Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140704_OR005_02 C20140704_OR005_02 TB426979.[MT7]-QSAALC[CAM]LLR.2y8_1.heavy 588.338 / 903.508 6620.0 34.30217361450195 35 12 10 5 8 2.708692457930791 36.91818157768691 0.0438995361328125 4 0.8961134152535707 3.795326329797777 6620.0 90.27272727272728 0.0 - - - - - - - 198.5 13 6 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 3 1 C20140704_OR005_02 C20140704_OR005_02 TB426979.[MT7]-QSAALC[CAM]LLR.2b4_1.heavy 588.338 / 502.274 1986.0 34.30217361450195 35 12 10 5 8 2.708692457930791 36.91818157768691 0.0438995361328125 4 0.8961134152535707 3.795326329797777 1986.0 8.246605199372652 3.0 - - - - - - - 750.4444444444445 3 9 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 5 1 C20140704_OR005_02 C20140704_OR005_02 TB426979.[MT7]-QSAALC[CAM]LLR.2b5_1.heavy 588.338 / 615.358 662.0 34.30217361450195 35 12 10 5 8 2.708692457930791 36.91818157768691 0.0438995361328125 4 0.8961134152535707 3.795326329797777 662.0 1.1005037783375315 23.0 - - - - - - - 629.125 3 8 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 7 1 C20140704_OR005_02 C20140704_OR005_02 TB426979.[MT7]-QSAALC[CAM]LLR.2y7_1.heavy 588.338 / 816.476 1457.0 34.30217361450195 35 12 10 5 8 2.708692457930791 36.91818157768691 0.0438995361328125 4 0.8961134152535707 3.795326329797777 1457.0 2.0448414348172244 3.0 - - - - - - - 264.75 5 4 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 9 2 C20140704_OR005_02 C20140704_OR005_02 TB451049.[MT7]-GRLVEC[CAM]LETVLNK[MT7].2b8_1.heavy 910.021 / 1101.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 11 2 C20140704_OR005_02 C20140704_OR005_02 TB451049.[MT7]-GRLVEC[CAM]LETVLNK[MT7].2y5_1.heavy 910.021 / 718.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 13 2 C20140704_OR005_02 C20140704_OR005_02 TB451049.[MT7]-GRLVEC[CAM]LETVLNK[MT7].2y3_1.heavy 910.021 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 15 2 C20140704_OR005_02 C20140704_OR005_02 TB451049.[MT7]-GRLVEC[CAM]LETVLNK[MT7].2b5_1.heavy 910.021 / 699.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 17 3 C20140704_OR005_02 C20140704_OR005_02 TB450583.[MT7]-VVSISK[MT7].2y4_1.heavy 460.805 / 578.363 19184.0 24.80755043029785 44 20 10 6 8 8.596165385084799 11.633094004160267 0.0373992919921875 4 0.9969498726755734 22.340502415639218 19184.0 167.27657783915572 0.0 - - - - - - - 257.0 38 4 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 19 3 C20140704_OR005_02 C20140704_OR005_02 TB450583.[MT7]-VVSISK[MT7].2y5_1.heavy 460.805 / 677.431 17900.0 24.80755043029785 44 20 10 6 8 8.596165385084799 11.633094004160267 0.0373992919921875 4 0.9969498726755734 22.340502415639218 17900.0 197.84210526315792 0.0 - - - - - - - 134.71428571428572 35 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 21 3 C20140704_OR005_02 C20140704_OR005_02 TB450583.[MT7]-VVSISK[MT7].2b4_1.heavy 460.805 / 543.362 1456.0 24.80755043029785 44 20 10 6 8 8.596165385084799 11.633094004160267 0.0373992919921875 4 0.9969498726755734 22.340502415639218 1456.0 1.1330739299610897 5.0 - - - - - - - 182.125 20 8 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 23 3 C20140704_OR005_02 C20140704_OR005_02 TB450583.[MT7]-VVSISK[MT7].2y3_1.heavy 460.805 / 491.331 5567.0 24.80755043029785 44 20 10 6 8 8.596165385084799 11.633094004160267 0.0373992919921875 4 0.9969498726755734 22.340502415639218 5567.0 8.217060787348453 1.0 - - - - - - - 231.3 11 10 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 25 4 C20140704_OR005_02 C20140704_OR005_02 TB412661.[MT7]-VVSGIDLAK[MT7].2y4_1.heavy 595.373 / 590.363 6472.0 31.598074913024902 38 15 10 3 10 2.7959150015962972 28.848036306712682 0.07789993286132812 3 0.9598093779571526 6.135283293599224 6472.0 17.738610210877233 0.0 - - - - - - - 349.6666666666667 12 12 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 27 4 C20140704_OR005_02 C20140704_OR005_02 TB412661.[MT7]-VVSGIDLAK[MT7].2y8_1.heavy 595.373 / 946.569 13782.0 31.598074913024902 38 15 10 3 10 2.7959150015962972 28.848036306712682 0.07789993286132812 3 0.9598093779571526 6.135283293599224 13782.0 30.925862845242534 0.0 - - - - - - - 240.0 27 8 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 29 4 C20140704_OR005_02 C20140704_OR005_02 TB412661.[MT7]-VVSGIDLAK[MT7].2b6_1.heavy 595.373 / 715.411 5034.0 31.598074913024902 38 15 10 3 10 2.7959150015962972 28.848036306712682 0.07789993286132812 3 0.9598093779571526 6.135283293599224 5034.0 26.366362656467317 0.0 - - - - - - - 221.53846153846155 10 13 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 31 4 C20140704_OR005_02 C20140704_OR005_02 TB412661.[MT7]-VVSGIDLAK[MT7].2y7_1.heavy 595.373 / 847.5 9108.0 31.598074913024902 38 15 10 3 10 2.7959150015962972 28.848036306712682 0.07789993286132812 3 0.9598093779571526 6.135283293599224 9108.0 76.406 0.0 - - - - - - - 250.0 18 12 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 33 5 C20140704_OR005_02 C20140704_OR005_02 TB427507.[MT7]-SLGVAAEGLPDQYADGEAAR.2y5_1.heavy 1067.53 / 503.257 2821.0 33.7170991897583 36 11 10 5 10 8.064905813493855 12.399400850123294 0.042400360107421875 3 0.8662223274938455 3.3358433884121665 2821.0 11.302885903288093 0.0 - - - - - - - 192.0 5 2 GNMT glycine N-methyltransferase 35 5 C20140704_OR005_02 C20140704_OR005_02 TB427507.[MT7]-SLGVAAEGLPDQYADGEAAR.2b4_1.heavy 1067.53 / 501.315 6284.0 33.7170991897583 36 11 10 5 10 8.064905813493855 12.399400850123294 0.042400360107421875 3 0.8662223274938455 3.3358433884121665 6284.0 19.247285499073097 0.0 - - - - - - - 160.0 12 4 GNMT glycine N-methyltransferase 37 5 C20140704_OR005_02 C20140704_OR005_02 TB427507.[MT7]-SLGVAAEGLPDQYADGEAAR.2b5_1.heavy 1067.53 / 572.352 5258.0 33.7170991897583 36 11 10 5 10 8.064905813493855 12.399400850123294 0.042400360107421875 3 0.8662223274938455 3.3358433884121665 5258.0 39.825242187499995 0.0 - - - - - - - 256.2 10 5 GNMT glycine N-methyltransferase 39 5 C20140704_OR005_02 C20140704_OR005_02 TB427507.[MT7]-SLGVAAEGLPDQYADGEAAR.2y11_1.heavy 1067.53 / 1192.52 5130.0 33.7170991897583 36 11 10 5 10 8.064905813493855 12.399400850123294 0.042400360107421875 3 0.8662223274938455 3.3358433884121665 5130.0 46.071875000000006 0.0 - - - - - - - 256.25 10 4 GNMT glycine N-methyltransferase 41 6 C20140704_OR005_02 C20140704_OR005_02 TB412660.[MT7]-ELALVQTK[MT7].2y4_1.heavy 595.373 / 619.39 2628.0 29.77680015563965 40 16 8 10 6 3.4374310344704977 23.682674874480973 0.0 5 0.9605691156428255 6.194505315735636 2628.0 6.161359367713816 0.0 - - - - - - - 687.1818181818181 5 11 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 43 6 C20140704_OR005_02 C20140704_OR005_02 TB412660.[MT7]-ELALVQTK[MT7].2y5_1.heavy 595.373 / 732.474 1205.0 29.77680015563965 40 16 8 10 6 3.4374310344704977 23.682674874480973 0.0 5 0.9605691156428255 6.194505315735636 1205.0 0.04442190669371196 4.0 - - - - - - - 189.54545454545453 2 11 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 45 6 C20140704_OR005_02 C20140704_OR005_02 TB412660.[MT7]-ELALVQTK[MT7].2b4_1.heavy 595.373 / 571.357 2081.0 29.77680015563965 40 16 8 10 6 3.4374310344704977 23.682674874480973 0.0 5 0.9605691156428255 6.194505315735636 2081.0 3.3316240875912406 8.0 - - - - - - - 736.9090909090909 6 11 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 47 6 C20140704_OR005_02 C20140704_OR005_02 TB412660.[MT7]-ELALVQTK[MT7].2y6_1.heavy 595.373 / 803.511 1205.0 29.77680015563965 40 16 8 10 6 3.4374310344704977 23.682674874480973 0.0 5 0.9605691156428255 6.194505315735636 1205.0 1.9624809741248095 5.0 - - - - - - - 259.09090909090907 4 11 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 49 7 C20140704_OR005_02 C20140704_OR005_02 TB413001.[MT7]-DFPDDVISFIK[MT7].2y4_1.heavy 792.432 / 638.399 1417.0 45.815232594807945 30 15 6 5 4 2.1136887060234963 37.51555564650724 0.0457000732421875 7 0.9508943222636168 5.546296740670754 1417.0 4.680000000000001 1.0 - - - - - - - 241.35714285714286 4 14 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 51 7 C20140704_OR005_02 C20140704_OR005_02 TB413001.[MT7]-DFPDDVISFIK[MT7].2b4_1.heavy 792.432 / 619.284 N/A 45.815232594807945 30 15 6 5 4 2.1136887060234963 37.51555564650724 0.0457000732421875 7 0.9508943222636168 5.546296740670754 0.0 0.0 37.0 - - - - - - - 0.0 1 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 53 7 C20140704_OR005_02 C20140704_OR005_02 TB413001.[MT7]-DFPDDVISFIK[MT7].2y9_1.heavy 792.432 / 1177.66 763.0 45.815232594807945 30 15 6 5 4 2.1136887060234963 37.51555564650724 0.0457000732421875 7 0.9508943222636168 5.546296740670754 763.0 3.2375 5.0 - - - - - - - 0.0 1 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 55 7 C20140704_OR005_02 C20140704_OR005_02 TB413001.[MT7]-DFPDDVISFIK[MT7].2b5_1.heavy 792.432 / 734.311 981.0 45.815232594807945 30 15 6 5 4 2.1136887060234963 37.51555564650724 0.0457000732421875 7 0.9508943222636168 5.546296740670754 981.0 4.540909090909091 5.0 - - - - - - - 278.55555555555554 2 9 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 57 8 C20140704_OR005_02 C20140704_OR005_02 TB450801.[MT7]-IIPADFEAK[MT7].2y4_1.heavy 646.379 / 638.363 7815.0 34.947200775146484 48 18 10 10 10 1.6938376479608734 35.55316408589986 0.0 3 0.9864684448512515 10.597357149349055 7815.0 17.058202183541045 0.0 - - - - - - - 277.2 15 5 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 59 8 C20140704_OR005_02 C20140704_OR005_02 TB450801.[MT7]-IIPADFEAK[MT7].2y8_1.heavy 646.379 / 1034.56 8698.0 34.947200775146484 48 18 10 10 10 1.6938376479608734 35.55316408589986 0.0 3 0.9864684448512515 10.597357149349055 8698.0 19.836178546575205 0.0 - - - - - - - 173.25 17 8 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 61 8 C20140704_OR005_02 C20140704_OR005_02 TB450801.[MT7]-IIPADFEAK[MT7].2y5_1.heavy 646.379 / 753.39 3025.0 34.947200775146484 48 18 10 10 10 1.6938376479608734 35.55316408589986 0.0 3 0.9864684448512515 10.597357149349055 3025.0 6.187067337948395 0.0 - - - - - - - 126.0 6 4 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 63 8 C20140704_OR005_02 C20140704_OR005_02 TB450801.[MT7]-IIPADFEAK[MT7].2y7_1.heavy 646.379 / 921.48 36304.0 34.947200775146484 48 18 10 10 10 1.6938376479608734 35.55316408589986 0.0 3 0.9864684448512515 10.597357149349055 36304.0 138.1009523809524 1.0 - - - - - - - 189.0 72 8 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 65 9 C20140704_OR005_02 C20140704_OR005_02 TB413004.[MT7]-RHHRDLDELPR.3y10_2.heavy 529.958 / 644.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 67 9 C20140704_OR005_02 C20140704_OR005_02 TB413004.[MT7]-RHHRDLDELPR.3y6_1.heavy 529.958 / 742.409 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 69 9 C20140704_OR005_02 C20140704_OR005_02 TB413004.[MT7]-RHHRDLDELPR.3y4_1.heavy 529.958 / 514.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 71 9 C20140704_OR005_02 C20140704_OR005_02 TB413004.[MT7]-RHHRDLDELPR.3b7_2.heavy 529.958 / 537.787 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 73 10 C20140704_OR005_02 C20140704_OR005_02 TB413217.[MT7]-IIYHLDGQETPYLVK[MT7].4b8_2.heavy 520.045 / 542.799 4989.0 36.08650016784668 33 10 10 5 8 1.2851796834430405 61.85135714872408 0.048801422119140625 4 0.8298795050323041 2.9486662777903168 4989.0 11.97179108049311 1.0 - - - - - - - 175.0 9 3 DVL3 dishevelled, dsh homolog 3 (Drosophila) 75 10 C20140704_OR005_02 C20140704_OR005_02 TB413217.[MT7]-IIYHLDGQETPYLVK[MT7].4b4_1.heavy 520.045 / 671.4 1313.0 36.08650016784668 33 10 10 5 8 1.2851796834430405 61.85135714872408 0.048801422119140625 4 0.8298795050323041 2.9486662777903168 1313.0 7.320144158576364 3.0 - - - - - - - 197.0 3 2 DVL3 dishevelled, dsh homolog 3 (Drosophila) 77 10 C20140704_OR005_02 C20140704_OR005_02 TB413217.[MT7]-IIYHLDGQETPYLVK[MT7].4y3_1.heavy 520.045 / 503.367 9322.0 36.08650016784668 33 10 10 5 8 1.2851796834430405 61.85135714872408 0.048801422119140625 4 0.8298795050323041 2.9486662777903168 9322.0 22.58159509299565 0.0 - - - - - - - 306.5 18 6 DVL3 dishevelled, dsh homolog 3 (Drosophila) 79 10 C20140704_OR005_02 C20140704_OR005_02 TB413217.[MT7]-IIYHLDGQETPYLVK[MT7].4b3_1.heavy 520.045 / 534.341 5252.0 36.08650016784668 33 10 10 5 8 1.2851796834430405 61.85135714872408 0.048801422119140625 4 0.8298795050323041 2.9486662777903168 5252.0 16.190571023617753 1.0 - - - - - - - 262.7142857142857 10 7 DVL3 dishevelled, dsh homolog 3 (Drosophila) 81 11 C20140704_OR005_02 C20140704_OR005_02 TB426833.[MT7]-YAPTSK[MT7].2y4_1.heavy 477.779 / 576.347 16675.0 18.944225311279297 44 18 10 6 10 3.8154863268411128 26.208978733987816 0.03910064697265625 3 0.9883966145959017 11.44587962819241 16675.0 71.30081246850024 0.0 - - - - - - - 145.06666666666666 33 15 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 83 11 C20140704_OR005_02 C20140704_OR005_02 TB426833.[MT7]-YAPTSK[MT7].2y4_2.heavy 477.779 / 288.677 981.0 18.944225311279297 44 18 10 6 10 3.8154863268411128 26.208978733987816 0.03910064697265625 3 0.9883966145959017 11.44587962819241 981.0 17.258333333333333 0.0 - - - - - - - 0.0 1 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 85 11 C20140704_OR005_02 C20140704_OR005_02 TB426833.[MT7]-YAPTSK[MT7].2y5_1.heavy 477.779 / 647.385 7411.0 18.944225311279297 44 18 10 6 10 3.8154863268411128 26.208978733987816 0.03910064697265625 3 0.9883966145959017 11.44587962819241 7411.0 194.2648980632008 0.0 - - - - - - - 119.5 14 10 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 87 11 C20140704_OR005_02 C20140704_OR005_02 TB426833.[MT7]-YAPTSK[MT7].2y3_1.heavy 477.779 / 479.295 2452.0 18.944225311279297 44 18 10 6 10 3.8154863268411128 26.208978733987816 0.03910064697265625 3 0.9883966145959017 11.44587962819241 2452.0 28.130844576362655 0.0 - - - - - - - 182.71428571428572 4 14 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 89 12 C20140704_OR005_02 C20140704_OR005_02 TB427500.[MT7]-QNSVLLLEQISSLC[CAM]SK[MT7].3y6_1.heavy 703.061 / 825.426 5647.0 43.9679012298584 43 18 10 5 10 4.455634333845957 17.75418800445258 0.042598724365234375 3 0.9899797881356521 12.318578802398097 5647.0 34.314306220095695 0.0 - - - - - - - 177.9 11 10 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 91 12 C20140704_OR005_02 C20140704_OR005_02 TB427500.[MT7]-QNSVLLLEQISSLC[CAM]SK[MT7].3b6_1.heavy 703.061 / 799.479 5542.0 43.9679012298584 43 18 10 5 10 4.455634333845957 17.75418800445258 0.042598724365234375 3 0.9899797881356521 12.318578802398097 5542.0 23.70747659322683 0.0 - - - - - - - 222.5 11 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 93 12 C20140704_OR005_02 C20140704_OR005_02 TB427500.[MT7]-QNSVLLLEQISSLC[CAM]SK[MT7].3b4_1.heavy 703.061 / 573.311 3660.0 43.9679012298584 43 18 10 5 10 4.455634333845957 17.75418800445258 0.042598724365234375 3 0.9899797881356521 12.318578802398097 3660.0 21.161244019138756 0.0 - - - - - - - 239.0 7 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 95 12 C20140704_OR005_02 C20140704_OR005_02 TB427500.[MT7]-QNSVLLLEQISSLC[CAM]SK[MT7].3b5_1.heavy 703.061 / 686.395 9516.0 43.9679012298584 43 18 10 5 10 4.455634333845957 17.75418800445258 0.042598724365234375 3 0.9899797881356521 12.318578802398097 9516.0 39.322852223553845 0.0 - - - - - - - 256.72727272727275 19 11 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 97 13 C20140704_OR005_02 C20140704_OR005_02 TB412667.[MT7]-SRLVSAFK[MT7].2y4_1.heavy 598.374 / 596.352 1453.0 26.285200119018555 27 13 6 6 2 12.874429993533541 7.767334169375044 0.0355987548828125 13 0.9072181383384561 4.019891366837155 1453.0 1.5018087855297158 4.0 - - - - - - - 226.08333333333334 4 12 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 99 13 C20140704_OR005_02 C20140704_OR005_02 TB412667.[MT7]-SRLVSAFK[MT7].2y5_1.heavy 598.374 / 695.421 581.0 26.285200119018555 27 13 6 6 2 12.874429993533541 7.767334169375044 0.0355987548828125 13 0.9072181383384561 4.019891366837155 581.0 0.0 14.0 - - - - - - - 268.38461538461536 3 13 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 101 13 C20140704_OR005_02 C20140704_OR005_02 TB412667.[MT7]-SRLVSAFK[MT7].2y6_1.heavy 598.374 / 808.505 678.0 26.285200119018555 27 13 6 6 2 12.874429993533541 7.767334169375044 0.0355987548828125 13 0.9072181383384561 4.019891366837155 678.0 3.9859298329737074 4.0 - - - - - - - 226.0 2 12 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 103 13 C20140704_OR005_02 C20140704_OR005_02 TB412667.[MT7]-SRLVSAFK[MT7].2b7_1.heavy 598.374 / 905.532 97.0 26.285200119018555 27 13 6 6 2 12.874429993533541 7.767334169375044 0.0355987548828125 13 0.9072181383384561 4.019891366837155 97.0 0.4 43.0 - - - - - - - 155.2 4 10 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 105 14 C20140704_OR005_02 C20140704_OR005_02 TB426830.[MT7]-ALSNQK[MT7].2y4_1.heavy 474.789 / 620.348 3160.0 16.48040008544922 44 18 10 10 6 6.962438657768142 14.362783633063374 0.0 5 0.9870333133972035 10.826235326193773 3160.0 87.31578947368422 0.0 - - - - - - - 110.25 6 20 SKIV2L2;SKIV2L superkiller viralicidic activity 2-like 2 (S. cerevisiae);superkiller viralicidic activity 2-like (S. cerevisiae) 107 14 C20140704_OR005_02 C20140704_OR005_02 TB426830.[MT7]-ALSNQK[MT7].2y5_1.heavy 474.789 / 733.432 2970.0 16.48040008544922 44 18 10 10 6 6.962438657768142 14.362783633063374 0.0 5 0.9870333133972035 10.826235326193773 2970.0 65.13157894736842 0.0 - - - - - - - 87.875 5 16 SKIV2L2;SKIV2L superkiller viralicidic activity 2-like 2 (S. cerevisiae);superkiller viralicidic activity 2-like (S. cerevisiae) 109 14 C20140704_OR005_02 C20140704_OR005_02 TB426830.[MT7]-ALSNQK[MT7].2y3_1.heavy 474.789 / 533.316 1485.0 16.48040008544922 44 18 10 10 6 6.962438657768142 14.362783633063374 0.0 5 0.9870333133972035 10.826235326193773 1485.0 8.524620022610225 3.0 - - - - - - - 162.4 3 15 SKIV2L2;SKIV2L superkiller viralicidic activity 2-like 2 (S. cerevisiae);superkiller viralicidic activity 2-like (S. cerevisiae) 111 14 C20140704_OR005_02 C20140704_OR005_02 TB426830.[MT7]-ALSNQK[MT7].2b5_1.heavy 474.789 / 658.364 609.0 16.48040008544922 44 18 10 10 6 6.962438657768142 14.362783633063374 0.0 5 0.9870333133972035 10.826235326193773 609.0 4.006578947368421 1.0 - - - - - - - 101.46666666666667 4 15 SKIV2L2;SKIV2L superkiller viralicidic activity 2-like 2 (S. cerevisiae);superkiller viralicidic activity 2-like (S. cerevisiae) 113 15 C20140704_OR005_02 C20140704_OR005_02 TB451059.[MT7]-IAVEYRPSEDIVGVR.3y14_2.heavy 616.343 / 795.418 18618.0 33.172000885009766 27 7 2 10 8 0.8612880588609788 69.1315539094887 0.0 4 0.7252341959547445 2.2982342073811397 18618.0 55.4472540238441 0.0 - - - - - - - 299.0 37 5 RDM1 RAD52 motif 1 115 15 C20140704_OR005_02 C20140704_OR005_02 TB451059.[MT7]-IAVEYRPSEDIVGVR.3b5_1.heavy 616.343 / 720.405 1379.0 33.172000885009766 27 7 2 10 8 0.8612880588609788 69.1315539094887 0.0 4 0.7252341959547445 2.2982342073811397 1379.0 2.5139124053656157 4.0 - - - - - - - 256.53846153846155 19 13 RDM1 RAD52 motif 1 117 15 C20140704_OR005_02 C20140704_OR005_02 TB451059.[MT7]-IAVEYRPSEDIVGVR.3y5_1.heavy 616.343 / 543.361 10229.0 33.172000885009766 27 7 2 10 8 0.8612880588609788 69.1315539094887 0.0 4 0.7252341959547445 2.2982342073811397 10229.0 16.17572051868674 2.0 - - - - - - - 364.1666666666667 86 6 RDM1 RAD52 motif 1 119 15 C20140704_OR005_02 C20140704_OR005_02 TB451059.[MT7]-IAVEYRPSEDIVGVR.3y9_1.heavy 616.343 / 971.516 11723.0 33.172000885009766 27 7 2 10 8 0.8612880588609788 69.1315539094887 0.0 4 0.7252341959547445 2.2982342073811397 11723.0 26.231087461105037 0.0 - - - - - - - 230.0 23 12 RDM1 RAD52 motif 1 121 16 C20140704_OR005_02 C20140704_OR005_02 TB413200.[MT7]-GYGFVSFFNDVDVQK[MT7].4y4_1.heavy 503.261 / 633.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - DAZL deleted in azoospermia-like 123 16 C20140704_OR005_02 C20140704_OR005_02 TB413200.[MT7]-GYGFVSFFNDVDVQK[MT7].4b4_1.heavy 503.261 / 569.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - DAZL deleted in azoospermia-like 125 16 C20140704_OR005_02 C20140704_OR005_02 TB413200.[MT7]-GYGFVSFFNDVDVQK[MT7].4b5_1.heavy 503.261 / 668.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - DAZL deleted in azoospermia-like 127 16 C20140704_OR005_02 C20140704_OR005_02 TB413200.[MT7]-GYGFVSFFNDVDVQK[MT7].4y3_1.heavy 503.261 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - DAZL deleted in azoospermia-like 129 17 C20140704_OR005_02 C20140704_OR005_02 TB426849.[MT7]-AAAAK[MT7]K[MT7].2b3_1.heavy 496.335 / 358.221 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDE12;NDUFB8 phosphodiesterase 12;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 131 17 C20140704_OR005_02 C20140704_OR005_02 TB426849.[MT7]-AAAAK[MT7]K[MT7].2y4_1.heavy 496.335 / 705.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDE12;NDUFB8 phosphodiesterase 12;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 133 17 C20140704_OR005_02 C20140704_OR005_02 TB426849.[MT7]-AAAAK[MT7]K[MT7].2y5_1.heavy 496.335 / 776.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDE12;NDUFB8 phosphodiesterase 12;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 135 17 C20140704_OR005_02 C20140704_OR005_02 TB426849.[MT7]-AAAAK[MT7]K[MT7].2y3_1.heavy 496.335 / 634.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDE12;NDUFB8 phosphodiesterase 12;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 137 18 C20140704_OR005_02 C20140704_OR005_02 TB413156.[MT7]-FRRTETDFSNLFAR.3y7_1.heavy 635.335 / 854.452 6040.0 35.044898986816406 41 11 10 10 10 1.353036923214535 48.11741991014892 0.0 3 0.8543917739441854 3.1941335688117922 6040.0 28.05380710659898 0.0 - - - - - - - 262.57142857142856 12 7 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 139 18 C20140704_OR005_02 C20140704_OR005_02 TB413156.[MT7]-FRRTETDFSNLFAR.3y6_1.heavy 635.335 / 707.383 788.0 35.044898986816406 41 11 10 10 10 1.353036923214535 48.11741991014892 0.0 3 0.8543917739441854 3.1941335688117922 788.0 2.5250871959519565 9.0 - - - - - - - 289.0 2 5 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 141 18 C20140704_OR005_02 C20140704_OR005_02 TB413156.[MT7]-FRRTETDFSNLFAR.3b10_2.heavy 635.335 / 699.848 4464.0 35.044898986816406 41 11 10 10 10 1.353036923214535 48.11741991014892 0.0 3 0.8543917739441854 3.1941335688117922 4464.0 40.191404371013284 0.0 - - - - - - - 262.5 8 4 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 143 18 C20140704_OR005_02 C20140704_OR005_02 TB413156.[MT7]-FRRTETDFSNLFAR.3b7_2.heavy 635.335 / 525.776 15757.0 35.044898986816406 41 11 10 10 10 1.353036923214535 48.11741991014892 0.0 3 0.8543917739441854 3.1941335688117922 15757.0 37.01616110423778 0.0 - - - - - - - 328.25 31 4 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 145 19 C20140704_OR005_02 C20140704_OR005_02 TB413011.[MT7]-LVEC[CAM]LETVLNK[MT7].3b6_1.heavy 535.976 / 888.462 400.0 44.324798583984375 46 20 10 10 6 10.7284810492893 9.320983980917264 0.0 5 0.9958449453688665 19.139188046008268 400.0 4.92 3.0 - - - - - - - 0.0 0 0 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 147 19 C20140704_OR005_02 C20140704_OR005_02 TB413011.[MT7]-LVEC[CAM]LETVLNK[MT7].3y3_1.heavy 535.976 / 518.342 2901.0 44.324798583984375 46 20 10 10 6 10.7284810492893 9.320983980917264 0.0 5 0.9958449453688665 19.139188046008268 2901.0 18.42135 0.0 - - - - - - - 230.76923076923077 5 13 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 149 19 C20140704_OR005_02 C20140704_OR005_02 TB413011.[MT7]-LVEC[CAM]LETVLNK[MT7].3b4_1.heavy 535.976 / 646.335 2401.0 44.324798583984375 46 20 10 10 6 10.7284810492893 9.320983980917264 0.0 5 0.9958449453688665 19.139188046008268 2401.0 26.651100000000003 0.0 - - - - - - - 222.22222222222223 4 9 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 151 19 C20140704_OR005_02 C20140704_OR005_02 TB413011.[MT7]-LVEC[CAM]LETVLNK[MT7].3b5_1.heavy 535.976 / 759.419 600.0 44.324798583984375 46 20 10 10 6 10.7284810492893 9.320983980917264 0.0 5 0.9958449453688665 19.139188046008268 600.0 5.828571428571428 5.0 - - - - - - - 200.0 2 1 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 153 20 C20140704_OR005_02 C20140704_OR005_02 TB413151.[MT7]-SSILWNTPNSQPEK[MT7].3y7_1.heavy 630.338 / 943.497 8666.0 32.31830024719238 43 18 10 5 10 5.56287003787537 17.976332238420053 0.042201995849609375 3 0.9811778835418962 8.981411268665694 8666.0 38.47609289617486 0.0 - - - - - - - 305.0 17 10 ZBTB44 zinc finger and BTB domain containing 44 155 20 C20140704_OR005_02 C20140704_OR005_02 TB413151.[MT7]-SSILWNTPNSQPEK[MT7].3b6_1.heavy 630.338 / 845.464 5248.0 32.31830024719238 43 18 10 5 10 5.56287003787537 17.976332238420053 0.042201995849609375 3 0.9811778835418962 8.981411268665694 5248.0 19.930928961748634 0.0 - - - - - - - 257.55555555555554 10 9 ZBTB44 zinc finger and BTB domain containing 44 157 20 C20140704_OR005_02 C20140704_OR005_02 TB413151.[MT7]-SSILWNTPNSQPEK[MT7].3y3_1.heavy 630.338 / 517.31 59196.0 32.31830024719238 43 18 10 5 10 5.56287003787537 17.976332238420053 0.042201995849609375 3 0.9811778835418962 8.981411268665694 59196.0 14.056662081899894 0.0 - - - - - - - 488.0 118 1 ZBTB44 zinc finger and BTB domain containing 44 159 20 C20140704_OR005_02 C20140704_OR005_02 TB413151.[MT7]-SSILWNTPNSQPEK[MT7].3b4_1.heavy 630.338 / 545.341 27096.0 32.31830024719238 43 18 10 5 10 5.56287003787537 17.976332238420053 0.042201995849609375 3 0.9811778835418962 8.981411268665694 27096.0 46.44985455854888 0.0 - - - - - - - 809.6363636363636 54 11 ZBTB44 zinc finger and BTB domain containing 44 161 21 C20140704_OR005_02 C20140704_OR005_02 TB413348.[MT7]-YLALESMC[CAM]TLASSEFSHEAVK[MT7].4y4_1.heavy 666.084 / 590.363 990.0 43.989200592041016 43 13 10 10 10 2.6011347505213913 30.714709297034766 0.0 3 0.9280545127154525 4.573216429415173 990.0 3.980952380952381 19.0 - - - - - - - 862.7142857142857 4 7 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 163 21 C20140704_OR005_02 C20140704_OR005_02 TB413348.[MT7]-YLALESMC[CAM]TLASSEFSHEAVK[MT7].4b4_1.heavy 666.084 / 605.378 3366.0 43.989200592041016 43 13 10 10 10 2.6011347505213913 30.714709297034766 0.0 3 0.9280545127154525 4.573216429415173 3366.0 1.5418233082706767 2.0 - - - - - - - 297.0 8 9 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 165 21 C20140704_OR005_02 C20140704_OR005_02 TB413348.[MT7]-YLALESMC[CAM]TLASSEFSHEAVK[MT7].4b5_1.heavy 666.084 / 734.42 1980.0 43.989200592041016 43 13 10 10 10 2.6011347505213913 30.714709297034766 0.0 3 0.9280545127154525 4.573216429415173 1980.0 20.0 0.0 - - - - - - - 282.85714285714283 3 14 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 167 21 C20140704_OR005_02 C20140704_OR005_02 TB413348.[MT7]-YLALESMC[CAM]TLASSEFSHEAVK[MT7].4b6_1.heavy 666.084 / 821.453 1881.0 43.989200592041016 43 13 10 10 10 2.6011347505213913 30.714709297034766 0.0 3 0.9280545127154525 4.573216429415173 1881.0 7.051111111111111 0.0 - - - - - - - 136.125 3 8 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 169 22 C20140704_OR005_02 C20140704_OR005_02 TB413019.