 16 10 10 10 2.4667419781653805 32.846751387375434 0.0 3 0.963466715380511 6.437049962415645 9829.0 14.40284036336838 0.0 - - - - - - - 210.85714285714286 19 7 SDCCAG3 serologically defined colon cancer antigen 3 1183 151 C20140704_OR005_01 C20140704_OR005_01 TB427171.[MT7]-VQEEIDHVIGR.2y5_1.heavy 719.892 / 581.352 20166.0 33.424800872802734 48 18 10 10 10 9.164641389383357 10.911501689072473 0.0 3 0.9879144656037829 11.214788250428048 20166.0 165.64928571428572 0.0 - - - - - - - 179.2 40 10 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1185 151 C20140704_OR005_01 C20140704_OR005_01 TB427171.[MT7]-VQEEIDHVIGR.2b4_1.heavy 719.892 / 630.321 6946.0 33.424800872802734 48 18 10 10 10 9.164641389383357 10.911501689072473 0.0 3 0.9879144656037829 11.214788250428048 6946.0 23.938892857142857 0.0 - - - - - - - 224.0 13 5 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1187 151 C20140704_OR005_01 C20140704_OR005_01 TB427171.[MT7]-VQEEIDHVIGR.2b6_1.heavy 719.892 / 858.432 9411.0 33.424800872802734 48 18 10 10 10 9.164641389383357 10.911501689072473 0.0 3 0.9879144656037829 11.214788250428048 9411.0 48.17535714285715 0.0 - - - - - - - 317.3333333333333 18 6 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1189 151 C20140704_OR005_01 C20140704_OR005_01 TB427171.[MT7]-VQEEIDHVIGR.2y10_1.heavy 719.892 / 1195.61 3361.0 33.424800872802734 48 18 10 10 10 9.164641389383357 10.911501689072473 0.0 3 0.9879144656037829 11.214788250428048 3361.0 25.807678571428575 0.0 - - - - - - - 192.0 6 7 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1191 152 C20140704_OR005_01 C20140704_OR005_01 TB451128.[MT7]-VNIGSSFENRPMNVLK[MT7].3y15_2.heavy 698.385 / 925.489 24784.0 34.682701110839844 43 13 10 10 10 1.2198988940279074 47.44730592974609 0.0 3 0.9092070608749415 4.064380137678893 24784.0 -0.08179537953795446 0.0 - - - - - - - 324.8 49 5 CPA2 carboxypeptidase A2 (pancreatic) 1193 152 C20140704_OR005_01 C20140704_OR005_01 TB451128.[MT7]-VNIGSSFENRPMNVLK[MT7].3y4_1.heavy 698.385 / 617.41 3030.0 34.682701110839844 43 13 10 10 10 1.2198988940279074 47.44730592974609 0.0 3 0.9092070608749415 4.064380137678893 3030.0 -0.08401109057301293 1.0 - - - - - - - 324.8 11 5 CPA2 carboxypeptidase A2 (pancreatic) 1195 152 C20140704_OR005_01 C20140704_OR005_01 TB451128.[MT7]-VNIGSSFENRPMNVLK[MT7].3y8_2.heavy 698.385 / 558.327 12662.0 34.682701110839844 43 13 10 10 10 1.2198988940279074 47.44730592974609 0.0 3 0.9092070608749415 4.064380137678893 12662.0 -1.3657010785824362 0.0 - - - - - - - 288.6666666666667 25 3 CPA2 carboxypeptidase A2 (pancreatic) 1197 152 C20140704_OR005_01 C20140704_OR005_01 TB451128.[MT7]-VNIGSSFENRPMNVLK[MT7].3y13_2.heavy 698.385 / 811.926 23593.0 34.682701110839844 43 13 10 10 10 1.2198988940279074 47.44730592974609 0.0 3 0.9092070608749415 4.064380137678893 23593.0 -10.89745958429561 0.0 - - - - - - - 324.6666666666667 47 3 CPA2 carboxypeptidase A2 (pancreatic) 1199 153 C20140704_OR005_01 C20140704_OR005_01 TB413280.[MT7]-GLVASLDMQLEQAQGTRER.3y15_2.heavy 749.394 / 881.431 3850.0 39.56252574920654 39 13 10 6 10 1.507793035248997 53.46956827616823 0.038097381591796875 3 0.9003245428091735 3.8760831390496464 3850.0 22.784999999999997 0.0 - - - - - - - 201.66666666666666 7 6 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1201 153 C20140704_OR005_01 C20140704_OR005_01 TB413280.[MT7]-GLVASLDMQLEQAQGTRER.3y12_2.heavy 749.394 / 723.859 11221.0 39.56252574920654 39 13 10 6 10 1.507793035248997 53.46956827616823 0.038097381591796875 3 0.9003245428091735 3.8760831390496464 11221.0 128.53145454545455 0.0 - - - - - - - 253.0 22 10 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1203 153 C20140704_OR005_01 C20140704_OR005_01 TB413280.[MT7]-GLVASLDMQLEQAQGTRER.3b7_1.heavy 749.394 / 800.463 7811.0 39.56252574920654 39 13 10 6 10 1.507793035248997 53.46956827616823 0.038097381591796875 3 0.9003245428091735 3.8760831390496464 7811.0 83.5066909090909 0.0 - - - - - - - 233.75 15 8 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1205 153 C20140704_OR005_01 C20140704_OR005_01 TB413280.[MT7]-GLVASLDMQLEQAQGTRER.3y16_2.heavy 749.394 / 916.95 7701.0 39.56252574920654 39 13 10 6 10 1.507793035248997 53.46956827616823 0.038097381591796875 3 0.9003245428091735 3.8760831390496464 7701.0 43.40563636363636 0.0 - - - - - - - 253.0 15 10 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1207 154 C20140704_OR005_01 C20140704_OR005_01 TB451229.[MT7]-QDPNYLATMAMDGMEVVILDVRVPC[CAM]TPVAR.4b7_1.heavy 877.191 / 946.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCAF7 DDB1 and CUL4 associated factor 7 1209 154 C20140704_OR005_01 C20140704_OR005_01 TB451229.[MT7]-QDPNYLATMAMDGMEVVILDVRVPC[CAM]TPVAR.4b4_1.heavy 877.191 / 599.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCAF7 DDB1 and CUL4 associated factor 7 1211 154 C20140704_OR005_01 C20140704_OR005_01 TB451229.[MT7]-QDPNYLATMAMDGMEVVILDVRVPC[CAM]TPVAR.4b5_1.heavy 877.191 / 762.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCAF7 DDB1 and CUL4 associated factor 7 1213 154 C20140704_OR005_01 C20140704_OR005_01 TB451229.[MT7]-QDPNYLATMAMDGMEVVILDVRVPC[CAM]TPVAR.4y7_1.heavy 877.191 / 800.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCAF7 DDB1 and CUL4 associated factor 7 1215 155 C20140704_OR005_01 C20140704_OR005_01 TB451227.[MT7]-VQLVGLDEESSEFIC[CAM]RNTFDHPYPTTK[MT7].4y4_1.heavy 868.434 / 590.363 4738.0 38.99347496032715 38 16 10 6 6 2.4736787473135218 40.42562119620527 0.03929901123046875 5 0.9674512639766015 6.821976744646513 4738.0 6.331740203845396 2.0 - - - - - - - 798.2857142857143 9 7 DCAF7 DDB1 and CUL4 associated factor 7 1217 155 C20140704_OR005_01 C20140704_OR005_01 TB451227.[MT7]-VQLVGLDEESSEFIC[CAM]RNTFDHPYPTTK[MT7].4y7_1.heavy 868.434 / 987.538 1215.0 38.99347496032715 38 16 10 6 6 2.4736787473135218 40.42562119620527 0.03929901123046875 5 0.9674512639766015 6.821976744646513 1215.0 -2.0027472527472527 0.0 - - - - - - - 275.8181818181818 2 11 DCAF7 DDB1 and CUL4 associated factor 7 1219 155 C20140704_OR005_01 C20140704_OR005_01 TB451227.[MT7]-VQLVGLDEESSEFIC[CAM]RNTFDHPYPTTK[MT7].4y6_1.heavy 868.434 / 850.479 1458.0 38.99347496032715 38 16 10 6 6 2.4736787473135218 40.42562119620527 0.03929901123046875 5 0.9674512639766015 6.821976744646513 1458.0 -0.11999999999999988 10.0 - - - - - - - 264.72727272727275 8 11 DCAF7 DDB1 and CUL4 associated factor 7 1221 155 C20140704_OR005_01 C20140704_OR005_01 TB451227.[MT7]-VQLVGLDEESSEFIC[CAM]RNTFDHPYPTTK[MT7].4b6_1.heavy 868.434 / 754.494 243.0 38.99347496032715 38 16 10 6 6 2.4736787473135218 40.42562119620527 0.03929901123046875 5 0.9674512639766015 6.821976744646513 243.0 -0.1335164835164835 28.0 - - - - - - - 0.0 1 0 DCAF7 DDB1 and CUL4 associated factor 7 1223 156 C20140704_OR005_01 C20140704_OR005_01 TB427280.[MT7]-FSIPSMTEDYAGR.2y4_1.heavy 809.389 / 466.241 2461.0 38.020100593566895 36 16 10 2 8 2.880796989332076 34.71261611641208 0.08720016479492188 4 0.9621278589204406 6.321529731125167 2461.0 11.98649511860038 0.0 - - - - - - - 234.25 4 8 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1225 156 C20140704_OR005_01 C20140704_OR005_01 TB427280.[MT7]-FSIPSMTEDYAGR.2y10_1.heavy 809.389 / 1126.48 11600.0 38.020100593566895 36 16 10 2 8 2.880796989332076 34.71261611641208 0.08720016479492188 4 0.9621278589204406 6.321529731125167 11600.0 34.701765727161906 0.0 - - - - - - - 219.75 23 8 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1227 156 C20140704_OR005_01 C20140704_OR005_01 TB427280.[MT7]-FSIPSMTEDYAGR.2y5_1.heavy 809.389 / 581.268 937.0 38.020100593566895 36 16 10 2 8 2.880796989332076 34.71261611641208 0.08720016479492188 4 0.9621278589204406 6.321529731125167 937.0 2.158106347831782 5.0 - - - - - - - 0.0 1 0 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1229 156 C20140704_OR005_01 C20140704_OR005_01 TB427280.[MT7]-FSIPSMTEDYAGR.2y9_1.heavy 809.389 / 1029.43 1406.0 38.020100593566895 36 16 10 2 8 2.880796989332076 34.71261611641208 0.08720016479492188 4 0.9621278589204406 6.321529731125167 1406.0 1.1534803237354172 1.0 - - - - - - - 286.44444444444446 3 9 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1231 157 C20140704_OR005_01 C20140704_OR005_01 TB451225.[MT7]-ILSLTETIEC[CAM]LQTNIDHLQSQVEELK[MT7].3y7_1.heavy 1114.93 / 976.543 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDR2 cerebellar degeneration-related protein 2, 62kDa 1233 157 C20140704_OR005_01 C20140704_OR005_01 TB451225.[MT7]-ILSLTETIEC[CAM]LQTNIDHLQSQVEELK[MT7].3y4_1.heavy 1114.93 / 662.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDR2 cerebellar degeneration-related protein 2, 62kDa 1235 157 C20140704_OR005_01 C20140704_OR005_01 TB451225.[MT7]-ILSLTETIEC[CAM]LQTNIDHLQSQVEELK[MT7].3b7_1.heavy 1114.93 / 902.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDR2 cerebellar degeneration-related protein 2, 62kDa 1237 157 C20140704_OR005_01 C20140704_OR005_01 TB451225.[MT7]-ILSLTETIEC[CAM]LQTNIDHLQSQVEELK[MT7].3y9_1.heavy 1114.93 / 1217.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDR2 cerebellar degeneration-related protein 2, 62kDa 1239 158 C20140704_OR005_01 C20140704_OR005_01 TB427077.[MT7]-SSK[MT7]PGK[MT7]K[MT7].2b3_1.heavy 654.428 / 591.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLCO6A1 solute carrier organic anion transporter family, member 6A1 1241 158 C20140704_OR005_01 C20140704_OR005_01 TB427077.[MT7]-SSK[MT7]PGK[MT7]K[MT7].2y4_1.heavy 654.428 / 717.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLCO6A1 solute carrier organic anion transporter family, member 6A1 1243 158 C20140704_OR005_01 C20140704_OR005_01 TB427077.[MT7]-SSK[MT7]PGK[MT7]K[MT7].2y5_1.heavy 654.428 / 989.683 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLCO6A1 solute carrier organic anion transporter family, member 6A1 1245 158 C20140704_OR005_01 C20140704_OR005_01 TB427077.[MT7]-SSK[MT7]PGK[MT7]K[MT7].2y3_1.heavy 654.428 / 620.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLCO6A1 solute carrier organic anion transporter family, member 6A1 1247 159 C20140704_OR005_01 C20140704_OR005_01 TB427388.[MT7]-QLEMILNK[MT7]PGLK[MT7].4y4_1.heavy 454.783 / 558.373 24920.0 35.11819839477539 44 14 10 10 10 1.8784265772046662 47.24441839180619 0.0 3 0.9490434873220436 5.443783794597316 24920.0 120.61098401167803 0.0 - - - - - - - 381.5 49 6 AKR1C4;AKR1C1;AKR1C3 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1249 159 C20140704_OR005_01 C20140704_OR005_01 TB427388.[MT7]-QLEMILNK[MT7]PGLK[MT7].4b4_1.heavy 454.783 / 646.335 10474.0 35.11819839477539 44 14 10 10 10 1.8784265772046662 47.24441839180619 0.0 3 0.9490434873220436 5.443783794597316 10474.0 46.901912506752794 0.0 - - - - - - - 240.6 20 5 AKR1C4;AKR1C1;AKR1C3 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1251 159 C20140704_OR005_01 C20140704_OR005_01 TB427388.[MT7]-QLEMILNK[MT7]PGLK[MT7].4y7_2.heavy 454.783 / 529.352 18780.0 35.11819839477539 44 14 10 10 10 1.8784265772046662 47.24441839180619 0.0 3 0.9490434873220436 5.443783794597316 18780.0 186.46877593360995 0.0 - - - - - - - 321.0 37 3 AKR1C4;AKR1C1;AKR1C3 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1253 159 C20140704_OR005_01 C20140704_OR005_01 TB427388.[MT7]-QLEMILNK[MT7]PGLK[MT7].4b3_1.heavy 454.783 / 515.295 19623.0 35.11819839477539 44 14 10 10 10 1.8784265772046662 47.24441839180619 0.0 3 0.9490434873220436 5.443783794597316 19623.0 91.40265784301329 0.0 - - - - - - - 270.875 39 8 AKR1C4;AKR1C1;AKR1C3 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1255 160 C20140704_OR005_01 C20140704_OR005_01 TB412705.[MT7]-HSGSQDEVSR.2y8_1.heavy 623.301 / 877.401 381.0 13.25100008646647 45 20 10 5 10 13.258572066825558 7.542290338354858 0.04349994659423828 3 0.999071289083838 40.49379479422687 381.0 30.35808 0.0 - - - - - - - 0.0 0 0 SLCO6A1 solute carrier organic anion transporter family, member 6A1 1257 160 C20140704_OR005_01 C20140704_OR005_01 TB412705.[MT7]-HSGSQDEVSR.2y5_1.heavy 623.301 / 605.289 N/A 13.25100008646647 45 20 10 5 10 13.258572066825558 7.542290338354858 0.04349994659423828 3 0.999071289083838 40.49379479422687 457.0 0.4859287054409006 19.0 - - - - - - - 307.2631578947368 3 19 SLCO6A1 solute carrier organic anion transporter family, member 6A1 1259 160 C20140704_OR005_01 C20140704_OR005_01 TB412705.[MT7]-HSGSQDEVSR.2y9_1.heavy 623.301 / 964.433 1548.0 13.25100008646647 45 20 10 5 10 13.258572066825558 7.542290338354858 0.04349994659423828 3 0.999071289083838 40.49379479422687 1548.0 120.744 0.0 - - - - - - - 76.0 3 2 SLCO6A1 solute carrier organic anion transporter family, member 6A1 1261 160 C20140704_OR005_01 C20140704_OR005_01 TB412705.[MT7]-HSGSQDEVSR.2b6_1.heavy 623.301 / 756.339 178.0 13.25100008646647 45 20 10 5 10 13.258572066825558 7.542290338354858 0.04349994659423828 3 0.999071289083838 40.49379479422687 178.0 3.4901960784313726 0.0 - - - - - - - 0.0 0 0 SLCO6A1 solute carrier organic anion transporter family, member 6A1 1263 161 C20140704_OR005_01 C20140704_OR005_01 TB412453.[MT7]-SITPSR.2y4_1.heavy 402.738 / 460.251 3005.0 17.26687479019165 28 17 4 1 6 4.0458673789803035 24.71657882795046 0.14710044860839844 6 0.9773322192151209 8.181521248917623 3005.0 10.230572005305287 1.0 - - - - - - - 192.0 12 6 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1265 161 C20140704_OR005_01 C20140704_OR005_01 TB412453.[MT7]-SITPSR.2b3_1.heavy 402.738 / 446.273 3005.0 17.26687479019165 28 17 4 1 6 4.0458673789803035 24.71657882795046 0.14710044860839844 6 0.9773322192151209 8.181521248917623 3005.0 7.5907552083333325 0.0 - - - - - - - 204.8 6 10 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1267 161 C20140704_OR005_01 C20140704_OR005_01 TB412453.[MT7]-SITPSR.2b5_1.heavy 402.738 / 630.358 1087.0 17.26687479019165 28 17 4 1 6 4.0458673789803035 24.71657882795046 0.14710044860839844 6 0.9773322192151209 8.181521248917623 1087.0 0.4104099244875944 3.0 - - - - - - - 198.4 3 10 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1269 161 C20140704_OR005_01 C20140704_OR005_01 TB412453.[MT7]-SITPSR.2y5_1.heavy 402.738 / 573.336 3836.0 17.26687479019165 28 17 4 1 6 4.0458673789803035 24.71657882795046 0.14710044860839844 6 0.9773322192151209 8.181521248917623 3836.0 38.959375 2.0 - - - - - - - 120.88888888888889 14 9 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1271 162 C20140704_OR005_01 C20140704_OR005_01 TB427243.[MT7]-SDYFMPFSAGK[MT7].3b4_1.heavy 513.258 / 657.3 7386.0 38.725799560546875 42 14 10 10 8 1.5904681984998232 42.16874823685946 0.0 4 0.9408024603604307 5.047129783301856 7386.0 19.957520702807333 1.0 - - - - - - - 201.83333333333334 15 6 CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1273 162 C20140704_OR005_01 C20140704_OR005_01 TB427243.[MT7]-SDYFMPFSAGK[MT7].3b5_1.heavy 513.258 / 788.341 2756.0 38.725799560546875 42 14 10 10 8 1.5904681984998232 42.16874823685946 0.0 4 0.9408024603604307 5.047129783301856 2756.0 12.51213402911288 0.0 - - - - - - - 267.57142857142856 5 7 CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1275 162 C20140704_OR005_01 C20140704_OR005_01 TB427243.[MT7]-SDYFMPFSAGK[MT7].3y4_1.heavy 513.258 / 506.306 11354.0 38.725799560546875 42 14 10 10 8 1.5904681984998232 42.16874823685946 0.0 4 0.9408024603604307 5.047129783301856 11354.0 116.58973448773448 0.0 - - - - - - - 280.6363636363636 22 11 CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1277 162 C20140704_OR005_01 C20140704_OR005_01 TB427243.[MT7]-SDYFMPFSAGK[MT7].3b3_1.heavy 513.258 / 510.232 7386.0 38.725799560546875 42 14 10 10 8 1.5904681984998232 42.16874823685946 0.0 4 0.9408024603604307 5.047129783301856 7386.0 45.96037847866419 1.0 - - - - - - - 299.14285714285717 20 7 CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1279 163 C20140704_OR005_01 C20140704_OR005_01 TB426799.[MT7]-VATWLR.2b3_1.heavy 445.272 / 416.263 3569.0 33.680999755859375 36 12 6 10 8 2.026338026243777 49.35010778303855 0.0 4 0.8942345081611391 3.760851012130059 3569.0 18.39484593837535 1.0 - - - - - - - 238.0 7 3 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1281 163 C20140704_OR005_01 C20140704_OR005_01 TB426799.[MT7]-VATWLR.2y4_1.heavy 445.272 / 575.33 5235.0 33.680999755859375 36 12 6 10 8 2.026338026243777 49.35010778303855 0.0 4 0.8942345081611391 3.760851012130059 5235.0 14.077310924369748 0.0 - - - - - - - 238.0 10 5 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1283 163 C20140704_OR005_01 C20140704_OR005_01 TB426799.[MT7]-VATWLR.2y5_1.heavy 445.272 / 646.367 7376.0 33.680999755859375 36 12 6 10 8 2.026338026243777 49.35010778303855 0.0 4 0.8942345081611391 3.760851012130059 7376.0 61.74407271611815 2.0 - - - - - - - 204.0 24 7 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1285 163 C20140704_OR005_01 C20140704_OR005_01 TB426799.[MT7]-VATWLR.2b4_1.heavy 445.272 / 602.342 4759.0 33.680999755859375 36 12 6 10 8 2.026338026243777 49.35010778303855 0.0 4 0.8942345081611391 3.760851012130059 4759.0 16.893419913419915 0.0 - - - - - - - 238.0 9 3 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1287 164 C20140704_OR005_01 C20140704_OR005_01 TB412707.[MT7]-NLNTTAVTK[MT7].3y3_1.heavy 417.25 / 491.331 11907.0 22.461325645446777 31 17 0 6 8 2.891521468019211 27.54123984052114 0.038700103759765625 4 0.975229278168427 7.825146140277109 11907.0 41.048845366161444 1.0 - - - - - - - 258.5 111 10 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1289 164 C20140704_OR005_01 C20140704_OR005_01 TB412707.[MT7]-NLNTTAVTK[MT7].3b4_1.heavy 417.25 / 587.327 1754.0 22.461325645446777 31 17 0 6 8 2.891521468019211 27.54123984052114 0.038700103759765625 4 0.975229278168427 7.825146140277109 1754.0 11.70417211435262 0.0 - - - - - - - 197.85714285714286 3 7 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1291 164 C20140704_OR005_01 C20140704_OR005_01 TB412707.[MT7]-NLNTTAVTK[MT7].3y4_1.heavy 417.25 / 562.368 7200.0 22.461325645446777 31 17 0 6 8 2.891521468019211 27.54123984052114 0.038700103759765625 4 0.975229278168427 7.825146140277109 7200.0 26.743243243243242 1.0 - - - - - - - 215.5 14 12 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1293 164 C20140704_OR005_01 C20140704_OR005_01 TB412707.