[MT7]-AMVDIILLLSDK[MT7].3b6_1.heavy 540.328 / 787.45 652.0 53.2823486328125 39 13 10 8 8 1.5753953272466246 53.59463839893106 0.0196990966796875 4 0.9165535431053292 4.242199580113325 652.0 26.81239289446186 0.0 - - - - - - - 0.0 1 0 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 171 22 C20140704_OR005_02 C20140704_OR005_02 TB413019.[MT7]-AMVDIILLLSDK[MT7].3b4_1.heavy 540.328 / 561.282 805.0 53.2823486328125 39 13 10 8 8 1.5753953272466246 53.59463839893106 0.0196990966796875 4 0.9165535431053292 4.242199580113325 805.0 15.71422634836428 0.0 - - - - - - - 0.0 1 0 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 173 22 C20140704_OR005_02 C20140704_OR005_02 TB413019.[MT7]-AMVDIILLLSDK[MT7].3b5_1.heavy 540.328 / 674.366 1109.0 53.2823486328125 39 13 10 8 8 1.5753953272466246 53.59463839893106 0.0196990966796875 4 0.9165535431053292 4.242199580113325 1109.0 22.876981737765735 0.0 - - - - - - - 88.26666666666667 2 15 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 175 22 C20140704_OR005_02 C20140704_OR005_02 TB413019.[MT7]-AMVDIILLLSDK[MT7].3y4_1.heavy 540.328 / 606.358 674.0 53.2823486328125 39 13 10 8 8 1.5753953272466246 53.59463839893106 0.0196990966796875 4 0.9165535431053292 4.242199580113325 674.0 1.5738461538461541 1.0 - - - - - - - 0.0 1 0 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 177 23 C20140704_OR005_02 C20140704_OR005_02 TB412759.[MT7]-ITIAGNHC[CAM]EINC[CAM]QK[MT7].3y7_1.heavy 649.332 / 1095.5 2680.0 25.585100173950195 47 17 10 10 10 3.088766999702275 25.677216491255308 0.0 3 0.9742438834118119 7.673360472724833 2680.0 19.47836564793515 0.0 - - - - - - - 178.53846153846155 5 13 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 179 23 C20140704_OR005_02 C20140704_OR005_02 TB412759.[MT7]-ITIAGNHC[CAM]EINC[CAM]QK[MT7].3y6_1.heavy 649.332 / 935.474 2233.0 25.585100173950195 47 17 10 10 10 3.088766999702275 25.677216491255308 0.0 3 0.9742438834118119 7.673360472724833 2233.0 25.478406422941468 0.0 - - - - - - - 212.0 4 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 181 23 C20140704_OR005_02 C20140704_OR005_02 TB412759.[MT7]-ITIAGNHC[CAM]EINC[CAM]QK[MT7].3y4_1.heavy 649.332 / 693.347 5360.0 25.585100173950195 47 17 10 10 10 3.088766999702275 25.677216491255308 0.0 3 0.9742438834118119 7.673360472724833 5360.0 27.0 0.0 - - - - - - - 184.375 10 16 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 183 23 C20140704_OR005_02 C20140704_OR005_02 TB412759.[MT7]-ITIAGNHC[CAM]EINC[CAM]QK[MT7].3y5_1.heavy 649.332 / 806.431 3931.0 25.585100173950195 47 17 10 10 10 3.088766999702275 25.677216491255308 0.0 3 0.9742438834118119 7.673360472724833 3931.0 55.12431109158245 0.0 - - - - - - - 156.25 7 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 185 24 C20140704_OR005_02 C20140704_OR005_02 TB413207.[MT7]-QLANVQVLALEEC[CAM]LK[MT7].2y8_1.heavy 1008.57 / 1119.62 2587.0 42.00402641296387 34 13 10 3 8 1.6230992195427645 40.39294490945782 0.06949996948242188 4 0.9208570850103335 4.3576222631071255 2587.0 3.547004470938897 2.0 - - - - - - - 179.75 7 16 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 187 24 C20140704_OR005_02 C20140704_OR005_02 TB413207.[MT7]-QLANVQVLALEEC[CAM]LK[MT7].2b4_1.heavy 1008.57 / 571.332 3546.0 42.00402641296387 34 13 10 3 8 1.6230992195427645 40.39294490945782 0.06949996948242188 4 0.9208570850103335 4.3576222631071255 3546.0 27.171726501305482 0.0 - - - - - - - 255.66666666666666 7 3 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 189 24 C20140704_OR005_02 C20140704_OR005_02 TB413207.[MT7]-QLANVQVLALEEC[CAM]LK[MT7].2b5_1.heavy 1008.57 / 670.4 3737.0 42.00402641296387 34 13 10 3 8 1.6230992195427645 40.39294490945782 0.06949996948242188 4 0.9208570850103335 4.3576222631071255 3737.0 38.412568840579716 0.0 - - - - - - - 217.9090909090909 7 11 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 191 24 C20140704_OR005_02 C20140704_OR005_02 TB413207.[MT7]-QLANVQVLALEEC[CAM]LK[MT7].2y7_1.heavy 1008.57 / 1006.54 862.0 42.00402641296387 34 13 10 3 8 1.6230992195427645 40.39294490945782 0.06949996948242188 4 0.9208570850103335 4.3576222631071255 862.0 0.0 2.0 - - - - - - - 221.15384615384616 7 13 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 193 25 C20140704_OR005_02 C20140704_OR005_02 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 147518.0 29.934200286865234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 147518.0 459.7107203650913 0.0 - - - - - - - 279.1111111111111 295 9 195 25 C20140704_OR005_02 C20140704_OR005_02 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 49667.0 29.934200286865234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 49667.0 470.43407030349596 0.0 - - - - - - - 257.0 99 8 197 25 C20140704_OR005_02 C20140704_OR005_02 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 55148.0 29.934200286865234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 55148.0 145.39827867009205 0.0 - - - - - - - 271.25 110 8 199 26 C20140704_OR005_02 C20140704_OR005_02 TB451050.[MT7]-MQLESFGYTTDDLR.3y6_1.heavy 607.293 / 720.352 6458.0 38.46929931640625 40 14 10 10 6 2.3528831896020344 29.145393135772125 0.0 5 0.9395983745680003 4.99605753348583 6458.0 20.91402596547119 0.0 - - - - - - - 279.5 12 6 GLRB glycine receptor, beta 201 26 C20140704_OR005_02 C20140704_OR005_02 TB451050.[MT7]-MQLESFGYTTDDLR.3b4_1.heavy 607.293 / 646.335 6329.0 38.46929931640625 40 14 10 10 6 2.3528831896020344 29.145393135772125 0.0 5 0.9395983745680003 4.99605753348583 6329.0 13.835580972960017 2.0 - - - - - - - 627.5714285714286 15 7 GLRB glycine receptor, beta 203 26 C20140704_OR005_02 C20140704_OR005_02 TB451050.[MT7]-MQLESFGYTTDDLR.3b5_1.heavy 607.293 / 733.367 4133.0 38.46929931640625 40 14 10 10 6 2.3528831896020344 29.145393135772125 0.0 5 0.9395983745680003 4.99605753348583 4133.0 13.071648698763987 0.0 - - - - - - - 294.85714285714283 8 7 GLRB glycine receptor, beta 205 26 C20140704_OR005_02 C20140704_OR005_02 TB451050.[MT7]-MQLESFGYTTDDLR.3y5_1.heavy 607.293 / 619.305 8137.0 38.46929931640625 40 14 10 10 6 2.3528831896020344 29.145393135772125 0.0 5 0.9395983745680003 4.99605753348583 8137.0 51.503811952988244 0.0 - - - - - - - 206.4 16 5 GLRB glycine receptor, beta 207 27 C20140704_OR005_02 C20140704_OR005_02 TB413236.[MT7]-SLGVAAEGLPDQYADGEAAR.3y11_1.heavy 712.023 / 1192.52 14160.0 33.727699279785156 50 20 10 10 10 6.394752135388399 15.63782268379137 0.0 3 0.9939662675744455 15.880008710603303 14160.0 79.17653202273077 0.0 - - - - - - - 175.75 28 8 GNMT glycine N-methyltransferase 209 27 C20140704_OR005_02 C20140704_OR005_02 TB413236.[MT7]-SLGVAAEGLPDQYADGEAAR.3b4_1.heavy 712.023 / 501.315 19390.0 33.727699279785156 50 20 10 10 10 6.394752135388399 15.63782268379137 0.0 3 0.9939662675744455 15.880008710603303 19390.0 90.2332026143791 0.0 - - - - - - - 271.125 38 8 GNMT glycine N-methyltransferase 211 27 C20140704_OR005_02 C20140704_OR005_02 TB413236.[MT7]-SLGVAAEGLPDQYADGEAAR.3b5_1.heavy 712.023 / 572.352 25641.0 33.727699279785156 50 20 10 10 10 6.394752135388399 15.63782268379137 0.0 3 0.9939662675744455 15.880008710603303 25641.0 51.1765776256222 0.0 - - - - - - - 212.83333333333334 51 6 GNMT glycine N-methyltransferase 213 27 C20140704_OR005_02 C20140704_OR005_02 TB413236.[MT7]-SLGVAAEGLPDQYADGEAAR.3y5_1.heavy 712.023 / 503.257 14926.0 33.727699279785156 50 20 10 10 10 6.394752135388399 15.63782268379137 0.0 3 0.9939662675744455 15.880008710603303 14926.0 16.385663531870428 0.0 - - - - - - - 268.0 29 10 GNMT glycine N-methyltransferase 215 28 C20140704_OR005_02 C20140704_OR005_02 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 42824.0 16.121666590372723 24 -3 10 7 10 null 0.0 0.024801254272460938 3 0.0 0.0 42824.0 126.84695604695605 0.0 - - - - - - - 175.75 85 12 217 28 C20140704_OR005_02 C20140704_OR005_02 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 53696.0 16.121666590372723 24 -3 10 7 10 null 0.0 0.024801254272460938 3 0.0 0.0 53696.0 204.92830412830415 0.0 - - - - - - - 168.1818181818182 107 11 219 28 C20140704_OR005_02 C20140704_OR005_02 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 39200.0 16.121666590372723 24 -3 10 7 10 null 0.0 0.024801254272460938 3 0.0 0.0 39200.0 156.3241416321264 0.0 - - - - - - - 193.22222222222223 78 18 221 29 C20140704_OR005_02 C20140704_OR005_02 TB412787.[MT7]-LSLYVADENR.2y5_1.heavy 662.355 / 604.268 2293.0 33.40715026855469 42 17 10 5 10 4.894887703190142 20.429477868272045 0.04229736328125 3 0.9708740167710593 7.2137700339924 2293.0 6.294509803921569 1.0 - - - - - - - 297.0 4 6 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 223 29 C20140704_OR005_02 C20140704_OR005_02 TB412787.[MT7]-LSLYVADENR.2y9_1.heavy 662.355 / 1066.52 7772.0 33.40715026855469 42 17 10 5 10 4.894887703190142 20.429477868272045 0.04229736328125 3 0.9708740167710593 7.2137700339924 7772.0 60.3666646987348 0.0 - - - - - - - 152.6 15 5 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 225 29 C20140704_OR005_02 C20140704_OR005_02 TB412787.[MT7]-LSLYVADENR.2y6_1.heavy 662.355 / 703.337 3313.0 33.40715026855469 42 17 10 5 10 4.894887703190142 20.429477868272045 0.04229736328125 3 0.9708740167710593 7.2137700339924 3313.0 9.541952694979337 0.0 - - - - - - - 268.77777777777777 6 9 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 227 29 C20140704_OR005_02 C20140704_OR005_02 TB412787.[MT7]-LSLYVADENR.2y7_1.heavy 662.355 / 866.4 4205.0 33.40715026855469 42 17 10 5 10 4.894887703190142 20.429477868272045 0.04229736328125 3 0.9708740167710593 7.2137700339924 4205.0 23.977263114669952 0.0 - - - - - - - 240.44444444444446 8 9 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 229 30 C20140704_OR005_02 C20140704_OR005_02 TB412509.[MT7]-DLLPAK[MT7].2y4_1.heavy 472.805 / 572.389 2424.0 27.62220001220703 50 20 10 10 10 4.883524671176371 20.477013373193717 0.0 3 0.9965479538384536 20.99902156810491 2424.0 3.3629813664596275 1.0 - - - - - - - 121.2 4 5 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 231 30 C20140704_OR005_02 C20140704_OR005_02 TB412509.[MT7]-DLLPAK[MT7].2b3_1.heavy 472.805 / 486.304 5049.0 27.62220001220703 50 20 10 10 10 4.883524671176371 20.477013373193717 0.0 3 0.9965479538384536 20.99902156810491 5049.0 24.19932998231108 1.0 - - - - - - - 158.71428571428572 10 7 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 233 30 C20140704_OR005_02 C20140704_OR005_02 TB412509.[MT7]-DLLPAK[MT7].2y5_1.heavy 472.805 / 685.473 808.0 27.62220001220703 50 20 10 10 10 4.883524671176371 20.477013373193717 0.0 3 0.9965479538384536 20.99902156810491 808.0 0.33777777777777773 2.0 - - - - - - - 176.75 2 12 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 235 30 C20140704_OR005_02 C20140704_OR005_02 TB412509.[MT7]-DLLPAK[MT7].2y3_1.heavy 472.805 / 459.305 19591.0 27.62220001220703 50 20 10 10 10 4.883524671176371 20.477013373193717 0.0 3 0.9965479538384536 20.99902156810491 19591.0 11.973314810979003 1.0 - - - - - - - 242.4 43 5 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 237 31 C20140704_OR005_02 C20140704_OR005_02 TB412501.[MT7]-NIASMVR.2y4_1.heavy 467.767 / 492.26 7508.0 28.52720069885254 47 17 10 10 10 6.878324479733269 14.538424334973778 0.0 3 0.9772270615439276 8.162537521639631 7508.0 81.67585949495665 0.0 - - - - - - - 183.0 15 9 GNMT glycine N-methyltransferase 239 31 C20140704_OR005_02 C20140704_OR005_02 TB412501.[MT7]-NIASMVR.2y5_1.heavy 467.767 / 563.297 18514.0 28.52720069885254 47 17 10 10 10 6.878324479733269 14.538424334973778 0.0 3 0.9772270615439276 8.162537521639631 18514.0 146.67401941747573 0.0 - - - - - - - 191.14285714285714 37 7 GNMT glycine N-methyltransferase 241 31 C20140704_OR005_02 C20140704_OR005_02 TB412501.[MT7]-NIASMVR.2b4_1.heavy 467.767 / 530.305 3703.0 28.52720069885254 47 17 10 10 10 6.878324479733269 14.538424334973778 0.0 3 0.9772270615439276 8.162537521639631 3703.0 20.357096638556207 0.0 - - - - - - - 249.85714285714286 7 7 GNMT glycine N-methyltransferase 243 31 C20140704_OR005_02 C20140704_OR005_02 TB412501.[MT7]-NIASMVR.2y6_1.heavy 467.767 / 676.381 15222.0 28.52720069885254 47 17 10 10 10 6.878324479733269 14.538424334973778 0.0 3 0.9772270615439276 8.162537521639631 15222.0 47.38365758754864 0.0 - - - - - - - 235.14285714285714 30 7 GNMT glycine N-methyltransferase 245 32 C20140704_OR005_02 C20140704_OR005_02 TB451022.[MT7]-MAMGNPSEFFVDVM.2b8_1.heavy 859.889 / 962.419 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 247 32 C20140704_OR005_02 C20140704_OR005_02 TB451022.[MT7]-MAMGNPSEFFVDVM.2b6_1.heavy 859.889 / 746.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 249 32 C20140704_OR005_02 C20140704_OR005_02 TB451022.[MT7]-MAMGNPSEFFVDVM.2b5_1.heavy 859.889 / 649.292 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 251 32 C20140704_OR005_02 C20140704_OR005_02 TB451022.[MT7]-MAMGNPSEFFVDVM.2b9_1.heavy 859.889 / 1109.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 253 33 C20140704_OR005_02 C20140704_OR005_02 TB450592.[MT7]-LPLPAER.2y4_1.heavy 470.291 / 472.251 6708.0 30.057400226593018 43 20 10 3 10 25.220598723531403 3.9650129283686546 0.07519912719726562 3 0.9983385265981717 30.273004408356403 6708.0 29.61766109785203 0.0 - - - - - - - 241.0 13 10 DVL3 dishevelled, dsh homolog 3 (Drosophila) 255 33 C20140704_OR005_02 C20140704_OR005_02 TB450592.[MT7]-LPLPAER.2y5_1.heavy 470.291 / 585.336 1677.0 30.057400226593018 43 20 10 3 10 25.220598723531403 3.9650129283686546 0.07519912719726562 3 0.9983385265981717 30.273004408356403 1677.0 19.41386225707467 0.0 - - - - - - - 314.2857142857143 3 7 DVL3 dishevelled, dsh homolog 3 (Drosophila) 257 33 C20140704_OR005_02 C20140704_OR005_02 TB450592.[MT7]-LPLPAER.2y6_1.heavy 470.291 / 682.388 21380.0 30.057400226593018 43 20 10 3 10 25.220598723531403 3.9650129283686546 0.07519912719726562 3 0.9983385265981717 30.273004408356403 21380.0 252.0939879531765 0.0 - - - - - - - 384.0 42 3 DVL3 dishevelled, dsh homolog 3 (Drosophila) 259 33 C20140704_OR005_02 C20140704_OR005_02 TB450592.[MT7]-LPLPAER.2b5_1.heavy 470.291 / 636.42 734.0 30.057400226593018 43 20 10 3 10 25.220598723531403 3.9650129283686546 0.07519912719726562 3 0.9983385265981717 30.273004408356403 734.0 -0.14964200477326967 13.0 - - - - - - - 194.71428571428572 5 7 DVL3 dishevelled, dsh homolog 3 (Drosophila) 261 34 C20140704_OR005_02 C20140704_OR005_02 TB413133.[MT7]-AWLLGLLRQHGC[CAM]QR.4y4_1.heavy 463.762 / 520.23 1389.0 40.27372455596924 36 15 10 3 8 2.5351007522915 30.933503768186533 0.07419967651367188 4 0.9578056879495284 5.986822737387619 1389.0 12.155665902724726 1.0 - - - - - - - 223.25 2 4 GNMT glycine N-methyltransferase 263 34 C20140704_OR005_02 C20140704_OR005_02 TB413133.[MT7]-AWLLGLLRQHGC[CAM]QR.4y10_2.heavy 463.762 / 612.823 2182.0 40.27372455596924 36 15 10 3 8 2.5351007522915 30.933503768186533 0.07419967651367188 4 0.9578056879495284 5.986822737387619 2182.0 7.1757046979865775 1.0 - - - - - - - 297.7142857142857 5 7 GNMT glycine N-methyltransferase 265 34 C20140704_OR005_02 C20140704_OR005_02 TB413133.[MT7]-AWLLGLLRQHGC[CAM]QR.4y11_2.heavy 463.762 / 669.365 1091.0 40.27372455596924 36 15 10 3 8 2.5351007522915 30.933503768186533 0.07419967651367188 4 0.9578056879495284 5.986822737387619 1091.0 15.979292929292932 0.0 - - - - - - - 173.5 2 4 GNMT glycine N-methyltransferase 267 34 C20140704_OR005_02 C20140704_OR005_02 TB413133.[MT7]-AWLLGLLRQHGC[CAM]QR.4b3_1.heavy 463.762 / 515.31 2678.0 40.27372455596924 36 15 10 3 8 2.5351007522915 30.933503768186533 0.07419967651367188 4 0.9578056879495284 5.986822737387619 2678.0 12.809833820769867 0.0 - - - - - - - 198.33333333333334 5 9 GNMT glycine N-methyltransferase 269 35 C20140704_OR005_02 C20140704_OR005_02 TB413135.[MT7]-NFSTSNLNTDFLAK[MT7].3y3_1.heavy 620.663 / 475.336 26143.0 37.37409973144531 50 20 10 10 10 8.483534866302325 11.787539224623531 0.0 3 0.9960639403807253 19.66477501860181 26143.0 47.112408558923214 0.0 - - - - - - - 795.0833333333334 52 12 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 271 35 C20140704_OR005_02 C20140704_OR005_02 TB413135.[MT7]-NFSTSNLNTDFLAK[MT7].3b6_1.heavy 620.663 / 795.375 21063.0 37.37409973144531 50 20 10 10 10 8.483534866302325 11.787539224623531 0.0 3 0.9960639403807253 19.66477501860181 21063.0 62.8541474344514 0.0 - - - - - - - 234.22222222222223 42 9 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 273 35 C20140704_OR005_02 C20140704_OR005_02 TB413135.[MT7]-NFSTSNLNTDFLAK[MT7].3y5_1.heavy 620.663 / 737.431 7558.0 37.37409973144531 50 20 10 10 10 8.483534866302325 11.787539224623531 0.0 3 0.9960639403807253 19.66477501860181 7558.0 17.92592470948211 0.0 - - - - - - - 214.1818181818182 15 11 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 275 35 C20140704_OR005_02 C20140704_OR005_02 TB413135.[MT7]-NFSTSNLNTDFLAK[MT7].3b7_1.heavy 620.663 / 908.459 5700.0 37.37409973144531 50 20 10 10 10 8.483534866302325 11.787539224623531 0.0 3 0.9960639403807253 19.66477501860181 5700.0 49.920967741935485 0.0 - - - - - - - 212.57142857142858 11 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 277 36 C20140704_OR005_02 C20140704_OR005_02 TB426969.[MT7]-GVPDSPQRR.2b8_1.heavy 578.321 / 981.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 279 36 C20140704_OR005_02 C20140704_OR005_02 TB426969.[MT7]-GVPDSPQRR.2y5_1.heavy 578.321 / 643.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 281 36 C20140704_OR005_02 C20140704_OR005_02 TB426969.[MT7]-GVPDSPQRR.2b4_1.heavy 578.321 / 513.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 283 36 C20140704_OR005_02 C20140704_OR005_02 TB426969.[MT7]-GVPDSPQRR.2y7_1.heavy 578.321 / 855.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 285 37 C20140704_OR005_02 C20140704_OR005_02 TB426967.[MT7]-RTPALIALR.2y8_1.heavy 577.878 / 854.546 2361.0 29.934200286865234 36 18 0 10 8 4.8556082457349286 20.59474219071072 0.0 4 0.9872162027627286 10.903569187093582 2361.0 20.869553571428572 0.0 - - - - - - - 248.78571428571428 4 14 LOC100508006;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 287 37 C20140704_OR005_02 C20140704_OR005_02 TB426967.[MT7]-RTPALIALR.2b7_1.heavy 577.878 / 867.553 1686.0 29.934200286865234 36 18 0 10 8 4.8556082457349286 20.59474219071072 0.0 4 0.9872162027627286 10.903569187093582 1686.0 7.118874930516954 2.0 - - - - - - - 234.9090909090909 3 11 LOC100508006;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 289 37 C20140704_OR005_02 C20140704_OR005_02 TB426967.[MT7]-RTPALIALR.2b5_1.heavy 577.878 / 683.432 N/A 29.934200286865234 36 18 0 10 8 4.8556082457349286 20.59474219071072 0.0 4 0.9872162027627286 10.903569187093582 899.0 0.02256930746332891 14.0 - - - - - - - 281.0 55 12 LOC100508006;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 291 37 C20140704_OR005_02 C20140704_OR005_02 TB426967.[MT7]-RTPALIALR.2y7_1.heavy 577.878 / 753.498 2698.0 29.934200286865234 36 18 0 10 8 4.8556082457349286 20.59474219071072 0.0 4 0.9872162027627286 10.903569187093582 2698.0 22.303466666666665 3.0 - - - - - - - 224.6 5 10 LOC100508006;AKR1C1;AKR1C2;AKR1C3 aldo-keto reductase family 1 member C2-like;aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) 293 38 C20140704_OR005_02 C20140704_OR005_02 TB412774.[MT7]-DSGMYYC[CAM]K[MT7].2y4_1.heavy 656.301 / 777.372 595.0 24.049149990081787 40 14 10 6 10 1.1107997631420765 56.51618311815483 0.03859901428222656 3 0.9382750984039465 4.9416564532191085 595.0 3.472 1.0 - - - - - - - 0.0 1 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 295 38 C20140704_OR005_02 C20140704_OR005_02 TB412774.[MT7]-DSGMYYC[CAM]K[MT7].2b4_1.heavy 656.301 / 535.23 849.0 24.049149990081787 40 14 10 6 10 1.1107997631420765 56.51618311815483 0.03859901428222656 3 0.9382750984039465 4.9416564532191085 849.0 14.033470588235293 1.0 - - - - - - - 0.0 1 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 297 38 C20140704_OR005_02 C20140704_OR005_02 TB412774.[MT7]-DSGMYYC[CAM]K[MT7].2y3_1.heavy 656.301 / 614.309 1189.0 24.049149990081787 40 14 10 6 10 1.1107997631420765 56.51618311815483 0.03859901428222656 3 0.9382750984039465 4.9416564532191085 1189.0 4.662745098039216 0.0 - - - - - - - 170.0 2 15 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 299 38 C20140704_OR005_02 C20140704_OR005_02 TB412774.[MT7]-DSGMYYC[CAM]K[MT7].2y7_1.heavy 656.301 / 1052.47 1019.0 24.049149990081787 40 14 10 6 10 1.1107997631420765 56.51618311815483 0.03859901428222656 3 0.9382750984039465 4.9416564532191085 1019.0 13.786470588235293 0.0 - - - - - - - 132.22222222222223 2 9 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 301 39 C20140704_OR005_02 C20140704_OR005_02 TB413038.[MT7]-YEPFWEDEEK[MT7].2y4_1.heavy 830.393 / 664.327 1441.0 36.81629943847656 40 15 10 5 10 7.121099662415891 14.042774956203068 0.04540252685546875 3 0.9524452179813784 5.636752972015671 1441.0 15.07 0.0 - - - - - - - 240.16666666666666 2 6 F2R coagulation factor II (thrombin) receptor 303 39 C20140704_OR005_02 C20140704_OR005_02 TB413038.[MT7]-YEPFWEDEEK[MT7].2y8_1.heavy 830.393 / 1223.57 1964.0 36.81629943847656 40 15 10 5 10 7.121099662415891 14.042774956203068 0.04540252685546875 3 0.9524452179813784 5.636752972015671 1964.0 6.92147582697201 0.0 - - - - - - - 275.1 3 10 F2R coagulation factor II (thrombin) receptor 305 39 C20140704_OR005_02 C20140704_OR005_02 TB413038.[MT7]-YEPFWEDEEK[MT7].2y3_1.heavy 830.393 / 549.3 1048.0 36.81629943847656 40 15 10 5 10 7.121099662415891 14.042774956203068 0.04540252685546875 3 0.9524452179813784 5.636752972015671 1048.0 5.253333333333333 3.0 - - - - - - - 240.16666666666666 2 6 F2R coagulation factor II (thrombin) receptor 307 39 C20140704_OR005_02 C20140704_OR005_02 TB413038.[MT7]-YEPFWEDEEK[MT7].2y6_1.heavy 830.393 / 979.449 1572.0 36.81629943847656 40 15 10 5 10 7.121099662415891 14.042774956203068 0.04540252685546875 3 0.9524452179813784 5.636752972015671 1572.0 6.499999999999999 0.0 - - - - - - - 224.57142857142858 3 7 F2R coagulation factor II (thrombin) receptor 309 40 C20140704_OR005_02 C20140704_OR005_02 TB427107.[MT7]-K[MT7]VQHSNAK[MT7].3y3_1.heavy 448.609 / 476.295 956.0 12.737299919128418 46 16 10 10 10 2.604458283634959 38.395700414303896 0.0 3 0.9683995564251914 6.924133587699542 956.0 35.50857142857143 0.0 - - - - - - - 0.0 1 0 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 311 40 C20140704_OR005_02 C20140704_OR005_02 TB427107.[MT7]-K[MT7]VQHSNAK[MT7].3y5_1.heavy 448.609 / 700.386 278.0 12.737299919128418 46 16 10 10 10 2.604458283634959 38.395700414303896 0.0 3 0.9683995564251914 6.924133587699542 278.0 13.220121978021979 0.0 - - - - - - - 0.0 0 0 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 313 40 C20140704_OR005_02 C20140704_OR005_02 TB427107.[MT7]-K[MT7]VQHSNAK[MT7].3y4_1.heavy 448.609 / 563.327 2277.0 12.737299919128418 46 16 10 10 10 2.604458283634959 38.395700414303896 0.0 3 0.9683995564251914 6.924133587699542 2277.0 121.00628571428572 0.0 - - - - - - - 32.625 4 8 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 315 40 C20140704_OR005_02 C20140704_OR005_02 TB427107.[MT7]-K[MT7]VQHSNAK[MT7].3b3_1.heavy 448.609 / 644.433 382.0 12.737299919128418 46 16 10 10 10 2.604458283634959 38.395700414303896 0.0 3 0.9683995564251914 6.924133587699542 382.0 15.60742857142857 0.0 - - - - - - - 0.0 0 0 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 317 41 C20140704_OR005_02 C20140704_OR005_02 TB413034.[MT7]-HVLQNLETFEK[MT7].3y3_1.heavy 549.31 / 567.326 7700.0 32.64440155029297 41 13 10 10 8 4.153284373608014 16.25641474403878 0.0 4 0.9286059387329878 4.591060202440985 7700.0 29.3818781587291 0.0 - - - - - - - 300.84615384615387 15 13 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 319 41 C20140704_OR005_02 C20140704_OR005_02 TB413034.[MT7]-HVLQNLETFEK[MT7].3b4_1.heavy 549.31 / 622.379 7578.0 32.64440155029297 41 13 10 10 8 4.153284373608014 16.25641474403878 0.0 4 0.9286059387329878 4.591060202440985 7578.0 18.060647635878023 1.0 - - - - - - - 206.69230769230768 15 13 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 321 41 C20140704_OR005_02 C20140704_OR005_02 TB413034.[MT7]-HVLQNLETFEK[MT7].3b5_1.heavy 549.31 / 736.422 4278.0 32.64440155029297 41 13 10 10 8 4.153284373608014 16.25641474403878 0.0 4 0.9286059387329878 4.591060202440985 4278.0 17.352006922272007 0.0 - - - - - - - 271.44444444444446 8 9 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 323 41 C20140704_OR005_02 C20140704_OR005_02 TB413034.[MT7]-HVLQNLETFEK[MT7].3y4_1.heavy 549.31 / 668.374 7455.0 32.64440155029297 41 13 10 10 8 4.153284373608014 16.25641474403878 0.0 4 0.9286059387329878 4.591060202440985 7455.0 54.987565137655714 0.0 - - - - - - - 191.85714285714286 14 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 325 42 C20140704_OR005_02 C20140704_OR005_02 TB413130.[MT7]-TTLPLGTEEDVRVK[MT7].3y11_2.heavy 616.022 / 693.889 27530.0 30.477699279785156 44 14 10 10 10 3.0981272549901004 32.27756375692177 0.0 3 0.9304979829434867 4.653884753775916 27530.0 344.125 0.0 - - - - - - - 189.83333333333334 55 6 ZBTB44 zinc finger and BTB domain containing 44 327 42 C20140704_OR005_02 C20140704_OR005_02 TB413130.[MT7]-TTLPLGTEEDVRVK[MT7].3y4_2.heavy 616.022 / 323.23 21842.0 30.477699279785156 44 14 10 10 10 3.0981272549901004 32.27756375692177 0.0 3 0.9304979829434867 4.653884753775916 21842.0 104.21317882117881 0.0 - - - - - - - 357.42857142857144 43 7 ZBTB44 zinc finger and BTB domain containing 44 329 42 C20140704_OR005_02 C20140704_OR005_02 TB413130.[MT7]-TTLPLGTEEDVRVK[MT7].3b3_1.heavy 616.022 / 460.289 7395.0 30.477699279785156 44 14 10 10 10 3.0981272549901004 32.27756375692177 0.0 3 0.9304979829434867 4.653884753775916 7395.0 25.312819760884278 0.0 - - - - - - - 246.58333333333334 14 12 ZBTB44 zinc finger and BTB domain containing 44 331 42 C20140704_OR005_02 C20140704_OR005_02 TB413130.[MT7]-TTLPLGTEEDVRVK[MT7].3y9_1.heavy 616.022 / 1176.63 6939.0 30.477699279785156 44 14 10 10 10 3.0981272549901004 32.27756375692177 0.0 3 0.9304979829434867 4.653884753775916 6939.0 82.17236842105264 0.0 - - - - - - - 152.0 13 3 ZBTB44 zinc finger and BTB domain containing 44 333 43 C20140704_OR005_02 C20140704_OR005_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 170461.0 18.87689971923828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 170461.0 857.0898091252424 0.0 - - - - - - - 209.72727272727272 340 11 335 43 C20140704_OR005_02 C20140704_OR005_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 92692.0 18.87689971923828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 92692.0 1575.0644790734582 0.0 - - - - - - - 209.63636363636363 185 11 337 43 C20140704_OR005_02 C20140704_OR005_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 116350.0 18.87689971923828 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 116350.0 1087.75911228689 0.0 - - - - - - - 217.41666666666666 232 12 339 44 C20140704_OR005_02 C20140704_OR005_02 TB427307.[MT7]-SPGIGLVEEPMDK[MT7].2y4_1.heavy 830.447 / 634.335 2732.0 33.94110107421875 50 20 10 10 10 9.490794420387433 10.536525771244955 0.0 3 0.9958792029416248 19.218633591609603 2732.0 29.211384615384617 0.0 - - - - - - - 195.0 5 4 RDM1 RAD52 motif 1 341 44 C20140704_OR005_02 C20140704_OR005_02 TB427307.