[MT7]-NLNTTAVTK[MT7].3b3_1.heavy 417.25 / 486.279 6554.0 22.461325645446777 31 17 0 6 8 2.891521468019211 27.54123984052114 0.038700103759765625 4 0.975229278168427 7.825146140277109 6554.0 23.74763750265449 0.0 - - - - - - - 248.6153846153846 13 13 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1295 165 C20140704_OR005_01 C20140704_OR005_01 TB427465.[MT7]-GTTIMALLTSVLHDDK[MT7].4y4_1.heavy 501.533 / 658.328 2442.0 52.353851318359375 41 14 10 7 10 4.155699404957866 19.261932191524636 0.0298004150390625 3 0.9438892473880175 5.185461186901659 2442.0 42.43261044176707 0.0 - - - - - - - 195.88888888888889 4 9 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1297 165 C20140704_OR005_01 C20140704_OR005_01 TB427465.[MT7]-GTTIMALLTSVLHDDK[MT7].4b4_1.heavy 501.533 / 517.31 1854.0 52.353851318359375 41 14 10 7 10 4.155699404957866 19.261932191524636 0.0298004150390625 3 0.9438892473880175 5.185461186901659 1854.0 47.958165745856355 0.0 - - - - - - - 120.55555555555556 3 9 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1299 165 C20140704_OR005_01 C20140704_OR005_01 TB427465.[MT7]-GTTIMALLTSVLHDDK[MT7].4b5_1.heavy 501.533 / 648.351 2895.0 52.353851318359375 41 14 10 7 10 4.155699404957866 19.261932191524636 0.0298004150390625 3 0.9438892473880175 5.185461186901659 2895.0 40.63406862745098 0.0 - - - - - - - 110.9090909090909 5 11 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1301 165 C20140704_OR005_01 C20140704_OR005_01 TB427465.[MT7]-GTTIMALLTSVLHDDK[MT7].4y3_1.heavy 501.533 / 521.269 3166.0 52.353851318359375 41 14 10 7 10 4.155699404957866 19.261932191524636 0.0298004150390625 3 0.9438892473880175 5.185461186901659 3166.0 32.81528495284953 0.0 - - - - - - - 126.4 6 10 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1303 166 C20140704_OR005_01 C20140704_OR005_01 TB412702.[MT7]-C[CAM]LEGIGGHTR.2y8_1.heavy 622.32 / 826.417 736.0 22.300100326538086 35 12 10 5 8 2.8901168411590863 34.60067723763542 0.04199981689453125 4 0.8914189003296579 3.71086296544082 736.0 10.666666666666666 1.0 - - - - - - - 0.0 1 0 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1305 166 C20140704_OR005_01 C20140704_OR005_01 TB412702.[MT7]-C[CAM]LEGIGGHTR.2y9_1.heavy 622.32 / 939.501 1749.0 22.300100326538086 35 12 10 5 8 2.8901168411590863 34.60067723763542 0.04199981689453125 4 0.8914189003296579 3.71086296544082 1749.0 14.765108695652174 0.0 - - - - - - - 220.8 3 5 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1307 166 C20140704_OR005_01 C20140704_OR005_01 TB412702.[MT7]-C[CAM]LEGIGGHTR.2y6_1.heavy 622.32 / 640.352 276.0 22.300100326538086 35 12 10 5 8 2.8901168411590863 34.60067723763542 0.04199981689453125 4 0.8914189003296579 3.71086296544082 276.0 3.2969999999999997 12.0 - - - - - - - 0.0 1 0 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1309 166 C20140704_OR005_01 C20140704_OR005_01 TB412702.[MT7]-C[CAM]LEGIGGHTR.2y7_1.heavy 622.32 / 697.374 920.0 22.300100326538086 35 12 10 5 8 2.8901168411590863 34.60067723763542 0.04199981689453125 4 0.8914189003296579 3.71086296544082 920.0 6.0 1.0 - - - - - - - 110.4 2 5 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1311 167 C20140704_OR005_01 C20140704_OR005_01 TB427562.[MT7]-HIDC[CAM]AAIYGNEPEIGEALK[MT7].3b6_1.heavy 796.742 / 812.384 20061.0 34.682701110839844 43 13 10 10 10 1.4613902687674896 47.551491488451234 0.0 3 0.9059053188397328 3.9912976345070765 20061.0 113.51483889528194 0.0 - - - - - - - 237.36363636363637 40 11 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1313 167 C20140704_OR005_01 C20140704_OR005_01 TB427562.[MT7]-HIDC[CAM]AAIYGNEPEIGEALK[MT7].3b5_1.heavy 796.742 / 741.347 7122.0 34.682701110839844 43 13 10 10 10 1.4613902687674896 47.551491488451234 0.0 3 0.9059053188397328 3.9912976345070765 7122.0 38.140020457741976 0.0 - - - - - - - 197.66666666666666 14 3 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1315 167 C20140704_OR005_01 C20140704_OR005_01 TB427562.[MT7]-HIDC[CAM]AAIYGNEPEIGEALK[MT7].3y8_1.heavy 796.742 / 1000.58 22673.0 34.682701110839844 43 13 10 10 10 1.4613902687674896 47.551491488451234 0.0 3 0.9059053188397328 3.9912976345070765 22673.0 277.59411764705885 0.0 - - - - - - - 154.5 45 10 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1317 167 C20140704_OR005_01 C20140704_OR005_01 TB427562.[MT7]-HIDC[CAM]AAIYGNEPEIGEALK[MT7].3y5_1.heavy 796.742 / 661.4 20418.0 34.682701110839844 43 13 10 10 10 1.4613902687674896 47.551491488451234 0.0 3 0.9059053188397328 3.9912976345070765 20418.0 253.25255589830869 0.0 - - - - - - - 207.875 40 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1319 168 C20140704_OR005_01 C20140704_OR005_01 TB451111.[MT7]-GTTIMALLTSVLHDDK[MT7].3b6_1.heavy 668.374 / 719.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1321 168 C20140704_OR005_01 C20140704_OR005_01 TB451111.[MT7]-GTTIMALLTSVLHDDK[MT7].3b4_1.heavy 668.374 / 517.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1323 168 C20140704_OR005_01 C20140704_OR005_01 TB451111.[MT7]-GTTIMALLTSVLHDDK[MT7].3b5_1.heavy 668.374 / 648.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1325 168 C20140704_OR005_01 C20140704_OR005_01 TB451111.[MT7]-GTTIMALLTSVLHDDK[MT7].3y4_1.heavy 668.374 / 658.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1327 169 C20140704_OR005_01 C20140704_OR005_01 TB426790.[MT7]-DAGLAK[MT7].2y4_1.heavy 431.765 / 532.357 7502.0 18.706899642944336 48 18 10 10 10 3.7979366916030552 26.330086075708497 0.0 3 0.9810827245041547 8.958721781587297 7502.0 53.016890697470906 0.0 - - - - - - - 171.8 15 10 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1329 169 C20140704_OR005_01 C20140704_OR005_01 TB426790.[MT7]-DAGLAK[MT7].2y5_1.heavy 431.765 / 603.395 9143.0 18.706899642944336 48 18 10 10 10 3.7979366916030552 26.330086075708497 0.0 3 0.9810827245041547 8.958721781587297 9143.0 113.70141025641024 0.0 - - - - - - - 241.54545454545453 18 11 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1331 169 C20140704_OR005_01 C20140704_OR005_01 TB426790.[MT7]-DAGLAK[MT7].2b4_1.heavy 431.765 / 501.279 3673.0 18.706899642944336 48 18 10 10 10 3.7979366916030552 26.330086075708497 0.0 3 0.9810827245041547 8.958721781587297 3673.0 16.90615366799049 0.0 - - - - - - - 182.13333333333333 7 15 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1333 169 C20140704_OR005_01 C20140704_OR005_01 TB426790.[MT7]-DAGLAK[MT7].2b5_1.heavy 431.765 / 572.316 3126.0 18.706899642944336 48 18 10 10 10 3.7979366916030552 26.330086075708497 0.0 3 0.9810827245041547 8.958721781587297 3126.0 18.822196708763876 0.0 - - - - - - - 179.6 6 10 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1335 170 C20140704_OR005_01 C20140704_OR005_01 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 114604.0 40.426900227864586 23 -3 10 6 10 null 0.0 0.03569793701171875 3 0.0 0.0 114604.0 643.9601309183349 0.0 - - - - - - - 735.0 229 9 1337 170 C20140704_OR005_01 C20140704_OR005_01 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 167603.0 40.426900227864586 23 -3 10 6 10 null 0.0 0.03569793701171875 3 0.0 0.0 167603.0 445.5207052939842 0.0 - - - - - - - 660.0 335 7 1339 170 C20140704_OR005_01 C20140704_OR005_01 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 244950.0 40.426900227864586 23 -3 10 6 10 null 0.0 0.03569793701171875 3 0.0 0.0 244950.0 378.1913490853658 0.0 - - - - - - - 330.0 489 7 1341 171 C20140704_OR005_01 C20140704_OR005_01 TB427185.[MT7]-SPMDTFLLIK[MT7].3b6_1.heavy 484.951 / 823.378 2024.0 44.58087348937988 39 15 10 6 8 1.6393480137465244 41.07300943361056 0.03929901123046875 4 0.9556989020932882 5.841691681841159 2024.0 3.9980246913580246 0.0 - - - - - - - 242.8 4 5 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1343 171 C20140704_OR005_01 C20140704_OR005_01 TB427185.[MT7]-SPMDTFLLIK[MT7].3y3_1.heavy 484.951 / 517.383 2834.0 44.58087348937988 39 15 10 6 8 1.6393480137465244 41.07300943361056 0.03929901123046875 4 0.9556989020932882 5.841691681841159 2834.0 54.71584158415841 0.0 - - - - - - - 202.25 5 4 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1345 171 C20140704_OR005_01 C20140704_OR005_01 TB427185.[MT7]-SPMDTFLLIK[MT7].3b4_1.heavy 484.951 / 575.262 2834.0 44.58087348937988 39 15 10 6 8 1.6393480137465244 41.07300943361056 0.03929901123046875 4 0.9556989020932882 5.841691681841159 2834.0 28.43134653465346 1.0 - - - - - - - 101.0 5 4 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1347 171 C20140704_OR005_01 C20140704_OR005_01 TB427185.[MT7]-SPMDTFLLIK[MT7].3b5_1.heavy 484.951 / 676.309 3644.0 44.58087348937988 39 15 10 6 8 1.6393480137465244 41.07300943361056 0.03929901123046875 4 0.9556989020932882 5.841691681841159 3644.0 9.357787732396428 0.0 - - - - - - - 274.7142857142857 7 7 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1349 172 C20140704_OR005_01 C20140704_OR005_01 TB426907.[MT7]-LLPEALIR.2b4_1.heavy 534.849 / 597.373 3345.0 40.205726623535156 46 20 10 6 10 88.6356890645344 1.1282137145364932 0.0364990234375 3 0.9996391482581387 64.96581726745474 3345.0 7.31196102855351 0.0 - - - - - - - 196.375 6 8 SLCO6A1 solute carrier organic anion transporter family, member 6A1 1351 172 C20140704_OR005_01 C20140704_OR005_01 TB426907.[MT7]-LLPEALIR.2y6_1.heavy 534.849 / 698.42 33036.0 40.205726623535156 46 20 10 6 10 88.6356890645344 1.1282137145364932 0.0364990234375 3 0.9996391482581387 64.96581726745474 33036.0 204.63382165605097 0.0 - - - - - - - 209.25 66 8 SLCO6A1 solute carrier organic anion transporter family, member 6A1 1353 172 C20140704_OR005_01 C20140704_OR005_01 TB426907.[MT7]-LLPEALIR.2b5_1.heavy 534.849 / 668.41 2823.0 40.205726623535156 46 20 10 6 10 88.6356890645344 1.1282137145364932 0.0364990234375 3 0.9996391482581387 64.96581726745474 2823.0 -0.5 2.0 - - - - - - - 244.0 7 3 SLCO6A1 solute carrier organic anion transporter family, member 6A1 1355 172 C20140704_OR005_01 C20140704_OR005_01 TB426907.[MT7]-LLPEALIR.2y7_1.heavy 534.849 / 811.504 14845.0 40.205726623535156 46 20 10 6 10 88.6356890645344 1.1282137145364932 0.0364990234375 3 0.9996391482581387 64.96581726745474 14845.0 169.0562062278066 0.0 - - - - - - - 167.6 29 5 SLCO6A1 solute carrier organic anion transporter family, member 6A1 1357 173 C20140704_OR005_01 C20140704_OR005_01 TB426901.[MT7]-GVSPTPSK[MT7].2y4_1.heavy 530.816 / 576.347 906.0 18.03697443008423 30 18 0 6 6 6.271631945576034 15.944813226888945 0.03890037536621094 5 0.9820817866994226 9.205860637421631 906.0 15.251231950844852 2.0 - - - - - - - 176.92307692307693 20 13 TROAP trophinin associated protein (tastin) 1359 173 C20140704_OR005_01 C20140704_OR005_01 TB426901.[MT7]-GVSPTPSK[MT7].2y5_1.heavy 530.816 / 673.4 2789.0 18.03697443008423 30 18 0 6 6 6.271631945576034 15.944813226888945 0.03890037536621094 5 0.9820817866994226 9.205860637421631 2789.0 28.054689151904284 0.0 - - - - - - - 162.5 5 6 TROAP trophinin associated protein (tastin) 1361 173 C20140704_OR005_01 C20140704_OR005_01 TB426901.[MT7]-GVSPTPSK[MT7].2y6_1.heavy 530.816 / 760.432 837.0 18.03697443008423 30 18 0 6 6 6.271631945576034 15.944813226888945 0.03890037536621094 5 0.9820817866994226 9.205860637421631 837.0 11.434985611510792 0.0 - - - - - - - 0.0 1 0 TROAP trophinin associated protein (tastin) 1363 173 C20140704_OR005_01 C20140704_OR005_01 TB426901.[MT7]-GVSPTPSK[MT7].2b5_1.heavy 530.816 / 586.332 976.0 18.03697443008423 30 18 0 6 6 6.271631945576034 15.944813226888945 0.03890037536621094 5 0.9820817866994226 9.205860637421631 976.0 3.6746016643588657 1.0 - - - - - - - 0.0 1 0 TROAP trophinin associated protein (tastin) 1365 174 C20140704_OR005_01 C20140704_OR005_01 TB426902.[MT7]-QEIDEQR.2y6_1.heavy 531.271 / 789.374 1086.0 16.77317476272583 40 14 10 6 10 1.4188772787274215 49.823364192221774 0.03550148010253906 3 0.9373865701242972 4.906096613206549 1086.0 11.077190082644629 0.0 - - - - - - - 144.8 2 10 CDR2 cerebellar degeneration-related protein 2, 62kDa 1367 174 C20140704_OR005_01 C20140704_OR005_01 TB426902.[MT7]-QEIDEQR.2b3_1.heavy 531.271 / 515.295 483.0 16.77317476272583 40 14 10 6 10 1.4188772787274215 49.823364192221774 0.03550148010253906 3 0.9373865701242972 4.906096613206549 483.0 4.790082644628099 4.0 - - - - - - - 0.0 0 0 CDR2 cerebellar degeneration-related protein 2, 62kDa 1369 174 C20140704_OR005_01 C20140704_OR005_01 TB426902.[MT7]-QEIDEQR.2y5_1.heavy 531.271 / 660.331 1509.0 16.77317476272583 40 14 10 6 10 1.4188772787274215 49.823364192221774 0.03550148010253906 3 0.9373865701242972 4.906096613206549 1509.0 7.670055248618786 0.0 - - - - - - - 181.1818181818182 3 11 CDR2 cerebellar degeneration-related protein 2, 62kDa 1371 174 C20140704_OR005_01 C20140704_OR005_01 TB426902.[MT7]-QEIDEQR.2b4_1.heavy 531.271 / 630.321 1811.0 16.77317476272583 40 14 10 6 10 1.4188772787274215 49.823364192221774 0.03550148010253906 3 0.9373865701242972 4.906096613206549 1811.0 9.002900838452124 0.0 - - - - - - - 271.7 3 10 CDR2 cerebellar degeneration-related protein 2, 62kDa 1373 175 C20140704_OR005_01 C20140704_OR005_01 TB427188.[MT7]-DMFASVGADGSVR.3y7_1.heavy 485.905 / 661.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCAF7 DDB1 and CUL4 associated factor 7 1375 175 C20140704_OR005_01 C20140704_OR005_01 TB427188.[MT7]-DMFASVGADGSVR.3b4_1.heavy 485.905 / 609.282 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCAF7 DDB1 and CUL4 associated factor 7 1377 175 C20140704_OR005_01 C20140704_OR005_01 TB427188.[MT7]-DMFASVGADGSVR.3b5_1.heavy 485.905 / 696.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCAF7 DDB1 and CUL4 associated factor 7 1379 175 C20140704_OR005_01 C20140704_OR005_01 TB427188.[MT7]-DMFASVGADGSVR.3b3_1.heavy 485.905 / 538.245 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCAF7 DDB1 and CUL4 associated factor 7 1381 176 C20140704_OR005_01 C20140704_OR005_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 128755.0 35.47439956665039 23 -3 10 10 6 null 0.0 0.0 5 0.0 0.0 128755.0 187.6908126349892 0.0 - - - - - - - 370.4 257 5 1383 176 C20140704_OR005_01 C20140704_OR005_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 22231.0 35.47439956665039 23 -3 10 10 6 null 0.0 0.0 5 0.0 0.0 22231.0 -0.33287321970998507 3.0 - - - - - - - 165.71428571428572 93 7 1385 176 C20140704_OR005_01 C20140704_OR005_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 27557.0 35.47439956665039 23 -3 10 10 6 null 0.0 0.0 5 0.0 0.0 27557.0 229.586636983334 0.0 - - - - - - - 312.6 55 10 1387 177 C20140704_OR005_01 C20140704_OR005_01 TB412831.[MT7]-AELAATLGLSER.3y6_1.heavy 458.928 / 674.383 1717.0 36.19150161743164 50 20 10 10 10 5.953457528977356 16.79696201967822 0.0 3 0.990642789065176 12.748231127976851 1717.0 -0.29813849393436814 2.0 - - - - - - - 245.11111111111111 5 9 CDX2 caudal type homeobox 2 1389 177 C20140704_OR005_01 C20140704_OR005_01 TB412831.[MT7]-AELAATLGLSER.3b4_1.heavy 458.928 / 529.31 10422.0 36.19150161743164 50 20 10 10 10 5.953457528977356 16.79696201967822 0.0 3 0.990642789065176 12.748231127976851 10422.0 35.37935386356827 0.0 - - - - - - - 245.4 20 5 CDX2 caudal type homeobox 2 1391 177 C20140704_OR005_01 C20140704_OR005_01 TB412831.[MT7]-AELAATLGLSER.3b5_1.heavy 458.928 / 600.347 3678.0 36.19150161743164 50 20 10 10 10 5.953457528977356 16.79696201967822 0.0 3 0.990642789065176 12.748231127976851 3678.0 10.694184782608696 0.0 - - - - - - - 257.6 7 10 CDX2 caudal type homeobox 2 1393 177 C20140704_OR005_01 C20140704_OR005_01 TB412831.[MT7]-AELAATLGLSER.3y5_1.heavy 458.928 / 561.299 17165.0 36.19150161743164 50 20 10 10 10 5.953457528977356 16.79696201967822 0.0 3 0.990642789065176 12.748231127976851 17165.0 46.97916582058507 0.0 - - - - - - - 306.5 34 4 CDX2 caudal type homeobox 2 1395 178 C20140704_OR005_01 C20140704_OR005_01 TB412461.[MT7]-EELFVTSK[MT7].3y3_1.heavy 414.239 / 479.295 10410.0 30.94764995574951 40 14 10 6 10 2.1826247836051187 35.48878415312822 0.03869819641113281 3 0.940448589084735 5.031960002420923 10410.0 38.65722441212451 0.0 - - - - - - - 294.4 20 5 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1397 178 C20140704_OR005_01 C20140704_OR005_01 TB412461.[MT7]-EELFVTSK[MT7].3b4_1.heavy 414.239 / 663.347 3470.0 30.94764995574951 40 14 10 6 10 2.1826247836051187 35.48878415312822 0.03869819641113281 3 0.940448589084735 5.031960002420923 3470.0 46.26666666666667 0.0 - - - - - - - 105.0 6 2 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1399 178 C20140704_OR005_01 C20140704_OR005_01 TB412461.[MT7]-EELFVTSK[MT7].3y4_1.heavy 414.239 / 578.363 1262.0 30.94764995574951 40 14 10 6 10 2.1826247836051187 35.48878415312822 0.03869819641113281 3 0.940448589084735 5.031960002420923 1262.0 12.019047619047619 1.0 - - - - - - - 262.75 2 4 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1401 178 C20140704_OR005_01 C20140704_OR005_01 TB412461.[MT7]-EELFVTSK[MT7].3b3_1.heavy 414.239 / 516.279 7360.0 30.94764995574951 40 14 10 6 10 2.1826247836051187 35.48878415312822 0.03869819641113281 3 0.940448589084735 5.031960002420923 7360.0 32.16412698412698 0.0 - - - - - - - 175.0 14 6 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1403 179 C20140704_OR005_01 C20140704_OR005_01 TB427060.[MT7]-NRDPQLNER.2b3_1.heavy 643.34 / 530.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - CNKSR1 connector enhancer of kinase suppressor of Ras 1 1405 179 C20140704_OR005_01 C20140704_OR005_01 TB427060.[MT7]-NRDPQLNER.2y6_1.heavy 643.34 / 756.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - CNKSR1 connector enhancer of kinase suppressor of Ras 1 1407 179 C20140704_OR005_01 C20140704_OR005_01 TB427060.[MT7]-NRDPQLNER.2b7_1.heavy 643.34 / 982.519 N/A N/A - - - - - - - - - 0.0 - - - - - - - CNKSR1 connector enhancer of kinase suppressor of Ras 1 1409 179 C20140704_OR005_01 C20140704_OR005_01 TB427060.[MT7]-NRDPQLNER.2y7_1.heavy 643.34 / 871.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - CNKSR1 connector enhancer of kinase suppressor of Ras 1 1411 180 C20140704_OR005_01 C20140704_OR005_01 TB427479.