[MT7]-SPGIGLVEEPMDK[MT7].2y9_1.heavy 830.447 / 1161.59 1171.0 33.94110107421875 50 20 10 10 10 9.490794420387433 10.536525771244955 0.0 3 0.9958792029416248 19.218633591609603 1171.0 5.063073717948718 0.0 - - - - - - - 260.0 2 2 RDM1 RAD52 motif 1 343 44 C20140704_OR005_02 C20140704_OR005_02 TB427307.[MT7]-SPGIGLVEEPMDK[MT7].2y6_1.heavy 830.447 / 892.42 520.0 33.94110107421875 50 20 10 10 10 9.490794420387433 10.536525771244955 0.0 3 0.9958792029416248 19.218633591609603 520.0 1.5979723502304148 8.0 - - - - - - - 0.0 1 0 RDM1 RAD52 motif 1 345 44 C20140704_OR005_02 C20140704_OR005_02 TB427307.[MT7]-SPGIGLVEEPMDK[MT7].2b5_1.heavy 830.447 / 556.321 911.0 33.94110107421875 50 20 10 10 10 9.490794420387433 10.536525771244955 0.0 3 0.9958792029416248 19.218633591609603 911.0 4.029591369245548 1.0 - - - - - - - 216.66666666666666 2 6 RDM1 RAD52 motif 1 347 45 C20140704_OR005_02 C20140704_OR005_02 TB427305.[MT7]-YEPFWEDEEK[MT7].3y3_1.heavy 553.931 / 549.3 4073.0 36.8390007019043 48 18 10 10 10 3.920216400002105 25.508795891968184 0.0 3 0.9857072610068203 10.310649080456884 4073.0 3.5269611750397605 1.0 - - - - - - - 254.66666666666666 8 6 F2R coagulation factor II (thrombin) receptor 349 45 C20140704_OR005_02 C20140704_OR005_02 TB427305.[MT7]-YEPFWEDEEK[MT7].3b4_1.heavy 553.931 / 681.336 10182.0 36.8390007019043 48 18 10 10 10 3.920216400002105 25.508795891968184 0.0 3 0.9857072610068203 10.310649080456884 10182.0 28.789424598072394 0.0 - - - - - - - 266.27272727272725 20 11 F2R coagulation factor II (thrombin) receptor 351 45 C20140704_OR005_02 C20140704_OR005_02 TB427305.[MT7]-YEPFWEDEEK[MT7].3b3_1.heavy 553.931 / 534.268 6109.0 36.8390007019043 48 18 10 10 10 3.920216400002105 25.508795891968184 0.0 3 0.9857072610068203 10.310649080456884 6109.0 29.246813982137354 0.0 - - - - - - - 280.1 12 10 F2R coagulation factor II (thrombin) receptor 353 45 C20140704_OR005_02 C20140704_OR005_02 TB427305.[MT7]-YEPFWEDEEK[MT7].3y4_1.heavy 553.931 / 664.327 11073.0 36.8390007019043 48 18 10 10 10 3.920216400002105 25.508795891968184 0.0 3 0.9857072610068203 10.310649080456884 11073.0 41.69750381220831 0.0 - - - - - - - 159.0 22 8 F2R coagulation factor II (thrombin) receptor 355 46 C20140704_OR005_02 C20140704_OR005_02 TB412906.[MT7]-TTLPLGTEEDVR.2y8_1.heavy 737.897 / 918.453 577.0 30.74732542037964 33 12 10 5 6 2.410368925076533 41.48742499940121 0.04030036926269531 6 0.8955859361965162 3.7855545300767113 577.0 2.2841040462427746 10.0 - - - - - - - 294.6666666666667 2 9 ZBTB44 zinc finger and BTB domain containing 44 357 46 C20140704_OR005_02 C20140704_OR005_02 TB412906.[MT7]-TTLPLGTEEDVR.2y9_1.heavy 737.897 / 1015.51 27677.0 30.74732542037964 33 12 10 5 6 2.410368925076533 41.48742499940121 0.04030036926269531 6 0.8955859361965162 3.7855545300767113 27677.0 281.46331755163635 0.0 - - - - - - - 276.7 55 10 ZBTB44 zinc finger and BTB domain containing 44 359 46 C20140704_OR005_02 C20140704_OR005_02 TB412906.[MT7]-TTLPLGTEEDVR.2y11_1.heavy 737.897 / 1229.64 461.0 30.74732542037964 33 12 10 5 6 2.410368925076533 41.48742499940121 0.04030036926269531 6 0.8955859361965162 3.7855545300767113 461.0 2.6052173913043477 14.0 - - - - - - - 0.0 1 0 ZBTB44 zinc finger and BTB domain containing 44 361 46 C20140704_OR005_02 C20140704_OR005_02 TB412906.[MT7]-TTLPLGTEEDVR.2y7_1.heavy 737.897 / 805.369 1615.0 30.74732542037964 33 12 10 5 6 2.410368925076533 41.48742499940121 0.04030036926269531 6 0.8955859361965162 3.7855545300767113 1615.0 3.023119704305399 1.0 - - - - - - - 197.71428571428572 3 7 ZBTB44 zinc finger and BTB domain containing 44 363 47 C20140704_OR005_02 C20140704_OR005_02 TB427302.[MT7]-AVQHQALALNSSK[MT7].2y6_1.heavy 827.978 / 763.443 1095.0 22.904975414276123 31 5 10 6 10 1.032312280304807 48.44537353526502 0.03429985046386719 3 0.6860682943504514 2.1422304088384423 1095.0 8.249082439299832 0.0 - - - - - - - 216.42857142857142 2 7 RDM1 RAD52 motif 1 365 47 C20140704_OR005_02 C20140704_OR005_02 TB427302.[MT7]-AVQHQALALNSSK[MT7].2y4_1.heavy 827.978 / 579.322 421.0 22.904975414276123 31 5 10 6 10 1.032312280304807 48.44537353526502 0.03429985046386719 3 0.6860682943504514 2.1422304088384423 421.0 2.5035714285714286 1.0 - - - - - - - 0.0 0 0 RDM1 RAD52 motif 1 367 47 C20140704_OR005_02 C20140704_OR005_02 TB427302.[MT7]-AVQHQALALNSSK[MT7].2y8_1.heavy 827.978 / 947.564 2864.0 22.904975414276123 31 5 10 6 10 1.032312280304807 48.44537353526502 0.03429985046386719 3 0.6860682943504514 2.1422304088384423 2864.0 51.8247619047619 0.0 - - - - - - - 151.4 5 5 RDM1 RAD52 motif 1 369 47 C20140704_OR005_02 C20140704_OR005_02 TB427302.[MT7]-AVQHQALALNSSK[MT7].2b5_1.heavy 827.978 / 708.391 1095.0 22.904975414276123 31 5 10 6 10 1.032312280304807 48.44537353526502 0.03429985046386719 3 0.6860682943504514 2.1422304088384423 1095.0 10.324491812535292 0.0 - - - - - - - 147.25 2 4 RDM1 RAD52 motif 1 371 48 C20140704_OR005_02 C20140704_OR005_02 TB451186.[MT7]-QMNAFLEGFTELLPIDLIK[MT7].4y4_1.heavy 620.848 / 632.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 373 48 C20140704_OR005_02 C20140704_OR005_02 TB451186.[MT7]-QMNAFLEGFTELLPIDLIK[MT7].4b4_1.heavy 620.848 / 589.288 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 375 48 C20140704_OR005_02 C20140704_OR005_02 TB451186.[MT7]-QMNAFLEGFTELLPIDLIK[MT7].4b5_1.heavy 620.848 / 736.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 377 48 C20140704_OR005_02 C20140704_OR005_02 TB451186.[MT7]-QMNAFLEGFTELLPIDLIK[MT7].4b6_1.heavy 620.848 / 849.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 379 49 C20140704_OR005_02 C20140704_OR005_02 TB412634.[MT7]-VLPGHSAGPR.2y8_1.heavy 567.829 / 778.396 10005.0 19.495450019836426 46 20 10 6 10 8.386925209575267 11.923320823921383 0.039798736572265625 3 0.9971198935661495 22.99078560131432 10005.0 70.31675563675252 0.0 - - - - - - - 220.875 20 8 ENG endoglin 381 49 C20140704_OR005_02 C20140704_OR005_02 TB412634.[MT7]-VLPGHSAGPR.2b4_1.heavy 567.829 / 511.336 589.0 19.495450019836426 46 20 10 6 10 8.386925209575267 11.923320823921383 0.039798736572265625 3 0.9971198935661495 22.99078560131432 589.0 1.5398993249307373 11.0 - - - - - - - 130.75 7 8 ENG endoglin 383 49 C20140704_OR005_02 C20140704_OR005_02 TB412634.[MT7]-VLPGHSAGPR.2y9_1.heavy 567.829 / 891.479 2943.0 19.495450019836426 46 20 10 6 10 8.386925209575267 11.923320823921383 0.039798736572265625 3 0.9971198935661495 22.99078560131432 2943.0 51.546567234292425 0.0 - - - - - - - 163.33333333333334 5 12 ENG endoglin 385 49 C20140704_OR005_02 C20140704_OR005_02 TB412634.[MT7]-VLPGHSAGPR.2y7_1.heavy 567.829 / 681.343 654.0 19.495450019836426 46 20 10 6 10 8.386925209575267 11.923320823921383 0.039798736572265625 3 0.9971198935661495 22.99078560131432 654.0 14.754362889019376 0.0 - - - - - - - 0.0 1 0 ENG endoglin 387 50 C20140704_OR005_02 C20140704_OR005_02 TB426863.[MT7]-SVYPVAGGPTFK[MT7].3y7_1.heavy 504.288 / 821.464 2911.0 32.036476135253906 27 14 2 5 6 2.1432081156264036 37.15281107960246 0.0420989990234375 5 0.948770779463135 5.429149303923661 2911.0 2.2858264625049074 1.0 - - - - - - - 242.5 5 4 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 389 50 C20140704_OR005_02 C20140704_OR005_02 TB426863.[MT7]-SVYPVAGGPTFK[MT7].3y6_1.heavy 504.288 / 750.427 4973.0 32.036476135253906 27 14 2 5 6 2.1432081156264036 37.15281107960246 0.0420989990234375 5 0.948770779463135 5.429149303923661 4973.0 46.14962968849332 2.0 - - - - - - - 277.14285714285717 49 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 391 50 C20140704_OR005_02 C20140704_OR005_02 TB426863.[MT7]-SVYPVAGGPTFK[MT7].3b5_1.heavy 504.288 / 690.394 5943.0 32.036476135253906 27 14 2 5 6 2.1432081156264036 37.15281107960246 0.0420989990234375 5 0.948770779463135 5.429149303923661 5943.0 25.284638233054075 0.0 - - - - - - - 277.42857142857144 11 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 393 50 C20140704_OR005_02 C20140704_OR005_02 TB426863.[MT7]-SVYPVAGGPTFK[MT7].3y4_1.heavy 504.288 / 636.384 9339.0 32.036476135253906 27 14 2 5 6 2.1432081156264036 37.15281107960246 0.0420989990234375 5 0.948770779463135 5.429149303923661 9339.0 71.48370370370371 0.0 - - - - - - - 225.42857142857142 18 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 395 51 C20140704_OR005_02 C20140704_OR005_02 TB426861.[MT7]-AEQADGK[MT7].2y4_1.heavy 503.774 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLRB glycine receptor, beta 397 51 C20140704_OR005_02 C20140704_OR005_02 TB426861.[MT7]-AEQADGK[MT7].2b4_1.heavy 503.774 / 544.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLRB glycine receptor, beta 399 51 C20140704_OR005_02 C20140704_OR005_02 TB426861.[MT7]-AEQADGK[MT7].2y6_1.heavy 503.774 / 791.402 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLRB glycine receptor, beta 401 51 C20140704_OR005_02 C20140704_OR005_02 TB426861.[MT7]-AEQADGK[MT7].2b5_1.heavy 503.774 / 659.312 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLRB glycine receptor, beta 403 52 C20140704_OR005_02 C20140704_OR005_02 TB450656.[MT7]-YFPEVK[MT7].2y4_1.heavy 535.81 / 616.379 38346.0 31.63719940185547 50 20 10 10 10 11.22331007455216 8.910027374788562 0.0 3 0.9991048844588114 41.246815150294005 38346.0 133.98484403669724 0.0 - - - - - - - 239.8 76 10 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 405 52 C20140704_OR005_02 C20140704_OR005_02 TB450656.[MT7]-YFPEVK[MT7].2y5_1.heavy 535.81 / 763.447 11983.0 31.63719940185547 50 20 10 10 10 11.22331007455216 8.910027374788562 0.0 3 0.9991048844588114 41.246815150294005 11983.0 129.5043486238532 0.0 - - - - - - - 295.85714285714283 23 7 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 407 52 C20140704_OR005_02 C20140704_OR005_02 TB450656.[MT7]-YFPEVK[MT7].2b4_1.heavy 535.81 / 681.336 2506.0 31.63719940185547 50 20 10 10 10 11.22331007455216 8.910027374788562 0.0 3 0.9991048844588114 41.246815150294005 2506.0 3.8529762703193384 1.0 - - - - - - - 272.5 5 14 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 409 52 C20140704_OR005_02 C20140704_OR005_02 TB450656.[MT7]-YFPEVK[MT7].2y3_1.heavy 535.81 / 519.326 4031.0 31.63719940185547 50 20 10 10 10 11.22331007455216 8.910027374788562 0.0 3 0.9991048844588114 41.246815150294005 4031.0 6.389984837113844 0.0 - - - - - - - 730.0 8 10 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 411 53 C20140704_OR005_02 C20140704_OR005_02 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 187571.0 37.98619842529297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 187571.0 385.87796658264466 1.0 - - - - - - - 307.8 410 5 413 53 C20140704_OR005_02 C20140704_OR005_02 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 100615.0 37.98619842529297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 100615.0 670.4760398613519 0.0 - - - - - - - 204.25 201 8 415 53 C20140704_OR005_02 C20140704_OR005_02 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 179106.0 37.98619842529297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 179106.0 911.3471532467532 0.0 - - - - - - - 300.625 358 8 417 54 C20140704_OR005_02 C20140704_OR005_02 TB451002.[MT7]-IMPNTVFVGGIDVR.2y8_1.heavy 831.462 / 862.478 5216.0 41.26707363128662 40 14 10 6 10 2.009712377189255 39.64815935910642 0.031299591064453125 3 0.938511818722588 4.95125957039542 5216.0 15.295359301705119 0.0 - - - - - - - 238.83333333333334 10 12 DAZL deleted in azoospermia-like 419 54 C20140704_OR005_02 C20140704_OR005_02 TB451002.[MT7]-IMPNTVFVGGIDVR.2y9_1.heavy 831.462 / 961.547 3887.0 41.26707363128662 40 14 10 6 10 2.009712377189255 39.64815935910642 0.031299591064453125 3 0.938511818722588 4.95125957039542 3887.0 8.222536530742769 0.0 - - - - - - - 241.21428571428572 7 14 DAZL deleted in azoospermia-like 421 54 C20140704_OR005_02 C20140704_OR005_02 TB451002.[MT7]-IMPNTVFVGGIDVR.2y6_1.heavy 831.462 / 616.341 6546.0 41.26707363128662 40 14 10 6 10 2.009712377189255 39.64815935910642 0.031299591064453125 3 0.938511818722588 4.95125957039542 6546.0 9.602933985330072 0.0 - - - - - - - 245.66666666666666 13 15 DAZL deleted in azoospermia-like 423 54 C20140704_OR005_02 C20140704_OR005_02 TB451002.[MT7]-IMPNTVFVGGIDVR.2y11_1.heavy 831.462 / 1176.64 1841.0 41.26707363128662 40 14 10 6 10 2.009712377189255 39.64815935910642 0.031299591064453125 3 0.938511818722588 4.95125957039542 1841.0 7.649145847104641 1.0 - - - - - - - 213.16666666666666 4 12 DAZL deleted in azoospermia-like 425 55 C20140704_OR005_02 C20140704_OR005_02 TB412620.[MT7]-TEYGLLIR.2b4_1.heavy 554.828 / 595.284 6105.0 35.115699768066406 39 14 10 5 10 4.4839105012767355 17.774822198526337 0.04720306396484375 3 0.941457716083979 5.075580373039643 6105.0 24.645516344144117 0.0 - - - - - - - 309.3333333333333 12 3 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 427 55 C20140704_OR005_02 C20140704_OR005_02 TB412620.[MT7]-TEYGLLIR.2y6_1.heavy 554.828 / 734.456 11148.0 35.115699768066406 39 14 10 5 10 4.4839105012767355 17.774822198526337 0.04720306396484375 3 0.941457716083979 5.075580373039643 11148.0 32.7698590919935 0.0 - - - - - - - 246.42857142857142 22 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 429 55 C20140704_OR005_02 C20140704_OR005_02 TB412620.[MT7]-TEYGLLIR.2b5_1.heavy 554.828 / 708.369 9423.0 35.115699768066406 39 14 10 5 10 4.4839105012767355 17.774822198526337 0.04720306396484375 3 0.941457716083979 5.075580373039643 9423.0 79.79652312256545 0.0 - - - - - - - 232.25 18 4 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 431 55 C20140704_OR005_02 C20140704_OR005_02 TB412620.[MT7]-TEYGLLIR.2y7_1.heavy 554.828 / 863.498 15130.0 35.115699768066406 39 14 10 5 10 4.4839105012767355 17.774822198526337 0.04720306396484375 3 0.941457716083979 5.075580373039643 15130.0 150.82638360977822 0.0 - - - - - - - 227.42857142857142 30 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 433 56 C20140704_OR005_02 C20140704_OR005_02 TB450794.[MT7]-RHEPAFDK[MT7].3y3_1.heavy 429.906 / 553.31 5008.0 18.353150367736816 38 14 10 6 8 1.7620879606947981 44.22418676427391 0.035800933837890625 4 0.942820178128718 5.136289829438368 5008.0 13.351821989185646 0.0 - - - - - - - 224.25 10 12 GNMT glycine N-methyltransferase 435 56 C20140704_OR005_02 C20140704_OR005_02 TB450794.[MT7]-RHEPAFDK[MT7].3b3_1.heavy 429.906 / 567.312 614.0 18.353150367736816 38 14 10 6 8 1.7620879606947981 44.22418676427391 0.035800933837890625 4 0.942820178128718 5.136289829438368 614.0 0.4140000917370409 5.0 - - - - - - - 218.0 6 13 GNMT glycine N-methyltransferase 437 56 C20140704_OR005_02 C20140704_OR005_02 TB450794.[MT7]-RHEPAFDK[MT7].3y4_1.heavy 429.906 / 624.347 1464.0 18.353150367736816 38 14 10 6 8 1.7620879606947981 44.22418676427391 0.035800933837890625 4 0.942820178128718 5.136289829438368 1464.0 1.3778823529411766 1.0 - - - - - - - 742.2857142857143 4 7 GNMT glycine N-methyltransferase 439 56 C20140704_OR005_02 C20140704_OR005_02 TB450794.[MT7]-RHEPAFDK[MT7].3y5_1.heavy 429.906 / 721.4 2220.0 18.353150367736816 38 14 10 6 8 1.7620879606947981 44.22418676427391 0.035800933837890625 4 0.942820178128718 5.136289829438368 2220.0 3.022692889561271 0.0 - - - - - - - 776.1428571428571 4 7 GNMT glycine N-methyltransferase 441 57 C20140704_OR005_02 C20140704_OR005_02 TB426879.[MT7]-RVEAEK[MT7].2b3_1.heavy 510.308 / 529.321 6468.0 26.571200370788574 34 16 2 6 10 1.8513339950790746 38.46119370101383 0.03719902038574219 3 0.964901068665871 6.568056746480659 6468.0 34.98 0.0 - - - - - - - 267.27272727272725 12 11 GLRB glycine receptor, beta 443 57 C20140704_OR005_02 C20140704_OR005_02 TB426879.[MT7]-RVEAEK[MT7].2y4_1.heavy 510.308 / 620.337 5880.0 26.571200370788574 34 16 2 6 10 1.8513339950790746 38.46119370101383 0.03719902038574219 3 0.964901068665871 6.568056746480659 5880.0 19.05 0.0 - - - - - - - 252.0 11 14 GLRB glycine receptor, beta 445 57 C20140704_OR005_02 C20140704_OR005_02 TB426879.[MT7]-RVEAEK[MT7].2y5_1.heavy 510.308 / 719.406 4508.0 26.571200370788574 34 16 2 6 10 1.8513339950790746 38.46119370101383 0.03719902038574219 3 0.964901068665871 6.568056746480659 4508.0 59.18666666666667 0.0 - - - - - - - 156.8 9 5 GLRB glycine receptor, beta 447 57 C20140704_OR005_02 C20140704_OR005_02 TB426879.[MT7]-RVEAEK[MT7].2b5_1.heavy 510.308 / 729.401 882.0 26.571200370788574 34 16 2 6 10 1.8513339950790746 38.46119370101383 0.03719902038574219 3 0.964901068665871 6.568056746480659 882.0 0.059361702127659566 3.0 - - - - - - - 168.0 27 7 GLRB glycine receptor, beta 449 58 C20140704_OR005_02 C20140704_OR005_02 TB427497.[MT7]-VFPNAAVAHPGFYAVIK[MT7].3b4_1.heavy 697.066 / 602.342 1652.0 38.04960060119629 27 14 2 5 6 6.155787938600968 12.64989772167366 0.041797637939453125 5 0.9366049990520119 4.875435106693796 1652.0 0.5264957264957264 6.0 - - - - - - - 259.6 44 5 RDM1 RAD52 motif 1 451 58 C20140704_OR005_02 C20140704_OR005_02 TB427497.[MT7]-VFPNAAVAHPGFYAVIK[MT7].3y4_1.heavy 697.066 / 574.404 4955.0 38.04960060119629 27 14 2 5 6 6.155787938600968 12.64989772167366 0.041797637939453125 5 0.9366049990520119 4.875435106693796 4955.0 4.054127678609327 1.0 - - - - - - - 295.0 10 8 RDM1 RAD52 motif 1 453 58 C20140704_OR005_02 C20140704_OR005_02 TB427497.[MT7]-VFPNAAVAHPGFYAVIK[MT7].3b8_1.heavy 697.066 / 914.522 3893.0 38.04960060119629 27 14 2 5 6 6.155787938600968 12.64989772167366 0.041797637939453125 5 0.9366049990520119 4.875435106693796 3893.0 0.5419261237291293 1.0 - - - - - - - 275.3333333333333 7 9 RDM1 RAD52 motif 1 455 58 C20140704_OR005_02 C20140704_OR005_02 TB427497.[MT7]-VFPNAAVAHPGFYAVIK[MT7].3y8_1.heavy 697.066 / 1038.61 9674.0 38.04960060119629 27 14 2 5 6 6.155787938600968 12.64989772167366 0.041797637939453125 5 0.9366049990520119 4.875435106693796 9674.0 4.364860657331748 1.0 - - - - - - - 269.7142857142857 22 7 RDM1 RAD52 motif 1 457 59 C20140704_OR005_02 C20140704_OR005_02 TB426871.[MT7]-ILVAGDSMDSVK[MT7].3b6_1.heavy 508.284 / 713.431 3815.0 32.95100021362305 43 15 10 10 8 2.214803042609096 36.131984866237104 0.0 4 0.9536733949228015 5.7115777346103505 3815.0 25.984055118110238 1.0 - - - - - - - 174.625 8 8 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 459 59 C20140704_OR005_02 C20140704_OR005_02 TB426871.[MT7]-ILVAGDSMDSVK[MT7].3b4_1.heavy 508.284 / 541.383 4451.0 32.95100021362305 43 15 10 10 8 2.214803042609096 36.131984866237104 0.0 4 0.9536733949228015 5.7115777346103505 4451.0 10.329981215104166 2.0 - - - - - - - 233.16666666666666 9 6 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 461 59 C20140704_OR005_02 C20140704_OR005_02 TB426871.[MT7]-ILVAGDSMDSVK[MT7].3y4_1.heavy 508.284 / 592.342 8139.0 32.95100021362305 43 15 10 10 8 2.214803042609096 36.131984866237104 0.0 4 0.9536733949228015 5.7115777346103505 8139.0 55.43492125984251 0.0 - - - - - - - 217.85714285714286 16 7 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 463 59 C20140704_OR005_02 C20140704_OR005_02 TB426871.[MT7]-ILVAGDSMDSVK[MT7].3b7_1.heavy 508.284 / 800.463 1526.0 32.95100021362305 43 15 10 10 8 2.214803042609096 36.131984866237104 0.0 4 0.9536733949228015 5.7115777346103505 1526.0 10.23259842519685 3.0 - - - - - - - 178.0 15 5 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 465 60 C20140704_OR005_02 C20140704_OR005_02 TB412625.[MT7]-VYSSNEK[MT7].2y4_1.heavy 557.803 / 621.332 1468.0 17.826499938964844 50 20 10 10 10 7.581665587541369 13.189713901959191 0.0 3 0.9920932358381797 13.869998246035353 1468.0 6.99047619047619 0.0 - - - - - - - 209.77777777777777 2 9 C1orf101 chromosome 1 open reading frame 101 467 60 C20140704_OR005_02 C20140704_OR005_02 TB412625.[MT7]-VYSSNEK[MT7].2y5_1.heavy 557.803 / 708.364 4487.0 17.826499938964844 50 20 10 10 10 7.581665587541369 13.189713901959191 0.0 3 0.9920932358381797 13.869998246035353 4487.0 107.91228628230616 0.0 - - - - - - - 125.9 8 10 C1orf101 chromosome 1 open reading frame 101 469 60 C20140704_OR005_02 C20140704_OR005_02 TB412625.[MT7]-VYSSNEK[MT7].2y3_1.heavy 557.803 / 534.3 839.0 17.826499938964844 50 20 10 10 10 7.581665587541369 13.189713901959191 0.0 3 0.9920932358381797 13.869998246035353 839.0 5.1367346938775515 0.0 - - - - - - - 0.0 1 0 C1orf101 chromosome 1 open reading frame 101 471 60 C20140704_OR005_02 C20140704_OR005_02 TB412625.[MT7]-VYSSNEK[MT7].2y6_1.heavy 557.803 / 871.428 6794.0 17.826499938964844 50 20 10 10 10 7.581665587541369 13.189713901959191 0.0 3 0.9920932358381797 13.869998246035353 6794.0 65.81405993105277 0.0 - - - - - - - 167.76923076923077 13 13 C1orf101 chromosome 1 open reading frame 101 473 61 C20140704_OR005_02 C20140704_OR005_02 TB451000.[MT7]-C[CAM]LELAEYLYAK[MT7].3b6_1.heavy 554.3 / 860.43 15491.0 41.82492637634277 40 14 10 6 10 1.2804587511230392 47.15040453841652 0.03569793701171875 3 0.9342439055504627 4.786139487800329 15491.0 -5.986859903381642 0.0 - - - - - - - 248.2 30 5 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 475 61 C20140704_OR005_02 C20140704_OR005_02 TB451000.[MT7]-C[CAM]LELAEYLYAK[MT7].3y3_1.heavy 554.3 / 525.315 25508.0 41.82492637634277 40 14 10 6 10 1.2804587511230392 47.15040453841652 0.03569793701171875 3 0.9342439055504627 4.786139487800329 25508.0 -12.352542372881352 0.0 - - - - - - - 258.1666666666667 51 6 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 477 61 C20140704_OR005_02 C20140704_OR005_02 TB451000.[MT7]-C[CAM]LELAEYLYAK[MT7].3b4_1.heavy 554.3 / 660.351 10017.0 41.82492637634277 40 14 10 6 10 1.2804587511230392 47.15040453841652 0.03569793701171875 3 0.9342439055504627 4.786139487800329 10017.0 -4.850847457627118 0.0 - - - - - - - 258.375 20 8 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 479 61 C20140704_OR005_02 C20140704_OR005_02 TB451000.[MT7]-C[CAM]LELAEYLYAK[MT7].3b3_1.heavy 554.3 / 547.267 12083.0 41.82492637634277 40 14 10 6 10 1.2804587511230392 47.15040453841652 0.03569793701171875 3 0.9342439055504627 4.786139487800329 12083.0 -1.8733333333333313 0.0 - - - - - - - 206.75 24 8 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 481 62 C20140704_OR005_02 C20140704_OR005_02 TB450907.[MT7]-MREIVGWSSK[MT7].3b6_1.heavy 494.278 / 830.468 3086.0 30.55590057373047 43 13 10 10 10 1.4198316843265688 47.035093780540876 0.0 3 0.9272316234342818 4.546964832953537 3086.0 14.712139316887235 1.0 - - - - - - - 240.0 6 3 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 483 62 C20140704_OR005_02 C20140704_OR005_02 TB450907.[MT7]-MREIVGWSSK[MT7].3b4_1.heavy 494.278 / 674.378 2366.0 30.55590057373047 43 13 10 10 10 1.4198316843265688 47.035093780540876 0.0 3 0.9272316234342818 4.546964832953537 2366.0 -1.3809338521400778 1.0 - - - - - - - 180.25 4 8 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 485 62 C20140704_OR005_02 C20140704_OR005_02 TB450907.[MT7]-MREIVGWSSK[MT7].3b3_1.heavy 494.278 / 561.294 3806.0 30.55590057373047 43 13 10 10 10 1.4198316843265688 47.035093780540876 0.0 3 0.9272316234342818 4.546964832953537 3806.0 7.330645236808932 0.0 - - - - - - - 205.85714285714286 7 7 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 487 62 C20140704_OR005_02 C20140704_OR005_02 TB450907.[MT7]-MREIVGWSSK[MT7].3y5_1.heavy 494.278 / 708.38 4629.0 30.55590057373047 43 13 10 10 10 1.4198316843265688 47.035093780540876 0.0 3 0.9272316234342818 4.546964832953537 4629.0 56.92621359223301 0.0 - - - - - - - 309.0 9 1 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 489 63 C20140704_OR005_02 C20140704_OR005_02 TB427334.[MT7]-HLPLEEVWGPEFL.2b6_1.heavy 855.455 / 863.474 2135.0 50.24755096435547 32 7 10 5 10 0.6973586940144366 78.11721190581243 0.04270172119140625 3 0.7318934041151955 2.328037232890527 2135.0 6.37565902088326 1.0 - - - - - - - 213.3 4 10 C1orf101 chromosome 1 open reading frame 101 491 63 C20140704_OR005_02 C20140704_OR005_02 TB427334.[MT7]-HLPLEEVWGPEFL.2b7_1.heavy 855.455 / 962.543 5794.0 50.24755096435547 32 7 10 5 10 0.6973586940144366 78.11721190581243 0.04270172119140625 3 0.7318934041151955 2.328037232890527 5794.0 2.0240920371291713 0.0 - - - - - - - 171.25 11 8 C1orf101 chromosome 1 open reading frame 101 493 63 C20140704_OR005_02 C20140704_OR005_02 TB427334.[MT7]-HLPLEEVWGPEFL.2b5_1.heavy 855.455 / 734.432 1067.0 50.24755096435547 32 7 10 5 10 0.6973586940144366 78.11721190581243 0.04270172119140625 3 0.7318934041151955 2.328037232890527 1067.0 2.9125459317585305 1.0 - - - - - - - 234.3846153846154 2 13 C1orf101 chromosome 1 open reading frame 101 495 63 C20140704_OR005_02 C20140704_OR005_02 TB427334.[MT7]-HLPLEEVWGPEFL.2b9_1.heavy 855.455 / 1205.64 1067.0 50.24755096435547 32 7 10 5 10 0.6973586940144366 78.11721190581243 0.04270172119140625 3 0.7318934041151955 2.328037232890527 1067.0 5.1662008733624445 3.0 - - - - - - - 244.92857142857142 2 14 C1orf101 chromosome 1 open reading frame 101 497 64 C20140704_OR005_02 C20140704_OR005_02 TB412814.[MT7]-LLIVVLESGK[MT7].2y5_1.heavy 679.947 / 677.395 15988.0 45.255300521850586 43 18 10 5 10 8.45333836625175 11.82964595374886 0.04199981689453125 3 0.9897634372207862 12.187485776015968 15988.0 164.81456790123457 0.0 - - - - - - - 185.14285714285714 31 7 RDM1 RAD52 motif 1 499 64 C20140704_OR005_02 C20140704_OR005_02 TB412814.[MT7]-LLIVVLESGK[MT7].2b4_1.heavy 679.947 / 583.43 16960.0 45.255300521850586 43 18 10 5 10 8.45333836625175 11.82964595374886 0.04199981689453125 3 0.9897634372207862 12.187485776015968 16960.0 19.2951960129158 1.0 - - - - - - - 270.0 38 6 RDM1 RAD52 motif 1 501 64 C20140704_OR005_02 C20140704_OR005_02 TB412814.[MT7]-LLIVVLESGK[MT7].2y6_1.heavy 679.947 / 776.463 18256.0 45.255300521850586 43 18 10 5 10 8.45333836625175 11.82964595374886 0.04199981689453125 3 0.9897634372207862 12.187485776015968 18256.0 52.964938271604936 0.0 - - - - - - - 284.72727272727275 36 11 RDM1 RAD52 motif 1 503 64 C20140704_OR005_02 C20140704_OR005_02 TB412814.[MT7]-LLIVVLESGK[MT7].2y7_1.heavy 679.947 / 875.532 21605.0 45.255300521850586 43 18 10 5 10 8.45333836625175 11.82964595374886 0.04199981689453125 3 0.9897634372207862 12.187485776015968 21605.0 72.47391534391535 0.0 - - - - - - - 216.0 43 7 RDM1 RAD52 motif 1 505 65 C20140704_OR005_02 C20140704_OR005_02 TB427338.[MT7]-AQEHTFIHTIVK[MT7].4y4_1.heavy 428.749 / 604.415 3795.0 27.28304958343506 34 8 10 6 10 0.6184978138198453 83.63448563963374 0.03849983215332031 3 0.7738868254379541 2.5448023302289635 3795.0 15.599231432897842 0.0 - - - - - - - 218.83333333333334 7 12 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 507 65 C20140704_OR005_02 C20140704_OR005_02 TB427338.[MT7]-AQEHTFIHTIVK[MT7].4b4_1.heavy 428.749 / 610.307 2724.0 27.28304958343506 34 8 10 6 10 0.6184978138198453 83.63448563963374 0.03849983215332031 3 0.7738868254379541 2.5448023302289635 2724.0 22.458760236397847 0.0 - - - - - - - 262.4 5 10 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 509 65 C20140704_OR005_02 C20140704_OR005_02 TB427338.[MT7]-AQEHTFIHTIVK[MT7].4b6_1.heavy 428.749 / 858.423 778.0 27.28304958343506 34 8 10 6 10 0.6184978138198453 83.63448563963374 0.03849983215332031 3 0.7738868254379541 2.5448023302289635 778.0 5.073315915831097 0.0 - - - - - - - 0.0 1 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 511 65 C20140704_OR005_02 C20140704_OR005_02 TB427338.