[MT7]-VQLVGLDEESSEFIC[CAM]R.2y4_1.heavy 1013.01 / 595.302 2229.0 40.32449913024902 31 5 10 6 10 0.5484681772620457 83.45782274708696 0.036602020263671875 3 0.6962679103427474 2.179995210191787 2229.0 13.344312985571587 0.0 - - - - - - - 254.6 4 5 DCAF7 DDB1 and CUL4 associated factor 7 1413 180 C20140704_OR005_01 C20140704_OR005_01 TB427479.[MT7]-VQLVGLDEESSEFIC[CAM]R.2b4_1.heavy 1013.01 / 584.389 12419.0 40.32449913024902 31 5 10 6 10 0.5484681772620457 83.45782274708696 0.036602020263671875 3 0.6962679103427474 2.179995210191787 12419.0 64.7190336577994 0.0 - - - - - - - 225.375 24 8 DCAF7 DDB1 and CUL4 associated factor 7 1415 180 C20140704_OR005_01 C20140704_OR005_01 TB427479.[MT7]-VQLVGLDEESSEFIC[CAM]R.2y9_1.heavy 1013.01 / 1156.49 3503.0 40.32449913024902 31 5 10 6 10 0.5484681772620457 83.45782274708696 0.036602020263671875 3 0.6962679103427474 2.179995210191787 3503.0 17.184528301886793 0.0 - - - - - - - 173.54545454545453 7 11 DCAF7 DDB1 and CUL4 associated factor 7 1417 180 C20140704_OR005_01 C20140704_OR005_01 TB427479.[MT7]-VQLVGLDEESSEFIC[CAM]R.2y7_1.heavy 1013.01 / 898.409 2441.0 40.32449913024902 31 5 10 6 10 0.5484681772620457 83.45782274708696 0.036602020263671875 3 0.6962679103427474 2.179995210191787 2441.0 21.186037735849055 0.0 - - - - - - - 270.0 4 11 DCAF7 DDB1 and CUL4 associated factor 7 1419 181 C20140704_OR005_01 C20140704_OR005_01 TB450943.[MT7]-YYWEVDVSGK[MT7].2y8_1.heavy 767.395 / 1063.55 1434.0 36.82649898529053 43 18 10 5 10 3.4126695378872283 23.46236477116512 0.043598175048828125 3 0.9853739063009064 10.192188167497964 1434.0 3.004469273743017 3.0 - - - - - - - 221.57142857142858 3 7 TRIM22 tripartite motif-containing 22 1421 181 C20140704_OR005_01 C20140704_OR005_01 TB450943.[MT7]-YYWEVDVSGK[MT7].2y5_1.heavy 767.395 / 649.364 1792.0 36.82649898529053 43 18 10 5 10 3.4126695378872283 23.46236477116512 0.043598175048828125 3 0.9853739063009064 10.192188167497964 1792.0 3.2761069020348117 1.0 - - - - - - - 238.66666666666666 3 9 TRIM22 tripartite motif-containing 22 1423 181 C20140704_OR005_01 C20140704_OR005_01 TB450943.[MT7]-YYWEVDVSGK[MT7].2b4_1.heavy 767.395 / 786.358 2151.0 36.82649898529053 43 18 10 5 10 3.4126695378872283 23.46236477116512 0.043598175048828125 3 0.9853739063009064 10.192188167497964 2151.0 15.075378151260502 0.0 - - - - - - - 198.77777777777777 4 9 TRIM22 tripartite motif-containing 22 1425 181 C20140704_OR005_01 C20140704_OR005_01 TB450943.[MT7]-YYWEVDVSGK[MT7].2y7_1.heavy 767.395 / 877.475 1553.0 36.82649898529053 43 18 10 5 10 3.4126695378872283 23.46236477116512 0.043598175048828125 3 0.9853739063009064 10.192188167497964 1553.0 -0.5220168067226894 0.0 - - - - - - - 221.42857142857142 3 7 TRIM22 tripartite motif-containing 22 1427 182 C20140704_OR005_01 C20140704_OR005_01 TB427575.[MT7]-GLDDSLQDYPFEDWQLPGK[MT7].4b8_1.heavy 628.563 / 988.47 8555.0 45.44694995880127 33 8 10 5 10 0.8894213506510106 71.98966228657017 0.042201995849609375 3 0.7702995767773814 2.524028639762103 8555.0 37.19957104154124 0.0 - - - - - - - 226.5 17 8 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1429 182 C20140704_OR005_01 C20140704_OR005_01 TB427575.[MT7]-GLDDSLQDYPFEDWQLPGK[MT7].4b4_1.heavy 628.563 / 545.269 3321.0 45.44694995880127 33 8 10 5 10 0.8894213506510106 71.98966228657017 0.042201995849609375 3 0.7702995767773814 2.524028639762103 3321.0 26.08731886923001 0.0 - - - - - - - 201.1818181818182 6 11 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1431 182 C20140704_OR005_01 C20140704_OR005_01 TB427575.[MT7]-GLDDSLQDYPFEDWQLPGK[MT7].4b9_1.heavy 628.563 / 1151.53 704.0 45.44694995880127 33 8 10 5 10 0.8894213506510106 71.98966228657017 0.042201995849609375 3 0.7702995767773814 2.524028639762103 704.0 -0.23769944638187132 4.0 - - - - - - - 224.0 3 9 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1433 182 C20140704_OR005_01 C20140704_OR005_01 TB427575.[MT7]-GLDDSLQDYPFEDWQLPGK[MT7].4b6_1.heavy 628.563 / 745.385 2818.0 45.44694995880127 33 8 10 5 10 0.8894213506510106 71.98966228657017 0.042201995849609375 3 0.7702995767773814 2.524028639762103 2818.0 7.4649006622516545 0.0 - - - - - - - 193.69230769230768 5 13 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1435 183 C20140704_OR005_01 C20140704_OR005_01 TB427576.[MT7]-IRENIQVFEFQLTSEDMK[MT7].3y3_1.heavy 839.108 / 537.282 4660.0 41.585601806640625 35 5 10 10 10 0.8768888057106167 69.21178229664797 0.0 3 0.6897784741729583 2.155756685988161 4660.0 34.646883203628626 0.0 - - - - - - - 259.0 9 12 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1437 183 C20140704_OR005_01 C20140704_OR005_01 TB427576.[MT7]-IRENIQVFEFQLTSEDMK[MT7].3y6_1.heavy 839.108 / 854.405 10045.0 41.585601806640625 35 5 10 10 10 0.8768888057106167 69.21178229664797 0.0 3 0.6897784741729583 2.155756685988161 10045.0 57.908373590982286 0.0 - - - - - - - 222.0 20 7 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1439 183 C20140704_OR005_01 C20140704_OR005_01 TB427576.[MT7]-IRENIQVFEFQLTSEDMK[MT7].3b6_1.heavy 839.108 / 898.523 3107.0 41.585601806640625 35 5 10 10 10 0.8768888057106167 69.21178229664797 0.0 3 0.6897784741729583 2.155756685988161 3107.0 58.555 0.0 - - - - - - - 163.0 6 7 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1441 183 C20140704_OR005_01 C20140704_OR005_01 TB427576.[MT7]-IRENIQVFEFQLTSEDMK[MT7].3b4_1.heavy 839.108 / 657.38 621.0 41.585601806640625 35 5 10 10 10 0.8768888057106167 69.21178229664797 0.0 3 0.6897784741729583 2.155756685988161 621.0 0.9269111969111967 9.0 - - - - - - - 0.0 1 0 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1443 184 C20140704_OR005_01 C20140704_OR005_01 TB427397.[MT7]-ELLREPAGLSLVLK[MT7].4b8_1.heavy 457.289 / 1010.58 N/A 39.93360137939453 43 15 10 10 8 1.7627718345008812 39.59232027591088 0.0 4 0.958600825302476 6.044449293205115 0.0 0.0 5.0 - - - - - - - 0.0 0 0 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1445 184 C20140704_OR005_01 C20140704_OR005_01 TB427397.[MT7]-ELLREPAGLSLVLK[MT7].4b8_2.heavy 457.289 / 505.791 2459.0 39.93360137939453 43 15 10 10 8 1.7627718345008812 39.59232027591088 0.0 4 0.958600825302476 6.044449293205115 2459.0 31.59929906542056 0.0 - - - - - - - 178.33333333333334 4 3 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1447 184 C20140704_OR005_01 C20140704_OR005_01 TB427397.[MT7]-ELLREPAGLSLVLK[MT7].4y3_1.heavy 457.289 / 503.367 3421.0 39.93360137939453 43 15 10 10 8 1.7627718345008812 39.59232027591088 0.0 4 0.958600825302476 6.044449293205115 3421.0 18.383878504672897 1.0 - - - - - - - 183.42857142857142 6 7 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1449 184 C20140704_OR005_01 C20140704_OR005_01 TB427397.[MT7]-ELLREPAGLSLVLK[MT7].4b10_2.heavy 457.289 / 605.849 2779.0 39.93360137939453 43 15 10 10 8 1.7627718345008812 39.59232027591088 0.0 4 0.958600825302476 6.044449293205115 2779.0 31.81565420560748 0.0 - - - - - - - 256.8 5 5 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1451 185 C20140704_OR005_01 C20140704_OR005_01 TB427579.[MT7]-LQELQVLEEVLGDPELTGEK[MT7].3y7_1.heavy 843.13 / 917.506 13735.0 52.51784896850586 42 15 10 7 10 2.219194045482701 36.134683509361395 0.0298004150390625 3 0.958976027147203 6.07222016997671 13735.0 171.92811636129863 0.0 - - - - - - - 171.3684210526316 27 19 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1453 185 C20140704_OR005_01 C20140704_OR005_01 TB427579.[MT7]-LQELQVLEEVLGDPELTGEK[MT7].3b6_1.heavy 843.13 / 855.506 11199.0 52.51784896850586 42 15 10 7 10 2.219194045482701 36.134683509361395 0.0298004150390625 3 0.958976027147203 6.07222016997671 11199.0 334.4373284589426 0.0 - - - - - - - 124.44444444444444 22 18 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1455 185 C20140704_OR005_01 C20140704_OR005_01 TB427579.[MT7]-LQELQVLEEVLGDPELTGEK[MT7].3b5_1.heavy 843.13 / 756.437 12129.0 52.51784896850586 42 15 10 7 10 2.219194045482701 36.134683509361395 0.0298004150390625 3 0.958976027147203 6.07222016997671 12129.0 138.03569129936096 0.0 - - - - - - - 162.04166666666666 24 24 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1457 185 C20140704_OR005_01 C20140704_OR005_01 TB427579.[MT7]-LQELQVLEEVLGDPELTGEK[MT7].3b3_1.heavy 843.13 / 515.295 5114.0 52.51784896850586 42 15 10 7 10 2.219194045482701 36.134683509361395 0.0298004150390625 3 0.958976027147203 6.07222016997671 5114.0 20.973122254455035 0.0 - - - - - - - 146.0 10 22 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1459 186 C20140704_OR005_01 C20140704_OR005_01 TB450743.[MT7]-TQLIAHDK[MT7].3y3_1.heavy 405.243 / 543.301 22338.0 20.32080078125 50 20 10 10 10 11.83038042782127 8.452813551526372 0.0 3 0.9988170950315156 35.87935455187773 22338.0 313.53939759036143 0.0 - - - - - - - 202.88888888888889 44 9 DCAF7 DDB1 and CUL4 associated factor 7 1461 186 C20140704_OR005_01 C20140704_OR005_01 TB450743.[MT7]-TQLIAHDK[MT7].3b4_1.heavy 405.243 / 600.384 15113.0 20.32080078125 50 20 10 10 10 11.83038042782127 8.452813551526372 0.0 3 0.9988170950315156 35.87935455187773 15113.0 209.39698795180723 0.0 - - - - - - - 249.0 30 8 DCAF7 DDB1 and CUL4 associated factor 7 1463 186 C20140704_OR005_01 C20140704_OR005_01 TB450743.[MT7]-TQLIAHDK[MT7].3y4_1.heavy 405.243 / 614.338 15363.0 20.32080078125 50 20 10 10 10 11.83038042782127 8.452813551526372 0.0 3 0.9988170950315156 35.87935455187773 15363.0 199.90409638554215 0.0 - - - - - - - 193.66666666666666 30 6 DCAF7 DDB1 and CUL4 associated factor 7 1465 186 C20140704_OR005_01 C20140704_OR005_01 TB450743.[MT7]-TQLIAHDK[MT7].3b3_1.heavy 405.243 / 487.3 59291.0 20.32080078125 50 20 10 10 10 11.83038042782127 8.452813551526372 0.0 3 0.9988170950315156 35.87935455187773 59291.0 430.7923728246319 0.0 - - - - - - - 228.25 118 8 DCAF7 DDB1 and CUL4 associated factor 7 1467 187 C20140704_OR005_01 C20140704_OR005_01 TB450647.[MT7]-VPDLSGMLQVLK[MT7].3y3_1.heavy 529.984 / 503.367 1527.0 47.339599609375 39 14 9 10 6 1.421228192911766 46.907785110906204 0.0 5 0.9307501352339892 4.662450442303511 1527.0 3.364250614250614 2.0 - - - - - - - 237.66666666666666 4 3 TRIM22 tripartite motif-containing 22 1469 187 C20140704_OR005_01 C20140704_OR005_01 TB450647.[MT7]-VPDLSGMLQVLK[MT7].3b6_1.heavy 529.984 / 713.395 1323.0 47.339599609375 39 14 9 10 6 1.421228192911766 46.907785110906204 0.0 5 0.9307501352339892 4.662450442303511 1323.0 20.752941176470586 1.0 - - - - - - - 122.4 4 5 TRIM22 tripartite motif-containing 22 1471 187 C20140704_OR005_01 C20140704_OR005_01 TB450647.[MT7]-VPDLSGMLQVLK[MT7].3b4_1.heavy 529.984 / 569.341 1018.0 47.339599609375 39 14 9 10 6 1.421228192911766 46.907785110906204 0.0 5 0.9307501352339892 4.662450442303511 1018.0 16.46764705882353 2.0 - - - - - - - 102.0 2 2 TRIM22 tripartite motif-containing 22 1473 187 C20140704_OR005_01 C20140704_OR005_01 TB450647.[MT7]-VPDLSGMLQVLK[MT7].3b7_1.heavy 529.984 / 844.435 1934.0 47.339599609375 39 14 9 10 6 1.421228192911766 46.907785110906204 0.0 5 0.9307501352339892 4.662450442303511 1934.0 20.382843137254902 0.0 - - - - - - - 122.4 3 5 TRIM22 tripartite motif-containing 22 1475 188 C20140704_OR005_01 C20140704_OR005_01 TB427193.[MT7]-YRVVYTDHQR.3y6_1.heavy 494.264 / 819.374 517.0 20.688466389973957 38 13 10 5 10 1.892789925121257 52.832064812260526 0.04129981994628906 3 0.9050905693458903 3.973849525263786 517.0 9.017441860465116 1.0 - - - - - - - 0.0 1 0 CDX1;CDX2;CDX4 caudal type homeobox 1;caudal type homeobox 2;caudal type homeobox 4 1477 188 C20140704_OR005_01 C20140704_OR005_01 TB427193.[MT7]-YRVVYTDHQR.3b7_1.heavy 494.264 / 1041.55 N/A 20.688466389973957 38 13 10 5 10 1.892789925121257 52.832064812260526 0.04129981994628906 3 0.9050905693458903 3.973849525263786 86.0 0.0 2.0 - - - - - - - 0.0 0 0 CDX1;CDX2;CDX4 caudal type homeobox 1;caudal type homeobox 2;caudal type homeobox 4 1479 188 C20140704_OR005_01 C20140704_OR005_01 TB427193.[MT7]-YRVVYTDHQR.3y5_1.heavy 494.264 / 656.311 1294.0 20.688466389973957 38 13 10 5 10 1.892789925121257 52.832064812260526 0.04129981994628906 3 0.9050905693458903 3.973849525263786 1294.0 21.366046511627907 0.0 - - - - - - - 198.1 2 10 CDX1;CDX2;CDX4 caudal type homeobox 1;caudal type homeobox 2;caudal type homeobox 4 1481 188 C20140704_OR005_01 C20140704_OR005_01 TB427193.[MT7]-YRVVYTDHQR.3b7_2.heavy 494.264 / 521.278 5692.0 20.688466389973957 38 13 10 5 10 1.892789925121257 52.832064812260526 0.04129981994628906 3 0.9050905693458903 3.973849525263786 5692.0 39.236314986082434 0.0 - - - - - - - 301.75 11 8 CDX1;CDX2;CDX4 caudal type homeobox 1;caudal type homeobox 2;caudal type homeobox 4 1483 189 C20140704_OR005_01 C20140704_OR005_01 TB427059.[MT7]-DVSMYPSSVR.2y8_1.heavy 642.822 / 926.44 41244.0 27.557600021362305 50 20 10 10 10 11.344095398840414 8.815158589923524 0.0 3 0.9975350676559149 24.852530690038904 41244.0 537.7894117647058 0.0 - - - - - - - 272.0 82 3 CDX2 caudal type homeobox 2 1485 189 C20140704_OR005_01 C20140704_OR005_01 TB427059.[MT7]-DVSMYPSSVR.2y5_1.heavy 642.822 / 545.304 36139.0 27.557600021362305 50 20 10 10 10 11.344095398840414 8.815158589923524 0.0 3 0.9975350676559149 24.852530690038904 36139.0 194.67760798378134 0.0 - - - - - - - 218.57142857142858 72 7 CDX2 caudal type homeobox 2 1487 189 C20140704_OR005_01 C20140704_OR005_01 TB427059.[MT7]-DVSMYPSSVR.2y9_1.heavy 642.822 / 1025.51 32770.0 27.557600021362305 50 20 10 10 10 11.344095398840414 8.815158589923524 0.0 3 0.9975350676559149 24.852530690038904 32770.0 359.8274509803921 0.0 - - - - - - - 187.0 65 6 CDX2 caudal type homeobox 2 1489 189 C20140704_OR005_01 C20140704_OR005_01 TB427059.[MT7]-DVSMYPSSVR.2y6_1.heavy 642.822 / 708.367 21336.0 27.557600021362305 50 20 10 10 10 11.344095398840414 8.815158589923524 0.0 3 0.9975350676559149 24.852530690038904 21336.0 97.56450116751431 0.0 - - - - - - - 181.33333333333334 42 9 CDX2 caudal type homeobox 2 1491 190 C20140704_OR005_01 C20140704_OR005_01 TB451102.[MT7]-NLLQLC[CAM]PQSLEALAVR.2y10_1.heavy 985.055 / 1083.62 18318.0 46.197649002075195 35 14 10 1 10 1.2408631318177004 52.915196479550886 0.132598876953125 3 0.9411196119746823 5.060841105781195 18318.0 -1.5088962108731465 0.0 - - - - - - - 236.0 36 3 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1493 190 C20140704_OR005_01 C20140704_OR005_01 TB451102.[MT7]-NLLQLC[CAM]PQSLEALAVR.2y11_1.heavy 985.055 / 1243.65 5465.0 46.197649002075195 35 14 10 1 10 1.2408631318177004 52.915196479550886 0.132598876953125 3 0.9411196119746823 5.060841105781195 5465.0 56.10626451534043 0.0 - - - - - - - 168.5 10 6 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1495 190 C20140704_OR005_01 C20140704_OR005_01 TB451102.[MT7]-NLLQLC[CAM]PQSLEALAVR.2y5_1.heavy 985.055 / 529.346 2935.0 46.197649002075195 35 14 10 1 10 1.2408631318177004 52.915196479550886 0.132598876953125 3 0.9411196119746823 5.060841105781195 2935.0 14.428380392641447 0.0 - - - - - - - 236.16666666666666 5 6 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1497 190 C20140704_OR005_01 C20140704_OR005_01 TB451102.[MT7]-NLLQLC[CAM]PQSLEALAVR.2b4_1.heavy 985.055 / 613.379 14978.0 46.197649002075195 35 14 10 1 10 1.2408631318177004 52.915196479550886 0.132598876953125 3 0.9411196119746823 5.060841105781195 14978.0 28.70247532528036 0.0 - - - - - - - 151.5 29 2 CNKSR1 connector enhancer of kinase suppressor of Ras 1 1499 191 C20140704_OR005_01 C20140704_OR005_01 TB427055.[MT7]-ELEETNQK[MT7].2y4_1.heavy 639.843 / 634.364 2106.0 18.99250030517578 48 18 10 10 10 4.213510827977829 23.73317741015336 0.0 3 0.9810643640867439 8.954363643096972 2106.0 10.917794585424472 0.0 - - - - - - - 250.66666666666666 4 9 CDR2 cerebellar degeneration-related protein 2, 62kDa 1501 191 C20140704_OR005_01 C20140704_OR005_01 TB427055.[MT7]-ELEETNQK[MT7].2b3_1.heavy 639.843 / 516.279 2482.0 18.99250030517578 48 18 10 10 10 4.213510827977829 23.73317741015336 0.0 3 0.9810643640867439 8.954363643096972 2482.0 26.474666666666668 0.0 - - - - - - - 150.1 4 10 CDR2 cerebellar degeneration-related protein 2, 62kDa 1503 191 C20140704_OR005_01 C20140704_OR005_01 TB427055.[MT7]-ELEETNQK[MT7].2y6_1.heavy 639.843 / 892.449 1654.0 18.99250030517578 48 18 10 10 10 4.213510827977829 23.73317741015336 0.0 3 0.9810643640867439 8.954363643096972 1654.0 21.890377668308705 1.0 - - - - - - - 135.2 4 5 CDR2 cerebellar degeneration-related protein 2, 62kDa 1505 191 C20140704_OR005_01 C20140704_OR005_01 TB427055.[MT7]-ELEETNQK[MT7].2y7_1.heavy 639.843 / 1005.53 4061.0 18.99250030517578 48 18 10 10 10 4.213510827977829 23.73317741015336 0.0 3 0.9810643640867439 8.954363643096972 4061.0 78.51266666666668 0.0 - - - - - - - 159.5 8 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 1507 192 C20140704_OR005_01 C20140704_OR005_01 TB451083.[MT7]-EWVTQATALWTANK[MT7].3b5_1.heavy 636.347 / 788.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPA2 carboxypeptidase A2 (pancreatic) 1509 192 C20140704_OR005_01 C20140704_OR005_01 TB451083.[MT7]-EWVTQATALWTANK[MT7].3y4_1.heavy 636.347 / 577.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPA2 carboxypeptidase A2 (pancreatic) 1511 192 C20140704_OR005_01 C20140704_OR005_01 TB451083.[MT7]-EWVTQATALWTANK[MT7].3b3_1.heavy 636.347 / 559.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPA2 carboxypeptidase A2 (pancreatic) 1513 192 C20140704_OR005_01 C20140704_OR005_01 TB451083.[MT7]-EWVTQATALWTANK[MT7].3y5_1.heavy 636.347 / 763.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPA2 carboxypeptidase A2 (pancreatic) 1515 193 C20140704_OR005_01 C20140704_OR005_01 TB426921.[MT7]-AENHVVK[MT7].2y4_1.heavy 542.821 / 626.411 1753.0 15.745800018310547 32 14 2 10 6 2.613135081209447 38.26820921699793 0.0 5 0.94062488442137 5.039500551090259 1753.0 7.5716431924882635 1.0 - - - - - - - 140.0909090909091 3 11 SDCCAG3 serologically defined colon cancer antigen 3 1517 193 C20140704_OR005_01 C20140704_OR005_01 TB426921.