[MT7]-AQEHTFIHTIVK[MT7].4b3_1.heavy 428.749 / 473.248 2335.0 27.28304958343506 34 8 10 6 10 0.6184978138198453 83.63448563963374 0.03849983215332031 3 0.7738868254379541 2.5448023302289635 2335.0 20.049145600903827 1.0 - - - - - - - 238.9090909090909 4 11 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 513 66 C20140704_OR005_02 C20140704_OR005_02 TB427499.[MT7]-C[CAM]LWK[MT7]PDLFFANEK[MT7].4b8_2.heavy 525.788 / 674.87 4592.0 41.43192481994629 44 18 10 6 10 3.3668138554830693 23.838834413354096 0.03389739990234375 3 0.9876444305962352 11.091309086371437 4592.0 18.363526285023966 0.0 - - - - - - - 363.4 9 5 GLRB glycine receptor, beta 515 66 C20140704_OR005_02 C20140704_OR005_02 TB427499.[MT7]-C[CAM]LWK[MT7]PDLFFANEK[MT7].4b7_2.heavy 525.788 / 601.336 3444.0 41.43192481994629 44 18 10 6 10 3.3668138554830693 23.838834413354096 0.03389739990234375 3 0.9876444305962352 11.091309086371437 3444.0 8.452637075718014 2.0 - - - - - - - 265.0769230769231 10 13 GLRB glycine receptor, beta 517 66 C20140704_OR005_02 C20140704_OR005_02 TB427499.[MT7]-C[CAM]LWK[MT7]PDLFFANEK[MT7].4y3_1.heavy 525.788 / 534.3 4114.0 41.43192481994629 44 18 10 6 10 3.3668138554830693 23.838834413354096 0.03389739990234375 3 0.9876444305962352 11.091309086371437 4114.0 12.18432055749129 0.0 - - - - - - - 234.9090909090909 8 11 GLRB glycine receptor, beta 519 66 C20140704_OR005_02 C20140704_OR005_02 TB427499.[MT7]-C[CAM]LWK[MT7]PDLFFANEK[MT7].4b6_2.heavy 525.788 / 544.794 11863.0 41.43192481994629 44 18 10 6 10 3.3668138554830693 23.838834413354096 0.03389739990234375 3 0.9876444305962352 11.091309086371437 11863.0 61.873313834481124 0.0 - - - - - - - 210.6 23 10 GLRB glycine receptor, beta 521 67 C20140704_OR005_02 C20140704_OR005_02 TB427337.[MT7]-AQEHTFIHTIVK[MT7].3b6_1.heavy 571.329 / 858.423 4875.0 27.30229949951172 47 17 10 10 10 2.958281945229086 26.971396194709698 0.0 3 0.9788621450699266 8.473521325432868 4875.0 28.99590163934426 0.0 - - - - - - - 231.875 9 8 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 523 67 C20140704_OR005_02 C20140704_OR005_02 TB427337.[MT7]-AQEHTFIHTIVK[MT7].3b4_1.heavy 571.329 / 610.307 6240.0 27.30229949951172 47 17 10 10 10 2.958281945229086 26.971396194709698 0.0 3 0.9788621450699266 8.473521325432868 6240.0 72.21397227833113 0.0 - - - - - - - 223.14285714285714 12 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 525 67 C20140704_OR005_02 C20140704_OR005_02 TB427337.[MT7]-AQEHTFIHTIVK[MT7].3y4_1.heavy 571.329 / 604.415 21159.0 27.30229949951172 47 17 10 10 10 2.958281945229086 26.971396194709698 0.0 3 0.9788621450699266 8.473521325432868 21159.0 90.77958102143758 0.0 - - - - - - - 278.85714285714283 42 14 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 527 67 C20140704_OR005_02 C20140704_OR005_02 TB427337.[MT7]-AQEHTFIHTIVK[MT7].3y5_1.heavy 571.329 / 741.474 8093.0 27.30229949951172 47 17 10 10 10 2.958281945229086 26.971396194709698 0.0 3 0.9788621450699266 8.473521325432868 8093.0 61.09276251526251 0.0 - - - - - - - 209.28571428571428 16 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 529 68 C20140704_OR005_02 C20140704_OR005_02 TB427498.[MT7]-VFPNAAVAHPGFYAVIK[MT7].4y4_1.heavy 523.051 / 574.404 2231.0 37.95499897003174 30 5 10 5 10 1.48964242664938 53.350848139023626 0.041599273681640625 3 0.6311677534246206 1.9660398044540588 2231.0 1.9291201705422851 1.0 - - - - - - - 301.85714285714283 4 7 RDM1 RAD52 motif 1 531 68 C20140704_OR005_02 C20140704_OR005_02 TB427498.[MT7]-VFPNAAVAHPGFYAVIK[MT7].4b8_1.heavy 523.051 / 914.522 2466.0 37.95499897003174 30 5 10 5 10 1.48964242664938 53.350848139023626 0.041599273681640625 3 0.6311677534246206 1.9660398044540588 2466.0 18.727952841860127 0.0 - - - - - - - 234.66666666666666 4 3 RDM1 RAD52 motif 1 533 68 C20140704_OR005_02 C20140704_OR005_02 TB427498.[MT7]-VFPNAAVAHPGFYAVIK[MT7].4b4_1.heavy 523.051 / 602.342 235.0 37.95499897003174 30 5 10 5 10 1.48964242664938 53.350848139023626 0.041599273681640625 3 0.6311677534246206 1.9660398044540588 235.0 -0.10272325151912305 29.0 - - - - - - - 293.5 7 4 RDM1 RAD52 motif 1 535 68 C20140704_OR005_02 C20140704_OR005_02 TB427498.[MT7]-VFPNAAVAHPGFYAVIK[MT7].4y3_1.heavy 523.051 / 503.367 5401.0 37.95499897003174 30 5 10 5 10 1.48964242664938 53.350848139023626 0.041599273681640625 3 0.6311677534246206 1.9660398044540588 5401.0 6.597830026372796 1.0 - - - - - - - 293.625 10 8 RDM1 RAD52 motif 1 537 69 C20140704_OR005_02 C20140704_OR005_02 TB412520.[MT7]-LVSINK[MT7].2y4_1.heavy 481.318 / 605.374 20431.0 27.62220001220703 48 18 10 10 10 6.136744151875432 16.295285826677212 0.0 3 0.9882186234909979 11.358920131461291 20431.0 120.02369636963695 0.0 - - - - - - - 224.44444444444446 40 9 F2R coagulation factor II (thrombin) receptor 539 69 C20140704_OR005_02 C20140704_OR005_02 TB412520.[MT7]-LVSINK[MT7].2y5_1.heavy 481.318 / 704.442 23566.0 27.62220001220703 48 18 10 10 10 6.136744151875432 16.295285826677212 0.0 3 0.9882186234909979 11.358920131461291 23566.0 447.9873267326733 0.0 - - - - - - - 126.25 47 4 F2R coagulation factor II (thrombin) receptor 541 69 C20140704_OR005_02 C20140704_OR005_02 TB412520.[MT7]-LVSINK[MT7].2y3_1.heavy 481.318 / 518.342 10114.0 27.62220001220703 48 18 10 10 10 6.136744151875432 16.295285826677212 0.0 3 0.9882186234909979 11.358920131461291 10114.0 49.25908550498967 0.0 - - - - - - - 218.83333333333334 20 6 F2R coagulation factor II (thrombin) receptor 543 70 C20140704_OR005_02 C20140704_OR005_02 TB412820.[MT7]-DYLPTVGALK[MT7].2y4_1.heavy 682.905 / 532.357 7867.0 36.39400100708008 48 18 10 10 10 5.420470504373935 18.44858300018552 0.0 3 0.9839715555327894 9.734975892640731 7867.0 67.69279069767441 0.0 - - - - - - - 215.0 15 6 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 545 70 C20140704_OR005_02 C20140704_OR005_02 TB412820.[MT7]-DYLPTVGALK[MT7].2b3_1.heavy 682.905 / 536.284 9801.0 36.39400100708008 48 18 10 10 10 5.420470504373935 18.44858300018552 0.0 3 0.9839715555327894 9.734975892640731 9801.0 -0.3013215996713553 2.0 - - - - - - - 239.57142857142858 31 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 547 70 C20140704_OR005_02 C20140704_OR005_02 TB412820.[MT7]-DYLPTVGALK[MT7].2y5_1.heavy 682.905 / 631.426 1548.0 36.39400100708008 48 18 10 10 10 5.420470504373935 18.44858300018552 0.0 3 0.9839715555327894 9.734975892640731 1548.0 5.77 4.0 - - - - - - - 245.1 3 10 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 549 70 C20140704_OR005_02 C20140704_OR005_02 TB412820.[MT7]-DYLPTVGALK[MT7].2y7_1.heavy 682.905 / 829.526 14444.0 36.39400100708008 48 18 10 10 10 5.420470504373935 18.44858300018552 0.0 3 0.9839715555327894 9.734975892640731 14444.0 72.89181395348837 0.0 - - - - - - - 165.85714285714286 28 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 551 71 C20140704_OR005_02 C20140704_OR005_02 TB413190.[MT7]-K[MT7]WC[CAM]WVNY[MT3]LLK[MT7].3b4_1.heavy 661.385 / 949.496 2412.0 51.101600646972656 46 16 10 10 10 4.940491408140645 20.240901509357148 0.0 3 0.9676041465669432 6.838143112795921 2412.0 38.282699662542186 0.0 - - - - - - - 114.0 4 5 C1orf101 chromosome 1 open reading frame 101 553 71 C20140704_OR005_02 C20140704_OR005_02 TB413190.[MT7]-K[MT7]WC[CAM]WVNY[MT3]LLK[MT7].3b3_1.heavy 661.385 / 763.416 1016.0 51.101600646972656 46 16 10 10 10 4.940491408140645 20.240901509357148 0.0 3 0.9676041465669432 6.838143112795921 1016.0 5.4399999999999995 0.0 - - - - - - - 147.88888888888889 2 9 C1orf101 chromosome 1 open reading frame 101 555 71 C20140704_OR005_02 C20140704_OR005_02 TB413190.[MT7]-K[MT7]WC[CAM]WVNY[MT3]LLK[MT7].3y4_1.heavy 661.385 / 820.541 3555.0 51.101600646972656 46 16 10 10 10 4.940491408140645 20.240901509357148 0.0 3 0.9676041465669432 6.838143112795921 3555.0 64.23970753655793 0.0 - - - - - - - 126.8 7 10 C1orf101 chromosome 1 open reading frame 101 557 71 C20140704_OR005_02 C20140704_OR005_02 TB413190.[MT7]-K[MT7]WC[CAM]WVNY[MT3]LLK[MT7].3y9_2.heavy 661.385 / 783.425 381.0 51.101600646972656 46 16 10 10 10 4.940491408140645 20.240901509357148 0.0 3 0.9676041465669432 6.838143112795921 381.0 1.0800000000000003 2.0 - - - - - - - 0.0 1 0 C1orf101 chromosome 1 open reading frame 101 559 72 C20140704_OR005_02 C20140704_OR005_02 TB413059.[MT7]-VTQSFLPPGWEMR.2b4_1.heavy 846.438 / 560.316 3150.0 41.79855155944824 37 15 10 6 6 1.605162551372716 37.04998974468705 0.034900665283203125 5 0.9599864506289184 6.148935687166113 3150.0 17.605078167905393 0.0 - - - - - - - 183.92857142857142 6 14 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 561 72 C20140704_OR005_02 C20140704_OR005_02 TB413059.[MT7]-VTQSFLPPGWEMR.2y9_1.heavy 846.438 / 1132.56 1241.0 41.79855155944824 37 15 10 6 6 1.605162551372716 37.04998974468705 0.034900665283203125 5 0.9599864506289184 6.148935687166113 1241.0 2.598952879581152 3.0 - - - - - - - 225.4090909090909 2 22 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 563 72 C20140704_OR005_02 C20140704_OR005_02 TB413059.[MT7]-VTQSFLPPGWEMR.2y10_1.heavy 846.438 / 1219.59 954.0 41.79855155944824 37 15 10 6 6 1.605162551372716 37.04998974468705 0.034900665283203125 5 0.9599864506289184 6.148935687166113 954.0 -0.5 5.0 - - - - - - - 0.0 1 0 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 565 72 C20140704_OR005_02 C20140704_OR005_02 TB413059.[MT7]-VTQSFLPPGWEMR.2y7_1.heavy 846.438 / 872.408 9545.0 41.79855155944824 37 15 10 6 6 1.605162551372716 37.04998974468705 0.034900665283203125 5 0.9599864506289184 6.148935687166113 9545.0 101.82138113305444 0.0 - - - - - - - 209.7 19 10 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 567 73 C20140704_OR005_02 C20140704_OR005_02 TB412518.[MT7]-AQEPPK[MT7].2y4_1.heavy 479.284 / 614.363 295.0 15.646374940872192 38 17 10 3 8 4.8503580670028885 20.617034581488443 0.05449962615966797 4 0.9712411104224317 7.259888698957365 295.0 3.7545454545454544 1.0 - - - - - - - 0.0 0 0 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 569 73 C20140704_OR005_02 C20140704_OR005_02 TB412518.[MT7]-AQEPPK[MT7].2b3_1.heavy 479.284 / 473.248 3563.0 15.646374940872192 38 17 10 3 8 4.8503580670028885 20.617034581488443 0.05449962615966797 4 0.9712411104224317 7.259888698957365 3563.0 8.432561791451347 0.0 - - - - - - - 228.86363636363637 7 22 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 571 73 C20140704_OR005_02 C20140704_OR005_02 TB412518.[MT7]-AQEPPK[MT7].2y5_1.heavy 479.284 / 742.422 295.0 15.646374940872192 38 17 10 3 8 4.8503580670028885 20.617034581488443 0.05449962615966797 4 0.9712411104224317 7.259888698957365 295.0 1.2113636363636362 1.0 - - - - - - - 0.0 0 0 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 573 73 C20140704_OR005_02 C20140704_OR005_02 TB412518.[MT7]-AQEPPK[MT7].2y3_1.heavy 479.284 / 485.32 5036.0 15.646374940872192 38 17 10 3 8 4.8503580670028885 20.617034581488443 0.05449962615966797 4 0.9712411104224317 7.259888698957365 5036.0 23.066696960058163 0.0 - - - - - - - 235.6315789473684 10 19 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 575 74 C20140704_OR005_02 C20140704_OR005_02 TB427613.[MT7]-LQELSDLEERENEDSMVPLPK[MT7].3b6_1.heavy 920.472 / 830.438 4335.0 38.982675552368164 34 11 10 3 10 0.800228907841072 64.654630577959 0.07109832763671875 3 0.8698521982716754 3.383118004263075 4335.0 5.335384615384616 1.0 - - - - - - - 295.72727272727275 8 11 RDM1 RAD52 motif 1 577 74 C20140704_OR005_02 C20140704_OR005_02 TB427613.[MT7]-LQELSDLEERENEDSMVPLPK[MT7].3y4_1.heavy 920.472 / 598.404 21569.0 38.982675552368164 34 11 10 3 10 0.800228907841072 64.654630577959 0.07109832763671875 3 0.8698521982716754 3.383118004263075 21569.0 69.10623267902987 0.0 - - - - - - - 295.6363636363636 43 11 RDM1 RAD52 motif 1 579 74 C20140704_OR005_02 C20140704_OR005_02 TB427613.[MT7]-LQELSDLEERENEDSMVPLPK[MT7].3b3_1.heavy 920.472 / 515.295 9105.0 38.982675552368164 34 11 10 3 10 0.800228907841072 64.654630577959 0.07109832763671875 3 0.8698521982716754 3.383118004263075 9105.0 45.63538319744771 0.0 - - - - - - - 292.7 18 10 RDM1 RAD52 motif 1 581 74 C20140704_OR005_02 C20140704_OR005_02 TB427613.[MT7]-LQELSDLEERENEDSMVPLPK[MT7].3b15_2.heavy 920.472 / 966.451 13548.0 38.982675552368164 34 11 10 3 10 0.800228907841072 64.654630577959 0.07109832763671875 3 0.8698521982716754 3.383118004263075 13548.0 61.847792903775186 0.0 - - - - - - - 216.72727272727272 27 11 RDM1 RAD52 motif 1 583 75 C20140704_OR005_02 C20140704_OR005_02 TB412519.[MT7]-GMAAVPK[MT7].2y4_1.heavy 481.291 / 558.373 2383.0 22.24815034866333 44 18 10 6 10 1.6325011382617791 38.54833784948892 0.03899955749511719 3 0.981754124904644 9.12257538133719 2383.0 4.591987829614604 1.0 - - - - - - - 240.86666666666667 4 15 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 585 75 C20140704_OR005_02 C20140704_OR005_02 TB412519.[MT7]-GMAAVPK[MT7].2y5_1.heavy 481.291 / 629.41 1479.0 22.24815034866333 44 18 10 6 10 1.6325011382617791 38.54833784948892 0.03899955749511719 3 0.981754124904644 9.12257538133719 1479.0 10.058091778486174 0.0 - - - - - - - 208.3846153846154 2 13 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 587 75 C20140704_OR005_02 C20140704_OR005_02 TB412519.[MT7]-GMAAVPK[MT7].2y3_1.heavy 481.291 / 487.336 2218.0 22.24815034866333 44 18 10 6 10 1.6325011382617791 38.54833784948892 0.03899955749511719 3 0.981754124904644 9.12257538133719 2218.0 10.496851648853566 1.0 - - - - - - - 266.9166666666667 4 12 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 589 75 C20140704_OR005_02 C20140704_OR005_02 TB412519.[MT7]-GMAAVPK[MT7].2b5_1.heavy 481.291 / 574.314 5998.0 22.24815034866333 44 18 10 6 10 1.6325011382617791 38.54833784948892 0.03899955749511719 3 0.981754124904644 9.12257538133719 5998.0 44.863089430894306 0.0 - - - - - - - 219.0 11 9 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 591 76 C20140704_OR005_02 C20140704_OR005_02 TB413199.[MT7]-GYGFVSFFNDVDVQK[MT7].2y8_1.heavy 1005.51 / 1108.58 1187.0 45.64204978942871 42 17 10 5 10 7.11825853758049 14.048379877192573 0.044498443603515625 3 0.970563850961534 7.175476511599328 1187.0 10.386249999999999 5.0 - - - - - - - 259.2 2 10 DAZL deleted in azoospermia-like 593 76 C20140704_OR005_02 C20140704_OR005_02 TB413199.[MT7]-GYGFVSFFNDVDVQK[MT7].2b4_1.heavy 1005.51 / 569.284 2373.0 45.64204978942871 42 17 10 5 10 7.11825853758049 14.048379877192573 0.044498443603515625 3 0.970563850961534 7.175476511599328 2373.0 15.841972222222221 0.0 - - - - - - - 240.0 4 9 DAZL deleted in azoospermia-like 595 76 C20140704_OR005_02 C20140704_OR005_02 TB413199.[MT7]-GYGFVSFFNDVDVQK[MT7].2y3_1.heavy 1005.51 / 518.342 1618.0 45.64204978942871 42 17 10 5 10 7.11825853758049 14.048379877192573 0.044498443603515625 3 0.970563850961534 7.175476511599328 1618.0 6.47949074074074 1.0 - - - - - - - 304.3636363636364 3 11 DAZL deleted in azoospermia-like 597 76 C20140704_OR005_02 C20140704_OR005_02 TB413199.[MT7]-GYGFVSFFNDVDVQK[MT7].2b5_1.heavy 1005.51 / 668.352 1402.0 45.64204978942871 42 17 10 5 10 7.11825853758049 14.048379877192573 0.044498443603515625 3 0.970563850961534 7.175476511599328 1402.0 10.259946402803545 0.0 - - - - - - - 172.8 2 5 DAZL deleted in azoospermia-like 599 77 C20140704_OR005_02 C20140704_OR005_02 TB413198.[MT7]-FFQPTEMAAQDFFQR.3y7_1.heavy 669.657 / 911.437 9396.0 45.20280075073242 50 20 10 10 10 11.282560702822966 8.863236160119163 0.0 3 0.996178240082984 19.956862175577925 9396.0 63.23374407582938 0.0 - - - - - - - 237.625 18 8 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 601 77 C20140704_OR005_02 C20140704_OR005_02 TB413198.[MT7]-FFQPTEMAAQDFFQR.3b6_1.heavy 669.657 / 894.448 10030.0 45.20280075073242 50 20 10 10 10 11.282560702822966 8.863236160119163 0.0 3 0.996178240082984 19.956862175577925 10030.0 59.89478672985783 0.0 - - - - - - - 221.8 20 10 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 603 77 C20140704_OR005_02 C20140704_OR005_02 TB413198.[MT7]-FFQPTEMAAQDFFQR.3y4_1.heavy 669.657 / 597.314 9291.0 45.20280075073242 50 20 10 10 10 11.282560702822966 8.863236160119163 0.0 3 0.996178240082984 19.956862175577925 9291.0 31.251569141030316 0.0 - - - - - - - 185.0 18 12 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 605 77 C20140704_OR005_02 C20140704_OR005_02 TB413198.[MT7]-FFQPTEMAAQDFFQR.3b3_1.heavy 669.657 / 567.305 25338.0 45.20280075073242 50 20 10 10 10 11.282560702822966 8.863236160119163 0.0 3 0.996178240082984 19.956862175577925 25338.0 70.82112440191388 0.0 - - - - - - - 229.0 50 6 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 607 78 C20140704_OR005_02 C20140704_OR005_02 TB426888.[MT7]-MDETEIR.2y4_1.heavy 519.256 / 518.293 4759.0 23.325000286102295 41 15 10 6 10 1.6379632006895648 40.70095508775821 0.03280067443847656 3 0.9591732755409152 6.0869726008722855 4759.0 0.5332212885154061 1.0 - - - - - - - 170.0 9 7 DAZL deleted in azoospermia-like 609 78 C20140704_OR005_02 C20140704_OR005_02 TB426888.[MT7]-MDETEIR.2y5_1.heavy 519.256 / 647.336 7224.0 23.325000286102295 41 15 10 6 10 1.6379632006895648 40.70095508775821 0.03280067443847656 3 0.9591732755409152 6.0869726008722855 7224.0 44.61882352941176 0.0 - - - - - - - 221.0 14 10 DAZL deleted in azoospermia-like 611 78 C20140704_OR005_02 C20140704_OR005_02 TB426888.[MT7]-MDETEIR.2y6_1.heavy 519.256 / 762.363 5694.0 23.325000286102295 41 15 10 6 10 1.6379632006895648 40.70095508775821 0.03280067443847656 3 0.9591732755409152 6.0869726008722855 5694.0 28.972411764705882 0.0 - - - - - - - 195.5 11 10 DAZL deleted in azoospermia-like 613 78 C20140704_OR005_02 C20140704_OR005_02 TB426888.[MT7]-MDETEIR.2b5_1.heavy 519.256 / 750.31 9178.0 23.325000286102295 41 15 10 6 10 1.6379632006895648 40.70095508775821 0.03280067443847656 3 0.9591732755409152 6.0869726008722855 9178.0 71.9843137254902 0.0 - - - - - - - 198.33333333333334 18 9 DAZL deleted in azoospermia-like 615 79 C20140704_OR005_02 C20140704_OR005_02 TB426889.[MT7]-IC[CAM]GFLQR.2y5_1.heavy 519.288 / 620.352 5430.0 33.685298919677734 39 13 8 10 8 2.5016764924514776 39.97319409673415 0.0 4 0.9294896905760159 4.620091348952319 5430.0 23.605541486370612 0.0 - - - - - - - 242.375 10 8 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 617 79 C20140704_OR005_02 C20140704_OR005_02 TB426889.[MT7]-IC[CAM]GFLQR.2b4_1.heavy 519.288 / 622.314 7499.0 33.685298919677734 39 13 8 10 8 2.5016764924514776 39.97319409673415 0.0 4 0.9294896905760159 4.620091348952319 7499.0 21.757253384912957 0.0 - - - - - - - 258.6666666666667 14 3 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 619 79 C20140704_OR005_02 C20140704_OR005_02 TB426889.[MT7]-IC[CAM]GFLQR.2y6_1.heavy 519.288 / 780.382 8792.0 33.685298919677734 39 13 8 10 8 2.5016764924514776 39.97319409673415 0.0 4 0.9294896905760159 4.620091348952319 8792.0 32.409154312056806 2.0 - - - - - - - 280.5 27 6 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 621 79 C20140704_OR005_02 C20140704_OR005_02 TB426889.[MT7]-IC[CAM]GFLQR.2b5_1.heavy 519.288 / 735.398 2456.0 33.685298919677734 39 13 8 10 8 2.5016764924514776 39.97319409673415 0.0 4 0.9294896905760159 4.620091348952319 2456.0 12.429285295910683 1.0 - - - - - - - 233.0 4 5 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 623 80 C20140704_OR005_02 C20140704_OR005_02 TB427484.[MT7]-TFTHSSSSHSQEMLGK[MT7].4y5_1.heavy 513.757 / 721.404 3085.0 21.854300498962402 44 18 10 6 10 3.852443972078238 25.957548175854207 0.03800010681152344 3 0.9838843339851757 9.708525245172234 3085.0 6.5723004147729975 0.0 - - - - - - - 179.77777777777777 6 9 ZBTB44 zinc finger and BTB domain containing 44 625 80 C20140704_OR005_02 C20140704_OR005_02 TB427484.[MT7]-TFTHSSSSHSQEMLGK[MT7].4y4_1.heavy 513.757 / 592.361 6171.0 21.854300498962402 44 18 10 6 10 3.852443972078238 25.957548175854207 0.03800010681152344 3 0.9838843339851757 9.708525245172234 6171.0 19.991065704320476 0.0 - - - - - - - 205.66666666666666 12 9 ZBTB44 zinc finger and BTB domain containing 44 627 80 C20140704_OR005_02 C20140704_OR005_02 TB427484.[MT7]-TFTHSSSSHSQEMLGK[MT7].4y7_1.heavy 513.757 / 936.494 1003.0 21.854300498962402 44 18 10 6 10 3.852443972078238 25.957548175854207 0.03800010681152344 3 0.9838843339851757 9.708525245172234 1003.0 2.4165544041450775 0.0 - - - - - - - 192.75 2 4 ZBTB44 zinc finger and BTB domain containing 44 629 80 C20140704_OR005_02 C20140704_OR005_02 TB427484.[MT7]-TFTHSSSSHSQEMLGK[MT7].4y3_1.heavy 513.757 / 461.32 17509.0 21.854300498962402 44 18 10 6 10 3.852443972078238 25.957548175854207 0.03800010681152344 3 0.9838843339851757 9.708525245172234 17509.0 125.60051242922393 0.0 - - - - - - - 223.7 35 10 ZBTB44 zinc finger and BTB domain containing 44 631 81 C20140704_OR005_02 C20140704_OR005_02 TB427227.[MT7]-TSPQELSEELSR.2y4_1.heavy 760.39 / 504.278 589.0 31.941749572753906 34 13 10 5 6 1.9316464912169353 51.769306886479065 0.0420989990234375 5 0.9032000518824904 3.934210702390102 589.0 0.7499647143968263 9.0 - - - - - - - 0.0 1 0 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 633 81 C20140704_OR005_02 C20140704_OR005_02 TB427227.[MT7]-TSPQELSEELSR.2y8_1.heavy 760.39 / 962.479 1767.0 31.941749572753906 34 13 10 5 6 1.9316464912169353 51.769306886479065 0.0420989990234375 5 0.9032000518824904 3.934210702390102 1767.0 5.9919485532088315 0.0 - - - - - - - 196.66666666666666 3 6 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 635 81 C20140704_OR005_02 C20140704_OR005_02 TB427227.[MT7]-TSPQELSEELSR.2y10_1.heavy 760.39 / 1187.59 1885.0 31.941749572753906 34 13 10 5 6 1.9316464912169353 51.769306886479065 0.0420989990234375 5 0.9032000518824904 3.934210702390102 1885.0 10.955654853620956 0.0 - - - - - - - 176.875 3 8 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 637 81 C20140704_OR005_02 C20140704_OR005_02 TB427227.[MT7]-TSPQELSEELSR.2y7_1.heavy 760.39 / 833.436 589.0 31.941749572753906 34 13 10 5 6 1.9316464912169353 51.769306886479065 0.0420989990234375 5 0.9032000518824904 3.934210702390102 589.0 2.085162663972141 11.0 - - - - - - - 319.7142857142857 3 7 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 639 82 C20140704_OR005_02 C20140704_OR005_02 TB450531.[MT7]-TPALVR.2y4_1.heavy 400.759 / 458.309 2036.0 23.366075038909912 38 20 9 3 6 3.8149444090434113 18.697439681995956 0.06569862365722656 5 0.9984602782356747 31.447455069488168 2036.0 0.3691749773345421 1.0 - - - - - - - 220.7 4 10 ENG endoglin 641 82 C20140704_OR005_02 C20140704_OR005_02 TB450531.[MT7]-TPALVR.2b3_1.heavy 400.759 / 414.247 1782.0 23.366075038909912 38 20 9 3 6 3.8149444090434113 18.697439681995956 0.06569862365722656 5 0.9984602782356747 31.447455069488168 1782.0 0.9693563009972801 3.0 - - - - - - - 731.875 5 8 ENG endoglin 643 82 C20140704_OR005_02 C20140704_OR005_02 TB450531.[MT7]-TPALVR.2y5_1.heavy 400.759 / 555.361 14339.0 23.366075038909912 38 20 9 3 6 3.8149444090434113 18.697439681995956 0.06569862365722656 5 0.9984602782356747 31.447455069488168 14339.0 165.32023529411765 1.0 - - - - - - - 206.0 35 7 ENG endoglin 645 82 C20140704_OR005_02 C20140704_OR005_02 TB450531.[MT7]-TPALVR.2b4_1.heavy 400.759 / 527.331 1697.0 23.366075038909912 38 20 9 3 6 3.8149444090434113 18.697439681995956 0.06569862365722656 5 0.9984602782356747 31.447455069488168 1697.0 5.323921568627451 2.0 - - - - - - - 228.125 3 16 ENG endoglin 647 83 C20140704_OR005_02 C20140704_OR005_02 TB426884.[MT7]-VAILAEK[MT7].2y4_1.heavy 516.339 / 604.379 6365.0 30.162399291992188 34 16 2 10 6 2.3699186221932846 36.6365465983297 0.0 5 0.962988727132369 6.395090484102027 6365.0 10.583521712045421 0.0 - - - - - - - 330.57142857142856 12 7 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 649 83 C20140704_OR005_02 C20140704_OR005_02 TB426884.[MT7]-VAILAEK[MT7].2y5_1.heavy 516.339 / 717.463 1967.0 30.162399291992188 34 16 2 10 6 2.3699186221932846 36.6365465983297 0.0 5 0.962988727132369 6.395090484102027 1967.0 24.624203239289447 2.0 - - - - - - - 173.66666666666666 3 6 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 651 83 C20140704_OR005_02 C20140704_OR005_02 TB426884.[MT7]-VAILAEK[MT7].2y3_1.heavy 516.339 / 491.295 2777.0 30.162399291992188 34 16 2 10 6 2.3699186221932846 36.6365465983297 0.0 5 0.962988727132369 6.395090484102027 2777.0 11.204147195497086 2.0 - - - - - - - 210.45454545454547 33 11 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 653 83 C20140704_OR005_02 C20140704_OR005_02 TB426884.[MT7]-VAILAEK[MT7].2y6_1.heavy 516.339 / 788.5 3240.0 30.162399291992188 34 16 2 10 6 2.3699186221932846 36.6365465983297 0.0 5 0.962988727132369 6.395090484102027 3240.0 20.883554458500463 0.0 - - - - - - - 231.5 6 4 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 655 84 C20140704_OR005_02 C20140704_OR005_02 TB427482.[MT7]-GPITSAAELNDPQSILLR.2b8_1.heavy 1020.07 / 871.464 771.0 40.468499183654785 39 16 10 3 10 3.1383881554893405 31.86349012472866 0.06509780883789062 3 0.9605227164357429 6.190839632757391 771.0 9.251165584415585 0.0 - - - - - - - 0.0 1 0 ENG endoglin 657 84 C20140704_OR005_02 C20140704_OR005_02 TB427482.[MT7]-GPITSAAELNDPQSILLR.2b6_1.heavy 1020.07 / 671.385 1252.0 40.468499183654785 39 16 10 3 10 3.1383881554893405 31.86349012472866 0.06509780883789062 3 0.9605227164357429 6.190839632757391 1252.0 0.7430267062314541 0.0 - - - - - - - 231.4 2 10 ENG endoglin 659 84 C20140704_OR005_02 C20140704_OR005_02 TB427482.[MT7]-GPITSAAELNDPQSILLR.2y10_1.heavy 1020.07 / 1168.67 482.0 40.468499183654785 39 16 10 3 10 3.1383881554893405 31.86349012472866 0.06509780883789062 3 0.9605227164357429 6.190839632757391 482.0 2.2476683937823836 18.0 - - - - - - - 0.0 1 0 ENG endoglin 661 84 C20140704_OR005_02 C20140704_OR005_02 TB427482.[MT7]-GPITSAAELNDPQSILLR.2y7_1.heavy 1020.07 / 826.515 3276.0 40.468499183654785 39 16 10 3 10 3.1383881554893405 31.86349012472866 0.06509780883789062 3 0.9605227164357429 6.190839632757391 3276.0 7.668727272727272 1.0 - - - - - - - 248.83333333333334 6 12 ENG endoglin 663 85 C20140704_OR005_02 C20140704_OR005_02 TB427480.[MT7]-EIVHK[MT7]PGPITLTVAK[MT7].2y4_1.heavy 1018.14 / 562.368 213.0 29.696500778198242 40 10 10 10 10 1.700810045824182 43.55084706107022 0.0 3 0.8413313101671281 3.0563254040399745 213.0 1.608490566037736 4.0 - - - - - - - 0.0 1 0 DVL3 dishevelled, dsh homolog 3 (Drosophila) 665 85 C20140704_OR005_02 C20140704_OR005_02 TB427480.[MT7]-EIVHK[MT7]PGPITLTVAK[MT7].2y10_1.heavy 1018.14 / 1140.71 1595.0 29.696500778198242 40 10 10 10 10 1.700810045824182 43.55084706107022 0.0 3 0.8413313101671281 3.0563254040399745 1595.0 20.047169811320757 0.0 - - - - - - - 319.0 3 1 DVL3 dishevelled, dsh homolog 3 (Drosophila) 667 85 C20140704_OR005_02 C20140704_OR005_02 TB427480.[MT7]-EIVHK[MT7]PGPITLTVAK[MT7].2b5_1.heavy 1018.14 / 895.56 3402.0 29.696500778198242 40 10 10 10 10 1.700810045824182 43.55084706107022 0.0 3 0.8413313101671281 3.0563254040399745 3402.0 20.774654515327256 0.0 - - - - - - - 372.0 6 2 DVL3 dishevelled, dsh homolog 3 (Drosophila) 669 85 C20140704_OR005_02 C20140704_OR005_02 TB427480.[MT7]-EIVHK[MT7]PGPITLTVAK[MT7].2y9_1.heavy 1018.14 / 1043.66 532.0 29.696500778198242 40 10 10 10 10 1.700810045824182 43.55084706107022 0.0 3 0.8413313101671281 3.0563254040399745 532.0 2.158903557184276 0.0 - - - - - - - 0.0 1 0 DVL3 dishevelled, dsh homolog 3 (Drosophila) 671 86 C20140704_OR005_02 C20140704_OR005_02 TB412927.[MT7]-SFLLRNPNDK[MT7].3y3_1.heavy 497.956 / 520.285 2047.0 28.29605007171631 33 16 4 5 8 2.2400033559195025 36.83786029683672 0.04210090637207031 4 0.9632450154884687 6.417486815196804 2047.0 19.531285048221243 0.0 - - - - - - - 255.66666666666666 4 6 F2R coagulation factor II (thrombin) receptor 673 86 C20140704_OR005_02 C20140704_OR005_02 TB412927.[MT7]-SFLLRNPNDK[MT7].3y4_1.heavy 497.956 / 617.338 4708.0 28.29605007171631 33 16 4 5 8 2.2400033559195025 36.83786029683672 0.04210090637207031 4 0.9632450154884687 6.417486815196804 4708.0 10.995037832519 0.0 - - - - - - - 204.5 9 6 F2R coagulation factor II (thrombin) receptor 675 86 C20140704_OR005_02 C20140704_OR005_02 TB412927.[MT7]-SFLLRNPNDK[MT7].3y9_2.heavy 497.956 / 630.863 3275.0 28.29605007171631 33 16 4 5 8 2.2400033559195025 36.83786029683672 0.04210090637207031 4 0.9632450154884687 6.417486815196804 3275.0 35.306866336278105 2.0 - - - - - - - 184.0 15 5 F2R coagulation factor II (thrombin) receptor 677 86 C20140704_OR005_02 C20140704_OR005_02 TB412927.[MT7]-SFLLRNPNDK[MT7].3y5_1.heavy 497.956 / 731.38 2047.0 28.29605007171631 33 16 4 5 8 2.2400033559195025 36.83786029683672 0.04210090637207031 4 0.9632450154884687 6.417486815196804 2047.0 11.984779344512194 2.0 - - - - - - - 190.14285714285714 4 7 F2R coagulation factor II (thrombin) receptor 679 87 C20140704_OR005_02 C20140704_OR005_02 TB412614.[MT7]-YASNLLK[MT7].2y5_1.heavy 548.834 / 718.458 2565.0 29.61520004272461 44 14 10 10 10 2.7943750204140834 35.786177327473226 0.0 3 0.9416172114768107 5.082577647226673 2565.0 15.262149532710282 0.0 - - - - - - - 229.28571428571428 5 7 DVL3 dishevelled, dsh homolog 3 (Drosophila) 681 87 C20140704_OR005_02 C20140704_OR005_02 TB412614.[MT7]-YASNLLK[MT7].2b4_1.heavy 548.834 / 580.285 4490.0 29.61520004272461 44 14 10 10 10 2.7943750204140834 35.786177327473226 0.0 3 0.9416172114768107 5.082577647226673 4490.0 10.653938612127465 0.0 - - - - - - - 233.45454545454547 8 11 DVL3 dishevelled, dsh homolog 3 (Drosophila) 683 87 C20140704_OR005_02 C20140704_OR005_02 TB412614.[MT7]-YASNLLK[MT7].2y6_1.heavy 548.834 / 789.495 8338.0 29.61520004272461 44 14 10 10 10 2.7943750204140834 35.786177327473226 0.0 3 0.9416172114768107 5.082577647226673 8338.0 61.820685358255446 0.0 - - - - - - - 259.85714285714283 16 7 DVL3 dishevelled, dsh homolog 3 (Drosophila) 685 87 C20140704_OR005_02 C20140704_OR005_02 TB412614.[MT7]-YASNLLK[MT7].2b5_1.heavy 548.834 / 693.369 2245.0 29.61520004272461 44 14 10 10 10 2.7943750204140834 35.786177327473226 0.0 3 0.9416172114768107 5.082577647226673 2245.0 7.30563449678937 1.0 - - - - - - - 291.8181818181818 5 11 DVL3 dishevelled, dsh homolog 3 (Drosophila) 687 88 C20140704_OR005_02 C20140704_OR005_02 TB427222.[MT7]-THIDTVINALK[MT7].2y4_1.heavy 756.953 / 589.379 N/A 33.77009963989258 42 18 4 10 10 3.880940375876294 22.06832291133534 0.0 3 0.986955195019907 10.793699773092692 3713.0 9.013055047071129 1.0 - - - - - - - 219.42857142857142 14 7 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 689 88 C20140704_OR005_02 C20140704_OR005_02 TB427222.[MT7]-THIDTVINALK[MT7].2y8_1.heavy 756.953 / 1017.61 4225.0 33.77009963989258 42 18 4 10 10 3.880940375876294 22.06832291133534 0.0 3 0.986955195019907 10.793699773092692 4225.0 45.880859375 0.0 - - - - - - - 184.88888888888889 8 9 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 691 88 C20140704_OR005_02 C20140704_OR005_02 TB427222.[MT7]-THIDTVINALK[MT7].2y5_1.heavy 756.953 / 702.463 2433.0 33.77009963989258 42 18 4 10 10 3.880940375876294 22.06832291133534 0.0 3 0.986955195019907 10.793699773092692 2433.0 5.430803571428571 0.0 - - - - - - - 213.33333333333334 4 9 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 693 88 C20140704_OR005_02 C20140704_OR005_02 TB427222.[MT7]-THIDTVINALK[MT7].2b4_1.heavy 756.953 / 611.327 1920.0 33.77009963989258 42 18 4 10 10 3.880940375876294 22.06832291133534 0.0 3 0.986955195019907 10.793699773092692 1920.0 10.95 0.0 - - - - - - - 272.0 3 8 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 695 89 C20140704_OR005_02 C20140704_OR005_02 TB412714.[MT7]-IQIWERK[MT7].3y6_2.heavy 420.927 / 502.294 6804.0 29.513466517130535 40 15 10 5 10 2.129684943503846 46.9553021469344 0.044200897216796875 3 0.9550086659239858 5.796369248787641 6804.0 60.69295774647887 0.0 - - - - - - - 167.14285714285714 13 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 697 89 C20140704_OR005_02 C20140704_OR005_02 TB412714.[MT7]-IQIWERK[MT7].3y5_1.heavy 420.927 / 875.522 N/A 29.513466517130535 40 15 10 5 10 2.129684943503846 46.9553021469344 0.044200897216796875 3 0.9550086659239858 5.796369248787641 106.0 1.6 9.0 - - - - - - - 0.0 0 0 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 699 89 C20140704_OR005_02 C20140704_OR005_02 TB412714.[MT7]-IQIWERK[MT7].3b3_1.heavy 420.927 / 499.336 4997.0 29.513466517130535 40 15 10 5 10 2.129684943503846 46.9553021469344 0.044200897216796875 3 0.9550086659239858 5.796369248787641 4997.0 37.418849765258216 0.0 - - - - - - - 200.77777777777777 9 9 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 701 89 C20140704_OR005_02 C20140704_OR005_02 TB412714.[MT7]-IQIWERK[MT7].3y4_1.heavy 420.927 / 762.438 1382.0 29.513466517130535 40 15 10 5 10 2.129684943503846 46.9553021469344 0.044200897216796875 3 0.9550086659239858 5.796369248787641 1382.0 19.51951049694393 0.0 - - - - - - - 283.6666666666667 2 3 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 703 90 C20140704_OR005_02 C20140704_OR005_02 TB427220.[MT7]-LPDTPQGLLGEAR.3y7_1.heavy 504.283 / 715.41 1879.0 37.73139953613281 50 20 10 10 10 8.725421822726927 11.460763964388754 0.0 3 0.9945782990979039 16.75321565238112 1879.0 1.8995003168045272 2.0 - - - - - - - 205.25 3 4 ENG endoglin 705 90 C20140704_OR005_02 C20140704_OR005_02 TB427220.[MT7]-LPDTPQGLLGEAR.3b4_1.heavy 504.283 / 571.321 1526.0 37.73139953613281 50 20 10 10 10 8.725421822726927 11.460763964388754 0.0 3 0.9945782990979039 16.75321565238112 1526.0 6.069318181818182 1.0 - - - - - - - 211.1 3 10 ENG endoglin 707 90 C20140704_OR005_02 C20140704_OR005_02 TB427220.[MT7]-LPDTPQGLLGEAR.3b7_1.heavy 504.283 / 853.454 587.0 37.73139953613281 50 20 10 10 10 8.725421822726927 11.460763964388754 0.0 3 0.9945782990979039 16.75321565238112 587.0 3.297872340425532 1.0 - - - - - - - 0.0 1 0 ENG endoglin 709 90 C20140704_OR005_02 C20140704_OR005_02 TB427220.[MT7]-LPDTPQGLLGEAR.3y5_1.heavy 504.283 / 545.304 1996.0 37.73139953613281 50 20 10 10 10 8.725421822726927 11.460763964388754 0.0 3 0.9945782990979039 16.75321565238112 1996.0 4.324381793030762 0.0 - - - - - - - 274.0 3 9 ENG endoglin 711 91 C20140704_OR005_02 C20140704_OR005_02 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 893512.0 34.99599838256836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 893512.0 734.9518866371162 0.0 - - - - - - - 1456.0 1787 1 713 91 C20140704_OR005_02 C20140704_OR005_02 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 160733.0 34.99599838256836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 160733.0 1183.4757317859446 0.0 - - - - - - - 718.7142857142857 321 7 715 91 C20140704_OR005_02 C20140704_OR005_02 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 202703.0 34.99599838256836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 202703.0 9.5165847037676 1.0 - - - - - - - 297.75 496 4 717 92 C20140704_OR005_02 C20140704_OR005_02 TB427618.[MT7]-AHMVTLDYTVQVPGAGQDGSPGLSK[MT7].3b4_1.heavy 939.488 / 583.314 5704.0 35.56209945678711 47 17 10 10 10 4.834119485516469 20.686290502253932 0.0 3 0.9753751250018823 7.848381359062464 5704.0 60.54542318059299 0.0 - - - - - - - 238.8 11 5 GNMT glycine N-methyltransferase 719 92 C20140704_OR005_02 C20140704_OR005_02 TB427618.[MT7]-AHMVTLDYTVQVPGAGQDGSPGLSK[MT7].3b8_1.heavy 939.488 / 1075.54 4510.0 35.56209945678711 47 17 10 10 10 4.834119485516469 20.686290502253932 0.0 3 0.9753751250018823 7.848381359062464 4510.0 20.812835403432253 0.0 - - - - - - - 212.2 9 5 GNMT glycine N-methyltransferase 721 92 C20140704_OR005_02 C20140704_OR005_02 TB427618.[MT7]-AHMVTLDYTVQVPGAGQDGSPGLSK[MT7].3b7_1.heavy 939.488 / 912.473 6367.0 35.56209945678711 47 17 10 10 10 4.834119485516469 20.686290502253932 0.0 3 0.9753751250018823 7.848381359062464 6367.0 57.41677531399119 0.0 - - - - - - - 177.16666666666666 12 6 GNMT glycine N-methyltransferase 723 92 C20140704_OR005_02 C20140704_OR005_02 TB427618.[MT7]-AHMVTLDYTVQVPGAGQDGSPGLSK[MT7].3y5_1.heavy 939.488 / 645.405 12602.0 35.56209945678711 47 17 10 10 10 4.834119485516469 20.686290502253932 0.0 3 0.9753751250018823 7.848381359062464 12602.0 111.76391514986562 0.0 - - - - - - - 221.0 25 6 GNMT glycine N-methyltransferase 725 93 C20140704_OR005_02 C20140704_OR005_02 TB413306.[MT7]-DGDGIFSPGGAISNMYSIMAAR.2b4_1.heavy 1187.57 / 489.206 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 727 93 C20140704_OR005_02 C20140704_OR005_02 TB413306.[MT7]-DGDGIFSPGGAISNMYSIMAAR.2b6_1.heavy 1187.57 / 749.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 729 93 C20140704_OR005_02 C20140704_OR005_02 TB413306.[MT7]-DGDGIFSPGGAISNMYSIMAAR.2b7_1.heavy 1187.57 / 836.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 731 93 C20140704_OR005_02 C20140704_OR005_02 TB413306.[MT7]-DGDGIFSPGGAISNMYSIMAAR.2b5_1.heavy 1187.57 / 602.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 733 94 C20140704_OR005_02 C20140704_OR005_02 TB427488.[MT7]-FQPVVQLFDDNGYVK[MT7].3b6_1.heavy 686.37 / 843.484 1139.0 43.681400299072266 35 14 10 5 6 1.4410851390277188 54.82534866367216 0.0417022705078125 5 0.9478343748659388 5.379772430400265 1139.0 5.5668167202572345 1.0 - - - - - - - 276.3333333333333 2 12 C1orf101 chromosome 1 open reading frame 101 735 94 C20140704_OR005_02 C20140704_OR005_02 TB427488.[MT7]-FQPVVQLFDDNGYVK[MT7].3b4_1.heavy 686.37 / 616.357 1657.0 43.681400299072266 35 14 10 5 6 1.4410851390277188 54.82534866367216 0.0417022705078125 5 0.9478343748659388 5.379772430400265 1657.0 8.617525699472601 1.0 - - - - - - - 236.78571428571428 3 14 C1orf101 chromosome 1 open reading frame 101 737 94 C20140704_OR005_02 C20140704_OR005_02 TB427488.[MT7]-FQPVVQLFDDNGYVK[MT7].3b5_1.heavy 686.37 / 715.426 725.0 43.681400299072266 35 14 10 5 6 1.4410851390277188 54.82534866367216 0.0417022705078125 5 0.9478343748659388 5.379772430400265 725.0 3.3890940630071063 14.0 - - - - - - - 0.0 1 0 C1orf101 chromosome 1 open reading frame 101 739 94 C20140704_OR005_02 C20140704_OR005_02 TB427488.[MT7]-FQPVVQLFDDNGYVK[MT7].3y4_1.heavy 686.37 / 610.368 N/A 43.681400299072266 35 14 10 5 6 1.4410851390277188 54.82534866367216 0.0417022705078125 5 0.9478343748659388 5.379772430400265 725.0 0.19466214675208887 14.0 - - - - - - - 0.0 1 0 C1orf101 chromosome 1 open reading frame 101 741 95 C20140704_OR005_02 C20140704_OR005_02 TB426787.[MT7]-ELANIR.2b3_1.heavy 430.26 / 458.273 8065.0 24.52560043334961 43 13 10 10 10 1.8523309206489087 42.208710514344574 0.0 3 0.9236576421466033 4.4378963877586965 8065.0 49.887624711579086 0.0 - - - - - - - 215.69230769230768 16 13 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 743 95 C20140704_OR005_02 C20140704_OR005_02 TB426787.[MT7]-ELANIR.2y5_1.heavy 430.26 / 586.367 14114.0 24.52560043334961 43 13 10 10 10 1.8523309206489087 42.208710514344574 0.0 3 0.9236576421466033 4.4378963877586965 14114.0 21.143481793455635 0.0 - - - - - - - 271.8 28 10 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 745 95 C20140704_OR005_02 C20140704_OR005_02 TB426787.[MT7]-ELANIR.2b4_1.heavy 430.26 / 572.316 23407.0 24.52560043334961 43 13 10 10 10 1.8523309206489087 42.208710514344574 0.0 3 0.9236576421466033 4.4378963877586965 23407.0 58.38178423236514 0.0 - - - - - - - 651.2857142857143 46 7 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 747 95 C20140704_OR005_02 C20140704_OR005_02 TB426787.[MT7]-ELANIR.2b5_1.heavy 430.26 / 685.4 2104.0 24.52560043334961 43 13 10 10 10 1.8523309206489087 42.208710514344574 0.0 3 0.9236576421466033 4.4378963877586965 2104.0 6.197720797720798 0.0 - - - - - - - 282.55555555555554 4 9 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 749 96 C20140704_OR005_02 C20140704_OR005_02 TB413308.[MT7]-YFTSDGLPIGDLQPLPIQK[MT7].3y6_1.heavy 797.445 / 839.547 10748.0 44.36750030517578 46 16 10 10 10 4.023479853219831 20.591481294987076 0.0 3 0.9613441759164089 6.256707887637261 10748.0 107.10424110910188 0.0 - - - - - - - 256.0 21 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 751 96 C20140704_OR005_02 C20140704_OR005_02 TB413308.[MT7]-YFTSDGLPIGDLQPLPIQK[MT7].3b6_1.heavy 797.445 / 815.369 6955.0 44.36750030517578 46 16 10 10 10 4.023479853219831 20.591481294987076 0.0 3 0.9613441759164089 6.256707887637261 6955.0 46.14691943127962 0.0 - - - - - - - 295.2 13 10 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 753 96 C20140704_OR005_02 C20140704_OR005_02 TB413308.[MT7]-YFTSDGLPIGDLQPLPIQK[MT7].3y4_1.heavy 797.445 / 629.41 12224.0 44.36750030517578 46 16 10 10 10 4.023479853219831 20.591481294987076 0.0 3 0.9613441759164089 6.256707887637261 12224.0 5.991144247737761 1.0 - - - - - - - 255.85714285714286 25 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 755 96 C20140704_OR005_02 C20140704_OR005_02 TB413308.[MT7]-YFTSDGLPIGDLQPLPIQK[MT7].3b7_1.heavy 797.445 / 928.453 8009.0 44.36750030517578 46 16 10 10 10 4.023479853219831 20.591481294987076 0.0 3 0.9613441759164089 6.256707887637261 8009.0 45.572838802567645 0.0 - - - - - - - 181.9090909090909 16 11 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 757 97 C20140704_OR005_02 C20140704_OR005_02 TB412742.[MT7]-DGLVQLSLHR.3y5_1.heavy 427.918 / 625.378 838.0 31.92087459564209 39 17 10 2 10 5.394223794403288 18.538348391061156 0.08349990844726562 3 0.9776868514775788 8.246526861901593 838.0 6.2869452181987 1.0 - - - - - - - 0.0 1 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 759 97 C20140704_OR005_02 C20140704_OR005_02 TB412742.[MT7]-DGLVQLSLHR.3b4_1.heavy 427.918 / 529.31 1796.0 31.92087459564209 39 17 10 2 10 5.394223794403288 18.538348391061156 0.08349990844726562 3 0.9776868514775788 8.246526861901593 1796.0 7.663431800560208 0.0 - - - - - - - 326.45454545454544 3 11 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 761 97 C20140704_OR005_02 C20140704_OR005_02 TB412742.[MT7]-DGLVQLSLHR.3b5_1.heavy 427.918 / 657.369 599.0 31.92087459564209 39 17 10 2 10 5.394223794403288 18.538348391061156 0.08349990844726562 3 0.9776868514775788 8.246526861901593 599.0 6.449483960948395 0.0 - - - - - - - 0.0 1 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 763 97 C20140704_OR005_02 C20140704_OR005_02 TB412742.[MT7]-DGLVQLSLHR.3y4_1.heavy 427.918 / 512.294 1915.0 31.92087459564209 39 17 10 2 10 5.394223794403288 18.538348391061156 0.08349990844726562 3 0.9776868514775788 8.246526861901593 1915.0 13.086633249791145 0.0 - - - - - - - 263.2 3 5 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 765 98 C20140704_OR005_02 C20140704_OR005_02 TB413163.[MT7]-FGFEISFPEFC[CAM]LK[MT7].3y3_1.heavy 636.998 / 564.33 3070.0 50.39580154418945 48 18 10 10 10 5.009557241300973 19.961843968076945 0.0 3 0.9824842863435115 9.31134656029252 3070.0 13.751671961630588 0.0 - - - - - - - 218.84615384615384 6 13 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 767 98 C20140704_OR005_02 C20140704_OR005_02 TB413163.[MT7]-FGFEISFPEFC[CAM]LK[MT7].3y6_1.heavy 636.998 / 937.493 4118.0 50.39580154418945 48 18 10 10 10 5.009557241300973 19.961843968076945 0.0 3 0.9824842863435115 9.31134656029252 4118.0 49.416 0.0 - - - - - - - 140.5 8 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 769 98 C20140704_OR005_02 C20140704_OR005_02 TB413163.[MT7]-FGFEISFPEFC[CAM]LK[MT7].3b4_1.heavy 636.998 / 625.31 6439.0 50.39580154418945 48 18 10 10 10 5.009557241300973 19.961843968076945 0.0 3 0.9824842863435115 9.31134656029252 6439.0 164.8384 0.0 - - - - - - - 116.66666666666667 12 9 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 771 98 C20140704_OR005_02 C20140704_OR005_02 TB413163.[MT7]-FGFEISFPEFC[CAM]LK[MT7].3y4_1.heavy 636.998 / 711.398 4343.0 50.39580154418945 48 18 10 10 10 5.009557241300973 19.961843968076945 0.0 3 0.9824842863435115 9.31134656029252 4343.0 67.68301627647715 0.0 - - - - - - - 149.83333333333334 8 6 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 773 99 C20140704_OR005_02 C20140704_OR005_02 TB413168.[MT7]-WVIEEANWMTLDK[MT7].3b4_1.heavy 641.669 / 672.384 4847.0 44.99420166015625 39 11 10 10 8 1.716317821801225 58.264267101213775 0.0 4 0.8550508169395071 3.201572537965461 4847.0 22.429680841058435 0.0 - - - - - - - 188.07142857142858 9 14 GNMT glycine N-methyltransferase 775 99 C20140704_OR005_02 C20140704_OR005_02 TB413168.[MT7]-WVIEEANWMTLDK[MT7].3b5_1.heavy 641.669 / 801.426 6006.0 44.99420166015625 39 11 10 10 8 1.716317821801225 58.264267101213775 0.0 4 0.8550508169395071 3.201572537965461 6006.0 53.51317535545024 1.0 - - - - - - - 228.25 21 12 GNMT glycine N-methyltransferase 777 99 C20140704_OR005_02 C20140704_OR005_02 TB413168.[MT7]-WVIEEANWMTLDK[MT7].3b3_1.heavy 641.669 / 543.341 7376.0 44.99420166015625 39 11 10 10 8 1.716317821801225 58.264267101213775 0.0 4 0.8550508169395071 3.201572537965461 7376.0 56.01494318795368 0.0 - - - - - - - 217.66666666666666 14 15 GNMT glycine N-methyltransferase 779 99 C20140704_OR005_02 C20140704_OR005_02 TB413168.[MT7]-WVIEEANWMTLDK[MT7].3y4_1.heavy 641.669 / 620.374 21497.0 44.99420166015625 39 11 10 10 8 1.716317821801225 58.264267101213775 0.0 4 0.8550508169395071 3.201572537965461 21497.0 87.88279090649729 0.0 - - - - - - - 257.55555555555554 42 9 GNMT glycine N-methyltransferase 781 100 C20140704_OR005_02 C20140704_OR005_02 TB413165.[MT7]-NYDHILSTGC[CAM]APPGK[MT7].4y4_1.heavy 480.249 / 542.342 2788.0 27.888099670410156 28 12 9 1 6 1.23545245896061 72.13440797890927 0.12459945678710938 5 0.8983066215805413 3.8367634094842438 2788.0 5.7566701666340405 1.0 - - - - - - - 365.1666666666667 6 12 GNMT glycine N-methyltransferase 783 100 C20140704_OR005_02 C20140704_OR005_02 TB413165.[MT7]-NYDHILSTGC[CAM]APPGK[MT7].4b14_2.heavy 480.249 / 814.386 896.0 27.888099670410156 28 12 9 1 6 1.23545245896061 72.13440797890927 0.12459945678710938 5 0.8983066215805413 3.8367634094842438 896.0 11.179323076923076 0.0 - - - - - - - 0.0 1 0 GNMT glycine N-methyltransferase 785 100 C20140704_OR005_02 C20140704_OR005_02 TB413165.[MT7]-NYDHILSTGC[CAM]APPGK[MT7].4b3_1.heavy 480.249 / 537.242 2887.0 27.888099670410156 28 12 9 1 6 1.23545245896061 72.13440797890927 0.12459945678710938 5 0.8983066215805413 3.8367634094842438 2887.0 32.703101204819276 0.0 - - - - - - - 354.1111111111111 5 9 GNMT glycine N-methyltransferase 787 100 C20140704_OR005_02 C20140704_OR005_02 TB413165.[MT7]-NYDHILSTGC[CAM]APPGK[MT7].4b4_1.heavy 480.249 / 674.302 4281.0 27.888099670410156 28 12 9 1 6 1.23545245896061 72.13440797890927 0.12459945678710938 5 0.8983066215805413 3.8367634094842438 4281.0 46.13775581061693 1.0 - - - - - - - 249.0 9 6 GNMT glycine N-methyltransferase 789 101 C20140704_OR005_02 C20140704_OR005_02 TB413062.[MT7]-NLLSC[CAM]ENSDRDAR.3b11_2.heavy 565.273 / 724.831 25299.0 22.91355037689209 36 10 10 6 10 1.6810768294578555 59.48568099189722 0.03429985046386719 3 0.8446030662691673 3.089226050220409 25299.0 39.026757463510926 0.0 - - - - - - - 226.42857142857142 50 7 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 791 101 C20140704_OR005_02 C20140704_OR005_02 TB413062.[MT7]-NLLSC[CAM]ENSDRDAR.3b4_1.heavy 565.273 / 572.352 2672.0 22.91355037689209 36 10 10 6 10 1.6810768294578555 59.48568099189722 0.03429985046386719 3 0.8446030662691673 3.089226050220409 2672.0 12.877108433734941 0.0 - - - - - - - 187.66666666666666 5 12 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 793 101 C20140704_OR005_02 C20140704_OR005_02 TB413062.[MT7]-NLLSC[CAM]ENSDRDAR.3y11_2.heavy 565.273 / 661.791 3089.0 22.91355037689209 36 10 10 6 10 1.6810768294578555 59.48568099189722 0.03429985046386719 3 0.8446030662691673 3.089226050220409 3089.0 15.87903645945519 0.0 - - - - - - - 200.0 6 10 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 795 101 C20140704_OR005_02 C20140704_OR005_02 TB413062.[MT7]-NLLSC[CAM]ENSDRDAR.3y12_2.heavy 565.273 / 718.333 5845.0 22.91355037689209 36 10 10 6 10 1.6810768294578555 59.48568099189722 0.03429985046386719 3 0.8446030662691673 3.089226050220409 5845.0 21.525 0.0 - - - - - - - 250.11111111111111 11 9 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 797 102 C20140704_OR005_02 C20140704_OR005_02 TB413060.[MT7]-TGTLSC[CAM]TVALRPK[MT7].3y7_1.heavy 564.662 / 928.606 3571.0 27.289466222127277 44 18 10 6 10 3.7857362475834977 21.106334835772113 0.03849983215332031 3 0.9897990495808805 12.20877736898486 3571.0 19.83888888888889 0.0 - - - - - - - 169.85714285714286 7 7 ENG endoglin 799 102 C20140704_OR005_02 C20140704_OR005_02 TB413060.[MT7]-TGTLSC[CAM]TVALRPK[MT7].3y8_1.heavy 564.662 / 1088.64 2777.0 27.289466222127277 44 18 10 6 10 3.7857362475834977 21.106334835772113 0.03849983215332031 3 0.9897990495808805 12.20877736898486 2777.0 10.626428880710112 0.0 - - - - - - - 255.14285714285714 5 7 ENG endoglin 801 102 C20140704_OR005_02 C20140704_OR005_02 TB413060.[MT7]-TGTLSC[CAM]TVALRPK[MT7].3y5_1.heavy 564.662 / 728.49 3868.0 27.289466222127277 44 18 10 6 10 3.7857362475834977 21.106334835772113 0.03849983215332031 3 0.9897990495808805 12.20877736898486 3868.0 35.74969696969697 0.0 - - - - - - - 231.33333333333334 7 9 ENG endoglin 803 102 C20140704_OR005_02 C20140704_OR005_02 TB413060.[MT7]-TGTLSC[CAM]TVALRPK[MT7].3y9_1.heavy 564.662 / 1175.67 N/A 27.289466222127277 44 18 10 6 10 3.7857362475834977 21.106334835772113 0.03849983215332031 3 0.9897990495808805 12.20877736898486 0.0 0.0 6.0 - - - - - - - 0.0 0 0 ENG endoglin 805 103 C20140704_OR005_02 C20140704_OR005_02 TB412604.[MT7]-AWLLGLLR.2b3_1.heavy 543.351 / 515.31 29549.0 49.76219940185547 41 15 10 6 10 2.5655524048695666 38.97796038396808 0.0352020263671875 3 0.9522440856362789 5.624774405966973 29549.0 370.3481038246947 0.0 - - - - - - - 189.28571428571428 59 7 GNMT glycine N-methyltransferase 807 103 C20140704_OR005_02 C20140704_OR005_02 TB412604.[MT7]-AWLLGLLR.2y5_1.heavy 543.351 / 571.393 35591.0 49.76219940185547 41 15 10 6 10 2.5655524048695666 38.97796038396808 0.0352020263671875 3 0.9522440856362789 5.624774405966973 35591.0 268.5118288698837 0.0 - - - - - - - 217.375 71 8 GNMT glycine N-methyltransferase 809 103 C20140704_OR005_02 C20140704_OR005_02 TB412604.[MT7]-AWLLGLLR.2y6_1.heavy 543.351 / 684.477 20775.0 49.76219940185547 41 15 10 6 10 2.5655524048695666 38.97796038396808 0.0352020263671875 3 0.9522440856362789 5.624774405966973 20775.0 286.76502384158994 0.0 - - - - - - - 276.0 41 6 GNMT glycine N-methyltransferase 811 103 C20140704_OR005_02 C20140704_OR005_02 TB412604.[MT7]-AWLLGLLR.2y7_1.heavy 543.351 / 870.556 43537.0 49.76219940185547 41 15 10 6 10 2.5655524048695666 38.97796038396808 0.0352020263671875 3 0.9522440856362789 5.624774405966973 43537.0 207.79159589415062 0.0 - - - - - - - 189.42857142857142 87 7 GNMT glycine N-methyltransferase 813 104 C20140704_OR005_02 C20140704_OR005_02 TB426996.[MT7]-FWLMWK[MT7].2b3_1.heavy 599.838 / 591.341 4470.0 47.212501525878906 45 15 10 10 10 1.6676080877394226 43.293698209199206 0.0 3 0.9507787236534341 5.539725688023692 4470.0 10.756604179947965 0.0 - - - - - - - 203.4 8 5 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 815 104 C20140704_OR005_02 C20140704_OR005_02 TB426996.[MT7]-FWLMWK[MT7].2y4_1.heavy 599.838 / 721.419 5384.0 47.212501525878906 45 15 10 10 10 1.6676080877394226 43.293698209199206 0.0 3 0.9507787236534341 5.539725688023692 5384.0 19.776551293439933 0.0 - - - - - - - 220.16666666666666 10 6 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 817 104 C20140704_OR005_02 C20140704_OR005_02 TB426996.[MT7]-FWLMWK[MT7].2y5_1.heavy 599.838 / 907.498 5892.0 47.212501525878906 45 15 10 10 10 1.6676080877394226 43.293698209199206 0.0 3 0.9507787236534341 5.539725688023692 5892.0 94.73411764705881 0.0 - - - - - - - 183.2 11 5 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 819 104 C20140704_OR005_02 C20140704_OR005_02 TB426996.[MT7]-FWLMWK[MT7].2y3_1.heavy 599.838 / 608.335 5384.0 47.212501525878906 45 15 10 10 10 1.6676080877394226 43.293698209199206 0.0 3 0.9507787236534341 5.539725688023692 5384.0 43.20243688928369 0.0 - - - - - - - 203.28571428571428 10 7 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 821 105 C20140704_OR005_02 C20140704_OR005_02 TB412936.[MT7]-ANHPMDAEVTK[MT7].3y7_1.heavy 500.929 / 937.478 753.0 20.33639907836914 46 16 10 10 10 3.187580120772333 31.371760461277614 0.0 3 0.9666203841260813 6.73606380705917 753.0 14.08228837876614 0.0 - - - - - - - 0.0 1 0 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 823 105 C20140704_OR005_02 C20140704_OR005_02 TB412936.[MT7]-ANHPMDAEVTK[MT7].3y6_1.heavy 500.929 / 806.438 2465.0 20.33639907836914 46 16 10 10 10 3.187580120772333 31.371760461277614 0.0 3 0.9666203841260813 6.73606380705917 2465.0 43.457602339181285 0.0 - - - - - - - 205.0 4 1 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 825 105 C20140704_OR005_02 C20140704_OR005_02 TB412936.[MT7]-ANHPMDAEVTK[MT7].3y4_1.heavy 500.929 / 620.374 2260.0 20.33639907836914 46 16 10 10 10 3.187580120772333 31.371760461277614 0.0 3 0.9666203841260813 6.73606380705917 2260.0 15.434146341463414 0.0 - - - - - - - 205.0909090909091 4 11 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 827 105 C20140704_OR005_02 C20140704_OR005_02 TB412936.[MT7]-ANHPMDAEVTK[MT7].3y5_1.heavy 500.929 / 691.411 1849.0 20.33639907836914 46 16 10 10 10 3.187580120772333 31.371760461277614 0.0 3 0.9666203841260813 6.73606380705917 1849.0 0.7251070766643994 2.0 - - - - - - - 195.42857142857142 4 7 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 829 106 C20140704_OR005_02 C20140704_OR005_02 TB450928.[MT7]-SVYPVAGGPTFK[MT7].2y6_1.heavy 755.929 / 750.427 3223.0 32.02595138549805 39 14 10 5 10 3.6637579721217555 27.294379367010425 0.0420989990234375 2 0.9366940856461584 4.878901437783364 3223.0 11.14022878994102 0.0 - - - - - - - 299.9 6 10 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 831 106 C20140704_OR005_02 C20140704_OR005_02 TB450928.[MT7]-SVYPVAGGPTFK[MT7].2y4_1.heavy 755.929 / 636.384 2445.0 32.02595138549805 39 14 10 5 10 3.6637579721217555 27.294379367010425 0.0420989990234375 2 0.9366940856461584 4.878901437783364 2445.0 16.153153153153156 0.0 - - - - - - - 203.5 4 6 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 833 106 C20140704_OR005_02 C20140704_OR005_02 TB450928.[MT7]-SVYPVAGGPTFK[MT7].2y9_1.heavy 755.929 / 1017.58 12669.0 32.02595138549805 39 14 10 5 10 3.6637579721217555 27.294379367010425 0.0420989990234375 2 0.9366940856461584 4.878901437783364 12669.0 -0.44881170937421216 2.0 - - - - - - - 222.22222222222223 25 9 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 835 106 C20140704_OR005_02 C20140704_OR005_02 TB450928.