[MT7]-AENHVVK[MT7].2b4_1.heavy 542.821 / 596.291 2497.0 15.745800018310547 32 14 2 10 6 2.613135081209447 38.26820921699793 0.0 5 0.94062488442137 5.039500551090259 2497.0 33.84298742138365 1.0 - - - - - - - 115.0 12 6 SDCCAG3 serologically defined colon cancer antigen 3 1519 193 C20140704_OR005_01 C20140704_OR005_01 TB426921.[MT7]-AENHVVK[MT7].2b6_1.heavy 542.821 / 794.428 691.0 15.745800018310547 32 14 2 10 6 2.613135081209447 38.26820921699793 0.0 5 0.94062488442137 5.039500551090259 691.0 6.388490566037736 1.0 - - - - - - - 159.33333333333334 2 6 SDCCAG3 serologically defined colon cancer antigen 3 1521 193 C20140704_OR005_01 C20140704_OR005_01 TB426921.[MT7]-AENHVVK[MT7].2b5_1.heavy 542.821 / 695.359 1913.0 15.745800018310547 32 14 2 10 6 2.613135081209447 38.26820921699793 0.0 5 0.94062488442137 5.039500551090259 1913.0 15.383968411595024 0.0 - - - - - - - 166.85714285714286 3 7 SDCCAG3 serologically defined colon cancer antigen 3 1523 194 C20140704_OR005_01 C20140704_OR005_01 TB413109.[MT7]-LDDFDELSEVAQK[MT7].2y4_1.heavy 898.961 / 589.379 2583.0 38.89522457122803 43 17 10 6 10 3.22711386415144 30.987440855699308 0.039302825927734375 3 0.9795160071908033 8.608171724097751 2583.0 17.261 0.0 - - - - - - - 182.625 5 8 CPA2 carboxypeptidase A2 (pancreatic) 1525 194 C20140704_OR005_01 C20140704_OR005_01 TB413109.[MT7]-LDDFDELSEVAQK[MT7].2b6_1.heavy 898.961 / 879.385 3481.0 38.89522457122803 43 17 10 6 10 3.22711386415144 30.987440855699308 0.039302825927734375 3 0.9795160071908033 8.608171724097751 3481.0 28.093928571428574 1.0 - - - - - - - 280.6666666666667 6 12 CPA2 carboxypeptidase A2 (pancreatic) 1527 194 C20140704_OR005_01 C20140704_OR005_01 TB413109.[MT7]-LDDFDELSEVAQK[MT7].2b7_1.heavy 898.961 / 992.469 2808.0 38.89522457122803 43 17 10 6 10 3.22711386415144 30.987440855699308 0.039302825927734375 3 0.9795160071908033 8.608171724097751 2808.0 25.817987591473113 0.0 - - - - - - - 194.6 5 15 CPA2 carboxypeptidase A2 (pancreatic) 1529 194 C20140704_OR005_01 C20140704_OR005_01 TB413109.[MT7]-LDDFDELSEVAQK[MT7].2b5_1.heavy 898.961 / 750.343 4604.0 38.89522457122803 43 17 10 6 10 3.22711386415144 30.987440855699308 0.039302825927734375 3 0.9795160071908033 8.608171724097751 4604.0 24.22071348499835 0.0 - - - - - - - 238.625 9 8 CPA2 carboxypeptidase A2 (pancreatic) 1531 195 C20140704_OR005_01 C20140704_OR005_01 TB426922.[MT7]-GVEPLEAAR.2y8_1.heavy 543.307 / 884.484 4909.0 25.909000396728516 50 20 10 10 10 9.48838807221936 10.539197937401577 0.0 3 0.9958991337726238 19.265311764682743 4909.0 60.67899613591365 0.0 - - - - - - - 187.33333333333334 9 6 SLCO6A1 solute carrier organic anion transporter family, member 6A1 1533 195 C20140704_OR005_01 C20140704_OR005_01 TB426922.[MT7]-GVEPLEAAR.2b4_1.heavy 543.307 / 527.295 3068.0 25.909000396728516 50 20 10 10 10 9.48838807221936 10.539197937401577 0.0 3 0.9958991337726238 19.265311764682743 3068.0 9.995114271985646 0.0 - - - - - - - 652.0 6 8 SLCO6A1 solute carrier organic anion transporter family, member 6A1 1535 195 C20140704_OR005_01 C20140704_OR005_01 TB426922.[MT7]-GVEPLEAAR.2y6_1.heavy 543.307 / 656.373 30987.0 25.909000396728516 50 20 10 10 10 9.48838807221936 10.539197937401577 0.0 3 0.9958991337726238 19.265311764682743 30987.0 385.1220258249641 0.0 - - - - - - - 204.66666666666666 61 12 SLCO6A1 solute carrier organic anion transporter family, member 6A1 1537 195 C20140704_OR005_01 C20140704_OR005_01 TB426922.[MT7]-GVEPLEAAR.2y7_1.heavy 543.307 / 785.415 5113.0 25.909000396728516 50 20 10 10 10 9.48838807221936 10.539197937401577 0.0 3 0.9958991337726238 19.265311764682743 5113.0 19.783697745296976 1.0 - - - - - - - 170.33333333333334 12 6 SLCO6A1 solute carrier organic anion transporter family, member 6A1 1539 196 C20140704_OR005_01 C20140704_OR005_01 TB426820.[MT7]-AVEVTK[MT7].2y4_1.heavy 467.794 / 620.374 8547.0 20.20044994354248 46 20 10 6 10 8.358308611093845 11.964143064455845 0.036998748779296875 3 0.9953726805887487 18.135520303049177 8547.0 127.76253882600683 0.0 - - - - - - - 211.71428571428572 17 14 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1541 196 C20140704_OR005_01 C20140704_OR005_01 TB426820.[MT7]-AVEVTK[MT7].2y5_1.heavy 467.794 / 719.442 8373.0 20.20044994354248 46 20 10 6 10 8.358308611093845 11.964143064455845 0.036998748779296875 3 0.9953726805887487 18.135520303049177 8373.0 57.43597272996739 0.0 - - - - - - - 203.33333333333334 16 9 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1543 196 C20140704_OR005_01 C20140704_OR005_01 TB426820.[MT7]-AVEVTK[MT7].2b4_1.heavy 467.794 / 543.326 3663.0 20.20044994354248 46 20 10 6 10 8.358308611093845 11.964143064455845 0.036998748779296875 3 0.9953726805887487 18.135520303049177 3663.0 22.928702290076334 0.0 - - - - - - - 200.6 7 10 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1545 196 C20140704_OR005_01 C20140704_OR005_01 TB426820.[MT7]-AVEVTK[MT7].2y3_1.heavy 467.794 / 491.331 10466.0 20.20044994354248 46 20 10 6 10 8.358308611093845 11.964143064455845 0.036998748779296875 3 0.9953726805887487 18.135520303049177 10466.0 83.22681223857985 1.0 - - - - - - - 237.72727272727272 20 11 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1547 197 C20140704_OR005_01 C20140704_OR005_01 TB450855.[MT7]-QNADVALQNLR.2b4_1.heavy 693.385 / 573.275 16210.0 29.554325580596924 44 18 10 6 10 3.497660371810551 22.88787691608335 0.03569984436035156 3 0.9835008013482234 9.594713333580541 16210.0 46.40509803921569 0.0 - - - - - - - 192.66666666666666 32 9 SDCCAG3 serologically defined colon cancer antigen 3 1549 197 C20140704_OR005_01 C20140704_OR005_01 TB450855.[MT7]-QNADVALQNLR.2b6_1.heavy 693.385 / 743.38 4894.0 29.554325580596924 44 18 10 6 10 3.497660371810551 22.88787691608335 0.03569984436035156 3 0.9835008013482234 9.594713333580541 4894.0 39.29865281937156 0.0 - - - - - - - 183.6 9 5 SDCCAG3 serologically defined colon cancer antigen 3 1551 197 C20140704_OR005_01 C20140704_OR005_01 TB450855.[MT7]-QNADVALQNLR.2y10_1.heavy 693.385 / 1113.6 14375.0 29.554325580596924 44 18 10 6 10 3.497660371810551 22.88787691608335 0.03569984436035156 3 0.9835008013482234 9.594713333580541 14375.0 90.19607843137256 0.0 - - - - - - - 224.4 28 10 SDCCAG3 serologically defined colon cancer antigen 3 1553 197 C20140704_OR005_01 C20140704_OR005_01 TB450855.[MT7]-QNADVALQNLR.2y7_1.heavy 693.385 / 813.494 12336.0 29.554325580596924 44 18 10 6 10 3.497660371810551 22.88787691608335 0.03569984436035156 3 0.9835008013482234 9.594713333580541 12336.0 66.11450980392156 0.0 - - - - - - - 255.0 24 10 SDCCAG3 serologically defined colon cancer antigen 3 1555 198 C20140704_OR005_01 C20140704_OR005_01 TB412896.[MT7]-DFIDC[CAM]FLIK[MT7].2y5_1.heavy 729.899 / 824.482 2744.0 45.585201263427734 35 7 10 10 8 0.5403729212414713 95.1178381923433 0.0 4 0.74890667247681 2.4093923341815846 2744.0 40.284029749830964 0.0 - - - - - - - 178.0 5 4 CYP2C19;CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 19;cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1557 198 C20140704_OR005_01 C20140704_OR005_01 TB412896.[MT7]-DFIDC[CAM]FLIK[MT7].2b4_1.heavy 729.899 / 635.316 915.0 45.585201263427734 35 7 10 10 8 0.5403729212414713 95.1178381923433 0.0 4 0.74890667247681 2.4093923341815846 915.0 -0.2626691771429609 3.0 - - - - - - - 190.5 3 8 CYP2C19;CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 19;cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1559 198 C20140704_OR005_01 C20140704_OR005_01 TB412896.[MT7]-DFIDC[CAM]FLIK[MT7].2y6_1.heavy 729.899 / 939.509 2236.0 45.585201263427734 35 7 10 10 8 0.5403729212414713 95.1178381923433 0.0 4 0.74890667247681 2.4093923341815846 2236.0 28.42082777938762 0.0 - - - - - - - 203.25 4 8 CYP2C19;CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 19;cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1561 198 C20140704_OR005_01 C20140704_OR005_01 TB412896.[MT7]-DFIDC[CAM]FLIK[MT7].2b5_1.heavy 729.899 / 795.346 813.0 45.585201263427734 35 7 10 10 8 0.5403729212414713 95.1178381923433 0.0 4 0.74890667247681 2.4093923341815846 813.0 4.644768240176875 3.0 - - - - - - - 0.0 1 0 CYP2C19;CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 19;cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1563 199 C20140704_OR005_01 C20140704_OR005_01 TB426825.[MT7]-SYNEQR.2y4_1.heavy 470.734 / 546.263 479.0 14.492700099945068 44 18 10 6 10 3.6634315328552796 27.296811501226546 0.03800010681152344 3 0.9842932231937704 9.834419784695042 479.0 9.929130487954017 0.0 - - - - - - - 0.0 0 0 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1565 199 C20140704_OR005_01 C20140704_OR005_01 TB426825.[MT7]-SYNEQR.2b3_1.heavy 470.734 / 509.248 994.0 14.492700099945068 44 18 10 6 10 3.6634315328552796 27.296811501226546 0.03800010681152344 3 0.9842932231937704 9.834419784695042 994.0 11.932020592020592 0.0 - - - - - - - 0.0 1 0 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1567 199 C20140704_OR005_01 C20140704_OR005_01 TB426825.[MT7]-SYNEQR.2y5_1.heavy 470.734 / 709.326 1989.0 14.492700099945068 44 18 10 6 10 3.6634315328552796 27.296811501226546 0.03800010681152344 3 0.9842932231937704 9.834419784695042 1989.0 66.44481744471744 0.0 - - - - - - - 89.42857142857143 3 7 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1569 199 C20140704_OR005_01 C20140704_OR005_01 TB426825.[MT7]-SYNEQR.2b4_1.heavy 470.734 / 638.29 1915.0 14.492700099945068 44 18 10 6 10 3.6634315328552796 27.296811501226546 0.03800010681152344 3 0.9842932231937704 9.834419784695042 1915.0 75.56486486486486 0.0 - - - - - - - 122.83333333333333 3 6 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1571 200 C20140704_OR005_01 C20140704_OR005_01 TB412893.[MT7]-VK[MT7]YEELLK[MT7].2y4_1.heavy 727.453 / 646.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDR2 cerebellar degeneration-related protein 2, 62kDa 1573 200 C20140704_OR005_01 C20140704_OR005_01 TB412893.[MT7]-VK[MT7]YEELLK[MT7].2b6_1.heavy 727.453 / 1050.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDR2 cerebellar degeneration-related protein 2, 62kDa 1575 200 C20140704_OR005_01 C20140704_OR005_01 TB412893.[MT7]-VK[MT7]YEELLK[MT7].2y3_1.heavy 727.453 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDR2 cerebellar degeneration-related protein 2, 62kDa 1577 200 C20140704_OR005_01 C20140704_OR005_01 TB412893.[MT7]-VK[MT7]YEELLK[MT7].2b5_1.heavy 727.453 / 937.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDR2 cerebellar degeneration-related protein 2, 62kDa 1579 201 C20140704_OR005_01 C20140704_OR005_01 TB413104.[MT7]-GVYPDLLATSGDYLR.2y8_1.heavy 892.471 / 882.432 10981.0 42.10757541656494 44 18 10 6 10 3.300652456621102 25.89509807122417 0.039699554443359375 3 0.9814332921705214 9.043169425732877 10981.0 108.75566140320434 0.0 - - - - - - - 229.0 21 8 DCAF7 DDB1 and CUL4 associated factor 7 1581 201 C20140704_OR005_01 C20140704_OR005_01 TB413104.[MT7]-GVYPDLLATSGDYLR.2y9_1.heavy 892.471 / 995.516 8337.0 42.10757541656494 44 18 10 6 10 3.300652456621102 25.89509807122417 0.039699554443359375 3 0.9814332921705214 9.043169425732877 8337.0 77.6203448275862 0.0 - - - - - - - 223.8 16 10 DCAF7 DDB1 and CUL4 associated factor 7 1583 201 C20140704_OR005_01 C20140704_OR005_01 TB413104.[MT7]-GVYPDLLATSGDYLR.2y10_1.heavy 892.471 / 1108.6 16674.0 42.10757541656494 44 18 10 6 10 3.300652456621102 25.89509807122417 0.039699554443359375 3 0.9814332921705214 9.043169425732877 16674.0 68.87507588874561 0.0 - - - - - - - 156.6153846153846 33 13 DCAF7 DDB1 and CUL4 associated factor 7 1585 201 C20140704_OR005_01 C20140704_OR005_01 TB413104.[MT7]-GVYPDLLATSGDYLR.2b5_1.heavy 892.471 / 676.342 14031.0 42.10757541656494 44 18 10 6 10 3.300652456621102 25.89509807122417 0.039699554443359375 3 0.9814332921705214 9.043169425732877 14031.0 172.09736354869818 0.0 - - - - - - - 213.5 28 10 DCAF7 DDB1 and CUL4 associated factor 7 1587 202 C20140704_OR005_01 C20140704_OR005_01 TB413254.[MT7]-EFPNPNIFDPGHFLDK[MT7].4y4_1.heavy 544.533 / 666.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1589 202 C20140704_OR005_01 C20140704_OR005_01 TB413254.[MT7]-EFPNPNIFDPGHFLDK[MT7].4b4_1.heavy 544.533 / 632.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1591 202 C20140704_OR005_01 C20140704_OR005_01 TB413254.[MT7]-EFPNPNIFDPGHFLDK[MT7].4y7_1.heavy 544.533 / 957.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1593 202 C20140704_OR005_01 C20140704_OR005_01 TB413254.[MT7]-EFPNPNIFDPGHFLDK[MT7].4y3_1.heavy 544.533 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1595 203 C20140704_OR005_01 C20140704_OR005_01 TB427028.[MT7]-VNLVSGHVK[MT7].2y8_1.heavy 620.884 / 997.591 2919.0 25.06302547454834 33 17 2 6 8 3.6531558234053185 27.37359281509766 0.039501190185546875 4 0.9707867383724678 7.2029329818843735 2919.0 5.299337748344371 2.0 - - - - - - - 201.33333333333334 18 9 DCAF7 DDB1 and CUL4 associated factor 7 1597 203 C20140704_OR005_01 C20140704_OR005_01 TB427028.[MT7]-VNLVSGHVK[MT7].2y5_1.heavy 620.884 / 671.396 4428.0 25.06302547454834 33 17 2 6 8 3.6531558234053185 27.37359281509766 0.039501190185546875 4 0.9707867383724678 7.2029329818843735 4428.0 34.41762973213403 0.0 - - - - - - - 186.0 8 13 DCAF7 DDB1 and CUL4 associated factor 7 1599 203 C20140704_OR005_01 C20140704_OR005_01 TB427028.[MT7]-VNLVSGHVK[MT7].2y3_1.heavy 620.884 / 527.342 906.0 25.06302547454834 33 17 2 6 8 3.6531558234053185 27.37359281509766 0.039501190185546875 4 0.9707867383724678 7.2029329818843735 906.0 6.102655354998721 3.0 - - - - - - - 181.2 2 10 DCAF7 DDB1 and CUL4 associated factor 7 1601 203 C20140704_OR005_01 C20140704_OR005_01 TB427028.[MT7]-VNLVSGHVK[MT7].2y6_1.heavy 620.884 / 770.464 1610.0 25.06302547454834 33 17 2 6 8 3.6531558234053185 27.37359281509766 0.039501190185546875 4 0.9707867383724678 7.2029329818843735 1610.0 8.273854238740075 0.0 - - - - - - - 201.35714285714286 3 14 DCAF7 DDB1 and CUL4 associated factor 7 1603 204 C20140704_OR005_01 C20140704_OR005_01 TB427123.[MT7]-K[MT7]LQIFC[CAM]K[MT7].3y3_1.heavy 456.951 / 598.314 24875.0 29.902599334716797 45 15 10 10 10 2.767529410353479 36.13331067987734 0.0 3 0.9566064735867815 5.902918510571039 24875.0 117.33059302635371 0.0 - - - - - - - 237.64705882352942 49 17 TRIM22 tripartite motif-containing 22 1605 204 C20140704_OR005_01 C20140704_OR005_01 TB427123.[MT7]-K[MT7]LQIFC[CAM]K[MT7].3b3_2.heavy 456.951 / 329.728 40345.0 29.902599334716797 45 15 10 10 10 2.767529410353479 36.13331067987734 0.0 3 0.9566064735867815 5.902918510571039 40345.0 186.4125412541254 0.0 - - - - - - - 252.5 80 6 TRIM22 tripartite motif-containing 22 1607 204 C20140704_OR005_01 C20140704_OR005_01 TB427123.[MT7]-K[MT7]LQIFC[CAM]K[MT7].3y4_1.heavy 456.951 / 711.398 4146.0 29.902599334716797 45 15 10 10 10 2.767529410353479 36.13331067987734 0.0 3 0.9566064735867815 5.902918510571039 4146.0 39.40752475247525 0.0 - - - - - - - 176.75 8 4 TRIM22 tripartite motif-containing 22 1609 204 C20140704_OR005_01 C20140704_OR005_01 TB427123.[MT7]-K[MT7]LQIFC[CAM]K[MT7].3b3_1.heavy 456.951 / 658.449 6471.0 29.902599334716797 45 15 10 10 10 2.767529410353479 36.13331067987734 0.0 3 0.9566064735867815 5.902918510571039 6471.0 58.94376237623763 0.0 - - - - - - - 168.33333333333334 12 9 TRIM22 tripartite motif-containing 22 1611 205 C20140704_OR005_01 C20140704_OR005_01 TB426927.[MT7]-QLNALNK[MT7].2b3_1.heavy 544.837 / 500.295 5835.0 24.26177453994751 42 16 10 6 10 2.6597097849053157 31.661321963253833 0.03890037536621094 3 0.9683141823893163 6.914749354724647 5835.0 10.170434765063305 0.0 - - - - - - - 649.1818181818181 11 11 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1613 205 C20140704_OR005_01 C20140704_OR005_01 TB426927.[MT7]-QLNALNK[MT7].2y5_1.heavy 544.837 / 703.422 7948.0 24.26177453994751 42 16 10 6 10 2.6597097849053157 31.661321963253833 0.03890037536621094 3 0.9683141823893163 6.914749354724647 7948.0 87.82563451576945 0.0 - - - - - - - 179.0 15 9 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1615 205 C20140704_OR005_01 C20140704_OR005_01 TB426927.[MT7]-QLNALNK[MT7].2y3_1.heavy 544.837 / 518.342 5030.0 24.26177453994751 42 16 10 6 10 2.6597097849053157 31.661321963253833 0.03890037536621094 3 0.9683141823893163 6.914749354724647 5030.0 14.837570176639737 0.0 - - - - - - - 283.45454545454544 10 11 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1617 205 C20140704_OR005_01 C20140704_OR005_01 TB426927.[MT7]-QLNALNK[MT7].2y6_1.heavy 544.837 / 816.506 10564.0 24.26177453994751 42 16 10 6 10 2.6597097849053157 31.661321963253833 0.03890037536621094 3 0.9683141823893163 6.914749354724647 10564.0 142.48729028126695 0.0 - - - - - - - 201.25 21 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1619 206 C20140704_OR005_01 C20140704_OR005_01 TB412480.[MT7]-GFNEMR.2y4_1.heavy 449.222 / 549.245 2540.0 23.50635051727295 44 18 10 6 10 3.493338144255386 24.12504711985325 0.03750038146972656 3 0.9831701678991376 9.499735163137423 2540.0 29.038641959851425 0.0 - - - - - - - 228.0 5 9 TRIM22 tripartite motif-containing 22 1621 206 C20140704_OR005_01 C20140704_OR005_01 TB412480.[MT7]-GFNEMR.2b3_1.heavy 449.222 / 463.242 11920.0 23.50635051727295 44 18 10 6 10 3.493338144255386 24.12504711985325 0.03750038146972656 3 0.9831701678991376 9.499735163137423 11920.0 69.88517590936195 0.0 - - - - - - - 211.66666666666666 23 6 TRIM22 tripartite motif-containing 22 1623 206 C20140704_OR005_01 C20140704_OR005_01 TB412480.[MT7]-GFNEMR.2y5_1.heavy 449.222 / 696.313 3517.0 23.50635051727295 44 18 10 6 10 3.493338144255386 24.12504711985325 0.03750038146972656 3 0.9831701678991376 9.499735163137423 3517.0 11.991409556313993 0.0 - - - - - - - 228.0 7 9 TRIM22 tripartite motif-containing 22 1625 206 C20140704_OR005_01 C20140704_OR005_01 TB412480.[MT7]-GFNEMR.2b4_1.heavy 449.222 / 592.285 15730.0 23.50635051727295 44 18 10 6 10 3.493338144255386 24.12504711985325 0.03750038146972656 3 0.9831701678991376 9.499735163137423 15730.0 33.332030253135315 0.0 - - - - - - - 374.6666666666667 31 6 TRIM22 tripartite motif-containing 22 1627 207 C20140704_OR005_01 C20140704_OR005_01 TB451095.[MT7]-GIVSLPPSYQIC[CAM]FIPV.2b12_2.heavy 967.533 / 730.