[MT7]-SVYPVAGGPTFK[MT7].2y7_1.heavy 755.929 / 821.464 2223.0 32.02595138549805 39 14 10 5 10 3.6637579721217555 27.294379367010425 0.0420989990234375 2 0.9366940856461584 4.878901437783364 2223.0 20.227027027027027 1.0 - - - - - - - 133.2 4 5 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 837 107 C20140704_OR005_02 C20140704_OR005_02 TB412935.[MT7]-DIFGASDPYVK[MT7].2b3_1.heavy 750.403 / 520.289 2514.0 35.235198974609375 42 12 10 10 10 1.8990653397282988 52.657482556291136 0.0 3 0.8822177967943619 3.5601205079945655 2514.0 21.35795248558088 0.0 - - - - - - - 170.0 5 7 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 839 107 C20140704_OR005_02 C20140704_OR005_02 TB412935.[MT7]-DIFGASDPYVK[MT7].2y4_1.heavy 750.403 / 650.399 10718.0 35.235198974609375 42 12 10 10 10 1.8990653397282988 52.657482556291136 0.0 3 0.8822177967943619 3.5601205079945655 10718.0 101.97071330432792 0.0 - - - - - - - 245.85714285714286 21 7 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 841 107 C20140704_OR005_02 C20140704_OR005_02 TB412935.[MT7]-DIFGASDPYVK[MT7].2b4_1.heavy 750.403 / 577.31 1191.0 35.235198974609375 42 12 10 10 10 1.8990653397282988 52.657482556291136 0.0 3 0.8822177967943619 3.5601205079945655 1191.0 2.5500000000000003 1.0 - - - - - - - 264.6 3 5 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 843 107 C20140704_OR005_02 C20140704_OR005_02 TB412935.[MT7]-DIFGASDPYVK[MT7].2b7_1.heavy 750.403 / 850.406 9925.0 35.235198974609375 42 12 10 10 10 1.8990653397282988 52.657482556291136 0.0 3 0.8822177967943619 3.5601205079945655 9925.0 36.25 0.0 - - - - - - - 245.85714285714286 19 7 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 845 108 C20140704_OR005_02 C20140704_OR005_02 TB450564.[MT7]-EAHILR.2y4_1.heavy 441.768 / 538.346 847.0 19.495450019836426 40 18 8 6 8 4.00432249488213 24.973013569163978 0.039798736572265625 4 0.985884392158065 10.375293463366436 847.0 5.2043133553563 2.0 - - - - - - - 0.0 1 0 ENG endoglin 847 108 C20140704_OR005_02 C20140704_OR005_02 TB450564.[MT7]-EAHILR.2b3_1.heavy 441.768 / 482.248 2214.0 19.495450019836426 40 18 8 6 8 4.00432249488213 24.973013569163978 0.039798736572265625 4 0.985884392158065 10.375293463366436 2214.0 22.389784615384613 0.0 - - - - - - - 138.125 4 8 ENG endoglin 849 108 C20140704_OR005_02 C20140704_OR005_02 TB450564.[MT7]-EAHILR.2y5_1.heavy 441.768 / 609.383 3126.0 19.495450019836426 40 18 8 6 8 4.00432249488213 24.973013569163978 0.039798736572265625 4 0.985884392158065 10.375293463366436 3126.0 24.916142708824914 1.0 - - - - - - - 170.875 7 8 ENG endoglin 851 108 C20140704_OR005_02 C20140704_OR005_02 TB450564.[MT7]-EAHILR.2b4_1.heavy 441.768 / 595.332 1107.0 19.495450019836426 40 18 8 6 8 4.00432249488213 24.973013569163978 0.039798736572265625 4 0.985884392158065 10.375293463366436 1107.0 5.6712461538461545 0.0 - - - - - - - 147.33333333333334 2 15 ENG endoglin 853 109 C20140704_OR005_02 C20140704_OR005_02 TB412933.[MT7]-GDGGIYIGSIMK[MT7].3y3_1.heavy 500.277 / 535.339 373.0 36.98485088348389 36 15 10 5 6 2.954417859857307 33.84761558570791 0.044597625732421875 6 0.9587629852312294 6.056405294500547 373.0 0.9000008080612187 18.0 - - - - - - - 0.0 1 0 DVL1;DVL2;DVL3 dishevelled, dsh homolog 1 (Drosophila);dishevelled, dsh homolog 2 (Drosophila);dishevelled, dsh homolog 3 (Drosophila) 855 109 C20140704_OR005_02 C20140704_OR005_02 TB412933.[MT7]-GDGGIYIGSIMK[MT7].3b6_1.heavy 500.277 / 707.348 1368.0 36.98485088348389 36 15 10 5 6 2.954417859857307 33.84761558570791 0.044597625732421875 6 0.9587629852312294 6.056405294500547 1368.0 2.9999648140096857 1.0 - - - - - - - 290.1111111111111 2 9 DVL1;DVL2;DVL3 dishevelled, dsh homolog 1 (Drosophila);dishevelled, dsh homolog 2 (Drosophila);dishevelled, dsh homolog 3 (Drosophila) 857 109 C20140704_OR005_02 C20140704_OR005_02 TB412933.[MT7]-GDGGIYIGSIMK[MT7].3b5_1.heavy 500.277 / 544.285 3108.0 36.98485088348389 36 15 10 5 6 2.954417859857307 33.84761558570791 0.044597625732421875 6 0.9587629852312294 6.056405294500547 3108.0 21.219277108433737 1.0 - - - - - - - 207.16666666666666 6 6 DVL1;DVL2;DVL3 dishevelled, dsh homolog 1 (Drosophila);dishevelled, dsh homolog 2 (Drosophila);dishevelled, dsh homolog 3 (Drosophila) 859 109 C20140704_OR005_02 C20140704_OR005_02 TB412933.[MT7]-GDGGIYIGSIMK[MT7].3y5_1.heavy 500.277 / 679.393 870.0 36.98485088348389 36 15 10 5 6 2.954417859857307 33.84761558570791 0.044597625732421875 6 0.9587629852312294 6.056405294500547 870.0 8.530333823402232 5.0 - - - - - - - 0.0 1 0 DVL1;DVL2;DVL3 dishevelled, dsh homolog 1 (Drosophila);dishevelled, dsh homolog 2 (Drosophila);dishevelled, dsh homolog 3 (Drosophila) 861 110 C20140704_OR005_02 C20140704_OR005_02 TB426994.[MT7]-AGGLLVIDHR.2b8_1.heavy 597.857 / 883.537 9040.0 29.895700454711914 40 10 10 10 10 0.8588153349197221 77.02296297727955 0.0 3 0.8251811141498664 2.9075563808691283 9040.0 94.0 0.0 - - - - - - - 357.8333333333333 18 6 GNMT glycine N-methyltransferase 863 110 C20140704_OR005_02 C20140704_OR005_02 TB426994.[MT7]-AGGLLVIDHR.2y9_1.heavy 597.857 / 979.568 4068.0 29.895700454711914 40 10 10 10 10 0.8588153349197221 77.02296297727955 0.0 3 0.8251811141498664 2.9075563808691283 4068.0 18.9 0.0 - - - - - - - 197.75 8 12 GNMT glycine N-methyltransferase 865 110 C20140704_OR005_02 C20140704_OR005_02 TB426994.[MT7]-AGGLLVIDHR.2b6_1.heavy 597.857 / 655.426 4068.0 29.895700454711914 40 10 10 10 10 0.8588153349197221 77.02296297727955 0.0 3 0.8251811141498664 2.9075563808691283 4068.0 12.149999999999999 0.0 - - - - - - - 254.25 8 8 GNMT glycine N-methyltransferase 867 110 C20140704_OR005_02 C20140704_OR005_02 TB426994.[MT7]-AGGLLVIDHR.2b5_1.heavy 597.857 / 556.357 4859.0 29.895700454711914 40 10 10 10 10 0.8588153349197221 77.02296297727955 0.0 3 0.8251811141498664 2.9075563808691283 4859.0 9.088636363636363 0.0 - - - - - - - 238.55555555555554 9 9 GNMT glycine N-methyltransferase 869 111 C20140704_OR005_02 C20140704_OR005_02 TB450920.[MT7]-GTVGFENQINK[MT7].2y8_1.heavy 747.911 / 1093.58 2597.0 27.78420066833496 44 14 10 10 10 8.781329779796964 11.387796894960951 0.0 3 0.9491563389274663 5.449874133605146 2597.0 26.607741935483872 1.0 - - - - - - - 130.2 5 5 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 871 111 C20140704_OR005_02 C20140704_OR005_02 TB450920.[MT7]-GTVGFENQINK[MT7].2y5_1.heavy 747.911 / 760.443 1484.0 27.78420066833496 44 14 10 10 10 8.781329779796964 11.387796894960951 0.0 3 0.9491563389274663 5.449874133605146 1484.0 8.22071942446043 0.0 - - - - - - - 257.6666666666667 2 9 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 873 111 C20140704_OR005_02 C20140704_OR005_02 TB450920.[MT7]-GTVGFENQINK[MT7].2y3_1.heavy 747.911 / 518.342 2133.0 27.78420066833496 44 14 10 10 10 8.781329779796964 11.387796894960951 0.0 3 0.9491563389274663 5.449874133605146 2133.0 8.058667584968736 0.0 - - - - - - - 232.1 4 10 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 875 111 C20140704_OR005_02 C20140704_OR005_02 TB450920.[MT7]-GTVGFENQINK[MT7].2b7_1.heavy 747.911 / 849.422 649.0 27.78420066833496 44 14 10 10 10 8.781329779796964 11.387796894960951 0.0 3 0.9491563389274663 5.449874133605146 649.0 13.670870967741935 1.0 - - - - - - - 0.0 1 0 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 877 112 C20140704_OR005_02 C20140704_OR005_02 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 18755.0 22.58609962463379 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 18755.0 140.81708311643243 0.0 - - - - - - - 202.53846153846155 37 13 879 112 C20140704_OR005_02 C20140704_OR005_02 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 19858.0 22.58609962463379 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 19858.0 297.87 0.0 - - - - - - - 180.375 39 8 881 112 C20140704_OR005_02 C20140704_OR005_02 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 63308.0 22.58609962463379 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 63308.0 466.74133333333333 0.0 - - - - - - - 144.5 126 10 883 113 C20140704_OR005_02 C20140704_OR005_02 TB427210.[MT7]-GTVGFENQINK[MT7].3b6_1.heavy 498.943 / 735.379 6304.0 27.774025440216064 40 15 10 5 10 2.664282539662505 37.53355678736212 0.04070091247558594 3 0.9558679298038919 5.852951758301851 6304.0 46.00344 0.0 - - - - - - - 200.0 12 6 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 885 113 C20140704_OR005_02 C20140704_OR005_02 TB427210.[MT7]-GTVGFENQINK[MT7].3y3_1.heavy 498.943 / 518.342 15909.0 27.774025440216064 40 15 10 5 10 2.664282539662505 37.53355678736212 0.04070091247558594 3 0.9558679298038919 5.852951758301851 15909.0 42.272485714285715 0.0 - - - - - - - 275.0 31 12 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 887 113 C20140704_OR005_02 C20140704_OR005_02 TB427210.[MT7]-GTVGFENQINK[MT7].3b5_1.heavy 498.943 / 606.337 9906.0 27.774025440216064 40 15 10 5 10 2.664282539662505 37.53355678736212 0.04070091247558594 3 0.9558679298038919 5.852951758301851 9906.0 95.0976 0.0 - - - - - - - 144.44444444444446 19 9 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 889 113 C20140704_OR005_02 C20140704_OR005_02 TB427210.[MT7]-GTVGFENQINK[MT7].3b7_1.heavy 498.943 / 849.422 1101.0 27.774025440216064 40 15 10 5 10 2.664282539662505 37.53355678736212 0.04070091247558594 3 0.9558679298038919 5.852951758301851 1101.0 15.1938 0.0 - - - - - - - 200.0 2 7 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 891 114 C20140704_OR005_02 C20140704_OR005_02 TB427634.[MT7]-FRLSYYPHC[CAM]LASFTELLQAAFGGK[MT7].4y5_1.heavy 766.904 / 623.363 1960.0 52.50062656402588 35 9 10 6 10 0.6735806084394954 75.67000457891614 0.031299591064453125 3 0.8076584239223578 2.767612946257818 1960.0 -3.843137254901961 0.0 - - - - - - - 169.88888888888889 3 9 GNMT glycine N-methyltransferase 893 114 C20140704_OR005_02 C20140704_OR005_02 TB427634.[MT7]-FRLSYYPHC[CAM]LASFTELLQAAFGGK[MT7].4y4_1.heavy 766.904 / 552.326 3674.0 52.50062656402588 35 9 10 6 10 0.6735806084394954 75.67000457891614 0.031299591064453125 3 0.8076584239223578 2.767612946257818 3674.0 -0.4498775510204087 0.0 - - - - - - - 193.83333333333334 7 6 GNMT glycine N-methyltransferase 895 114 C20140704_OR005_02 C20140704_OR005_02 TB427634.[MT7]-FRLSYYPHC[CAM]LASFTELLQAAFGGK[MT7].4b5_1.heavy 766.904 / 811.458 919.0 52.50062656402588 35 9 10 6 10 0.6735806084394954 75.67000457891614 0.031299591064453125 3 0.8076584239223578 2.767612946257818 919.0 -0.30131147540983605 0.0 - - - - - - - 0.0 1 0 GNMT glycine N-methyltransferase 897 114 C20140704_OR005_02 C20140704_OR005_02 TB427634.[MT7]-FRLSYYPHC[CAM]LASFTELLQAAFGGK[MT7].4b6_1.heavy 766.904 / 974.522 1286.0 52.50062656402588 35 9 10 6 10 0.6735806084394954 75.67000457891614 0.031299591064453125 3 0.8076584239223578 2.767612946257818 1286.0 -4.216393442622951 0.0 - - - - - - - 78.42857142857143 2 7 GNMT glycine N-methyltransferase 899 115 C20140704_OR005_02 C20140704_OR005_02 TB451212.[MT7]-LSDLPSC[CAM]YMSDIEFELGLTNSTK[MT7].4y5_1.heavy 727.86 / 694.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 901 115 C20140704_OR005_02 C20140704_OR005_02 TB451212.[MT7]-LSDLPSC[CAM]YMSDIEFELGLTNSTK[MT7].4b4_1.heavy 727.86 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 903 115 C20140704_OR005_02 C20140704_OR005_02 TB451212.[MT7]-LSDLPSC[CAM]YMSDIEFELGLTNSTK[MT7].4y7_1.heavy 727.86 / 864.491 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 905 115 C20140704_OR005_02 C20140704_OR005_02 TB451212.[MT7]-LSDLPSC[CAM]YMSDIEFELGLTNSTK[MT7].4y6_1.heavy 727.86 / 807.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 907 116 C20140704_OR005_02 C20140704_OR005_02 TB426769.[MT7]-VDNLGR.2b3_1.heavy 409.236 / 473.248 2740.0 20.25 43 15 10 10 8 2.255022032084295 44.345464734803926 0.0 4 0.9584519093094426 6.033531327955295 2740.0 5.972896708885084 2.0 - - - - - - - 247.0 8 7 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 909 116 C20140704_OR005_02 C20140704_OR005_02 TB426769.[MT7]-VDNLGR.2y4_1.heavy 409.236 / 459.267 9517.0 20.25 43 15 10 10 8 2.255022032084295 44.345464734803926 0.0 4 0.9584519093094426 6.033531327955295 9517.0 72.2587037037037 0.0 - - - - - - - 222.63636363636363 19 11 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 911 116 C20140704_OR005_02 C20140704_OR005_02 TB426769.[MT7]-VDNLGR.2y5_1.heavy 409.236 / 574.294 7499.0 20.25 43 15 10 10 8 2.255022032084295 44.345464734803926 0.0 4 0.9584519093094426 6.033531327955295 7499.0 57.28402777777778 0.0 - - - - - - - 180.1 14 10 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 913 116 C20140704_OR005_02 C20140704_OR005_02 TB426769.[MT7]-VDNLGR.2b4_1.heavy 409.236 / 586.332 1082.0 20.25 43 15 10 10 8 2.255022032084295 44.345464734803926 0.0 4 0.9584519093094426 6.033531327955295 1082.0 5.2403433360367675 2.0 - - - - - - - 152.11111111111111 18 9 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 915 117 C20140704_OR005_02 C20140704_OR005_02 TB413176.[MT7]-IAEYLSANVVSLEDLR.2y9_1.heavy 968.529 / 1044.57 8133.0 47.46799850463867 42 12 10 10 10 7.956458594922991 12.56840575577304 0.0 3 0.8844611978253584 3.5952197950150278 8133.0 37.59928971962617 0.0 - - - - - - - 290.42857142857144 16 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 917 117 C20140704_OR005_02 C20140704_OR005_02 TB413176.[MT7]-IAEYLSANVVSLEDLR.2b4_1.heavy 968.529 / 621.336 16908.0 47.46799850463867 42 12 10 10 10 7.956458594922991 12.56840575577304 0.0 3 0.8844611978253584 3.5952197950150278 16908.0 130.52343925233646 0.0 - - - - - - - 214.0 33 9 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 919 117 C20140704_OR005_02 C20140704_OR005_02 TB413176.[MT7]-IAEYLSANVVSLEDLR.2b5_1.heavy 968.529 / 734.42 8026.0 47.46799850463867 42 12 10 10 10 7.956458594922991 12.56840575577304 0.0 3 0.8844611978253584 3.5952197950150278 8026.0 53.987976635514016 0.0 - - - - - - - 356.6666666666667 16 3 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 921 117 C20140704_OR005_02 C20140704_OR005_02 TB413176.[MT7]-IAEYLSANVVSLEDLR.2y11_1.heavy 968.529 / 1202.64 8026.0 47.46799850463867 42 12 10 10 10 7.956458594922991 12.56840575577304 0.0 3 0.8844611978253584 3.5952197950150278 8026.0 12.929266769398012 1.0 - - - - - - - 235.4 16 10 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 923 118 C20140704_OR005_02 C20140704_OR005_02 TB412949.[MT7]-THIDTVINALK[MT7].3b4_1.heavy 504.971 / 611.327 7191.0 33.77009963989258 42 20 2 10 10 7.719015551100561 12.955019890553558 0.0 3 0.9942557934235879 16.275683495980292 7191.0 14.639072302667318 0.0 - - - - - - - 275.0 14 7 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 925 118 C20140704_OR005_02 C20140704_OR005_02 TB412949.[MT7]-THIDTVINALK[MT7].3b5_1.heavy 504.971 / 712.375 4880.0 33.77009963989258 42 20 2 10 10 7.719015551100561 12.955019890553558 0.0 3 0.9942557934235879 16.275683495980292 4880.0 52.54426070038911 0.0 - - - - - - - 219.85714285714286 9 7 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 927 118 C20140704_OR005_02 C20140704_OR005_02 TB412949.[MT7]-THIDTVINALK[MT7].3y4_1.heavy 504.971 / 589.379 N/A 33.77009963989258 42 20 2 10 10 7.719015551100561 12.955019890553558 0.0 3 0.9942557934235879 16.275683495980292 18491.0 72.29329099953273 1.0 - - - - - - - 256.5 86 4 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 929 118 C20140704_OR005_02 C20140704_OR005_02 TB412949.[MT7]-THIDTVINALK[MT7].3y5_1.heavy 504.971 / 702.463 3210.0 33.77009963989258 42 20 2 10 10 7.719015551100561 12.955019890553558 0.0 3 0.9942557934235879 16.275683495980292 3210.0 24.916858986435567 1.0 - - - - - - - 224.5 7 4 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 931 119 C20140704_OR005_02 C20140704_OR005_02 TB412942.[MT7]-LPDTPQGLLGEAR.2y9_1.heavy 755.921 / 940.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 933 119 C20140704_OR005_02 C20140704_OR005_02 TB412942.[MT7]-LPDTPQGLLGEAR.2y10_1.heavy 755.921 / 1041.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 935 119 C20140704_OR005_02 C20140704_OR005_02 TB412942.[MT7]-LPDTPQGLLGEAR.2y11_1.heavy 755.921 / 1156.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 937 119 C20140704_OR005_02 C20140704_OR005_02 TB412942.[MT7]-LPDTPQGLLGEAR.2y7_1.heavy 755.921 / 715.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 939 120 C20140704_OR005_02 C20140704_OR005_02 TB450551.[MT7]-AIQC[CAM]GR.2b3_1.heavy 424.73 / 457.289 1001.0 15.863849639892578 39 16 10 7 6 4.064742643014148 24.601803553753783 0.02700042724609375 5 0.9679633390840523 6.876578917096965 1001.0 4.139834572045073 0.0 - - - - - - - 117.95 2 20 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 941 120 C20140704_OR005_02 C20140704_OR005_02 TB450551.[MT7]-AIQC[CAM]GR.2y4_1.heavy 424.73 / 520.23 2551.0 15.863849639892578 39 16 10 7 6 4.064742643014148 24.601803553753783 0.02700042724609375 5 0.9679633390840523 6.876578917096965 2551.0 28.699213010018873 0.0 - - - - - - - 108.42857142857143 5 14 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 943 120 C20140704_OR005_02 C20140704_OR005_02 TB450551.[MT7]-AIQC[CAM]GR.2y5_1.heavy 424.73 / 633.314 2971.0 15.863849639892578 39 16 10 7 6 4.064742643014148 24.601803553753783 0.02700042724609375 5 0.9679633390840523 6.876578917096965 2971.0 41.24322003577817 0.0 - - - - - - - 145.27777777777777 5 18 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 945 120 C20140704_OR005_02 C20140704_OR005_02 TB450551.[MT7]-AIQC[CAM]GR.2y3_1.heavy 424.73 / 392.171 1098.0 15.863849639892578 39 16 10 7 6 4.064742643014148 24.601803553753783 0.02700042724609375 5 0.9679633390840523 6.876578917096965 1098.0 6.469364245086039 2.0 - - - - - - - 158.10344827586206 3 29 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 947 121 C20140704_OR005_02 C20140704_OR005_02 TB427205.[MT7]-SFLLRNPNDK[MT7].2y4_1.heavy 746.43 / 617.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - F2R coagulation factor II (thrombin) receptor 949 121 C20140704_OR005_02 C20140704_OR005_02 TB427205.[MT7]-SFLLRNPNDK[MT7].2b9_2.heavy 746.43 / 601.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - F2R coagulation factor II (thrombin) receptor 951 121 C20140704_OR005_02 C20140704_OR005_02 TB427205.[MT7]-SFLLRNPNDK[MT7].2b5_1.heavy 746.43 / 761.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - F2R coagulation factor II (thrombin) receptor 953 121 C20140704_OR005_02 C20140704_OR005_02 TB427205.[MT7]-SFLLRNPNDK[MT7].2b9_1.heavy 746.43 / 1201.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - F2R coagulation factor II (thrombin) receptor 955 122 C20140704_OR005_02 C20140704_OR005_02 TB450553.[MT7]-ESADHR.2b3_1.heavy 429.713 / 432.221 470.0 11.335399627685547 50 20 10 10 10 5.345020233621978 18.709003077475053 0.0 3 0.9909378043205943 12.954394959382997 470.0 45.25055555555555 0.0 - - - - - - - 0.0 0 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 957 122 C20140704_OR005_02 C20140704_OR005_02 TB450553.[MT7]-ESADHR.2b5_1.heavy 429.713 / 684.307 145.0 11.335399627685547 50 20 10 10 10 5.345020233621978 18.709003077475053 0.0 3 0.9909378043205943 12.954394959382997 145.0 17.72222222222222 0.0 - - - - - - - 0.0 0 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 959 122 C20140704_OR005_02 C20140704_OR005_02 TB450553.[MT7]-ESADHR.2y5_1.heavy 429.713 / 585.274 334.0 11.335399627685547 50 20 10 10 10 5.345020233621978 18.709003077475053 0.0 3 0.9909378043205943 12.954394959382997 334.0 19.174074074074078 0.0 - - - - - - - 0.0 0 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 961 122 C20140704_OR005_02 C20140704_OR005_02 TB450553.[MT7]-ESADHR.2b4_1.heavy 429.713 / 547.248 3776.0 11.335399627685547 50 20 10 10 10 5.345020233621978 18.709003077475053 0.0 3 0.9909378043205943 12.954394959382997 3776.0 57.817946805866264 0.0 - - - - - - - 82.52380952380952 7 21 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 963 123 C20140704_OR005_02 C20140704_OR005_02 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 94476.0 32.29719924926758 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 94476.0 388.90845366013787 0.0 - - - - - - - 226.0 188 6 965 123 C20140704_OR005_02 C20140704_OR005_02 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 99532.0 32.29719924926758 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 99532.0 424.6056992177292 0.0 - - - - - - - 193.57142857142858 199 7 967 123 C20140704_OR005_02 C20140704_OR005_02 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 176618.0 32.29719924926758 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 176618.0 363.40066913022173 0.0 - - - - - - - 320.8 353 5 969 124 C20140704_OR005_02 C20140704_OR005_02 TB427348.[MT7]-LQNPAITGPAVPYSR.2b3_1.heavy 864.482 / 500.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 971 124 C20140704_OR005_02 C20140704_OR005_02 TB427348.[MT7]-LQNPAITGPAVPYSR.2y8_1.heavy 864.482 / 846.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 973 124 C20140704_OR005_02 C20140704_OR005_02 TB427348.[MT7]-LQNPAITGPAVPYSR.2y12_1.heavy 864.482 / 1228.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 975 124 C20140704_OR005_02 C20140704_OR005_02 TB427348.[MT7]-LQNPAITGPAVPYSR.2y9_1.heavy 864.482 / 947.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 977 125 C20140704_OR005_02 C20140704_OR005_02 TB412803.[MT7]-GVLQRPSYK[MT7].2y4_1.heavy 668.403 / 638.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 979 125 C20140704_OR005_02 C20140704_OR005_02 TB412803.[MT7]-GVLQRPSYK[MT7].2b4_1.heavy 668.403 / 542.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 981 125 C20140704_OR005_02 C20140704_OR005_02 TB412803.[MT7]-GVLQRPSYK[MT7].2b5_1.heavy 668.403 / 698.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 983 125 C20140704_OR005_02 C20140704_OR005_02 TB412803.[MT7]-GVLQRPSYK[MT7].2y7_1.heavy 668.403 / 1035.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 985 126 C20140704_OR005_02 C20140704_OR005_02 TB427649.[MT7]-SLGVAAEGLPDQYADGEAARVWQLYIGDTR.4b8_1.heavy 842.177 / 829.454 4683.0 46.40312480926514 35 13 10 2 10 2.4073380520981447 33.78057152041696 0.08189773559570312 3 0.9031873816436985 3.9339489440689372 4683.0 36.94844036697248 0.0 - - - - - - - 171.28571428571428 9 7 GNMT glycine N-methyltransferase 987 126 C20140704_OR005_02 C20140704_OR005_02 TB427649.[MT7]-SLGVAAEGLPDQYADGEAARVWQLYIGDTR.4b5_1.heavy 842.177 / 572.352 3594.0 46.40312480926514 35 13 10 2 10 2.4073380520981447 33.78057152041696 0.08189773559570312 3 0.9031873816436985 3.9339489440689372 3594.0 14.829371559633028 0.0 - - - - - - - 327.0 7 8 GNMT glycine N-methyltransferase 989 126 C20140704_OR005_02 C20140704_OR005_02 TB427649.[MT7]-SLGVAAEGLPDQYADGEAARVWQLYIGDTR.4y21_2.heavy 842.177 / 1212.58 3049.0 46.40312480926514 35 13 10 2 10 2.4073380520981447 33.78057152041696 0.08189773559570312 3 0.9031873816436985 3.9339489440689372 3049.0 33.56697247706422 0.0 - - - - - - - 130.8 6 5 GNMT glycine N-methyltransferase 991 126 C20140704_OR005_02 C20140704_OR005_02 TB427649.[MT7]-SLGVAAEGLPDQYADGEAARVWQLYIGDTR.4b4_1.heavy 842.177 / 501.315 1634.0 46.40312480926514 35 13 10 2 10 2.4073380520981447 33.78057152041696 0.08189773559570312 3 0.9031873816436985 3.9339489440689372 1634.0 6.521009174311926 1.0 - - - - - - - 311.42857142857144 3 7 GNMT glycine N-methyltransferase 993 127 C20140704_OR005_02 C20140704_OR005_02 TB427443.[MT7]-IAEYLSANVVSLEDLR.3y7_1.heavy 646.022 / 831.457 26404.0 47.46799850463867 44 14 10 10 10 1.5686378026919918 42.764200625753546 0.0 3 0.9475527328352359 5.365179894876034 26404.0 271.84051282051286 0.0 - - - - - - - 259.0 52 6 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 995 127 C20140704_OR005_02 C20140704_OR005_02 TB427443.[MT7]-IAEYLSANVVSLEDLR.3y6_1.heavy 646.022 / 732.389 29511.0 47.46799850463867 44 14 10 10 10 1.5686378026919918 42.764200625753546 0.0 3 0.9475527328352359 5.365179894876034 29511.0 179.19956221889055 0.0 - - - - - - - 233.125 59 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 997 127 C20140704_OR005_02 C20140704_OR005_02 TB427443.[MT7]-IAEYLSANVVSLEDLR.3b4_1.heavy 646.022 / 621.336 17499.0 47.46799850463867 44 14 10 10 10 1.5686378026919918 42.764200625753546 0.0 3 0.9475527328352359 5.365179894876034 17499.0 56.44017458452241 0.0 - - - - - - - 233.0 34 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 999 127 C20140704_OR005_02 C20140704_OR005_02 TB427443.[MT7]-IAEYLSANVVSLEDLR.3b5_1.heavy 646.022 / 734.42 12218.0 47.46799850463867 44 14 10 10 10 1.5686378026919918 42.764200625753546 0.0 3 0.9475527328352359 5.365179894876034 12218.0 75.03659163987138 0.0 - - - - - - - 207.2 24 10 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1001 128 C20140704_OR005_02 C20140704_OR005_02 TB427585.[MT7]-LSFPFDLLSLPHFSGEQIVQR.3b6_1.heavy 858.799 / 851.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1003 128 C20140704_OR005_02 C20140704_OR005_02 TB427585.[MT7]-LSFPFDLLSLPHFSGEQIVQR.3y8_1.heavy 858.799 / 916.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1005 128 C20140704_OR005_02 C20140704_OR005_02 TB427585.[MT7]-LSFPFDLLSLPHFSGEQIVQR.3b7_1.heavy 858.799 / 964.526 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1007 128 C20140704_OR005_02 C20140704_OR005_02 TB427585.[MT7]-LSFPFDLLSLPHFSGEQIVQR.3y9_1.heavy 858.799 / 1063.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1009 129 C20140704_OR005_02 C20140704_OR005_02 TB427449.[MT7]-SLSSPTVTLSAPLEGAK[MT7].2y6_1.heavy 973.556 / 758.453 1177.0 35.57653299967448 33 8 10 5 10 0.8658060864685454 75.18479340109351 0.043300628662109375 3 0.7795619318938269 2.5786809571475664 1177.0 3.9206330037959365 1.0 - - - - - - - 218.33333333333334 2 3 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 1011 129 C20140704_OR005_02 C20140704_OR005_02 TB427449.[MT7]-SLSSPTVTLSAPLEGAK[MT7].2y8_1.heavy 973.556 / 916.522 N/A 35.57653299967448 33 8 10 5 10 0.8658060864685454 75.18479340109351 0.043300628662109375 3 0.7795619318938269 2.5786809571475664 1308.0 15.975572519083968 0.0 - - - - - - - 261.6666666666667 2 6 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 1013 129 C20140704_OR005_02 C20140704_OR005_02 TB427449.[MT7]-SLSSPTVTLSAPLEGAK[MT7].2y9_1.heavy 973.556 / 1029.61 915.0 35.57653299967448 33 8 10 5 10 0.8658060864685454 75.18479340109351 0.043300628662109375 3 0.7795619318938269 2.5786809571475664 915.0 9.56908396946565 1.0 - - - - - - - 0.0 1 0 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 1015 129 C20140704_OR005_02 C20140704_OR005_02 TB427449.[MT7]-SLSSPTVTLSAPLEGAK[MT7].2b4_1.heavy 973.556 / 519.289 2223.0 35.57653299967448 33 8 10 5 10 0.8658060864685454 75.18479340109351 0.043300628662109375 3 0.7795619318938269 2.5786809571475664 2223.0 15.272519083969465 1.0 - - - - - - - 205.85714285714286 4 7 NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 1017 130 C20140704_OR005_02 C20140704_OR005_02 TB427369.[MT7]-HSSIILNMELSLK[MT7].2b8_1.heavy 887.013 / 1040.57 395.0 40.11779975891113 25 13 2 6 4 1.1203971922632772 54.36208230726896 0.036602020263671875 7 0.9194335650046809 4.318425679427655 395.0 1.3393676493274662 34.0 - - - - - - - 288.61538461538464 8 13 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1019 130 C20140704_OR005_02 C20140704_OR005_02 TB427369.[MT7]-HSSIILNMELSLK[MT7].2y4_1.heavy 887.013 / 604.415 691.0 40.11779975891113 25 13 2 6 4 1.1203971922632772 54.36208230726896 0.036602020263671875 7 0.9194335650046809 4.318425679427655 691.0 2.7620812182741115 12.0 - - - - - - - 0.0 1 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1021 130 C20140704_OR005_02 C20140704_OR005_02 TB427369.[MT7]-HSSIILNMELSLK[MT7].2b4_1.heavy 887.013 / 569.316 1777.0 40.11779975891113 25 13 2 6 4 1.1203971922632772 54.36208230726896 0.036602020263671875 7 0.9194335650046809 4.318425679427655 1777.0 8.476527342765598 0.0 - - - - - - - 238.5 3 12 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1023 130 C20140704_OR005_02 C20140704_OR005_02 TB427369.[MT7]-HSSIILNMELSLK[MT7].2b6_1.heavy 887.013 / 795.484 1086.0 40.11779975891113 25 13 2 6 4 1.1203971922632772 54.36208230726896 0.036602020263671875 7 0.9194335650046809 4.318425679427655 1086.0 4.842972972972973 1.0 - - - - - - - 288.61538461538464 2 13 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1025 131 C20140704_OR005_02 C20140704_OR005_02 TB427362.[MT7]-LQTSPAPIQTTPPK[MT7].3b6_1.heavy 589.68 / 742.422 15838.0 27.581300735473633 46 20 10 10 6 5.768025105487217 17.336956440232612 0.0 5 0.9943757343112003 16.44847716961456 15838.0 159.66539107070557 0.0 - - - - - - - 216.42857142857142 31 7 ENG endoglin 1027 131 C20140704_OR005_02 C20140704_OR005_02 TB427362.[MT7]-LQTSPAPIQTTPPK[MT7].3b4_1.heavy 589.68 / 574.332 8675.0 27.581300735473633 46 20 10 10 6 5.768025105487217 17.336956440232612 0.0 5 0.9943757343112003 16.44847716961456 8675.0 23.081450530994296 0.0 - - - - - - - 743.875 17 8 ENG endoglin 1029 131 C20140704_OR005_02 C20140704_OR005_02 TB427362.[MT7]-LQTSPAPIQTTPPK[MT7].3b8_1.heavy 589.68 / 952.558 2925.0 27.581300735473633 46 20 10 10 6 5.768025105487217 17.336956440232612 0.0 5 0.9943757343112003 16.44847716961456 2925.0 5.386662140331984 1.0 - - - - - - - 168.33333333333334 5 9 ENG endoglin 1031 131 C20140704_OR005_02 C20140704_OR005_02 TB427362.[MT7]-LQTSPAPIQTTPPK[MT7].3y5_1.heavy 589.68 / 687.416 3127.0 27.581300735473633 46 20 10 10 6 5.768025105487217 17.336956440232612 0.0 5 0.9943757343112003 16.44847716961456 3127.0 8.078988646528204 3.0 - - - - - - - 202.0 13 10 ENG endoglin 1033 132 C20140704_OR005_02 C20140704_OR005_02 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 193519.0 26.480899810791016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 193519.0 59.64073321511862 0.0 - - - - - - - 1190.0 387 1 1035 132 C20140704_OR005_02 C20140704_OR005_02 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 240039.0 26.480899810791016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 240039.0 54.64231678355879 0.0 - - - - - - - 3472.0 480 1 1037 132 C20140704_OR005_02 C20140704_OR005_02 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 267415.0 26.480899810791016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 267415.0 42.361626691261 0.0 - - - - - - - 2281.0 534 1 1039 133 C20140704_OR005_02 C20140704_OR005_02 TB427268.[MT7]-QYDVSYDTGDK[MT7].2y4_1.heavy 789.88 / 564.311 1028.0 24.67317533493042 36 10 10 6 10 0.9275553955624197 64.73410119233904 0.03849983215332031 3 0.8401523019995149 3.0447152203484342 1028.0 8.918867918094556 1.0 - - - - - - - 222.8 2 5 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1041 133 C20140704_OR005_02 C20140704_OR005_02 TB427268.[MT7]-QYDVSYDTGDK[MT7].2b3_1.heavy 789.88 / 551.258 856.0 24.67317533493042 36 10 10 6 10 0.9275553955624197 64.73410119233904 0.03849983215332031 3 0.8401523019995149 3.0447152203484342 856.0 11.279072479490134 0.0 - - - - - - - 0.0 1 0 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1043 133 C20140704_OR005_02 C20140704_OR005_02 TB427268.[MT7]-QYDVSYDTGDK[MT7].2y8_1.heavy 789.88 / 1028.5 1456.0 24.67317533493042 36 10 10 6 10 0.9275553955624197 64.73410119233904 0.03849983215332031 3 0.8401523019995149 3.0447152203484342 1456.0 5.2121400778210125 1.0 - - - - - - - 183.57142857142858 2 7 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1045 133 C20140704_OR005_02 C20140704_OR005_02 TB427268.[MT7]-QYDVSYDTGDK[MT7].2y7_1.heavy 789.88 / 929.433 1113.0 24.67317533493042 36 10 10 6 10 0.9275553955624197 64.73410119233904 0.03849983215332031 3 0.8401523019995149 3.0447152203484342 1113.0 10.839511229435455 0.0 - - - - - - - 257.0 2 3 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1047 134 C20140704_OR005_02 C20140704_OR005_02 TB450813.[MT7]-EEISDDNAK[MT7].2y4_1.heavy 654.83 / 591.322 1818.0 18.840099334716797 48 18 10 10 10 4.19388267840251 23.844253086758012 0.0 3 0.9804316046481798 8.807933040098568 1818.0 7.2274377633090765 0.0 - - - - - - - 166.57142857142858 3 14 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1049 134 C20140704_OR005_02 C20140704_OR005_02 TB450813.[MT7]-EEISDDNAK[MT7].2y8_1.heavy 654.83 / 1035.51 932.0 18.840099334716797 48 18 10 10 10 4.19388267840251 23.844253086758012 0.0 3 0.9804316046481798 8.807933040098568 932.0 27.962132235186452 0.0 - - - - - - - 0.0 1 0 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1051 134 C20140704_OR005_02 C20140704_OR005_02 TB450813.[MT7]-EEISDDNAK[MT7].2b6_1.heavy 654.83 / 833.365 979.0 18.840099334716797 48 18 10 10 10 4.19388267840251 23.844253086758012 0.0 3 0.9804316046481798 8.807933040098568 979.0 29.8873850377488 0.0 - - - - - - - 0.0 1 0 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1053 134 C20140704_OR005_02 C20140704_OR005_02 TB450813.[MT7]-EEISDDNAK[MT7].2y6_1.heavy 654.83 / 793.381 1957.0 18.840099334716797 48 18 10 10 10 4.19388267840251 23.844253086758012 0.0 3 0.9804316046481798 8.807933040098568 1957.0 54.70287348432852 0.0 - - - - - - - 116.66666666666667 3 6 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1055 135 C20140704_OR005_02 C20140704_OR005_02 TB427440.[MT7]-STRDFPDDVISFIK[MT7].4y4_1.heavy 482.765 / 638.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1057 135 C20140704_OR005_02 C20140704_OR005_02 TB427440.[MT7]-STRDFPDDVISFIK[MT7].4b8_1.heavy 482.765 / 1078.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1059 135 C20140704_OR005_02 C20140704_OR005_02 TB427440.[MT7]-STRDFPDDVISFIK[MT7].4b8_2.heavy 482.765 / 539.75 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1061 135 C20140704_OR005_02 C20140704_OR005_02 TB427440.[MT7]-STRDFPDDVISFIK[MT7].4b4_1.heavy 482.765 / 604.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1063 136 C20140704_OR005_02 C20140704_OR005_02 TB427360.[MT7]-MVISNPAATQSDIDFLIEEIER.3y6_1.heavy 879.118 / 788.415 4233.0 53.29714870452881 48 20 10 8 10 16.105414496317287 6.209091981014602 0.019802093505859375 3 0.9983074476498242 29.99369978194519 4233.0 26.019406084217508 1.0 - - - - - - - 125.63157894736842 8 19 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1065 136 C20140704_OR005_02 C20140704_OR005_02 TB427360.[MT7]-MVISNPAATQSDIDFLIEEIER.3b5_1.heavy 879.118 / 689.377 13639.0 53.29714870452881 48 20 10 8 10 16.105414496317287 6.209091981014602 0.019802093505859375 3 0.9983074476498242 29.99369978194519 13639.0 32.75534831761094 1.0 - - - - - - - 158.6153846153846 27 26 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1067 136 C20140704_OR005_02 C20140704_OR005_02 TB427360.[MT7]-MVISNPAATQSDIDFLIEEIER.3y8_1.heavy 879.118 / 1048.57 4884.0 53.29714870452881 48 20 10 8 10 16.105414496317287 6.209091981014602 0.019802093505859375 3 0.9983074476498242 29.99369978194519 4884.0 0.42423802378019826 1.0 - - - - - - - 122.92 9 25 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1069 136 C20140704_OR005_02 C20140704_OR005_02 TB427360.[MT7]-MVISNPAATQSDIDFLIEEIER.3y9_1.heavy 879.118 / 1163.59 4993.0 53.29714870452881 48 20 10 8 10 16.105414496317287 6.209091981014602 0.019802093505859375 3 0.9983074476498242 29.99369978194519 4993.0 0.9857847976307994 0.0 - - - - - - - 113.92592592592592 9 27 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1071 137 C20140704_OR005_02 C20140704_OR005_02 TB427166.[MT7]-SNDFSIVGSLPR.3y6_1.heavy 479.26 / 628.378 3187.0 37.574100494384766 39 14 10 5 10 1.8541553639308646 44.60008084304201 0.0446014404296875 3 0.9406167110859055 5.039150219549492 3187.0 18.500805084745764 0.0 - - - - - - - 301.55555555555554 6 9 GLRB glycine receptor, beta 1073 137 C20140704_OR005_02 C20140704_OR005_02 TB427166.[MT7]-SNDFSIVGSLPR.3b4_1.heavy 479.26 / 608.28 590.0 37.574100494384766 39 14 10 5 10 1.8541553639308646 44.60008084304201 0.0446014404296875 3 0.9406167110859055 5.039150219549492 590.0 0.08333333333333331 5.0 - - - - - - - 222.88888888888889 2 9 GLRB glycine receptor, beta 1075 137 C20140704_OR005_02 C20140704_OR005_02 TB427166.[MT7]-SNDFSIVGSLPR.3b5_1.heavy 479.26 / 695.312 1062.0 37.574100494384766 39 14 10 5 10 1.8541553639308646 44.60008084304201 0.0446014404296875 3 0.9406167110859055 5.039150219549492 1062.0 17.991 0.0 - - - - - - - 118.0 2 1 GLRB glycine receptor, beta 1077 137 C20140704_OR005_02 C20140704_OR005_02 TB427166.[MT7]-SNDFSIVGSLPR.3y5_1.heavy 479.26 / 529.309 2833.0 37.574100494384766 39 14 10 5 10 1.8541553639308646 44.60008084304201 0.0446014404296875 3 0.9406167110859055 5.039150219549492 2833.0 19.00670903954802 0.0 - - - - - - - 236.0 5 6 GLRB glycine receptor, beta 1079 138 C20140704_OR005_02 C20140704_OR005_02 TB451139.[MT7]-WNMEEVVLEELQIFK[MT7].3b6_1.heavy 732.394 / 933.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1081 138 C20140704_OR005_02 C20140704_OR005_02 TB451139.[MT7]-WNMEEVVLEELQIFK[MT7].3b4_1.heavy 732.394 / 705.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1083 138 C20140704_OR005_02 C20140704_OR005_02 TB451139.[MT7]-WNMEEVVLEELQIFK[MT7].3b5_1.heavy 732.394 / 834.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1085 138 C20140704_OR005_02 C20140704_OR005_02 TB451139.[MT7]-WNMEEVVLEELQIFK[MT7].3b7_1.heavy 732.394 / 1032.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1087 139 C20140704_OR005_02 C20140704_OR005_02 TB427640.[MT7]-DVPQSAEGGFDAVIC[CAM]LGNSFAHLPDC[CAM]K[MT7].4y5_1.heavy 798.889 / 776.409 2873.0 47.4182014465332 44 14 10 10 10 2.3807628208719787 37.358595961005 0.0 3 0.9491628028704964 5.450223589719021 2873.0 33.6715532028154 0.0 - - - - - - - 186.125 5 8 GNMT glycine N-methyltransferase 1089 139 C20140704_OR005_02 C20140704_OR005_02 TB427640.[MT7]-DVPQSAEGGFDAVIC[CAM]LGNSFAHLPDC[CAM]K[MT7].4y4_1.heavy 798.889 / 663.325 6384.0 47.4182014465332 44 14 10 10 10 2.3807628208719787 37.358595961005 0.0 3 0.9491628028704964 5.450223589719021 6384.0 19.842526645768025 1.0 - - - - - - - 227.85714285714286 17 7 GNMT glycine N-methyltransferase 1091 139 C20140704_OR005_02 C20140704_OR005_02 TB427640.[MT7]-DVPQSAEGGFDAVIC[CAM]LGNSFAHLPDC[CAM]K[MT7].4b7_1.heavy 798.889 / 871.428 3937.0 47.4182014465332 44 14 10 10 10 2.3807628208719787 37.358595961005 0.0 3 0.9491628028704964 5.450223589719021 3937.0 34.56427230046948 0.0 - - - - - - - 255.6 7 5 GNMT glycine N-methyltransferase 1093 139 C20140704_OR005_02 C20140704_OR005_02 TB427640.[MT7]-DVPQSAEGGFDAVIC[CAM]LGNSFAHLPDC[CAM]K[MT7].4b4_1.heavy 798.889 / 584.316 2554.0 47.4182014465332 44 14 10 10 10 2.3807628208719787 37.358595961005 0.0 3 0.9491628028704964 5.450223589719021 2554.0 13.581527514091864 0.0 - - - - - - - 255.2 5 10 GNMT glycine N-methyltransferase 1095 140 C20140704_OR005_02 C20140704_OR005_02 TB450756.[MT7]-GLAVFISDIR.2y8_1.heavy 617.867 / 920.52 4043.0 44.770050048828125 42 17 10 5 10 4.98745770368723 20.050295349085353 0.04070281982421875 3 0.9729669885235324 7.48913937180073 4043.0 46.70282347304649 0.0 - - - - - - - 176.33333333333334 8 6 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1097 140 C20140704_OR005_02 C20140704_OR005_02 TB450756.[MT7]-GLAVFISDIR.2y6_1.heavy 617.867 / 750.414 10011.0 44.770050048828125 42 17 10 5 10 4.98745770368723 20.050295349085353 0.04070281982421875 3 0.9729669885235324 7.48913937180073 10011.0 39.59460330824598 0.0 - - - - - - - 336.8333333333333 20 6 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1099 140 C20140704_OR005_02 C20140704_OR005_02 TB450756.[MT7]-GLAVFISDIR.2b5_1.heavy 617.867 / 632.389 5968.0 44.770050048828125 42 17 10 5 10 4.98745770368723 20.050295349085353 0.04070281982421875 3 0.9729669885235324 7.48913937180073 5968.0 33.04083044982699 0.0 - - - - - - - 262.6363636363636 11 11 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1101 140 C20140704_OR005_02 C20140704_OR005_02 TB450756.[MT7]-GLAVFISDIR.2y7_1.heavy 617.867 / 849.483 5872.0 44.770050048828125 42 17 10 5 10 4.98745770368723 20.050295349085353 0.04070281982421875 3 0.9729669885235324 7.48913937180073 5872.0 76.92421416234889 0.0 - - - - - - - 204.625 11 8 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1103 141 C20140704_OR005_02 C20140704_OR005_02 TB413092.[MT7]-HFLDYFDAVIPK[MT7].3b4_1.heavy 584.99 / 657.348 9281.0 43.61280059814453 47 17 10 10 10 4.02338880648929 24.85466973480436 0.0 3 0.9792870993291567 8.560308587196898 9281.0 30.08022978444031 0.0 - - - - - - - 230.33333333333334 18 9 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1105 141 C20140704_OR005_02 C20140704_OR005_02 TB413092.[MT7]-HFLDYFDAVIPK[MT7].3b5_1.heavy 584.99 / 820.411 4542.0 43.61280059814453 47 17 10 10 10 4.02338880648929 24.85466973480436 0.0 3 0.9792870993291567 8.560308587196898 4542.0 54.71851433251433 0.0 - - - - - - - 217.2 9 5 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1107 141 C20140704_OR005_02 C20140704_OR005_02 TB413092.[MT7]-HFLDYFDAVIPK[MT7].3b8_1.heavy 584.99 / 1153.54 1481.0 43.61280059814453 47 17 10 10 10 4.02338880648929 24.85466973480436 0.0 3 0.9792870993291567 8.560308587196898 1481.0 14.217297020841325 0.0 - - - - - - - 246.875 2 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1109 141 C20140704_OR005_02 C20140704_OR005_02 TB413092.[MT7]-HFLDYFDAVIPK[MT7].3b7_1.heavy 584.99 / 1082.51 5036.0 43.61280059814453 47 17 10 10 10 4.02338880648929 24.85466973480436 0.0 3 0.9792870993291567 8.560308587196898 5036.0 58.010897640371326 0.0 - - - - - - - 225.71428571428572 10 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1111 142 C20140704_OR005_02 C20140704_OR005_02 TB427061.[MT7]-RHEPAFDK[MT7].2b3_1.heavy 644.356 / 567.312 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNMT glycine N-methyltransferase 1113 142 C20140704_OR005_02 C20140704_OR005_02 TB427061.[MT7]-RHEPAFDK[MT7].2y5_1.heavy 644.356 / 721.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNMT glycine N-methyltransferase 1115 142 C20140704_OR005_02 C20140704_OR005_02 TB427061.[MT7]-RHEPAFDK[MT7].2y3_1.heavy 644.356 / 553.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNMT glycine N-methyltransferase 1117 142 C20140704_OR005_02 C20140704_OR005_02 TB427061.[MT7]-RHEPAFDK[MT7].2b7_1.heavy 644.356 / 997.497 N/A N/A - - - - - - - - - 0.0 - - - - - - - GNMT glycine N-methyltransferase 1119 143 C20140704_OR005_02 C20140704_OR005_02 TB412850.[MT7]-DFLTPPLLSVR.2y8_1.heavy 701.415 / 882.541 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1121 143 C20140704_OR005_02 C20140704_OR005_02 TB412850.[MT7]-DFLTPPLLSVR.2y6_1.heavy 701.415 / 684.44 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1123 143 C20140704_OR005_02 C20140704_OR005_02 TB412850.[MT7]-DFLTPPLLSVR.2b5_1.heavy 701.415 / 718.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1125 143 C20140704_OR005_02 C20140704_OR005_02 TB412850.[MT7]-DFLTPPLLSVR.2y7_1.heavy 701.415 / 781.493 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1127 144 C20140704_OR005_02 C20140704_OR005_02 TB427643.[MT7]-TQILEWAAERGPITSAAELNDPQSILLR.4y5_1.heavy 809.94 / 601.403 4574.0 45.91365051269531 42 17 10 5 10 3.2595809162753926 30.678790485209507 0.04470062255859375 3 0.9732985843965203 7.535708739916293 4574.0 21.359321100917434 0.0 - - - - - - - 202.42857142857142 9 7 ENG endoglin 1129 144 C20140704_OR005_02 C20140704_OR005_02 TB427643.[MT7]-TQILEWAAERGPITSAAELNDPQSILLR.4y9_1.heavy 809.94 / 1055.58 9475.0 45.91365051269531 42 17 10 5 10 3.2595809162753926 30.678790485209507 0.04470062255859375 3 0.9732985843965203 7.535708739916293 9475.0 50.95850496161768 0.0 - - - - - - - 218.0 18 5 ENG endoglin 1131 144 C20140704_OR005_02 C20140704_OR005_02 TB427643.[MT7]-TQILEWAAERGPITSAAELNDPQSILLR.4b4_1.heavy 809.94 / 600.384 4029.0 45.91365051269531 42 17 10 5 10 3.2595809162753926 30.678790485209507 0.04470062255859375 3 0.9732985843965203 7.535708739916293 4029.0 5.947871484491534 0.0 - - - - - - - 677.5555555555555 8 9 ENG endoglin 1133 144 C20140704_OR005_02 C20140704_OR005_02 TB427643.[MT7]-TQILEWAAERGPITSAAELNDPQSILLR.4y7_1.heavy 809.94 / 826.515 17969.0 45.91365051269531 42 17 10 5 10 3.2595809162753926 30.678790485209507 0.04470062255859375 3 0.9732985843965203 7.535708739916293 17969.0 75.63247706422018 1.0 - - - - - - - 746.5714285714286 35 7 ENG endoglin 1135 145 C20140704_OR005_02 C20140704_OR005_02 TB427596.[MT7]-MVISNPAATQSDIDFLIEEIER.4y4_1.heavy 659.591 / 546.288 724.0 53.2823486328125 27 11 4 8 4 8.540483847735794 11.708938484382408 0.0196990966796875 9 0.8637449335691346 3.3046599657751354 724.0 -0.8390471226660943 10.0 - - - - - - - 139.53571428571428 4 28 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1137 145 C20140704_OR005_02 C20140704_OR005_02 TB427596.[MT7]-MVISNPAATQSDIDFLIEEIER.4y5_1.heavy 659.591 / 675.331 1302.0 53.2823486328125 27 11 4 8 4 8.540483847735794 11.708938484382408 0.0196990966796875 9 0.8637449335691346 3.3046599657751354 1302.0 1.2156481652222015 1.0 - - - - - - - 128.9375 2 16 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1139 145 C20140704_OR005_02 C20140704_OR005_02 TB427596.[MT7]-MVISNPAATQSDIDFLIEEIER.4b5_1.heavy 659.591 / 689.377 724.0 53.2823486328125 27 11 4 8 4 8.540483847735794 11.708938484382408 0.0196990966796875 9 0.8637449335691346 3.3046599657751354 724.0 -0.8718245605909734 3.0 - - - - - - - 0.0 1 0 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1141 145 C20140704_OR005_02 C20140704_OR005_02 TB427596.[MT7]-MVISNPAATQSDIDFLIEEIER.4y6_1.heavy 659.591 / 788.415 1411.0 53.2823486328125 27 11 4 8 4 8.540483847735794 11.708938484382408 0.0196990966796875 9 0.8637449335691346 3.3046599657751354 1411.0 22.820220467258967 1.0 - - - - - - - 129.7058823529412 2 17 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1143 146 C20140704_OR005_02 C20140704_OR005_02 TB427270.[MT7]-DFPDDVISFIK[MT7].3b6_1.heavy 528.623 / 833.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1145 146 C20140704_OR005_02 C20140704_OR005_02 TB427270.[MT7]-DFPDDVISFIK[MT7].3b4_1.heavy 528.623 / 619.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1147 146 C20140704_OR005_02 C20140704_OR005_02 TB427270.[MT7]-DFPDDVISFIK[MT7].3b5_1.heavy 528.623 / 734.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1149 146 C20140704_OR005_02 C20140704_OR005_02 TB427270.[MT7]-DFPDDVISFIK[MT7].3y4_1.heavy 528.623 / 638.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1151 147 C20140704_OR005_02 C20140704_OR005_02 TB427276.[MT7]-DVTTSVLIVNNK[MT7].2y4_1.heavy 795.969 / 618.369 8147.0 32.00490188598633 42 12 10 10 10 0.7874200360058804 72.72317239837585 0.0 3 0.8939775375171699 3.7562068851746484 8147.0 95.91583423850432 0.0 - - - - - - - 191.77777777777777 16 9 GNMT glycine N-methyltransferase 1153 147 C20140704_OR005_02 C20140704_OR005_02 TB427276.[MT7]-DVTTSVLIVNNK[MT7].2y5_1.heavy 795.969 / 731.453 3827.0 32.00490188598633 42 12 10 10 10 0.7874200360058804 72.72317239837585 0.0 3 0.8939775375171699 3.7562068851746484 3827.0 14.87417004048583 0.0 - - - - - - - 298.25 7 12 GNMT glycine N-methyltransferase 1155 147 C20140704_OR005_02 C20140704_OR005_02 TB427276.[MT7]-DVTTSVLIVNNK[MT7].2y3_1.heavy 795.969 / 519.301 3950.0 32.00490188598633 42 12 10 10 10 0.7874200360058804 72.72317239837585 0.0 3 0.8939775375171699 3.7562068851746484 3950.0 7.316194331983805 1.0 - - - - - - - 296.0 7 5 GNMT glycine N-methyltransferase 1157 147 C20140704_OR005_02 C20140704_OR005_02 TB427276.[MT7]-DVTTSVLIVNNK[MT7].2y6_1.heavy 795.969 / 844.537 9135.0 32.00490188598633 42 12 10 10 10 0.7874200360058804 72.72317239837585 0.0 3 0.8939775375171699 3.7562068851746484 9135.0 106.8080280438432 0.0 - - - - - - - 193.85714285714286 18 7 GNMT glycine N-methyltransferase 1159 148 C20140704_OR005_02 C20140704_OR005_02 TB427275.[MT7]-DVTTSVLIVNNK[MT7].3b6_1.heavy 530.982 / 747.401 18270.0 32.00490188598633 47 17 10 10 10 4.3495215625163945 22.99103443049619 0.0 3 0.9729085057856508 7.481014731376782 18270.0 39.1116006296986 0.0 - - - - - - - 246.75 36 8 GNMT glycine N-methyltransferase 1161 148 C20140704_OR005_02 C20140704_OR005_02 TB427275.[MT7]-DVTTSVLIVNNK[MT7].3y3_1.heavy 530.982 / 519.301 68511.0 32.00490188598633 47 17 10 10 10 4.3495215625163945 22.99103443049619 0.0 3 0.9729085057856508 7.481014731376782 68511.0 445.8799932158879 0.0 - - - - - - - 308.5 137 6 GNMT glycine N-methyltransferase 1163 148 C20140704_OR005_02 C20140704_OR005_02 TB427275.[MT7]-DVTTSVLIVNNK[MT7].3b5_1.heavy 530.982 / 648.332 18023.0 32.00490188598633 47 17 10 10 10 4.3495215625163945 22.99103443049619 0.0 3 0.9729085057856508 7.481014731376782 18023.0 9.446597509242038 1.0 - - - - - - - 274.1111111111111 48 9 GNMT glycine N-methyltransferase 1165 148 C20140704_OR005_02 C20140704_OR005_02 TB427275.[MT7]-DVTTSVLIVNNK[MT7].3y4_1.heavy 530.982 / 618.369 52093.0 32.00490188598633 47 17 10 10 10 4.3495215625163945 22.99103443049619 0.0 3 0.9729085057856508 7.481014731376782 52093.0 162.09318368368366 0.0 - - - - - - - 246.7 104 10 GNMT glycine N-methyltransferase 1167 149 C20140704_OR005_02 C20140704_OR005_02 TB427080.[MT7]-ALLLSTYIK[MT7].3y3_1.heavy 437.283 / 567.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1169 149 C20140704_OR005_02 C20140704_OR005_02 TB427080.[MT7]-ALLLSTYIK[MT7].3b4_1.heavy 437.283 / 555.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1171 149 C20140704_OR005_02 C20140704_OR005_02 TB427080.[MT7]-ALLLSTYIK[MT7].3y4_1.heavy 437.283 / 668.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1173 149 C20140704_OR005_02 C20140704_OR005_02 TB427080.[MT7]-ALLLSTYIK[MT7].3b3_1.heavy 437.283 / 442.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1175 150 C20140704_OR005_02 C20140704_OR005_02 TB450829.[MT7]-GVLQRPSYK[MT7].3y3_1.heavy 445.938 / 541.31 7905.0 22.86210060119629 47 17 10 10 10 9.43588941413756 10.597835096516974 0.0 3 0.9755230173350022 7.872153898258991 7905.0 73.3125 0.0 - - - - - - - 172.0 15 9 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1177 150 C20140704_OR005_02 C20140704_OR005_02 TB450829.[MT7]-GVLQRPSYK[MT7].3b4_1.heavy 445.938 / 542.342 2325.0 22.86210060119629 47 17 10 10 10 9.43588941413756 10.597835096516974 0.0 3 0.9755230173350022 7.872153898258991 2325.0 5.887596899224806 1.0 - - - - - - - 264.3333333333333 4 12 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1179 150 C20140704_OR005_02 C20140704_OR005_02 TB450829.[MT7]-GVLQRPSYK[MT7].3y7_2.heavy 445.938 / 518.307 3797.0 22.86210060119629 47 17 10 10 10 9.43588941413756 10.597835096516974 0.0 3 0.9755230173350022 7.872153898258991 3797.0 7.8140361168317565 0.0 - - - - - - - 256.0769230769231 7 13 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1181 150 C20140704_OR005_02 C20140704_OR005_02 TB450829.[MT7]-GVLQRPSYK[MT7].3y4_1.heavy 445.938 / 638.363 15034.0 22.86210060119629 47 17 10 10 10 9.43588941413756 10.597835096516974 0.0 3 0.9755230173350022 7.872153898258991 15034.0 245.10200179131215 0.0 - - - - - - - 143.42857142857142 30 7 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1183 151 C20140704_OR005_02 C20140704_OR005_02 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 216944.0 37.642398834228516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 216944.0 157.63238559366204 0.0 - - - - - - - 692.0 433 9 1185 151 C20140704_OR005_02 C20140704_OR005_02 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 459243.0 37.642398834228516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 459243.0 452.88685687284715 0.0 - - - - - - - 191.25 918 8 1187 151 C20140704_OR005_02 C20140704_OR005_02 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 484052.0 37.642398834228516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 484052.0 207.2832689249259 0.0 - - - - - - - 273.4166666666667 968 12 1189 152 C20140704_OR005_02 C20140704_OR005_02 TB450828.[MT7]-IALPQFDIK[MT7].3y3_1.heavy 444.943 / 519.326 3118.0 41.14112377166748 35 16 10 3 6 2.0512140843475257 42.38993977853171 0.0625 5 0.9631207975735584 6.406602661574741 3118.0 27.882115384615382 1.0 - - - - - - - 190.66666666666666 6 6 GLRB glycine receptor, beta 1191 152 C20140704_OR005_02 C20140704_OR005_02 TB450828.[MT7]-IALPQFDIK[MT7].3b4_1.heavy 444.943 / 539.367 831.0 41.14112377166748 35 16 10 3 6 2.0512140843475257 42.38993977853171 0.0625 5 0.9631207975735584 6.406602661574741 831.0 8.389903846153846 2.0 - - - - - - - 156.0 3 4 GLRB glycine receptor, beta 1193 152 C20140704_OR005_02 C20140704_OR005_02 TB450828.[MT7]-IALPQFDIK[MT7].3b5_1.heavy 444.943 / 667.426 831.0 41.14112377166748 35 16 10 3 6 2.0512140843475257 42.38993977853171 0.0625 5 0.9631207975735584 6.406602661574741 831.0 0.0 2.0 - - - - - - - 208.0 2 6 GLRB glycine receptor, beta 1195 152 C20140704_OR005_02 C20140704_OR005_02 TB450828.[MT7]-IALPQFDIK[MT7].3y4_1.heavy 444.943 / 666.394 1975.0 41.14112377166748 35 16 10 3 6 2.0512140843475257 42.38993977853171 0.0625 5 0.9631207975735584 6.406602661574741 1975.0 11.647435897435898 0.0 - - - - - - - 208.0 3 6 GLRB glycine receptor, beta 1197 153 C20140704_OR005_02 C20140704_OR005_02 TB427177.[MT7]-TETDFSNLFAR.3y6_1.heavy 482.244 / 707.383 928.0 39.10835075378418 29 11 4 6 8 1.4981332121561586 61.1969439359787 0.035701751708984375 4 0.8655361027968191 3.327120232026013 928.0 15.27145631067961 0.0 - - - - - - - 0.0 1 0 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1199 153 C20140704_OR005_02 C20140704_OR005_02 TB427177.[MT7]-TETDFSNLFAR.3b4_1.heavy 482.244 / 591.274 1649.0 39.10835075378418 29 11 4 6 8 1.4981332121561586 61.1969439359787 0.035701751708984375 4 0.8655361027968191 3.327120232026013 1649.0 20.278964401294495 0.0 - - - - - - - 144.2 3 5 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1201 153 C20140704_OR005_02 C20140704_OR005_02 TB427177.[MT7]-TETDFSNLFAR.3y4_1.heavy 482.244 / 506.309 1546.0 39.10835075378418 29 11 4 6 8 1.4981332121561586 61.1969439359787 0.035701751708984375 4 0.8655361027968191 3.327120232026013 1546.0 8.255339805825242 1.0 - - - - - - - 144.2 3 5 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1203 153 C20140704_OR005_02 C20140704_OR005_02 TB427177.[MT7]-TETDFSNLFAR.3y5_1.heavy 482.244 / 620.352 1340.0 39.10835075378418 29 11 4 6 8 1.4981332121561586 61.1969439359787 0.035701751708984375 4 0.8655361027968191 3.327120232026013 1340.0 7.935922330097087 1.0 - - - - - - - 171.66666666666666 5 9 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1205 154 C20140704_OR005_02 C20140704_OR005_02 TB427176.