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1629 207 C20140704_OR005_01 C20140704_OR005_01 TB451095.[MT7]-GIVSLPPSYQIC[CAM]FIPV.2b4_1.heavy 967.533 / 501.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1631 207 C20140704_OR005_01 C20140704_OR005_01 TB451095.[MT7]-GIVSLPPSYQIC[CAM]FIPV.2b5_1.heavy 967.533 / 614.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1633 207 C20140704_OR005_01 C20140704_OR005_01 TB451095.[MT7]-GIVSLPPSYQIC[CAM]FIPV.2b10_1.heavy 967.533 / 1186.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1635 208 C20140704_OR005_01 C20140704_OR005_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 143527.0 43.97549819946289 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 143527.0 348.9676078431373 1.0 - - - - - - - 229.5 287 8 1637 208 C20140704_OR005_01 C20140704_OR005_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 232110.0 43.97549819946289 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 232110.0 145.7328973185088 1.0 - - - - - - - 280.5 465 4 1639 208 C20140704_OR005_01 C20140704_OR005_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 206931.0 43.97549819946289 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 206931.0 434.82103722003825 0.0 - - - - - - - 145.71428571428572 413 7 1641 209 C20140704_OR005_01 C20140704_OR005_01 TB450869.[MT7]-IAWILGVHSK[MT7].3b6_1.heavy 471.294 / 798.499 1216.0 38.99347496032715 38 14 10 6 8 1.7784433087654234 56.22895006387296 0.03929901123046875 4 0.9435284225488106 5.1687096980715515 1216.0 7.158948955944922 2.0 - - - - - - - 182.5 2 2 TRIM22 tripartite motif-containing 22 1643 209 C20140704_OR005_01 C20140704_OR005_01 TB450869.[MT7]-IAWILGVHSK[MT7].3y6_1.heavy 471.294 / 784.48 1216.0 38.99347496032715 38 14 10 6 8 1.7784433087654234 56.22895006387296 0.03929901123046875 4 0.9435284225488106 5.1687096980715515 1216.0 -5.980327868852459 0.0 - - - - - - - 122.0 2 3 TRIM22 tripartite motif-containing 22 1645 209 C20140704_OR005_01 C20140704_OR005_01 TB450869.[MT7]-IAWILGVHSK[MT7].3y5_1.heavy 471.294 / 671.396 5713.0 38.99347496032715 38 14 10 6 8 1.7784433087654234 56.22895006387296 0.03929901123046875 4 0.9435284225488106 5.1687096980715515 5713.0 -0.7053086419753107 0.0 - - - - - - - 208.42857142857142 11 7 TRIM22 tripartite motif-containing 22 1647 209 C20140704_OR005_01 C20140704_OR005_01 TB450869.[MT7]-IAWILGVHSK[MT7].3b4_1.heavy 471.294 / 628.394 6564.0 38.99347496032715 38 14 10 6 8 1.7784433087654234 56.22895006387296 0.03929901123046875 4 0.9435284225488106 5.1687096980715515 6564.0 -0.5395068493150674 0.0 - - - - - - - 273.75 13 4 TRIM22 tripartite motif-containing 22 1649 210 C20140704_OR005_01 C20140704_OR005_01 TB450866.[MT7]-MPLIGLGTWK[MT7].2y4_1.heavy 702.42 / 635.363 13027.0 44.00264930725098 46 20 10 6 10 9.036795453905688 11.065869589510314 0.03620147705078125 3 0.9963151968188088 20.324589102522797 13027.0 57.20988154207865 0.0 - - - - - - - 274.7 26 10 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1651 210 C20140704_OR005_01 C20140704_OR005_01 TB450866.[MT7]-MPLIGLGTWK[MT7].2y9_1.heavy 702.42 / 1128.69 21575.0 44.00264930725098 46 20 10 6 10 9.036795453905688 11.065869589510314 0.03620147705078125 3 0.9963151968188088 20.324589102522797 21575.0 89.142951444032 0.0 - - - - - - - 172.46153846153845 43 13 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1653 210 C20140704_OR005_01 C20140704_OR005_01 TB450866.[MT7]-MPLIGLGTWK[MT7].2y6_1.heavy 702.42 / 805.469 16894.0 44.00264930725098 46 20 10 6 10 9.036795453905688 11.065869589510314 0.03620147705078125 3 0.9963151968188088 20.324589102522797 16894.0 89.97839529544447 0.0 - - - - - - - 254.58333333333334 33 12 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1655 210 C20140704_OR005_01 C20140704_OR005_01 TB450866.[MT7]-MPLIGLGTWK[MT7].2y7_1.heavy 702.42 / 918.553 7938.0 44.00264930725098 46 20 10 6 10 9.036795453905688 11.065869589510314 0.03620147705078125 3 0.9963151968188088 20.324589102522797 7938.0 33.96821642860935 0.0 - - - - - - - 195.25 15 12 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1657 211 C20140704_OR005_01 C20140704_OR005_01 TB427411.[MT7]-IVNESDVFSWVIRR.4y8_2.heavy 466.76 / 531.814 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1659 211 C20140704_OR005_01 C20140704_OR005_01 TB427411.[MT7]-IVNESDVFSWVIRR.4b4_1.heavy 466.76 / 600.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1661 211 C20140704_OR005_01 C20140704_OR005_01 TB427411.[MT7]-IVNESDVFSWVIRR.4y7_2.heavy 466.76 / 482.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1663 211 C20140704_OR005_01 C20140704_OR005_01 TB427411.[MT7]-IVNESDVFSWVIRR.4b3_1.heavy 466.76 / 471.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1665 212 C20140704_OR005_01 C20140704_OR005_01 TB427410.[MT7]-IVNESDVFSWVIRR.3b6_1.heavy 622.011 / 802.406 30124.0 43.920650482177734 39 13 10 6 10 1.1710089493099645 56.93096257372846 0.03710174560546875 3 0.9114469328003835 4.116256084038837 30124.0 127.97818615504278 0.0 - - - - - - - 202.66666666666666 60 6 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1667 212 C20140704_OR005_01 C20140704_OR005_01 TB427410.[MT7]-IVNESDVFSWVIRR.3b4_1.heavy 622.011 / 600.347 9230.0 43.920650482177734 39 13 10 6 10 1.1710089493099645 56.93096257372846 0.03710174560546875 3 0.9114469328003835 4.116256084038837 9230.0 18.949350538957546 0.0 - - - - - - - 225.33333333333334 18 9 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1669 212 C20140704_OR005_01 C20140704_OR005_01 TB427410.[MT7]-IVNESDVFSWVIRR.3y8_2.heavy 622.011 / 531.814 47773.0 43.920650482177734 39 13 10 6 10 1.1710089493099645 56.93096257372846 0.03710174560546875 3 0.9114469328003835 4.116256084038837 47773.0 123.96972223870853 0.0 - - - - - - - 233.1 95 10 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1671 212 C20140704_OR005_01 C20140704_OR005_01 TB427410.[MT7]-IVNESDVFSWVIRR.3y13_2.heavy 622.011 / 803.92 44831.0 43.920650482177734 39 13 10 6 10 1.1710089493099645 56.93096257372846 0.03710174560546875 3 0.9114469328003835 4.116256084038837 44831.0 246.50058836389076 0.0 - - - - - - - 289.85714285714283 89 7 TRIM50;TRIM73;TRIM74 tripartite motif-containing 50;tripartite motif-containing 73;tripartite motif-containing 74 1673 213 C20140704_OR005_01 C20140704_OR005_01 TB450863.[MT7]-DQNFLTLMK[MT7].3y3_1.heavy 466.595 / 535.339 5100.0 39.733500480651855 34 8 10 6 10 4.164500445256438 24.01248392563019 0.037998199462890625 3 0.7892725883956108 2.6397472718030115 5100.0 45.37620385232744 0.0 - - - - - - - 237.33333333333334 10 3 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1675 213 C20140704_OR005_01 C20140704_OR005_01 TB450863.[MT7]-DQNFLTLMK[MT7].3b4_1.heavy 466.595 / 649.306 6641.0 39.733500480651855 34 8 10 6 10 4.164500445256438 24.01248392563019 0.037998199462890625 3 0.7892725883956108 2.6397472718030115 6641.0 57.532655320555186 1.0 - - - - - - - 220.42857142857142 13 7 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1677 213 C20140704_OR005_01 C20140704_OR005_01 TB450863.[MT7]-DQNFLTLMK[MT7].3y4_1.heavy 466.595 / 636.387 5693.0 39.733500480651855 34 8 10 6 10 4.164500445256438 24.01248392563019 0.037998199462890625 3 0.7892725883956108 2.6397472718030115 5693.0 36.810981723794626 0.0 - - - - - - - 296.5 11 4 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1679 213 C20140704_OR005_01 C20140704_OR005_01 TB450863.[MT7]-DQNFLTLMK[MT7].3b3_1.heavy 466.595 / 502.238 3676.0 39.733500480651855 34 8 10 6 10 4.164500445256438 24.01248392563019 0.037998199462890625 3 0.7892725883956108 2.6397472718030115 3676.0 -2.162352941176472 0.0 - - - - - - - 237.33333333333334 7 6 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1681 214 C20140704_OR005_01 C20140704_OR005_01 TB412689.[MT7]-YGLLLLLK[MT7].2y4_1.heavy 610.915 / 630.467 4718.0 48.786598205566406 39 9 10 10 10 0.6371516611620176 90.27326380589426 0.0 3 0.8057765372308802 2.7537070498240976 4718.0 31.214260532061132 0.0 - - - - - - - 203.36363636363637 9 11 CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1683 214 C20140704_OR005_01 C20140704_OR005_01 TB412689.[MT7]-YGLLLLLK[MT7].2y5_1.heavy 610.915 / 743.551 993.0 48.786598205566406 39 9 10 10 10 0.6371516611620176 90.27326380589426 0.0 3 0.8057765372308802 2.7537070498240976 993.0 5.582747220767126 1.0 - - - - - - - 186.375 2 8 CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1685 214 C20140704_OR005_01 C20140704_OR005_01 TB412689.[MT7]-YGLLLLLK[MT7].2b4_1.heavy 610.915 / 591.362 1490.0 48.786598205566406 39 9 10 10 10 0.6371516611620176 90.27326380589426 0.0 3 0.8057765372308802 2.7537070498240976 1490.0 12.708142246404975 0.0 - - - - - - - 217.5 2 8 CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1687 214 C20140704_OR005_01 C20140704_OR005_01 TB412689.[MT7]-YGLLLLLK[MT7].2y3_1.heavy 610.915 / 517.383 3063.0 48.786598205566406 39 9 10 10 10 0.6371516611620176 90.27326380589426 0.0 3 0.8057765372308802 2.7537070498240976 3063.0 28.707440730664594 0.0 - - - - - - - 295.85714285714283 6 7 CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1689 215 C20140704_OR005_01 C20140704_OR005_01 TB427030.[MT7]-EVYDIAFSR.3b4_1.heavy 415.219 / 651.311 10192.0 35.73500061035156 47 17 10 10 10 3.8142725758479243 19.683895919499594 0.0 3 0.9737849318782205 7.60560079801422 10192.0 161.58048780487803 0.0 - - - - - - - 307.0 20 2 DCAF7 DDB1 and CUL4 associated factor 7 1691 215 C20140704_OR005_01 C20140704_OR005_01 TB427030.[MT7]-EVYDIAFSR.3b3_1.heavy 415.219 / 536.284 3193.0 35.73500061035156 47 17 10 10 10 3.8142725758479243 19.683895919499594 0.0 3 0.9737849318782205 7.60560079801422 3193.0 38.9390243902439 0.0 - - - - - - - 307.0 6 2 DCAF7 DDB1 and CUL4 associated factor 7 1693 215 C20140704_OR005_01 C20140704_OR005_01 TB427030.[MT7]-EVYDIAFSR.3y4_1.heavy 415.219 / 480.257 10315.0 35.73500061035156 47 17 10 10 10 3.8142725758479243 19.683895919499594 0.0 3 0.9737849318782205 7.60560079801422 10315.0 83.00213046961652 1.0 - - - - - - - 276.5 21 4 DCAF7 DDB1 and CUL4 associated factor 7 1695 215 C20140704_OR005_01 C20140704_OR005_01 TB427030.[MT7]-EVYDIAFSR.3y5_1.heavy 415.219 / 593.341 1228.0 35.73500061035156 47 17 10 10 10 3.8142725758479243 19.683895919499594 0.0 3 0.9737849318782205 7.60560079801422 1228.0 8.328826440438318 0.0 - - - - - - - 429.5 2 2 DCAF7 DDB1 and CUL4 associated factor 7 1697 216 C20140704_OR005_01 C20140704_OR005_01 TB413385.[MT7]-YQRVELNDGHFMPVLGFGTYAPPEVPR.4b8_1.heavy 809.164 / 1162.6 2342.0 41.790799140930176 32 10 10 2 10 1.1666099645350927 71.1661141576972 0.08440017700195312 3 0.8456833193037693 3.100315862586764 2342.0 28.318300653594772 0.0 - - - - - - - 240.9090909090909 4 11 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1699 216 C20140704_OR005_01 C20140704_OR005_01 TB413385.[MT7]-YQRVELNDGHFMPVLGFGTYAPPEVPR.4y6_1.heavy 809.164 / 694.388 26582.0 41.790799140930176 32 10 10 2 10 1.1666099645350927 71.1661141576972 0.08440017700195312 3 0.8456833193037693 3.100315862586764 26582.0 104.02893070127112 0.0 - - - - - - - 305.54545454545456 53 11 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1701 216 C20140704_OR005_01 C20140704_OR005_01 TB413385.[MT7]-YQRVELNDGHFMPVLGFGTYAPPEVPR.4b9_1.heavy 809.164 / 1219.62 2852.0 41.790799140930176 32 10 10 2 10 1.1666099645350927 71.1661141576972 0.08440017700195312 3 0.8456833193037693 3.100315862586764 2852.0 35.51019607843138 0.0 - - - - - - - 192.55555555555554 5 9 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1703 216 C20140704_OR005_01 C20140704_OR005_01 TB413385.[MT7]-YQRVELNDGHFMPVLGFGTYAPPEVPR.4b10_2.heavy 809.164 / 678.843 7129.0 41.790799140930176 32 10 10 2 10 1.1666099645350927 71.1661141576972 0.08440017700195312 3 0.8456833193037693 3.100315862586764 7129.0 44.28371634414813 0.0 - - - - - - - 204.0 14 6 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1705 217 C20140704_OR005_01 C20140704_OR005_01 TB413116.[MT7]-QHFVYDHVFAEK[MT7].4y4_1.heavy 452.74 / 638.363 8524.0 29.743599891662598 38 12 10 6 10 25.476682569356225 3.9251578272707155 0.03560066223144531 3 0.8959882937935446 3.793001714108086 8524.0 67.7892260824475 0.0 - - - - - - - 173.57142857142858 17 7 CDR2 cerebellar degeneration-related protein 2, 62kDa 1707 217 C20140704_OR005_01 C20140704_OR005_01 TB413116.[MT7]-QHFVYDHVFAEK[MT7].4y3_1.heavy 452.74 / 491.295 7408.0 29.743599891662598 38 12 10 6 10 25.476682569356225 3.9251578272707155 0.03560066223144531 3 0.8959882937935446 3.793001714108086 7408.0 31.421258318209315 0.0 - - - - - - - 211.16666666666666 14 12 CDR2 cerebellar degeneration-related protein 2, 62kDa 1709 217 C20140704_OR005_01 C20140704_OR005_01 TB413116.[MT7]-QHFVYDHVFAEK[MT7].4b3_1.heavy 452.74 / 557.295 3856.0 29.743599891662598 38 12 10 6 10 25.476682569356225 3.9251578272707155 0.03560066223144531 3 0.8959882937935446 3.793001714108086 3856.0 14.421260046668397 0.0 - - - - - - - 202.63636363636363 7 11 CDR2 cerebellar degeneration-related protein 2, 62kDa 1711 217 C20140704_OR005_01 C20140704_OR005_01 TB413116.[MT7]-QHFVYDHVFAEK[MT7].4b6_1.heavy 452.74 / 934.454 203.0 29.743599891662598 38 12 10 6 10 25.476682569356225 3.9251578272707155 0.03560066223144531 3 0.8959882937935446 3.793001714108086 203.0 2.1700587810260314 2.0 - - - - - - - 0.0 1 0 CDR2 cerebellar degeneration-related protein 2, 62kDa 1713 218 C20140704_OR005_01 C20140704_OR005_01 TB427039.[MT7]-VILDNEEQR.2y8_1.heavy 630.339 / 1016.5 25155.0 25.607099533081055 46 16 10 10 10 2.109792765766416 37.90713638503344 0.0 3 0.9642044285474495 6.503447643833642 25155.0 99.83131188118813 0.0 - - - - - - - 258.1111111111111 50 9 TRIM22 tripartite motif-containing 22 1715 218 C20140704_OR005_01 C20140704_OR005_01 TB427039.[MT7]-VILDNEEQR.2y5_1.heavy 630.339 / 675.306 9900.0 25.607099533081055 46 16 10 10 10 2.109792765766416 37.90713638503344 0.0 3 0.9642044285474495 6.503447643833642 9900.0 22.836280056577085 0.0 - - - - - - - 168.33333333333334 19 6 TRIM22 tripartite motif-containing 22 1717 218 C20140704_OR005_01 C20140704_OR005_01 TB427039.[MT7]-VILDNEEQR.2y6_1.heavy 630.339 / 790.333 7981.0 25.607099533081055 46 16 10 10 10 2.109792765766416 37.90713638503344 0.0 3 0.9642044285474495 6.503447643833642 7981.0 84.55118811881188 0.0 - - - - - - - 202.0 15 10 TRIM22 tripartite motif-containing 22 1719 218 C20140704_OR005_01 C20140704_OR005_01 TB427039.[MT7]-VILDNEEQR.2y7_1.heavy 630.339 / 903.417 16669.0 25.607099533081055 46 16 10 10 10 2.109792765766416 37.90713638503344 0.0 3 0.9642044285474495 6.503447643833642 16669.0 78.80641089108912 0.0 - - - - - - - 227.25 33 12 TRIM22 tripartite motif-containing 22 1721 219 C20140704_OR005_01 C20140704_OR005_01 TB427131.[MT7]-AELAATLGLSER.2y8_1.heavy 687.889 / 846.468 15551.0 36.202775955200195 41 16 10 5 10 2.3274356908660474 34.24393235875552 0.04509735107421875 3 0.9674958000644798 6.826674401009738 15551.0 160.11061597493415 0.0 - - - - - - - 279.1 31 10 CDX2 caudal type homeobox 2 1723 219 C20140704_OR005_01 C20140704_OR005_01 TB427131.[MT7]-AELAATLGLSER.2b4_1.heavy 687.889 / 529.31 23692.0 36.202775955200195 41 16 10 5 10 2.3274356908660474 34.24393235875552 0.04509735107421875 3 0.9674958000644798 6.826674401009738 23692.0 83.58561243652585 0.0 - - - - - - - 388.6 47 5 CDX2 caudal type homeobox 2 1725 219 C20140704_OR005_01 C20140704_OR005_01 TB427131.[MT7]-AELAATLGLSER.2y9_1.heavy 687.889 / 917.505 25636.0 36.202775955200195 41 16 10 5 10 2.3274356908660474 34.24393235875552 0.04509735107421875 3 0.9674958000644798 6.826674401009738 25636.0 33.53541180501433 0.0 - - - - - - - 151.5 51 4 CDX2 caudal type homeobox 2 1727 219 C20140704_OR005_01 C20140704_OR005_01 TB427131.[MT7]-AELAATLGLSER.2y11_1.heavy 687.889 / 1159.63 7411.0 36.202775955200195 41 16 10 5 10 2.3274356908660474 34.24393235875552 0.04509735107421875 3 0.9674958000644798 6.826674401009738 7411.0 26.356422353366796 0.0 - - - - - - - 254.9 14 10 CDX2 caudal type homeobox 2 1729 220 C20140704_OR005_01 C20140704_OR005_01 TB413115.[MT7]-QHFVYDHVFAEK[MT7].3b6_1.heavy 603.317 / 934.454 13305.0 29.734699726104736 41 15 10 6 10 3.181066376070617 31.43599918324373 0.03560066223144531 3 0.9571624919073075 5.941383795985767 13305.0 90.83458774125818 0.0 - - - - - - - 161.08333333333334 26 12 CDR2 cerebellar degeneration-related protein 2, 62kDa 1731 220 C20140704_OR005_01 C20140704_OR005_01 TB413115.[MT7]-QHFVYDHVFAEK[MT7].3b4_1.heavy 603.317 / 656.364 4469.0 29.734699726104736 41 15 10 6 10 3.181066376070617 31.43599918324373 0.03560066223144531 3 0.9571624919073075 5.941383795985767 4469.0 9.460126636734348 0.0 - - - - - - - 228.625 8 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 1733 220 C20140704_OR005_01 C20140704_OR005_01 TB413115.[MT7]-QHFVYDHVFAEK[MT7].3b3_1.heavy 603.317 / 557.295 4469.0 29.734699726104736 41 15 10 6 10 3.181066376070617 31.43599918324373 0.03560066223144531 3 0.9571624919073075 5.941383795985767 4469.0 8.849202339863858 0.0 - - - - - - - 673.0 8 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 1735 220 C20140704_OR005_01 C20140704_OR005_01 TB413115.[MT7]-QHFVYDHVFAEK[MT7].3y4_1.heavy 603.317 / 638.363 31892.0 29.734699726104736 41 15 10 6 10 3.181066376070617 31.43599918324373 0.03560066223144531 3 0.9571624919073075 5.941383795985767 31892.0 119.35532446375237 0.0 - - - - - - - 246.78571428571428 63 14 CDR2 cerebellar degeneration-related protein 2, 62kDa 1737 221 C20140704_OR005_01 C20140704_OR005_01 TB413380.[MT7]-ASPC[CAM]DPTFILGC[CAM]APC[CAM]NVIC[CAM]SVVFQK[MT7].3b9_1.heavy 1043.51 / 1133.54 1297.0 48.609049797058105 38 13 10 5 10 1.496754630820525 54.378757007289906 0.041797637939453125 3 0.9229185403855574 4.416288657850482 1297.0 4.7710314059432415 1.0 - - - - - - - 216.0 2 8 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1739 221 C20140704_OR005_01 C20140704_OR005_01 TB413380.[MT7]-ASPC[CAM]DPTFILGC[CAM]APC[CAM]NVIC[CAM]SVVFQK[MT7].3y3_1.heavy 1043.51 / 566.342 2335.0 48.609049797058105 38 13 10 5 10 1.496754630820525 54.378757007289906 0.041797637939453125 3 0.9229185403855574 4.416288657850482 2335.0 25.756884375694224 1.0 - - - - - - - 129.5 4 10 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1741 221 C20140704_OR005_01 C20140704_OR005_01 TB413380.[MT7]-ASPC[CAM]DPTFILGC[CAM]APC[CAM]NVIC[CAM]SVVFQK[MT7].3b5_1.heavy 1043.51 / 675.289 3978.0 48.609049797058105 38 13 10 5 10 1.496754630820525 54.378757007289906 0.041797637939453125 3 0.9229185403855574 4.416288657850482 3978.0 50.84713178294573 0.0 - - - - - - - 180.45454545454547 7 11 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1743 221 C20140704_OR005_01 C20140704_OR005_01 TB413380.[MT7]-ASPC[CAM]DPTFILGC[CAM]APC[CAM]NVIC[CAM]SVVFQK[MT7].3b8_1.heavy 1043.51 / 1020.46 3719.0 48.609049797058105 38 13 10 5 10 1.496754630820525 54.378757007289906 0.041797637939453125 3 0.9229185403855574 4.416288657850482 3719.0 12.898265895953758 0.0 - - - - - - - 198.8 7 10 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1745 222 C20140704_OR005_01 C20140704_OR005_01 TB450723.[MT7]-EIFSC[CAM]IK[MT7].2y4_1.heavy 592.833 / 651.362 4787.0 33.24810028076172 34 14 4 10 6 1.2494272061201086 53.35778374291132 0.0 5 0.939315291956917 4.9842708247014045 4787.0 6.856555931918116 0.0 - - - - - - - 661.8888888888889 9 9 CDR2 cerebellar degeneration-related protein 2, 62kDa 1747 222 C20140704_OR005_01 C20140704_OR005_01 TB450723.[MT7]-EIFSC[CAM]IK[MT7].2y5_1.heavy 592.833 / 798.43 3085.0 33.24810028076172 34 14 4 10 6 1.2494272061201086 53.35778374291132 0.0 5 0.939315291956917 4.9842708247014045 3085.0 10.069994290064713 2.0 - - - - - - - 248.33333333333334 7 6 CDR2 cerebellar degeneration-related protein 2, 62kDa 1749 222 C20140704_OR005_01 C20140704_OR005_01 TB450723.[MT7]-EIFSC[CAM]IK[MT7].2y3_1.heavy 592.833 / 564.33 2766.0 33.24810028076172 34 14 4 10 6 1.2494272061201086 53.35778374291132 0.0 5 0.939315291956917 4.9842708247014045 2766.0 2.471777716339508 5.0 - - - - - - - 803.5555555555555 10 9 CDR2 cerebellar degeneration-related protein 2, 62kDa 1751 222 C20140704_OR005_01 C20140704_OR005_01 TB450723.[MT7]-EIFSC[CAM]IK[MT7].2y6_1.heavy 592.833 / 911.514 5532.0 33.24810028076172 34 14 4 10 6 1.2494272061201086 53.35778374291132 0.0 5 0.939315291956917 4.9842708247014045 5532.0 24.104952978056424 1.0 - - - - - - - 212.625 20 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 1753 223 C20140704_OR005_01 C20140704_OR005_01 TB426918.[MT7]-YGFLLPAR.2b3_1.heavy 540.82 / 512.263 7138.0 38.57542419433594 45 20 10 5 10 5.35234238389724 18.68340865129526 0.04010009765625 3 0.990324286083069 12.53631977812853 7138.0 20.626926153497465 0.0 - - - - - - - 219.66666666666666 14 9 CPA2 carboxypeptidase A2 (pancreatic) 1755 223 C20140704_OR005_01 C20140704_OR005_01 TB426918.[MT7]-YGFLLPAR.2y5_1.heavy 540.82 / 569.377 3404.0 38.57542419433594 45 20 10 5 10 5.35234238389724 18.68340865129526 0.04010009765625 3 0.990324286083069 12.53631977812853 3404.0 6.076669831716167 2.0 - - - - - - - 274.4 20 10 CPA2 carboxypeptidase A2 (pancreatic) 1757 223 C20140704_OR005_01 C20140704_OR005_01 TB426918.[MT7]-YGFLLPAR.2b4_1.heavy 540.82 / 625.347 7797.0 38.57542419433594 45 20 10 5 10 5.35234238389724 18.68340865129526 0.04010009765625 3 0.990324286083069 12.53631977812853 7797.0 36.542482361819836 0.0 - - - - - - - 241.5 15 10 CPA2 carboxypeptidase A2 (pancreatic) 1759 223 C20140704_OR005_01 C20140704_OR005_01 TB426918.[MT7]-YGFLLPAR.2y7_1.heavy 540.82 / 773.467 15045.0 38.57542419433594 45 20 10 5 10 5.35234238389724 18.68340865129526 0.04010009765625 3 0.990324286083069 12.53631977812853 15045.0 36.23137467516112 0.0 - - - - - - - 153.8 30 5 CPA2 carboxypeptidase A2 (pancreatic) 1761 224 C20140704_OR005_01 C20140704_OR005_01 TB426917.[MT7]-NYIQIER.2b3_1.heavy 540.302 / 535.3 11170.0 28.380699157714844 50 20 10 10 10 9.117789201069227 10.967570953304467 0.0 3 0.9969981573763909 22.519550089963836 11170.0 14.216697009490838 0.0 - - - - - - - 681.8571428571429 22 7 TRIM22 tripartite motif-containing 22 1763 224 C20140704_OR005_01 C20140704_OR005_01 TB426917.[MT7]-NYIQIER.2y5_1.heavy 540.302 / 658.388 10764.0 28.380699157714844 50 20 10 10 10 9.117789201069227 10.967570953304467 0.0 3 0.9969981573763909 22.519550089963836 10764.0 72.42642978276669 0.0 - - - - - - - 214.55555555555554 21 9 TRIM22 tripartite motif-containing 22 1765 224 C20140704_OR005_01 C20140704_OR005_01 TB426917.[MT7]-NYIQIER.2b4_1.heavy 540.302 / 663.358 11780.0 28.380699157714844 50 20 10 10 10 9.117789201069227 10.967570953304467 0.0 3 0.9969981573763909 22.519550089963836 11780.0 96.90935960591133 0.0 - - - - - - - 183.0 23 10 TRIM22 tripartite motif-containing 22 1767 224 C20140704_OR005_01 C20140704_OR005_01 TB426917.[MT7]-NYIQIER.2y6_1.heavy 540.302 / 821.452 16553.0 28.380699157714844 50 20 10 10 10 9.117789201069227 10.967570953304467 0.0 3 0.9969981573763909 22.519550089963836 16553.0 95.39417657457611 0.0 - - - - - - - 203.16666666666666 33 6 TRIM22 tripartite motif-containing 22 1769 225 C20140704_OR005_01 C20140704_OR005_01 TB426942.[MT7]-SIVDFIK[MT7].2y4_1.heavy 555.344 / 666.394 17176.0 38.765899658203125 50 20 10 10 10 11.36808699249543 8.796554782349428 0.0 3 0.9938493488153786 15.728198073303085 17176.0 25.562193211488253 0.0 - - - - - - - 194.33333333333334 34 9 CPA2 carboxypeptidase A2 (pancreatic) 1771 225 C20140704_OR005_01 C20140704_OR005_01 TB426942.[MT7]-SIVDFIK[MT7].2y5_1.heavy 555.344 / 765.463 10612.0 38.765899658203125 50 20 10 10 10 11.36808699249543 8.796554782349428 0.0 3 0.9938493488153786 15.728198073303085 10612.0 16.767744953408126 1.0 - - - - - - - 291.8333333333333 22 6 CPA2 carboxypeptidase A2 (pancreatic) 1773 225 C20140704_OR005_01 C20140704_OR005_01 TB426942.[MT7]-SIVDFIK[MT7].2b4_1.heavy 555.344 / 559.321 28882.0 38.765899658203125 50 20 10 10 10 11.36808699249543 8.796554782349428 0.0 3 0.9938493488153786 15.728198073303085 28882.0 93.5495024390244 0.0 - - - - - - - 316.1111111111111 57 9 CPA2 carboxypeptidase A2 (pancreatic) 1775 225 C20140704_OR005_01 C20140704_OR005_01 TB426942.[MT7]-SIVDFIK[MT7].2y3_1.heavy 555.344 / 551.367 29211.0 38.765899658203125 50 20 10 10 10 11.36808699249543 8.796554782349428 0.0 3 0.9938493488153786 15.728198073303085 29211.0 27.1221454741708 0.0 - - - - - - - 259.75 58 8 CPA2 carboxypeptidase A2 (pancreatic) 1777 226 C20140704_OR005_01 C20140704_OR005_01 TB451154.[MT7]-VIFDTVDLSATWEVMEK[MT7].3y3_1.heavy 757.732 / 551.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1779 226 C20140704_OR005_01 C20140704_OR005_01 TB451154.[MT7]-VIFDTVDLSATWEVMEK[MT7].3b4_1.heavy 757.732 / 619.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1781 226 C20140704_OR005_01 C20140704_OR005_01 TB451154.[MT7]-VIFDTVDLSATWEVMEK[MT7].3y4_1.heavy 757.732 / 650.366 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1783 226 C20140704_OR005_01 C20140704_OR005_01 TB451154.[MT7]-VIFDTVDLSATWEVMEK[MT7].3b7_1.heavy 757.732 / 934.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1785 227 C20140704_OR005_01 C20140704_OR005_01 TB426944.[MT7]-QNPLEPK[MT7].2y5_1.heavy 557.329 / 727.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1787 227 C20140704_OR005_01 C20140704_OR005_01 TB426944.[MT7]-QNPLEPK[MT7].2b4_1.heavy 557.329 / 597.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1789 227 C20140704_OR005_01 C20140704_OR005_01 TB426944.[MT7]-QNPLEPK[MT7].2y6_1.heavy 557.329 / 841.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1791 227 C20140704_OR005_01 C20140704_OR005_01 TB426944.[MT7]-QNPLEPK[MT7].2b5_1.heavy 557.329 / 726.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1793 228 C20140704_OR005_01 C20140704_OR005_01 TB451155.[MT7]-FQPGNLRPNRHLANIVER.4y5_1.heavy 569.572 / 630.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 1795 228 C20140704_OR005_01 C20140704_OR005_01 TB451155.[MT7]-FQPGNLRPNRHLANIVER.4y11_2.heavy 569.572 / 659.871 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 1797 228 C20140704_OR005_01 C20140704_OR005_01 TB451155.[MT7]-FQPGNLRPNRHLANIVER.4y7_1.heavy 569.572 / 814.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 1799 228 C20140704_OR005_01 C20140704_OR005_01 TB451155.[MT7]-FQPGNLRPNRHLANIVER.4y6_1.heavy 569.572 / 701.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM22 tripartite motif-containing 22 1801 229 C20140704_OR005_01 C20140704_OR005_01 TB450975.[MT7]-SLGHQELILGGVEQLQALSSR.3b4_1.heavy 793.775 / 539.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - CNKSR1 connector enhancer of kinase suppressor of Ras 1 1803 229 C20140704_OR005_01 C20140704_OR005_01 TB450975.[MT7]-SLGHQELILGGVEQLQALSSR.3y12_1.heavy 793.775 / 1244.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - CNKSR1 connector enhancer of kinase suppressor of Ras 1 1805 229 C20140704_OR005_01 C20140704_OR005_01 TB450975.[MT7]-SLGHQELILGGVEQLQALSSR.3b7_1.heavy 793.775 / 909.491 N/A N/A - - - - - - - - - 0.0 - - - - - - - CNKSR1 connector enhancer of kinase suppressor of Ras 1 1807 229 C20140704_OR005_01 C20140704_OR005_01 TB450975.[MT7]-SLGHQELILGGVEQLQALSSR.3y9_1.heavy 793.775 / 1031.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - CNKSR1 connector enhancer of kinase suppressor of Ras 1 1809 230 C20140704_OR005_01 C20140704_OR005_01 TB412493.[MT7]-NLGLSK[MT7].2y4_1.heavy 460.294 / 548.352 31988.0 24.116100311279297 50 20 10 10 10 8.452954617808542 11.830182997708482 0.0 3 0.9973352182809465 23.902045058751217 31988.0 464.7485641101424 0.0 - - - - - - - 151.16666666666666 63 6 SDCCAG3 serologically defined colon cancer antigen 3 1811 230 C20140704_OR005_01 C20140704_OR005_01 TB412493.[MT7]-NLGLSK[MT7].2y5_1.heavy 460.294 / 661.437 19615.0 24.116100311279297 50 20 10 10 10 8.452954617808542 11.830182997708482 0.0 3 0.9973352182809465 23.902045058751217 19615.0 152.78192069454056 2.0 - - - - - - - 213.875 39 8 SDCCAG3 serologically defined colon cancer antigen 3 1813 230 C20140704_OR005_01 C20140704_OR005_01 TB412493.[MT7]-NLGLSK[MT7].2b4_1.heavy 460.294 / 542.342 4325.0 24.116100311279297 50 20 10 10 10 8.452954617808542 11.830182997708482 0.0 3 0.9973352182809465 23.902045058751217 4325.0 30.82262528417515 0.0 - - - - - - - 211.4 8 10 SDCCAG3 serologically defined colon cancer antigen 3 1815 230 C20140704_OR005_01 C20140704_OR005_01 TB412493.[MT7]-NLGLSK[MT7].2y3_1.heavy 460.294 / 491.331 7544.0 24.116100311279297 50 20 10 10 10 8.452954617808542 11.830182997708482 0.0 3 0.9973352182809465 23.902045058751217 7544.0 58.26087707159566 0.0 - - - - - - - 218.0 15 6 SDCCAG3 serologically defined colon cancer antigen 3 1817 231 C20140704_OR005_01 C20140704_OR005_01 TB451062.[MT7]-AWRDPDEPVLLEEPVVLALAEK[MT7].3b6_1.heavy 926.516 / 885.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1819 231 C20140704_OR005_01 C20140704_OR005_01 TB451062.[MT7]-AWRDPDEPVLLEEPVVLALAEK[MT7].3y5_1.heavy 926.516 / 675.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1821 231 C20140704_OR005_01 C20140704_OR005_01 TB451062.[MT7]-AWRDPDEPVLLEEPVVLALAEK[MT7].3b7_1.heavy 926.516 / 1014.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1823 231 C20140704_OR005_01 C20140704_OR005_01 TB451062.[MT7]-AWRDPDEPVLLEEPVVLALAEK[MT7].3y9_1.heavy 926.516 / 1083.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1825 232 C20140704_OR005_01 C20140704_OR005_01 TB412496.[MT7]-VLDGLNR.2b3_1.heavy 465.778 / 472.289 5284.0 28.60024929046631 44 18 10 6 10 5.0494132233310305 19.804281324797447 0.03989982604980469 3 0.9891286522822832 11.825688705999468 5284.0 18.72283464566929 0.0 - - - - - - - 304.6363636363636 10 11 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1827 232 C20140704_OR005_01 C20140704_OR005_01 TB412496.[MT7]-VLDGLNR.2y5_1.heavy 465.778 / 574.294 4471.0 28.60024929046631 44 18 10 6 10 5.0494132233310305 19.804281324797447 0.03989982604980469 3 0.9891286522822832 11.825688705999468 4471.0 49.36108374384237 1.0 - - - - - - - 169.5 8 6 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1829 232 C20140704_OR005_01 C20140704_OR005_01 TB412496.[MT7]-VLDGLNR.2b4_1.heavy 465.778 / 529.31 2947.0 28.60024929046631 44 18 10 6 10 5.0494132233310305 19.804281324797447 0.03989982604980469 3 0.9891286522822832 11.825688705999468 2947.0 10.35401212791958 0.0 - - - - - - - 183.0 5 10 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1831 232 C20140704_OR005_01 C20140704_OR005_01 TB412496.[MT7]-VLDGLNR.2y6_1.heavy 465.778 / 687.378 9653.0 28.60024929046631 44 18 10 6 10 5.0494132233310305 19.804281324797447 0.03989982604980469 3 0.9891286522822832 11.825688705999468 9653.0 74.60631656302995 0.0 - - - - - - - 203.25 19 8 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1833 233 C20140704_OR005_01 C20140704_OR005_01 TB427287.[MT7]-DIVLVAHSALGTQR.2b4_1.heavy 812.469 / 585.373 10006.0 33.18155097961426 42 17 10 5 10 6.825895935841018 14.650091495671038 0.043300628662109375 3 0.9710655475376077 7.237723087824222 10006.0 14.573956521739131 0.0 - - - - - - - 306.6666666666667 20 6 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1835 233 C20140704_OR005_01 C20140704_OR005_01 TB427287.[MT7]-DIVLVAHSALGTQR.2y9_1.heavy 812.469 / 940.496 10236.0 33.18155097961426 42 17 10 5 10 6.825895935841018 14.650091495671038 0.043300628662109375 3 0.9710655475376077 7.237723087824222 10236.0 33.89177257525083 0.0 - - - - - - - 244.375 20 8 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1837 233 C20140704_OR005_01 C20140704_OR005_01 TB427287.[MT7]-DIVLVAHSALGTQR.2y10_1.heavy 812.469 / 1039.56 7475.0 33.18155097961426 42 17 10 5 10 6.825895935841018 14.650091495671038 0.043300628662109375 3 0.9710655475376077 7.237723087824222 7475.0 49.18333333333334 0.0 - - - - - - - 249.16666666666666 14 12 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1839 233 C20140704_OR005_01 C20140704_OR005_01 TB427287.[MT7]-DIVLVAHSALGTQR.2y11_1.heavy 812.469 / 1152.65 4485.0 33.18155097961426 42 17 10 5 10 6.825895935841018 14.650091495671038 0.043300628662109375 3 0.9710655475376077 7.237723087824222 4485.0 30.419999999999998 0.0 - - - - - - - 209.0909090909091 8 11 AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1841 234 C20140704_OR005_01 C20140704_OR005_01 TB427284.[MT7]-GLVQALGLSNFNSR.2y8_1.heavy 810.453 / 894.443 49509.0 41.99850082397461 43 13 10 10 10 1.8733170536419264 35.75292452761056 0.0 3 0.9036772259695184 3.9441061372390087 49509.0 184.24254962779156 0.0 - - - - - - - 224.11111111111111 99 9 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1843 234 C20140704_OR005_01 C20140704_OR005_01 TB427284.[MT7]-GLVQALGLSNFNSR.2b4_1.heavy 810.453 / 542.342 27427.0 41.99850082397461 43 13 10 10 10 1.8733170536419264 35.75292452761056 0.0 3 0.9036772259695184 3.9441061372390087 27427.0 42.73328611898017 0.0 - - - - - - - 183.63636363636363 54 11 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1845 234 C20140704_OR005_01 C20140704_OR005_01 TB427284.[MT7]-GLVQALGLSNFNSR.2y10_1.heavy 810.453 / 1078.56 26620.0 41.99850082397461 43 13 10 10 10 1.8733170536419264 35.75292452761056 0.0 3 0.9036772259695184 3.9441061372390087 26620.0 85.83822692876535 0.0 - - - - - - - 633.8571428571429 53 7 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1847 234 C20140704_OR005_01 C20140704_OR005_01 TB427284.[MT7]-GLVQALGLSNFNSR.2y11_1.heavy 810.453 / 1206.62 13713.0 41.99850082397461 43 13 10 10 10 1.8733170536419264 35.75292452761056 0.0 3 0.9036772259695184 3.9441061372390087 13713.0 69.45061106272493 0.0 - - - - - - - 255.33333333333334 27 15 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1849 235 C20140704_OR005_01 C20140704_OR005_01 TB413375.[MT7]-EDEPWYDHQDLQQDLQLAAELGK[MT7].4y5_1.heavy 758.124 / 661.4 8766.0 44.1598014831543 41 11 10 10 10 0.975873941176559 68.31483437941814 0.0 3 0.8793045048411813 3.515998817645182 8766.0 29.719154276808236 0.0 - - - - - - - 210.08333333333334 17 12 CDR2 cerebellar degeneration-related protein 2, 62kDa 1851 235 C20140704_OR005_01 C20140704_OR005_01 TB413375.[MT7]-EDEPWYDHQDLQQDLQLAAELGK[MT7].4b7_1.heavy 758.124 / 1079.44 5038.0 44.1598014831543 41 11 10 10 10 0.975873941176559 68.31483437941814 0.0 3 0.8793045048411813 3.515998817645182 5038.0 35.121641859550195 1.0 - - - - - - - 214.25 15 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 1853 235 C20140704_OR005_01 C20140704_OR005_01 TB413375.[MT7]-EDEPWYDHQDLQQDLQLAAELGK[MT7].4b14_2.heavy 758.124 / 972.412 14308.0 44.1598014831543 41 11 10 10 10 0.975873941176559 68.31483437941814 0.0 3 0.8793045048411813 3.515998817645182 14308.0 69.61105960264901 0.0 - - - - - - - 241.8 28 10 CDR2 cerebellar degeneration-related protein 2, 62kDa 1855 235 C20140704_OR005_01 C20140704_OR005_01 TB413375.[MT7]-EDEPWYDHQDLQQDLQLAAELGK[MT7].4b3_1.heavy 758.124 / 518.221 7356.0 44.1598014831543 41 11 10 10 10 0.975873941176559 68.31483437941814 0.0 3 0.8793045048411813 3.515998817645182 7356.0 74.73917963224893 0.0 - - - - - - - 226.91666666666666 14 12 CDR2 cerebellar degeneration-related protein 2, 62kDa 1857 236 C20140704_OR005_01 C20140704_OR005_01 TB427000.[MT7]-NRAVEVTK[MT7].2y4_1.heavy 602.866 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1859 236 C20140704_OR005_01 C20140704_OR005_01 TB427000.[MT7]-NRAVEVTK[MT7].2y5_1.heavy 602.866 / 719.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1861 236 C20140704_OR005_01 C20140704_OR005_01 TB427000.[MT7]-NRAVEVTK[MT7].2y6_1.heavy 602.866 / 790.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1863 236 C20140704_OR005_01 C20140704_OR005_01 TB427000.[MT7]-NRAVEVTK[MT7].2b5_1.heavy 602.866 / 714.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1C4 aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) 1865 237 C20140704_OR005_01 C20140704_OR005_01 TB412695.[MT7]-EESPAPWDR.2y4_1.heavy 615.797 / 573.278 2155.0 27.814249992370605 23 12 0 5 6 2.01508016540464 35.01508198415338 0.04009819030761719 6 0.8847876555238142 3.6004120733288376 2155.0 2.798701298701299 3.0 - - - - - - - 230.91666666666666 25 12 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1867 237 C20140704_OR005_01 C20140704_OR005_01 TB412695.[MT7]-EESPAPWDR.2y6_1.heavy 615.797 / 741.368 1129.0 27.814249992370605 23 12 0 5 6 2.01508016540464 35.01508198415338 0.04009819030761719 6 0.8847876555238142 3.6004120733288376 1129.0 0.27503045066991466 2.0 - - - - - - - 641.25 3 8 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1869 237 C20140704_OR005_01 C20140704_OR005_01 TB412695.[MT7]-EESPAPWDR.2b5_1.heavy 615.797 / 658.316 3181.0 27.814249992370605 23 12 0 5 6 2.01508016540464 35.01508198415338 0.04009819030761719 6 0.8847876555238142 3.6004120733288376 3181.0 1.1785482123510294 2.0 - - - - - - - 250.77777777777777 19 9 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1871 237 C20140704_OR005_01 C20140704_OR005_01 TB412695.[MT7]-EESPAPWDR.2y7_1.heavy 615.797 / 828.4 2257.0 27.814249992370605 23 12 0 5 6 2.01508016540464 35.01508198415338 0.04009819030761719 6 0.8847876555238142 3.6004120733288376 2257.0 3.1772853906656717 0.0 - - - - - - - 184.8 4 10 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1873 238 C20140704_OR005_01 C20140704_OR005_01 TB427291.[MT7]-TVTMLQAQLSLER.3y7_1.heavy 545.307 / 816.457 4001.0 38.565399169921875 48 18 10 10 10 9.890753128929203 10.110453541451017 0.0 3 0.9879908169842103 11.250454074265749 4001.0 16.818618018018018 0.0 - - - - - - - 249.75 8 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 1875 238 C20140704_OR005_01 C20140704_OR005_01 TB427291.[MT7]-TVTMLQAQLSLER.3b4_1.heavy 545.307 / 577.314 8225.0 38.565399169921875 48 18 10 10 10 9.890753128929203 10.110453541451017 0.0 3 0.9879908169842103 11.250454074265749 8225.0 22.92533840573299 0.0 - - - - - - - 308.77777777777777 16 9 CDR2 cerebellar degeneration-related protein 2, 62kDa 1877 238 C20140704_OR005_01 C20140704_OR005_01 TB427291.[MT7]-TVTMLQAQLSLER.3y4_1.heavy 545.307 / 504.278 8670.0 38.565399169921875 48 18 10 10 10 9.890753128929203 10.110453541451017 0.0 3 0.9879908169842103 11.250454074265749 8670.0 26.68034738900881 0.0 - - - - - - - 317.57142857142856 17 7 CDR2 cerebellar degeneration-related protein 2, 62kDa 1879 238 C20140704_OR005_01 C20140704_OR005_01 TB427291.[MT7]-TVTMLQAQLSLER.3y5_1.heavy 545.307 / 617.362 6335.0 38.565399169921875 48 18 10 10 10 9.890753128929203 10.110453541451017 0.0 3 0.9879908169842103 11.250454074265749 6335.0 1.6022497677216843 2.0 - - - - - - - 361.0 13 4 CDR2 cerebellar degeneration-related protein 2, 62kDa 1881 239 C20140704_OR005_01 C20140704_OR005_01 TB427149.[MT7]-MPLIGLGTWK[MT7].3b4_1.heavy 468.616 / 599.371 2355.0 44.01169967651367 41 11 10 10 10 0.8128958499513786 70.89216623050955 0.0 3 0.8794396711059552 3.5180107183761278 2355.0 33.652510760401725 0.0 - - - - - - - 102.0 4 4 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1883 239 C20140704_OR005_01 C20140704_OR005_01 TB427149.[MT7]-MPLIGLGTWK[MT7].3b5_1.heavy 468.616 / 656.392 7373.0 44.01169967651367 41 11 10 10 10 0.8128958499513786 70.89216623050955 0.0 3 0.8794396711059552 3.5180107183761278 7373.0 67.25614634146342 0.0 - - - - - - - 163.8 14 5 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1885 239 C20140704_OR005_01 C20140704_OR005_01 TB427149.[MT7]-MPLIGLGTWK[MT7].3y4_1.heavy 468.616 / 635.363 7987.0 44.01169967651367 41 11 10 10 10 0.8128958499513786 70.89216623050955 0.0 3 0.8794396711059552 3.5180107183761278 7987.0 154.25872549019607 0.0 - - - - - - - 184.2 15 5 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1887 239 C20140704_OR005_01 C20140704_OR005_01 TB427149.[MT7]-MPLIGLGTWK[MT7].3b3_1.heavy 468.616 / 486.287 6656.0 44.01169967651367 41 11 10 10 10 0.8128958499513786 70.89216623050955 0.0 3 0.8794396711059552 3.5180107183761278 6656.0 48.377756097560976 0.0 - - - - - - - 143.2 13 5 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 1889 240 C20140704_OR005_01 C20140704_OR005_01 TB412872.[MT7]-VVMNSAQASIK[MT7].2y4_1.heavy 718.413 / 562.368 3390.0 26.73824977874756 40 14 10 6 10 3.4650471504130227 23.439699610854838 0.03769874572753906 3 0.9338547477273033 4.771880772237731 3390.0 15.679566783581382 0.0 - - - - - - - 236.84615384615384 6 13 SDCCAG3 serologically defined colon cancer antigen 3 1891 240 C20140704_OR005_01 C20140704_OR005_01 TB412872.[MT7]-VVMNSAQASIK[MT7].2y8_1.heavy 718.413 / 962.539 7087.0 26.73824977874756 40 14 10 6 10 3.4650471504130227 23.439699610854838 0.03769874572753906 3 0.9338547477273033 4.771880772237731 7087.0 64.54522122221434 0.0 - - - - - - - 205.45454545454547 14 11 SDCCAG3 serologically defined colon cancer antigen 3 1893 240 C20140704_OR005_01 C20140704_OR005_01 TB412872.[MT7]-VVMNSAQASIK[MT7].2b4_1.heavy 718.413 / 588.33 5033.0 26.73824977874756 40 14 10 6 10 3.4650471504130227 23.439699610854838 0.03769874572753906 3 0.9338547477273033 4.771880772237731 5033.0 13.898522727272727 0.0 - - - - - - - 182.55555555555554 10 9 SDCCAG3 serologically defined colon cancer antigen 3 1895 240 C20140704_OR005_01 C20140704_OR005_01 TB412872.[MT7]-VVMNSAQASIK[MT7].2y9_1.heavy 718.413 / 1093.58 8320.0 26.73824977874756 40 14 10 6 10 3.4650471504130227 23.439699610854838 0.03769874572753906 3 0.9338547477273033 4.771880772237731 8320.0 49.43376623376623 0.0 - - - - - - - 193.88888888888889 16 9 SDCCAG3 serologically defined colon cancer antigen 3 1897 241 C20140704_OR005_01 C20140704_OR005_01 TB413379.[MT7]-ASPC[CAM]DPTFILGC[CAM]APC[CAM]NVIC[CAM]SVVFQK[MT7].4y4_1.heavy 782.887 / 665.41 2086.0 48.629950523376465 39 17 10 2 10 4.034678176800508 24.78512426963873 0.08359909057617188 3 0.9708908783750256 7.215869286490095 2086.0 24.171235319578706 1.0 - - - - - - - 164.33333333333334 4 9 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1899 241 C20140704_OR005_01 C20140704_OR005_01 TB413379.[MT7]-ASPC[CAM]DPTFILGC[CAM]APC[CAM]NVIC[CAM]SVVFQK[MT7].4b8_1.heavy 782.887 / 1020.46 2086.0 48.629950523376465 39 17 10 2 10 4.034678176800508 24.78512426963873 0.08359909057617188 3 0.9708908783750256 7.215869286490095 2086.0 19.329467432950192 0.0 - - - - - - - 212.66666666666666 4 9 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1901 241 C20140704_OR005_01 C20140704_OR005_01 TB413379.[MT7]-ASPC[CAM]DPTFILGC[CAM]APC[CAM]NVIC[CAM]SVVFQK[MT7].4b5_1.heavy 782.887 / 675.289 5564.0 48.629950523376465 39 17 10 2 10 4.034678176800508 24.78512426963873 0.08359909057617188 3 0.9708908783750256 7.215869286490095 5564.0 19.307773842467974 0.0 - - - - - - - 211.28571428571428 11 7 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1903 241 C20140704_OR005_01 C20140704_OR005_01 TB413379.[MT7]-ASPC[CAM]DPTFILGC[CAM]APC[CAM]NVIC[CAM]SVVFQK[MT7].4y3_1.heavy 782.887 / 566.342 3651.0 48.629950523376465 39 17 10 2 10 4.034678176800508 24.78512426963873 0.08359909057617188 3 0.9708908783750256 7.215869286490095 3651.0 14.109888435973707 1.0 - - - - - - - 189.8181818181818 7 11 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1905 242 C20140704_OR005_01 C20140704_OR005_01 TB413270.[MT7]-GVYPDLLATSGDYLRVWR.3y6_1.heavy 742.399 / 892.515 714.0 45.57435131072998 43 18 10 5 10 2.608552869134352 30.37696347996504 0.043399810791015625 3 0.9837231167916467 9.660195158443436 714.0 7.886666666666667 0.0 - - - - - - - 0.0 1 0 DCAF7 DDB1 and CUL4 associated factor 7 1907 242 C20140704_OR005_01 C20140704_OR005_01 TB413270.[MT7]-GVYPDLLATSGDYLRVWR.3b6_1.heavy 742.399 / 789.426 1021.0 45.57435131072998 43 18 10 5 10 2.608552869134352 30.37696347996504 0.043399810791015625 3 0.9837231167916467 9.660195158443436 1021.0 2.0341351540616244 2.0 - - - - - - - 243.23076923076923 2 13 DCAF7 DDB1 and CUL4 associated factor 7 1909 242 C20140704_OR005_01 C20140704_OR005_01 TB413270.[MT7]-GVYPDLLATSGDYLRVWR.3b5_1.heavy 742.399 / 676.342 1735.0 45.57435131072998 43 18 10 5 10 2.608552869134352 30.37696347996504 0.043399810791015625 3 0.9837231167916467 9.660195158443436 1735.0 6.647998366013072 0.0 - - - - - - - 699.7142857142857 3 7 DCAF7 DDB1 and CUL4 associated factor 7 1911 242 C20140704_OR005_01 C20140704_OR005_01 TB413270.[MT7]-GVYPDLLATSGDYLRVWR.3y13_2.heavy 742.399 / 775.428 1225.0 45.57435131072998 43 18 10 5 10 2.608552869134352 30.37696347996504 0.043399810791015625 3 0.9837231167916467 9.660195158443436 1225.0 8.870098039215685 0.0 - - - - - - - 127.5 2 4 DCAF7 DDB1 and CUL4 associated factor 7 1913 243 C20140704_OR005_01 C20140704_OR005_01 TB412875.[MT7]-TLQISYDALK[MT7].3b4_1.heavy 480.616 / 600.384 12891.0 35.649200439453125 46 16 10 10 10 3.011518670603743 33.20583763140084 0.0 3 0.9604731427960302 6.186930277731313 12891.0 50.75696830062763 0.0 - - - - - - - 337.75 25 4 SDCCAG3 serologically defined colon cancer antigen 3 1915 243 C20140704_OR005_01 C20140704_OR005_01 TB412875.[MT7]-TLQISYDALK[MT7].3b5_1.heavy 480.616 / 687.416 4174.0 35.649200439453125 46 16 10 10 10 3.011518670603743 33.20583763140084 0.0 3 0.9604731427960302 6.186930277731313 4174.0 5.2594868572186675 1.0 - - - - - - - 307.0 9 6 SDCCAG3 serologically defined colon cancer antigen 3 1917 243 C20140704_OR005_01 C20140704_OR005_01 TB412875.[MT7]-TLQISYDALK[MT7].3y4_1.heavy 480.616 / 590.363 18784.0 35.649200439453125 46 16 10 10 10 3.011518670603743 33.20583763140084 0.0 3 0.9604731427960302 6.186930277731313 18784.0 48.96099564141518 0.0 - - - - - - - 245.77777777777777 37 9 SDCCAG3 serologically defined colon cancer antigen 3 1919 243 C20140704_OR005_01 C20140704_OR005_01 TB412875.[MT7]-TLQISYDALK[MT7].3b3_1.heavy 480.616 / 487.3 27623.0 35.649200439453125 46 16 10 10 10 3.011518670603743 33.20583763140084 0.0 3 0.9604731427960302 6.186930277731313 27623.0 98.40281052306256 0.0 - - - - - - - 245.75 55 8 SDCCAG3 serologically defined colon cancer antigen 3 1921 244 C20140704_OR005_01 C20140704_OR005_01 TB426949.[MT7]-IRVVLNK[MT7].2y4_1.heavy 565.387 / 617.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD4;EHD2 EH-domain containing 1;EH-domain containing 4;EH-domain containing 2 1923 244 C20140704_OR005_01 C20140704_OR005_01 TB426949.[MT7]-IRVVLNK[MT7].2y5_1.heavy 565.387 / 716.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD4;EHD2 EH-domain containing 1;EH-domain containing 4;EH-domain containing 2 1925 244 C20140704_OR005_01 C20140704_OR005_01 TB426949.[MT7]-IRVVLNK[MT7].2y3_1.heavy 565.387 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD4;EHD2 EH-domain containing 1;EH-domain containing 4;EH-domain containing 2 1927 244 C20140704_OR005_01 C20140704_OR005_01 TB426949.[MT7]-IRVVLNK[MT7].2b5_1.heavy 565.387 / 725.515 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD1;EHD4;EHD2 EH-domain containing 1;EH-domain containing 4;EH-domain containing 2 1929 245 C20140704_OR005_01 C20140704_OR005_01 TB427004.[MT7]-SVTLLC[CAM]QSR.2y8_1.heavy 604.333 / 976.524 12905.0 28.62019920349121 48 18 10 10 10 4.175086992718662 20.07209770817483 0.0 3 0.9865437007034454 10.6270162594708 12905.0 39.158699138176765 1.0 - - - - - - - 183.2 27 5 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1931 245 C20140704_OR005_01 C20140704_OR005_01 TB427004.[MT7]-SVTLLC[CAM]QSR.2y5_1.heavy 604.333 / 663.324 13108.0 28.62019920349121 48 18 10 10 10 4.175086992718662 20.07209770817483 0.0 3 0.9865437007034454 10.6270162594708 13108.0 90.72285714285714 0.0 - - - - - - - 203.25 26 8 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1933 245 C20140704_OR005_01 C20140704_OR005_01 TB427004.[MT7]-SVTLLC[CAM]QSR.2y6_1.heavy 604.333 / 776.408 10365.0 28.62019920349121 48 18 10 10 10 4.175086992718662 20.07209770817483 0.0 3 0.9865437007034454 10.6270162594708 10365.0 65.5406035452465 0.0 - - - - - - - 169.33333333333334 20 6 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1935 245 C20140704_OR005_01 C20140704_OR005_01 TB427004.[MT7]-SVTLLC[CAM]QSR.2y7_1.heavy 604.333 / 877.456 23574.0 28.62019920349121 48 18 10 10 10 4.175086992718662 20.07209770817483 0.0 3 0.9865437007034454 10.6270162594708 23574.0 127.81513252039085 0.0 - - - - - - - 203.33333333333334 47 9 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 1937 246 C20140704_OR005_01 C20140704_OR005_01 TB427144.[MT7]-SPTTPGETAHVR.3y7_1.heavy 466.248 / 769.395 684.0 18.00779962539673 22 3 6 3 10 0.41577495043350016 110.47787979624692 0.07779884338378906 3 0.5722047820078101 1.8150175974548668 684.0 9.04312769010043 1.0 - - - - - - - 0.0 1 0 CPA2 carboxypeptidase A2 (pancreatic) 1939 246 C20140704_OR005_01 C20140704_OR005_01 TB427144.[MT7]-SPTTPGETAHVR.3y8_1.heavy 466.248 / 866.448 68.0 18.00779962539673 22 3 6 3 10 0.41577495043350016 110.47787979624692 0.07779884338378906 3 0.5722047820078101 1.8150175974548668 68.0 0.999 13.0 - - - - - - - 256.5 6 4 CPA2 carboxypeptidase A2 (pancreatic) 1941 246 C20140704_OR005_01 C20140704_OR005_01 TB427144.[MT7]-SPTTPGETAHVR.3b4_1.heavy 466.248 / 531.289 1984.0 18.00779962539673 22 3 6 3 10 0.41577495043350016 110.47787979624692 0.07779884338378906 3 0.5722047820078101 1.8150175974548668 1984.0 31.943969728242173 0.0 - - - - - - - 216.66666666666666 3 6 CPA2 carboxypeptidase A2 (pancreatic) 1943 246 C20140704_OR005_01 C20140704_OR005_01 TB427144.[MT7]-SPTTPGETAHVR.3y4_1.heavy 466.248 / 482.283 1642.0 18.00779962539673 22 3 6 3 10 0.41577495043350016 110.47787979624692 0.07779884338378906 3 0.5722047820078101 1.8150175974548668 1642.0 10.547153284671532 0.0 - - - - - - - 177.9 3 10 CPA2 carboxypeptidase A2 (pancreatic) 1945 247 C20140704_OR005_01 C20140704_OR005_01 TB450889.[MT7]-REDIFYTSK[MT7].3b4_1.heavy 482.933 / 658.364 7550.0 26.832375049591064 38 17 10 3 8 6.651807770091382 15.03350719929572 0.07349967956542969 4 0.9744872128114898 7.710023975862719 7550.0 20.184642147117295 0.0 - - - - - - - 163.75 15 8 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1947 247 C20140704_OR005_01 C20140704_OR005_01 TB450889.[MT7]-REDIFYTSK[MT7].3b5_1.heavy 482.933 / 805.432 3825.0 26.832375049591064 38 17 10 3 8 6.651807770091382 15.03350719929572 0.07349967956542969 4 0.9744872128114898 7.710023975862719 3825.0 40.97435004262016 0.0 - - - - - - - 151.0 7 2 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1949 247 C20140704_OR005_01 C20140704_OR005_01 TB450889.[MT7]-REDIFYTSK[MT7].3y4_1.heavy 482.933 / 642.358 6442.0 26.832375049591064 38 17 10 3 8 6.651807770091382 15.03350719929572 0.07349967956542969 4 0.9744872128114898 7.710023975862719 6442.0 5.23739837398374 1.0 - - - - - - - 258.85714285714283 16 7 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1951 247 C20140704_OR005_01 C20140704_OR005_01 TB450889.[MT7]-REDIFYTSK[MT7].3b3_1.heavy 482.933 / 545.28 26474.0 26.832375049591064 38 17 10 3 8 6.651807770091382 15.03350719929572 0.07349967956542969 4 0.9744872128114898 7.710023975862719 26474.0 204.30295308504358 0.0 - - - - - - - 201.5 52 8 LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 1953 248 C20140704_OR005_01 C20140704_OR005_01 TB451078.[MT7]-VILDNEEQRELQK[MT7].3y3_1.heavy 634.689 / 532.357 4977.0 28.440550804138184 40 14 10 6 10 2.815339392619471 28.377856346070544 0.03989982604980469 3 0.9367286880171113 4.880249771348653 4977.0 11.075239852398525 0.0 - - - - - - - 203.42857142857142 9 7 TRIM22 tripartite motif-containing 22 1955 248 C20140704_OR005_01 C20140704_OR005_01 TB451078.[MT7]-VILDNEEQRELQK[MT7].3y11_2.heavy 634.689 / 773.403 16658.0 28.440550804138184 40 14 10 6 10 2.815339392619471 28.377856346070544 0.03989982604980469 3 0.9367286880171113 4.880249771348653 16658.0 84.23712585495778 0.0 - - - - - - - 233.7 33 10 TRIM22 tripartite motif-containing 22 1957 248 C20140704_OR005_01 C20140704_OR005_01 TB451078.[MT7]-VILDNEEQRELQK[MT7].3b4_1.heavy 634.689 / 585.373 14626.0 28.440550804138184 40 14 10 6 10 2.815339392619471 28.377856346070544 0.03989982604980469 3 0.9367286880171113 4.880249771348653 14626.0 108.00302349995962 0.0 - - - - - - - 203.2 29 10 TRIM22 tripartite motif-containing 22 1959 248 C20140704_OR005_01 C20140704_OR005_01 TB451078.[MT7]-VILDNEEQRELQK[MT7].3y12_2.heavy 634.689 / 829.945 20009.0 28.440550804138184 40 14 10 6 10 2.815339392619471 28.377856346070544 0.03989982604980469 3 0.9367286880171113 4.880249771348653 20009.0 84.23749418176175 0.0 - - - - - - - 241.375 40 8 TRIM22 tripartite motif-containing 22 1961 249 C20140704_OR005_01 C20140704_OR005_01 TB426931.[MT7]-HLANIVER.2y5_1.heavy 548.323 / 630.357 1006.0 23.678775310516357 39 18 10 3 8 3.824127613555882 26.14975495208816 0.07689857482910156 4 0.9898015939914271 12.210302862785973 1006.0 5.22621777476255 1.0 - - - - - - - 279.44444444444446 2 9 TRIM22 tripartite motif-containing 22 1963 249 C20140704_OR005_01 C20140704_OR005_01 TB426931.[MT7]-HLANIVER.2b4_1.heavy 548.323 / 580.332 905.0 23.678775310516357 39 18 10 3 8 3.824127613555882 26.14975495208816 0.07689857482910156 4 0.9898015939914271 12.210302862785973 905.0 1.6192842942345924 2.0 - - - - - - - 211.2 2 10 TRIM22 tripartite motif-containing 22 1965 249 C20140704_OR005_01 C20140704_OR005_01 TB426931.[MT7]-HLANIVER.2y6_1.heavy 548.323 / 701.394 1508.0 23.678775310516357 39 18 10 3 8 3.824127613555882 26.14975495208816 0.07689857482910156 4 0.9898015939914271 12.210302862785973 1508.0 17.916645978030637 0.0 - - - - - - - 201.27272727272728 3 11 TRIM22 tripartite motif-containing 22 1967 249 C20140704_OR005_01 C20140704_OR005_01 TB426931.[MT7]-HLANIVER.2y7_1.heavy 548.323 / 814.478 2413.0 23.678775310516357 39 18 10 3 8 3.824127613555882 26.14975495208816 0.07689857482910156 4 0.9898015939914271 12.210302862785973 2413.0 9.018439425389609 0.0 - - - - - - - 246.0 4 9 TRIM22 tripartite motif-containing 22 1969 250 C20140704_OR005_01 C20140704_OR005_01 TB412568.[MT7]-NYLIPK[MT7].2b3_1.heavy 518.326 / 535.3 3047.0 29.949166615804035 22 12 4 6 0 0.8171463937864281 76.27552294084052 0.034999847412109375 25 0.8936358274406595 3.7500572190773482 3047.0 10.501746187827466 1.0 - - - - - - - 203.4 12 5 CYP2C19;CYP2C8;CYP2C9;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 19;cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 9;cytochrome P450, family 2, subfamily C, polypeptide 18 1971 250 C20140704_OR005_01 C20140704_OR005_01 TB412568.[MT7]-NYLIPK[MT7].2y5_1.heavy 518.326 / 777.499 203.0 29.949166615804035 22 12 4 6 0 0.8171463937864281 76.27552294084052 0.034999847412109375 25 0.8936358274406595 3.7500572190773482 203.0 0.5324590163934427 30.0 - - - - - - - 225.77777777777777 9 9 CYP2C19;CYP2C8;CYP2C9;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 19;cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 9;cytochrome P450, family 2, subfamily C, polypeptide 18 1973 250 C20140704_OR005_01 C20140704_OR005_01 TB412568.[MT7]-NYLIPK[MT7].2b4_1.heavy 518.326 / 648.384 1523.0 29.949166615804035 22 12 4 6 0 0.8171463937864281 76.27552294084052 0.034999847412109375 25 0.8936358274406595 3.7500572190773482 1523.0 7.201183041774951 3.0 - - - - - - - 239.42857142857142 5 14 CYP2C19;CYP2C8;CYP2C9;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 19;cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 9;cytochrome P450, family 2, subfamily C, polypeptide 18 1975 250 C20140704_OR005_01 C20140704_OR005_01 TB412568.[MT7]-NYLIPK[MT7].2y3_1.heavy 518.326 / 501.352 N/A 29.949166615804035 22 12 4 6 0 0.8171463937864281 76.27552294084052 0.034999847412109375 25 0.8936358274406595 3.7500572190773482 4469.0 1.2836684448091915 5.0 - - - - - - - 284.2 15 5 CYP2C19;CYP2C8;CYP2C9;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 19;cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 9;cytochrome P450, family 2, subfamily C, polypeptide 18 1977 251 C20140704_OR005_01 C20140704_OR005_01 TB427299.[MT7]-QDASTLISDLQRR.3b4_1.heavy 549.636 / 546.264 2372.0 34.63750076293945 32 16 0 10 6 2.7968177130600633 28.55684208696635 0.0 5 0.9690282530804419 6.994427845991924 2372.0 5.243542168674699 3.0 - - - - - - - 779.4285714285714 8 7 TRIM22 tripartite motif-containing 22 1979 251 C20140704_OR005_01 C20140704_OR005_01 TB427299.[MT7]-QDASTLISDLQRR.3y11_2.heavy 549.636 / 630.357 5811.0 34.63750076293945 32 16 0 10 6 2.7968177130600633 28.55684208696635 0.0 5 0.9690282530804419 6.994427845991924 5811.0 10.6049966663752 0.0 - - - - - - - 257.0 11 12 TRIM22 tripartite motif-containing 22 1981 251 C20140704_OR005_01 C20140704_OR005_01 TB427299.[MT7]-QDASTLISDLQRR.3b5_1.heavy 549.636 / 647.312 4032.0 34.63750076293945 32 16 0 10 6 2.7968177130600633 28.55684208696635 0.0 5 0.9690282530804419 6.994427845991924 4032.0 33.4292550342228 1.0 - - - - - - - 237.30769230769232 8 13 TRIM22 tripartite motif-containing 22 1983 251 C20140704_OR005_01 C20140704_OR005_01 TB427299.[MT7]-QDASTLISDLQRR.3y12_2.heavy 549.636 / 687.87 4981.0 34.63750076293945 32 16 0 10 6 2.7968177130600633 28.55684208696635 0.0 5 0.9690282530804419 6.994427845991924 4981.0 38.250717299578056 2.0 - - - - - - - 316.22222222222223 41 9 TRIM22 tripartite motif-containing 22 1985 252 C20140704_OR005_01 C20140704_OR005_01 TB450883.[MT7]-VQEEIDHVIGR.3b6_1.heavy 480.264 / 858.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1987 252 C20140704_OR005_01 C20140704_OR005_01 TB450883.[MT7]-VQEEIDHVIGR.3b4_1.heavy 480.264 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1989 252 C20140704_OR005_01 C20140704_OR005_01 TB450883.[MT7]-VQEEIDHVIGR.3b3_1.heavy 480.264 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1991 252 C20140704_OR005_01 C20140704_OR005_01 TB450883.[MT7]-VQEEIDHVIGR.3y5_1.heavy 480.264 / 581.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 1993 253 C20140704_OR005_01 C20140704_OR005_01 TB427437.[MT7]-SHMPYTDAVVHEIQR.4y4_1.heavy 482.496 / 545.304 N/A 30.056033452351887 30 18 0 6 6 2.538137265124147 31.315390512311893 0.035800933837890625 5 0.9800728095034064 8.728015224441432 3147.0 1.901011162179908 5.0 - - - - - - - 304.6666666666667 65 6 CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1995 253 C20140704_OR005_01 C20140704_OR005_01 TB427437.[MT7]-SHMPYTDAVVHEIQR.4y5_1.heavy 482.496 / 682.363 5076.0 30.056033452351887 30 18 0 6 6 2.538137265124147 31.315390512311893 0.035800933837890625 5 0.9800728095034064 8.728015224441432 5076.0 11.658437022413644 0.0 - - - - - - - 159.85714285714286 10 7 CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1997 253 C20140704_OR005_01 C20140704_OR005_01 TB427437.[MT7]-SHMPYTDAVVHEIQR.4y6_1.heavy 482.496 / 781.432 3147.0 30.056033452351887 30 18 0 6 6 2.538137265124147 31.315390512311893 0.035800933837890625 5 0.9800728095034064 8.728015224441432 3147.0 2.445944170771757 0.0 - - - - - - - 305.0 6 1 CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 1999 253 C20140704_OR005_01 C20140704_OR005_01 TB427437.[MT7]-SHMPYTDAVVHEIQR.4b3_1.heavy 482.496 / 500.241 4061.0 30.056033452351887 30 18 0 6 6 2.538137265124147 31.315390512311893 0.035800933837890625 5 0.9800728095034064 8.728015224441432 4061.0 0.7509788944723619 2.0 - - - - - - - 188.85714285714286 14 7 CYP2C8;CYP2C18 cytochrome P450, family 2, subfamily C, polypeptide 8;cytochrome P450, family 2, subfamily C, polypeptide 18 2001 254 C20140704_OR005_01 C20140704_OR005_01 TB427294.[MT7]-NTQPEDGVEMDTR.2y10_1.heavy 818.374 / 1148.49 1707.0 23.133299509684246 38 12 10 6 10 0.9312261722312988 68.27159850318587 0.03510093688964844 3 0.8942949702166844 3.761946163098875 1707.0 4.313937375083278 0.0 - - - - - - - 189.75 3 4 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 2003 254 C20140704_OR005_01 C20140704_OR005_01 TB427294.[MT7]-NTQPEDGVEMDTR.2y8_1.heavy 818.374 / 922.393 379.0 23.133299509684246 38 12 10 6 10 0.9312261722312988 68.27159850318587 0.03510093688964844 3 0.8942949702166844 3.761946163098875 379.0 0.7978947368421053 4.0 - - - - - - - 0.0 0 0 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 2005 254 C20140704_OR005_01 C20140704_OR005_01 TB427294.[MT7]-NTQPEDGVEMDTR.2y7_1.heavy 818.374 / 807.367 N/A 23.133299509684246 38 12 10 6 10 0.9312261722312988 68.27159850318587 0.03510093688964844 3 0.8942949702166844 3.761946163098875 2181.0 21.58042105263158 1.0 - - - - - - - 252.66666666666666 4 6 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 2007 254 C20140704_OR005_01 C20140704_OR005_01 TB427294.[MT7]-NTQPEDGVEMDTR.2b6_1.heavy 818.374 / 829.381 1138.0 23.133299509684246 38 12 10 6 10 0.9312261722312988 68.27159850318587 0.03510093688964844 3 0.8942949702166844 3.761946163098875 1138.0 13.779833000222075 0.0 - - - - - - - 203.14285714285714 2 7 LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 2009 255 C20140704_OR005_01 C20140704_OR005_01 TB427433.[MT7]-K[MT7]C[CAM]QEEQDSLSHK[MT7].3y3_1.heavy 640.998 / 515.306 3221.0 17.377949714660645 40 14 10 6 10 3.3153785843002854 30.162467862204977 0.037799835205078125 3 0.9453862075218011 5.2567166651406625 3221.0 61.495510718789404 0.0 - - - - - - - 192.33333333333334 6 6 CDR2 cerebellar degeneration-related protein 2, 62kDa 2011 255 C20140704_OR005_01 C20140704_OR005_01 TB427433.[MT7]-K[MT7]C[CAM]QEEQDSLSHK[MT7].3b5_1.heavy 640.998 / 963.481 304.0 17.377949714660645 40 14 10 6 10 3.3153785843002854 30.162467862204977 0.037799835205078125 3 0.9453862075218011 5.2567166651406625 304.0 6.229508196721312 1.0 - - - - - - - 0.0 0 0 CDR2 cerebellar degeneration-related protein 2, 62kDa 2013 255 C20140704_OR005_01 C20140704_OR005_01 TB427433.[MT7]-K[MT7]C[CAM]QEEQDSLSHK[MT7].3y5_1.heavy 640.998 / 715.422 1094.0 17.377949714660645 40 14 10 6 10 3.3153785843002854 30.162467862204977 0.037799835205078125 3 0.9453862075218011 5.2567166651406625 1094.0 25.108196721311476 0.0 - - - - - - - 91.33333333333333 2 6 CDR2 cerebellar degeneration-related protein 2, 62kDa 2015 255 C20140704_OR005_01 C20140704_OR005_01 TB427433.[MT7]-K[MT7]C[CAM]QEEQDSLSHK[MT7].3b7_2.heavy 640.998 / 603.787 1337.0 17.377949714660645 40 14 10 6 10 3.3153785843002854 30.162467862204977 0.037799835205078125 3 0.9453862075218011 5.2567166651406625 1337.0 9.770384615384614 0.0 - - - - - - - 174.625 2 8 CDR2 cerebellar degeneration-related protein 2, 62kDa 2017 256 C20140704_OR005_01 C20140704_OR005_01 TB412882.[MT7]-REDIFYTSK[MT7].2y4_1.heavy 723.895 / 642.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 2019 256 C20140704_OR005_01 C20140704_OR005_01 TB412882.[MT7]-REDIFYTSK[MT7].2b3_1.heavy 723.895 / 545.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 2021 256 C20140704_OR005_01 C20140704_OR005_01 TB412882.[MT7]-REDIFYTSK[MT7].2y5_1.heavy 723.895 / 789.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 2023 256 C20140704_OR005_01 C20140704_OR005_01 TB412882.[MT7]-REDIFYTSK[MT7].2b5_1.heavy 723.895 / 805.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100508006;AKR1C4;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4);aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 2025 257 C20140704_OR005_01 C20140704_OR005_01 TB413262.[MT7]-LRGSSVEMLQDVIDVMK[MT7].3y3_1.heavy 736.737 / 521.324 7860.0 47.15719985961914 41 11 10 10 10 1.0187312603626717 64.89105806280685 0.0 3 0.86999430589227 3.385008628477809 7860.0 32.002843455556814 0.0 - - - - - - - 205.42857142857142 15 7 TRIM22 tripartite motif-containing 22 2027 257 C20140704_OR005_01 C20140704_OR005_01 TB413262.[MT7]-LRGSSVEMLQDVIDVMK[MT7].3y4_1.heavy 736.737 / 636.351 14666.0 47.15719985961914 41 11 10 10 10 1.0187312603626717 64.89105806280685 0.0 3 0.86999430589227 3.385008628477809 14666.0 112.00136368581374 0.0 - - - - - - - 239.83333333333334 29 6 TRIM22 tripartite motif-containing 22 2029 257 C20140704_OR005_01 C20140704_OR005_01 TB413262.[MT7]-LRGSSVEMLQDVIDVMK[MT7].3b8_1.heavy 736.737 / 1004.53 6135.0 47.15719985961914 41 11 10 10 10 1.0187312603626717 64.89105806280685 0.0 3 0.86999430589227 3.385008628477809 6135.0 80.09583333333333 0.0 - - - - - - - 179.875 12 8 TRIM22 tripartite motif-containing 22 2031 257 C20140704_OR005_01 C20140704_OR005_01 TB413262.[MT7]-LRGSSVEMLQDVIDVMK[MT7].3b7_1.heavy 736.737 / 873.491 8819.0 47.15719985961914 41 11 10 10 10 1.0187312603626717 64.89105806280685 0.0 3 0.86999430589227 3.385008628477809 8819.0 115.90248263888888 0.0 - - - - - - - 239.66666666666666 17 6 TRIM22 tripartite motif-containing 22 2033 258 C20140704_OR005_01 C20140704_OR005_01 TB427158.[MT7]-GESSC[CAM]PVC[CAM]QTR.2y8_1.heavy 712.823 / 1007.44 1437.0 17.202499866485596 32 9 10 3 10 3.1692242667689485 25.17493962211493 0.07359886169433594 3 0.8067917661051994 2.7611839987870077 1437.0 43.34177419354839 0.0 - - - - - - - 82.83333333333333 2 6 TRIM22 tripartite motif-containing 22 2035 258 C20140704_OR005_01 C20140704_OR005_01 TB427158.[MT7]-GESSC[CAM]PVC[CAM]QTR.2y9_1.heavy 712.823 / 1094.47 1562.0 17.202499866485596 32 9 10 3 10 3.1692242667689485 25.17493962211493 0.07359886169433594 3 0.8067917661051994 2.7611839987870077 1562.0 13.873764102564103 0.0 - - - - - - - 145.5 3 6 TRIM22 tripartite motif-containing 22 2037 258 C20140704_OR005_01 C20140704_OR005_01 TB427158.[MT7]-GESSC[CAM]PVC[CAM]QTR.2y6_1.heavy 712.823 / 760.377 625.0 17.202499866485596 32 9 10 3 10 3.1692242667689485 25.17493962211493 0.07359886169433594 3 0.8067917661051994 2.7611839987870077 625.0 2.339572192513369 1.0 - - - - - - - 0.0 1 0 TRIM22 tripartite motif-containing 22 2039 258 C20140704_OR005_01 C20140704_OR005_01 TB427158.[MT7]-GESSC[CAM]PVC[CAM]QTR.2b5_1.heavy 712.823 / 665.268 1000.0 17.202499866485596 32 9 10 3 10 3.1692242667689485 25.17493962211493 0.07359886169433594 3 0.8067917661051994 2.7611839987870077 1000.0 6.311743772241993 0.0 - - - - - - - 179.625 2 8 TRIM22 tripartite motif-containing 22 2041 259 C20140704_OR005_01 C20140704_OR005_01 TB450705.[MT7]-NLC[CAM]EWMR.2b3_1.heavy 576.774 / 532.267 2310.0 34.86140060424805 48 18 10 10 10 3.72177322642228 21.43340419096087 0.0 3 0.9853870127331514 10.196769042199366 2310.0 3.683076923076923 2.0 - - - - - - - 754.2857142857143 4 7 CDX2 caudal type homeobox 2 2043 259 C20140704_OR005_01 C20140704_OR005_01 TB450705.[MT7]-NLC[CAM]EWMR.2y5_1.heavy 576.774 / 781.312 5280.0 34.86140060424805 48 18 10 10 10 3.72177322642228 21.43340419096087 0.0 3 0.9853870127331514 10.196769042199366 5280.0 8.0 0.0 - - - - - - - 256.6666666666667 10 6 CDX2 caudal type homeobox 2 2045 259 C20140704_OR005_01 C20140704_OR005_01 TB450705.[MT7]-NLC[CAM]EWMR.2b4_1.heavy 576.774 / 661.31 7370.0 34.86140060424805 48 18 10 10 10 3.72177322642228 21.43340419096087 0.0 3 0.9853870127331514 10.196769042199366 7370.0 21.7415 0.0 - - - - - - - 330.0 14 8 CDX2 caudal type homeobox 2 2047 259 C20140704_OR005_01 C20140704_OR005_01 TB450705.[MT7]-NLC[CAM]EWMR.2y6_1.heavy 576.774 / 894.396 9899.0 34.86140060424805 48 18 10 10 10 3.72177322642228 21.43340419096087 0.0 3 0.9853870127331514 10.196769042199366 9899.0 49.794969696969694 0.0 - - - - - - - 286.0 19 5 CDX2 caudal type homeobox 2 2049 260 C20140704_OR005_01 C20140704_OR005_01 TB427539.[MT7]-REMASPPSPLSGEFLDTK[MT7].3b5_1.heavy 750.727 / 719.363 609.0 35.2734489440918 34 15 10 5 4 2.4652572294208945 31.590727485326447 0.04489898681640625 8 0.9577262434870535 5.981154395301957 609.0 0.5493440605710136 8.0 - - - - - - - 244.0 2 9 LILRB1;LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 2051 260 C20140704_OR005_01 C20140704_OR005_01 TB427539.[MT7]-REMASPPSPLSGEFLDTK[MT7].3y4_1.heavy 750.727 / 620.374 609.0 35.2734489440918 34 15 10 5 4 2.4652572294208945 31.590727485326447 0.04489898681640625 8 0.9577262434870535 5.981154395301957 609.0 1.089188396229875 10.0 - - - - - - - 300.3076923076923 2 13 LILRB1;LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 2053 260 C20140704_OR005_01 C20140704_OR005_01 TB427539.[MT7]-REMASPPSPLSGEFLDTK[MT7].3b17_2.heavy 750.727 / 980.484 1706.0 35.2734489440918 34 15 10 5 4 2.4652572294208945 31.590727485326447 0.04489898681640625 8 0.9577262434870535 5.981154395301957 1706.0 4.894262295081967 2.0 - - - - - - - 234.6153846153846 3 13 LILRB1;LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 2055 260 C20140704_OR005_01 C20140704_OR005_01 TB427539.[MT7]-REMASPPSPLSGEFLDTK[MT7].3y9_2.heavy 750.727 / 577.315 1341.0 35.2734489440918 34 15 10 5 4 2.4652572294208945 31.590727485326447 0.04489898681640625 8 0.9577262434870535 5.981154395301957 1341.0 0.8795046095347417 1.0 - - - - - - - 199.63636363636363 3 11 LILRB1;LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 2057 261 C20140704_OR005_01 C20140704_OR005_01 TB427150.[MT7]-LEC[CAM]LLNNNK[MT7].3y3_1.heavy 469.262 / 519.301 3533.0 32.95320129394531 46 20 10 10 6 7.161987157514406 13.962605321775719 0.0 5 0.9952484085338446 17.89660723782883 3533.0 4.257036822826297 3.0 - - - - - - - 216.6 9 10 DCAF7 DDB1 and CUL4 associated factor 7 2059 261 C20140704_OR005_01 C20140704_OR005_01 TB427150.[MT7]-LEC[CAM]LLNNNK[MT7].3b4_1.heavy 469.262 / 660.351 2850.0 32.95320129394531 46 20 10 10 6 7.161987157514406 13.962605321775719 0.0 5 0.9952484085338446 17.89660723782883 2850.0 32.375 0.0 - - - - - - - 195.42857142857142 5 7 DCAF7 DDB1 and CUL4 associated factor 7 2061 261 C20140704_OR005_01 C20140704_OR005_01 TB427150.[MT7]-LEC[CAM]LLNNNK[MT7].3y4_1.heavy 469.262 / 633.344 1710.0 32.95320129394531 46 20 10 10 6 7.161987157514406 13.962605321775719 0.0 5 0.9952484085338446 17.89660723782883 1710.0 2.8909090909090907 1.0 - - - - - - - 256.5 3 8 DCAF7 DDB1 and CUL4 associated factor 7 2063 261 C20140704_OR005_01 C20140704_OR005_01 TB427150.[MT7]-LEC[CAM]LLNNNK[MT7].3b3_1.heavy 469.262 / 547.267 6611.0 32.95320129394531 46 20 10 10 6 7.161987157514406 13.962605321775719 0.0 5 0.9952484085338446 17.89660723782883 6611.0 31.121959064327484 0.0 - - - - - - - 247.0 13 6 DCAF7 DDB1 and CUL4 associated factor 7 2065 262 C20140704_OR005_01 C20140704_OR005_01 TB413361.[MT7]-AWRDPDEPVLLEEPVVLALAEK[MT7].4y5_1.heavy 695.139 / 675.416 10652.0 47.89609909057617 46 16 10 10 10 2.7485463431793287 28.99810093463999 0.0 3 0.962031628025341 6.313462340931123 10652.0 59.89013333521421 0.0 - - - - - - - 207.22222222222223 21 9 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 2067 262 C20140704_OR005_01 C20140704_OR005_01 TB413361.[MT7]-AWRDPDEPVLLEEPVVLALAEK[MT7].4b7_1.heavy 695.139 / 1014.48 4882.0 47.89609909057617 46 16 10 10 10 2.7485463431793287 28.99810093463999 0.0 3 0.962031628025341 6.313462340931123 4882.0 4.462239848039028 1.0 - - - - - - - 211.0 10 8 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 2069 262 C20140704_OR005_01 C20140704_OR005_01 TB413361.[MT7]-AWRDPDEPVLLEEPVVLALAEK[MT7].4b10_2.heavy 695.139 / 662.344 19439.0 47.89609909057617 46 16 10 10 10 2.7485463431793287 28.99810093463999 0.0 3 0.962031628025341 6.313462340931123 19439.0 12.797289301348137 0.0 - - - - - - - 281.0 38 6 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 2071 262 C20140704_OR005_01 C20140704_OR005_01 TB413361.[MT7]-AWRDPDEPVLLEEPVVLALAEK[MT7].4b9_2.heavy 695.139 / 605.802 12338.0 47.89609909057617 46 16 10 10 10 2.7485463431793287 28.99810093463999 0.0 3 0.962031628025341 6.313462340931123 12338.0 133.91582022471908 0.0 - - - - - - - 142.4 24 5 AKR1A1 aldo-keto reductase family 1, member A1 (aldehyde reductase) 2073 263 C20140704_OR005_01 C20140704_OR005_01 TB450608.[MT7]-SVDDLK[MT7].2y4_1.heavy 482.781 / 634.353 2750.0 22.947399139404297 46 16 10 10 10 3.4656575462129826 28.8545531884051 0.0 3 0.9609433680441013 6.224310321811986 2750.0 44.4379157757187 0.0 - - - - - - - 144.0 5 7 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 2075 263 C20140704_OR005_01 C20140704_OR005_01 TB450608.[MT7]-SVDDLK[MT7].2y5_1.heavy 482.781 / 733.421 2108.0 22.947399139404297 46 16 10 10 10 3.4656575462129826 28.8545531884051 0.0 3 0.9609433680441013 6.224310321811986 2108.0 31.677595628415304 0.0 - - - - - - - 160.5 4 8 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 2077 263 C20140704_OR005_01 C20140704_OR005_01 TB450608.[MT7]-SVDDLK[MT7].2b4_1.heavy 482.781 / 561.264 12098.0 22.947399139404297 46 16 10 10 10 3.4656575462129826 28.8545531884051 0.0 3 0.9609433680441013 6.224310321811986 12098.0 68.73633999093231 0.0 - - - - - - - 213.77777777777777 24 9 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 2079 263 C20140704_OR005_01 C20140704_OR005_01 TB450608.[MT7]-SVDDLK[MT7].2y3_1.heavy 482.781 / 519.326 6507.0 22.947399139404297 46 16 10 10 10 3.4656575462129826 28.8545531884051 0.0 3 0.9609433680441013 6.224310321811986 6507.0 76.0119483949614 0.0 - - - - - - - 165.2 13 5 CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8