[MT7]-TETDFSNLFAR.2y8_1.heavy 722.863 / 969.479 1859.0 39.10835075378418 40 14 10 6 10 2.113891487865918 38.31473458497409 0.035701751708984375 3 0.9469713984986563 5.3354269515007156 1859.0 2.5218992248062015 0.0 - - - - - - - 230.3846153846154 3 13 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1207 154 C20140704_OR005_02 C20140704_OR005_02 TB427176.[MT7]-TETDFSNLFAR.2y9_1.heavy 722.863 / 1070.53 4028.0 39.10835075378418 40 14 10 6 10 2.113891487865918 38.31473458497409 0.035701751708984375 3 0.9469713984986563 5.3354269515007156 4028.0 37.92904933317042 0.0 - - - - - - - 220.33333333333334 8 15 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1209 154 C20140704_OR005_02 C20140704_OR005_02 TB427176.[MT7]-TETDFSNLFAR.2b4_1.heavy 722.863 / 591.274 5577.0 39.10835075378418 40 14 10 6 10 2.113891487865918 38.31473458497409 0.035701751708984375 3 0.9469713984986563 5.3354269515007156 5577.0 12.967150458922237 0.0 - - - - - - - 234.9090909090909 11 11 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1211 154 C20140704_OR005_02 C20140704_OR005_02 TB427176.[MT7]-TETDFSNLFAR.2y7_1.heavy 722.863 / 854.452 4957.0 39.10835075378418 40 14 10 6 10 2.113891487865918 38.31473458497409 0.035701751708984375 3 0.9469713984986563 5.3354269515007156 4957.0 24.952646723424195 0.0 - - - - - - - 286.0769230769231 9 13 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1213 155 C20140704_OR005_02 C20140704_OR005_02 TB427175.[MT7]-TANQHQGK[MT7]K[MT7].3y3_1.heavy 481.951 / 620.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC13A4 solute carrier family 13 (sodium/sulfate symporters), member 4 1215 155 C20140704_OR005_02 C20140704_OR005_02 TB427175.[MT7]-TANQHQGK[MT7]K[MT7].3b5_1.heavy 481.951 / 696.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC13A4 solute carrier family 13 (sodium/sulfate symporters), member 4 1217 155 C20140704_OR005_02 C20140704_OR005_02 TB427175.[MT7]-TANQHQGK[MT7]K[MT7].3y4_1.heavy 481.951 / 748.492 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC13A4 solute carrier family 13 (sodium/sulfate symporters), member 4 1219 155 C20140704_OR005_02 C20140704_OR005_02 TB427175.[MT7]-TANQHQGK[MT7]K[MT7].3y8_2.heavy 481.951 / 599.848 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC13A4 solute carrier family 13 (sodium/sulfate symporters), member 4 1221 156 C20140704_OR005_02 C20140704_OR005_02 TB450624.[MT7]-DLDELPR.2y4_1.heavy 501.273 / 514.298 7265.0 28.56920051574707 50 20 10 10 10 9.94482763627069 10.055478451459617 0.0 3 0.9928843269346963 14.621654426026726 7265.0 34.46201419698314 0.0 - - - - - - - 303.45454545454544 14 11 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1223 156 C20140704_OR005_02 C20140704_OR005_02 TB450624.[MT7]-DLDELPR.2y5_1.heavy 501.273 / 629.325 1767.0 28.56920051574707 50 20 10 10 10 9.94482763627069 10.055478451459617 0.0 3 0.9928843269346963 14.621654426026726 1767.0 9.725519551331983 2.0 - - - - - - - 265.2 4 10 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1225 156 C20140704_OR005_02 C20140704_OR005_02 TB450624.[MT7]-DLDELPR.2b4_1.heavy 501.273 / 617.29 3731.0 28.56920051574707 50 20 10 10 10 9.94482763627069 10.055478451459617 0.0 3 0.9928843269346963 14.621654426026726 3731.0 0.20010723860589807 1.0 - - - - - - - 210.42857142857142 7 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1227 156 C20140704_OR005_02 C20140704_OR005_02 TB450624.[MT7]-DLDELPR.2y6_1.heavy 501.273 / 742.409 4320.0 28.56920051574707 50 20 10 10 10 9.94482763627069 10.055478451459617 0.0 3 0.9928843269346963 14.621654426026726 4320.0 24.67823013755587 0.0 - - - - - - - 179.83333333333334 8 12 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1229 157 C20140704_OR005_02 C20140704_OR005_02 TB427659.[MT7]-FFC[CAM]ALEVVLPSC[CAM]DC[CAM]RSPGIGLVEEPMDK[MT7].4y4_1.heavy 879.184 / 634.335 3408.0 47.44309997558594 40 17 10 5 8 2.317747680755596 29.47549911153834 0.04979705810546875 4 0.9776451395162855 8.238800792633524 3408.0 11.32463768115942 1.0 - - - - - - - 216.9 6 10 RDM1 RAD52 motif 1 1231 157 C20140704_OR005_02 C20140704_OR005_02 TB427659.[MT7]-FFC[CAM]ALEVVLPSC[CAM]DC[CAM]RSPGIGLVEEPMDK[MT7].4b4_1.heavy 879.184 / 670.314 2685.0 47.44309997558594 40 17 10 5 8 2.317747680755596 29.47549911153834 0.04979705810546875 4 0.9776451395162855 8.238800792633524 2685.0 7.2266315367862415 0.0 - - - - - - - 206.5 5 12 RDM1 RAD52 motif 1 1233 157 C20140704_OR005_02 C20140704_OR005_02 TB427659.[MT7]-FFC[CAM]ALEVVLPSC[CAM]DC[CAM]RSPGIGLVEEPMDK[MT7].4b5_1.heavy 879.184 / 783.398 1962.0 47.44309997558594 40 17 10 5 8 2.317747680755596 29.47549911153834 0.04979705810546875 4 0.9776451395162855 8.238800792633524 1962.0 9.358692493946732 0.0 - - - - - - - 236.14285714285714 3 7 RDM1 RAD52 motif 1 1235 157 C20140704_OR005_02 C20140704_OR005_02 TB427659.[MT7]-FFC[CAM]ALEVVLPSC[CAM]DC[CAM]RSPGIGLVEEPMDK[MT7].4b6_1.heavy 879.184 / 912.441 2995.0 47.44309997558594 40 17 10 5 8 2.317747680755596 29.47549911153834 0.04979705810546875 4 0.9776451395162855 8.238800792633524 2995.0 9.069419334683719 1.0 - - - - - - - 217.0 6 10 RDM1 RAD52 motif 1 1237 158 C20140704_OR005_02 C20140704_OR005_02 TB451223.[MT7]-ITIPNAFIGSDVVDWLYHNVEGFTDRR.4y13_2.heavy 820.423 / 846.916 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 1239 158 C20140704_OR005_02 C20140704_OR005_02 TB451223.[MT7]-ITIPNAFIGSDVVDWLYHNVEGFTDRR.4b5_1.heavy 820.423 / 683.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 1241 158 C20140704_OR005_02 C20140704_OR005_02 TB451223.[MT7]-ITIPNAFIGSDVVDWLYHNVEGFTDRR.4y19_2.heavy 820.423 / 1133.04 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 1243 158 C20140704_OR005_02 C20140704_OR005_02 TB451223.[MT7]-ITIPNAFIGSDVVDWLYHNVEGFTDRR.4b6_1.heavy 820.423 / 754.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 1245 159 C20140704_OR005_02 C20140704_OR005_02 TB412833.[MT7]-LQELSDLEER.2b3_1.heavy 688.363 / 515.295 3766.0 34.6609992980957 42 14 10 10 8 1.466584067618162 47.425321990690236 0.0 4 0.9429238642814438 5.140998452281464 3766.0 31.15169112198014 1.0 - - - - - - - 216.66666666666666 7 6 RDM1 RAD52 motif 1 1247 159 C20140704_OR005_02 C20140704_OR005_02 TB412833.[MT7]-LQELSDLEER.2y4_1.heavy 688.363 / 546.288 2857.0 34.6609992980957 42 14 10 10 8 1.466584067618162 47.425321990690236 0.0 4 0.9429238642814438 5.140998452281464 2857.0 13.630433092331398 1.0 - - - - - - - 303.3333333333333 7 6 RDM1 RAD52 motif 1 1249 159 C20140704_OR005_02 C20140704_OR005_02 TB412833.[MT7]-LQELSDLEER.2y9_1.heavy 688.363 / 1118.53 2597.0 34.6609992980957 42 14 10 10 8 1.466584067618162 47.425321990690236 0.0 4 0.9429238642814438 5.140998452281464 2597.0 -0.3809314264759808 2.0 - - - - - - - 130.0 5 4 RDM1 RAD52 motif 1 1251 159 C20140704_OR005_02 C20140704_OR005_02 TB412833.[MT7]-LQELSDLEER.2b6_1.heavy 688.363 / 830.438 4156.0 34.6609992980957 42 14 10 10 8 1.466584067618162 47.425321990690236 0.0 4 0.9429238642814438 5.140998452281464 4156.0 30.24289230769231 1.0 - - - - - - - 208.0 8 10 RDM1 RAD52 motif 1 1253 160 C20140704_OR005_02 C20140704_OR005_02 TB427561.[MT7]-DGDGIFSPGGAISNMYSIMAAR.3y7_1.heavy 792.048 / 811.413 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1255 160 C20140704_OR005_02 C20140704_OR005_02 TB427561.[MT7]-DGDGIFSPGGAISNMYSIMAAR.3b6_1.heavy 792.048 / 749.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1257 160 C20140704_OR005_02 C20140704_OR005_02 TB427561.[MT7]-DGDGIFSPGGAISNMYSIMAAR.3b5_1.heavy 792.048 / 602.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1259 160 C20140704_OR005_02 C20140704_OR005_02 TB427561.[MT7]-DGDGIFSPGGAISNMYSIMAAR.3y10_1.heavy 792.048 / 1143.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1261 161 C20140704_OR005_02 C20140704_OR005_02 TB426795.[MT7]-FPSAASR.2y4_1.heavy 440.244 / 404.225 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1263 161 C20140704_OR005_02 C20140704_OR005_02 TB426795.[MT7]-FPSAASR.2y5_1.heavy 440.244 / 491.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1265 161 C20140704_OR005_02 C20140704_OR005_02 TB426795.[MT7]-FPSAASR.2b4_1.heavy 440.244 / 547.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1267 161 C20140704_OR005_02 C20140704_OR005_02 TB426795.[MT7]-FPSAASR.2y6_1.heavy 440.244 / 588.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1269 162 C20140704_OR005_02 C20140704_OR005_02 TB427563.[MT7]-YFTSDGLPIGDLQPLPIQK[MT7].2y4_1.heavy 1195.66 / 629.41 2261.0 44.36750030517578 50 20 10 10 10 88.48185954896154 1.130175162567248 0.0 3 0.9999109120334115 130.7523858784539 2261.0 27.51518518518519 0.0 - - - - - - - 215.5 4 4 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1271 162 C20140704_OR005_02 C20140704_OR005_02 TB427563.[MT7]-YFTSDGLPIGDLQPLPIQK[MT7].2b6_1.heavy 1195.66 / 815.369 1831.0 44.36750030517578 50 20 10 10 10 88.48185954896154 1.130175162567248 0.0 3 0.9999109120334115 130.7523858784539 1831.0 13.050208942328462 0.0 - - - - - - - 200.14285714285714 3 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1273 162 C20140704_OR005_02 C20140704_OR005_02 TB427563.[MT7]-YFTSDGLPIGDLQPLPIQK[MT7].2y6_1.heavy 1195.66 / 839.547 1292.0 44.36750030517578 50 20 10 10 10 88.48185954896154 1.130175162567248 0.0 3 0.9999109120334115 130.7523858784539 1292.0 15.579672695951768 0.0 - - - - - - - 193.8 2 5 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1275 162 C20140704_OR005_02 C20140704_OR005_02 TB427563.[MT7]-YFTSDGLPIGDLQPLPIQK[MT7].2b5_1.heavy 1195.66 / 758.348 1292.0 44.36750030517578 50 20 10 10 10 88.48185954896154 1.130175162567248 0.0 3 0.9999109120334115 130.7523858784539 1292.0 11.778232558139536 0.0 - - - - - - - 143.66666666666666 2 3 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1277 163 C20140704_OR005_02 C20140704_OR005_02 TB427462.[MT7]-VGGYILGEFGNLIAGDPR.3b6_1.heavy 664.694 / 747.452 1677.0 50.49989891052246 45 20 10 5 10 5.354245338933994 18.676768371602027 0.041599273681640625 3 0.9919310298420061 13.729693948218772 1677.0 27.81397581015858 0.0 - - - - - - - 152.4 3 10 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1279 163 C20140704_OR005_02 C20140704_OR005_02 TB427462.[MT7]-VGGYILGEFGNLIAGDPR.3b4_1.heavy 664.694 / 521.284 4422.0 50.49989891052246 45 20 10 5 10 5.354245338933994 18.676768371602027 0.041599273681640625 3 0.9919310298420061 13.729693948218772 4422.0 24.93718032786885 0.0 - - - - - - - 198.1 8 10 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1281 163 C20140704_OR005_02 C20140704_OR005_02 TB427462.[MT7]-VGGYILGEFGNLIAGDPR.3b5_1.heavy 664.694 / 634.368 3812.0 50.49989891052246 45 20 10 5 10 5.354245338933994 18.676768371602027 0.041599273681640625 3 0.9919310298420061 13.729693948218772 3812.0 54.14946263296036 0.0 - - - - - - - 220.11111111111111 7 9 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1283 163 C20140704_OR005_02 C20140704_OR005_02 TB427462.[MT7]-VGGYILGEFGNLIAGDPR.3b8_1.heavy 664.694 / 933.516 2211.0 50.49989891052246 45 20 10 5 10 5.354245338933994 18.676768371602027 0.041599273681640625 3 0.9919310298420061 13.729693948218772 2211.0 8.748048750179228 0.0 - - - - - - - 219.0 4 8 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1285 164 C20140704_OR005_02 C20140704_OR005_02 TB427565.[MT7]-EASTQSSSAATSQGYILPEGK[MT7].3b5_1.heavy 800.743 / 661.327 3547.0 29.110849857330322 41 16 10 5 10 3.2846849603670174 30.44431999007491 0.04139900207519531 3 0.9666408909264094 6.738145572367252 3547.0 15.529284023260626 0.0 - - - - - - - 339.0 7 8 DAZL deleted in azoospermia-like 1287 164 C20140704_OR005_02 C20140704_OR005_02 TB427565.[MT7]-EASTQSSSAATSQGYILPEGK[MT7].3y4_1.heavy 800.743 / 574.332 29107.0 29.110849857330322 41 16 10 5 10 3.2846849603670174 30.44431999007491 0.04139900207519531 3 0.9666408909264094 6.738145572367252 29107.0 43.67982059025194 0.0 - - - - - - - 149.0 58 7 DAZL deleted in azoospermia-like 1289 164 C20140704_OR005_02 C20140704_OR005_02 TB427565.[MT7]-EASTQSSSAATSQGYILPEGK[MT7].3b7_1.heavy 800.743 / 835.391 1461.0 29.110849857330322 41 16 10 5 10 3.2846849603670174 30.44431999007491 0.04139900207519531 3 0.9666408909264094 6.738145572367252 1461.0 18.715808552469895 1.0 - - - - - - - 286.75 2 4 DAZL deleted in azoospermia-like 1291 164 C20140704_OR005_02 C20140704_OR005_02 TB427565.[MT7]-EASTQSSSAATSQGYILPEGK[MT7].3y5_1.heavy 800.743 / 687.416 7407.0 29.110849857330322 41 16 10 5 10 3.2846849603670174 30.44431999007491 0.04139900207519531 3 0.9666408909264094 6.738145572367252 7407.0 29.02849840255591 0.0 - - - - - - - 700.5714285714286 14 7 DAZL deleted in azoospermia-like 1293 165 C20140704_OR005_02 C20140704_OR005_02 TB451110.[MT7]-FSFLLHFYTVPIPK[MT7].4b4_1.heavy 500.043 / 639.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 1295 165 C20140704_OR005_02 C20140704_OR005_02 TB451110.[MT7]-FSFLLHFYTVPIPK[MT7].4b5_1.heavy 500.043 / 752.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 1297 165 C20140704_OR005_02 C20140704_OR005_02 TB451110.[MT7]-FSFLLHFYTVPIPK[MT7].4b6_1.heavy 500.043 / 889.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 1299 165 C20140704_OR005_02 C20140704_OR005_02 TB451110.[MT7]-FSFLLHFYTVPIPK[MT7].4b3_1.heavy 500.043 / 526.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 1301 166 C20140704_OR005_02 C20140704_OR005_02 TB427464.[MT7]-FSFLLHFYTVPIPK[MT7].3b4_1.heavy 666.388 / 639.362 2495.0 48.21910095214844 39 9 10 10 10 0.5515993551596453 86.50814232998235 0.0 3 0.8161804374732784 2.833202187772408 2495.0 11.86857638888889 0.0 - - - - - - - 234.66666666666666 4 9 ENG endoglin 1303 166 C20140704_OR005_02 C20140704_OR005_02 TB427464.[MT7]-FSFLLHFYTVPIPK[MT7].3b5_1.heavy 666.388 / 752.446 2399.0 48.21910095214844 39 9 10 10 10 0.5515993551596453 86.50814232998235 0.0 3 0.8161804374732784 2.833202187772408 2399.0 31.986666666666665 0.0 - - - - - - - 224.0 4 9 ENG endoglin 1305 166 C20140704_OR005_02 C20140704_OR005_02 TB427464.[MT7]-FSFLLHFYTVPIPK[MT7].3y4_1.heavy 666.388 / 598.404 2879.0 48.21910095214844 39 9 10 10 10 0.5515993551596453 86.50814232998235 0.0 3 0.8161804374732784 2.833202187772408 2879.0 10.782110990488006 1.0 - - - - - - - 264.0 5 8 ENG endoglin 1307 166 C20140704_OR005_02 C20140704_OR005_02 TB427464.[MT7]-FSFLLHFYTVPIPK[MT7].3b3_1.heavy 666.388 / 526.278 1056.0 48.21910095214844 39 9 10 10 10 0.5515993551596453 86.50814232998235 0.0 3 0.8161804374732784 2.833202187772408 1056.0 4.693333333333333 0.0 - - - - - - - 236.30769230769232 2 13 ENG endoglin 1309 167 C20140704_OR005_02 C20140704_OR005_02 TB450838.[MT7]-LLIVVLESGK[MT7].3b4_1.heavy 453.634 / 583.43 8265.0 45.24480056762695 40 10 10 10 10 0.5199709705692396 90.93832049470089 0.0 3 0.8319657746486241 2.967465008441026 8265.0 168.5891326530612 0.0 - - - - - - - 246.0 16 4 RDM1 RAD52 motif 1 1311 167 C20140704_OR005_02 C20140704_OR005_02 TB450838.[MT7]-LLIVVLESGK[MT7].3b5_1.heavy 453.634 / 682.498 4329.0 45.24480056762695 40 10 10 10 10 0.5199709705692396 90.93832049470089 0.0 3 0.8319657746486241 2.967465008441026 4329.0 57.96757108267036 0.0 - - - - - - - 328.0 8 3 RDM1 RAD52 motif 1 1313 167 C20140704_OR005_02 C20140704_OR005_02 TB450838.[MT7]-LLIVVLESGK[MT7].3y4_1.heavy 453.634 / 564.311 9052.0 45.24480056762695 40 10 10 10 10 0.5199709705692396 90.93832049470089 0.0 3 0.8319657746486241 2.967465008441026 9052.0 0.0 0.0 - - - - - - - 262.6666666666667 18 3 RDM1 RAD52 motif 1 1315 167 C20140704_OR005_02 C20140704_OR005_02 TB450838.[MT7]-LLIVVLESGK[MT7].3b3_1.heavy 453.634 / 484.362 4428.0 45.24480056762695 40 10 10 10 10 0.5199709705692396 90.93832049470089 0.0 3 0.8319657746486241 2.967465008441026 4428.0 67.4810135709106 0.0 - - - - - - - 172.25 8 4 RDM1 RAD52 motif 1 1317 168 C20140704_OR005_02 C20140704_OR005_02 TB427245.[MT7]-VEEGPLSFLMK[MT7].3y3_1.heavy 513.289 / 535.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDM1 RAD52 motif 1 1319 168 C20140704_OR005_02 C20140704_OR005_02 TB427245.[MT7]-VEEGPLSFLMK[MT7].3b4_1.heavy 513.289 / 559.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDM1 RAD52 motif 1 1321 168 C20140704_OR005_02 C20140704_OR005_02 TB427245.[MT7]-VEEGPLSFLMK[MT7].3y4_1.heavy 513.289 / 682.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDM1 RAD52 motif 1 1323 168 C20140704_OR005_02 C20140704_OR005_02 TB427245.[MT7]-VEEGPLSFLMK[MT7].3b7_1.heavy 513.289 / 856.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDM1 RAD52 motif 1 1325 169 C20140704_OR005_02 C20140704_OR005_02 TB427247.[MT7]-VEEGPLSFLMK[MT7].2y4_1.heavy 769.431 / 682.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDM1 RAD52 motif 1 1327 169 C20140704_OR005_02 C20140704_OR005_02 TB427247.[MT7]-VEEGPLSFLMK[MT7].2b4_1.heavy 769.431 / 559.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDM1 RAD52 motif 1 1329 169 C20140704_OR005_02 C20140704_OR005_02 TB427247.[MT7]-VEEGPLSFLMK[MT7].2y3_1.heavy 769.431 / 535.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDM1 RAD52 motif 1 1331 169 C20140704_OR005_02 C20140704_OR005_02 TB427247.[MT7]-VEEGPLSFLMK[MT7].2b7_1.heavy 769.431 / 856.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDM1 RAD52 motif 1 1333 170 C20140704_OR005_02 C20140704_OR005_02 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 111388.0 40.392601013183594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 111388.0 568.1131790123458 0.0 - - - - - - - 781.625 222 8 1335 170 C20140704_OR005_02 C20140704_OR005_02 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 179972.0 40.392601013183594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 179972.0 529.3093976656255 0.0 - - - - - - - 1236.7142857142858 359 7 1337 170 C20140704_OR005_02 C20140704_OR005_02 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 210656.0 40.392601013183594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 210656.0 1069.6155221869285 0.0 - - - - - - - 728.2857142857143 421 7 1339 171 C20140704_OR005_02 C20140704_OR005_02 TB427183.[MT7]-GC[CAM]HLEGVAGHK[MT7].3y6_1.heavy 484.926 / 712.422 843.0 18.39780044555664 48 18 10 10 10 4.8444311960071635 20.642258286673812 0.0 3 0.9847217102276591 9.971729827950512 843.0 21.918 0.0 - - - - - - - 0.0 1 0 ENG endoglin 1341 171 C20140704_OR005_02 C20140704_OR005_02 TB427183.[MT7]-GC[CAM]HLEGVAGHK[MT7].3b6_1.heavy 484.926 / 798.369 893.0 18.39780044555664 48 18 10 10 10 4.8444311960071635 20.642258286673812 0.0 3 0.9847217102276591 9.971729827950512 893.0 26.86234202020202 0.0 - - - - - - - 0.0 1 0 ENG endoglin 1343 171 C20140704_OR005_02 C20140704_OR005_02 TB427183.[MT7]-GC[CAM]HLEGVAGHK[MT7].3y4_1.heavy 484.926 / 556.332 3720.0 18.39780044555664 48 18 10 10 10 4.8444311960071635 20.642258286673812 0.0 3 0.9847217102276591 9.971729827950512 3720.0 44.31818181818182 0.0 - - - - - - - 145.15384615384616 7 13 ENG endoglin 1345 171 C20140704_OR005_02 C20140704_OR005_02 TB427183.[MT7]-GC[CAM]HLEGVAGHK[MT7].3b3_1.heavy 484.926 / 499.22 5406.0 18.39780044555664 48 18 10 10 10 4.8444311960071635 20.642258286673812 0.0 3 0.9847217102276591 9.971729827950512 5406.0 127.03011543624162 0.0 - - - - - - - 160.30769230769232 10 13 ENG endoglin 1347 172 C20140704_OR005_02 C20140704_OR005_02 TB427661.[MT7]-EAEHGPEVSSGEGTENQPDFTAANVYHLLK[MT7].4b8_1.heavy 879.43 / 993.476 1947.0 37.98619842529297 48 18 10 10 10 4.020655169945529 19.913477289021568 0.0 3 0.9832135250223946 9.512030078029193 1947.0 2.701012941574809 1.0 - - - - - - - 260.7142857142857 5 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1349 172 C20140704_OR005_02 C20140704_OR005_02 TB427661.[MT7]-EAEHGPEVSSGEGTENQPDFTAANVYHLLK[MT7].4y5_1.heavy 879.43 / 817.505 4867.0 37.98619842529297 48 18 10 10 10 4.020655169945529 19.913477289021568 0.0 3 0.9832135250223946 9.512030078029193 4867.0 11.817283950617284 1.0 - - - - - - - 304.25 9 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1351 172 C20140704_OR005_02 C20140704_OR005_02 TB427661.[MT7]-EAEHGPEVSSGEGTENQPDFTAANVYHLLK[MT7].4y4_1.heavy 879.43 / 654.442 4137.0 37.98619842529297 48 18 10 10 10 4.020655169945529 19.913477289021568 0.0 3 0.9832135250223946 9.512030078029193 4137.0 40.36871983034302 0.0 - - - - - - - 324.55555555555554 8 9 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1353 172 C20140704_OR005_02 C20140704_OR005_02 TB427661.[MT7]-EAEHGPEVSSGEGTENQPDFTAANVYHLLK[MT7].4b4_1.heavy 879.43 / 611.291 3650.0 37.98619842529297 48 18 10 10 10 4.020655169945529 19.913477289021568 0.0 3 0.9832135250223946 9.512030078029193 3650.0 11.001027749229188 0.0 - - - - - - - 328.6 7 10 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1355 173 C20140704_OR005_02 C20140704_OR005_02 TB451119.[MT7]-DTC[CAM]SPELLMSLIQTK[MT7].2b8_1.heavy 1012.54 / 1060.51 1973.0 45.441823959350586 43 18 10 5 10 5.048817814101433 19.806616852107105 0.04109954833984375 3 0.983742253163088 9.665894316123214 1973.0 8.583239181058865 0.0 - - - - - - - 188.45454545454547 3 11 ENG endoglin 1357 173 C20140704_OR005_02 C20140704_OR005_02 TB451119.[MT7]-DTC[CAM]SPELLMSLIQTK[MT7].2b4_1.heavy 1012.54 / 608.247 2861.0 45.441823959350586 43 18 10 5 10 5.048817814101433 19.806616852107105 0.04109954833984375 3 0.983742253163088 9.665894316123214 2861.0 22.834226231307447 0.0 - - - - - - - 197.33333333333334 5 9 ENG endoglin 1359 173 C20140704_OR005_02 C20140704_OR005_02 TB451119.[MT7]-DTC[CAM]SPELLMSLIQTK[MT7].2y6_1.heavy 1012.54 / 833.521 1480.0 45.441823959350586 43 18 10 5 10 5.048817814101433 19.806616852107105 0.04109954833984375 3 0.983742253163088 9.665894316123214 1480.0 9.169696969696968 1.0 - - - - - - - 99.0 2 2 ENG endoglin 1361 173 C20140704_OR005_02 C20140704_OR005_02 TB451119.[MT7]-DTC[CAM]SPELLMSLIQTK[MT7].2b7_1.heavy 1012.54 / 947.426 2467.0 45.441823959350586 43 18 10 5 10 5.048817814101433 19.806616852107105 0.04109954833984375 3 0.983742253163088 9.665894316123214 2467.0 33.16205651105651 0.0 - - - - - - - 246.83333333333334 4 6 ENG endoglin 1363 174 C20140704_OR005_02 C20140704_OR005_02 TB426908.[MT7]-VQHSNAK[MT7].2y4_1.heavy 536.311 / 563.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1365 174 C20140704_OR005_02 C20140704_OR005_02 TB426908.[MT7]-VQHSNAK[MT7].2y5_1.heavy 536.311 / 700.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1367 174 C20140704_OR005_02 C20140704_OR005_02 TB426908.[MT7]-VQHSNAK[MT7].2y6_1.heavy 536.311 / 828.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1369 174 C20140704_OR005_02 C20140704_OR005_02 TB426908.[MT7]-VQHSNAK[MT7].2b5_1.heavy 536.311 / 710.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1371 175 C20140704_OR005_02 C20140704_OR005_02 TB412595.[MT7]-AC[CAM]PIAQK[MT7].2y4_1.heavy 538.312 / 603.395 716.0 19.811100006103516 50 20 10 10 10 4.960614000022573 20.1587948587705 0.0 3 0.9915274030946898 13.398216352880068 716.0 3.470184049079755 1.0 - - - - - - - 0.0 1 0 C1orf101 chromosome 1 open reading frame 101 1373 175 C20140704_OR005_02 C20140704_OR005_02 TB412595.[MT7]-AC[CAM]PIAQK[MT7].2y5_1.heavy 538.312 / 700.447 4623.0 19.811100006103516 50 20 10 10 10 4.960614000022573 20.1587948587705 0.0 3 0.9915274030946898 13.398216352880068 4623.0 27.729908637437646 0.0 - - - - - - - 195.14285714285714 9 7 C1orf101 chromosome 1 open reading frame 101 1375 175 C20140704_OR005_02 C20140704_OR005_02 TB412595.[MT7]-AC[CAM]PIAQK[MT7].2b4_1.heavy 538.312 / 586.314 912.0 19.811100006103516 50 20 10 10 10 4.960614000022573 20.1587948587705 0.0 3 0.9915274030946898 13.398216352880068 912.0 13.890677064870614 1.0 - - - - - - - 179.0 2 4 C1orf101 chromosome 1 open reading frame 101 1377 175 C20140704_OR005_02 C20140704_OR005_02 TB412595.[MT7]-AC[CAM]PIAQK[MT7].2y6_1.heavy 538.312 / 860.478 2019.0 19.811100006103516 50 20 10 10 10 4.960614000022573 20.1587948587705 0.0 3 0.9915274030946898 13.398216352880068 2019.0 41.41538461538462 0.0 - - - - - - - 97.5 4 4 C1orf101 chromosome 1 open reading frame 101 1379 176 C20140704_OR005_02 C20140704_OR005_02 TB427390.[MT7]-GRLVEC[CAM]LETVLNK[MT7].3y3_1.heavy 607.016 / 518.342 44585.0 41.18802356719971 37 11 10 6 10 2.4632667339503134 40.596496766564584 0.031299591064453125 3 0.8629673637968094 3.295045886791423 44585.0 185.71777111301532 0.0 - - - - - - - 268.9230769230769 89 13 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1381 176 C20140704_OR005_02 C20140704_OR005_02 TB427390.[MT7]-GRLVEC[CAM]LETVLNK[MT7].3b5_1.heavy 607.016 / 699.427 3497.0 41.18802356719971 37 11 10 6 10 2.4632667339503134 40.596496766564584 0.031299591064453125 3 0.8629673637968094 3.295045886791423 3497.0 3.398658960450787 0.0 - - - - - - - 216.46153846153845 6 13 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1383 176 C20140704_OR005_02 C20140704_OR005_02 TB427390.[MT7]-GRLVEC[CAM]LETVLNK[MT7].3b8_1.heavy 607.016 / 1101.58 6605.0 41.18802356719971 37 11 10 6 10 2.4632667339503134 40.596496766564584 0.031299591064453125 3 0.8629673637968094 3.295045886791423 6605.0 87.15876288659794 0.0 - - - - - - - 249.71428571428572 13 7 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1385 176 C20140704_OR005_02 C20140704_OR005_02 TB427390.[MT7]-GRLVEC[CAM]LETVLNK[MT7].3b8_2.heavy 607.016 / 551.296 28655.0 41.18802356719971 37 11 10 6 10 2.4632667339503134 40.596496766564584 0.031299591064453125 3 0.8629673637968094 3.295045886791423 28655.0 132.45769405700423 0.0 - - - - - - - 291.3636363636364 57 11 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1387 177 C20140704_OR005_02 C20140704_OR005_02 TB426904.[MT7]-SQQATIK[MT7].2y4_1.heavy 532.321 / 576.384 6506.0 17.22480010986328 48 18 10 10 10 4.606390800306327 21.708970066836265 0.0 3 0.9884521457494216 11.473420332979387 6506.0 85.39710746182655 0.0 - - - - - - - 148.53333333333333 13 15 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1389 177 C20140704_OR005_02 C20140704_OR005_02 TB426904.[MT7]-SQQATIK[MT7].2y5_1.heavy 532.321 / 704.442 3208.0 17.22480010986328 48 18 10 10 10 4.606390800306327 21.708970066836265 0.0 3 0.9884521457494216 11.473420332979387 3208.0 33.53359480623787 0.0 - - - - - - - 130.30769230769232 6 13 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1391 177 C20140704_OR005_02 C20140704_OR005_02 TB426904.[MT7]-SQQATIK[MT7].2b4_1.heavy 532.321 / 559.296 4144.0 17.22480010986328 48 18 10 10 10 4.606390800306327 21.708970066836265 0.0 3 0.9884521457494216 11.473420332979387 4144.0 81.48314606741573 0.0 - - - - - - - 137.07692307692307 8 13 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1393 177 C20140704_OR005_02 C20140704_OR005_02 TB426904.[MT7]-SQQATIK[MT7].2y3_1.heavy 532.321 / 505.347 4456.0 17.22480010986328 48 18 10 10 10 4.606390800306327 21.708970066836265 0.0 3 0.9884521457494216 11.473420332979387 4456.0 21.70871794871795 0.0 - - - - - - - 232.77777777777777 8 18 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1395 178 C20140704_OR005_02 C20140704_OR005_02 TB427668.[MT7]-GYVPFYVNATAGTTVYGAFDPIQEIADIC[CAM]EK[MT7].4b7_1.heavy 925.214 / 970.516 2000.0 52.11152458190918 43 17 10 6 10 3.8231785182360953 26.156246568924832 0.03389739990234375 3 0.9791761420229036 8.53739231525547 2000.0 6.611570247933884 0.0 - - - - - - - 282.94444444444446 4 18 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1397 178 C20140704_OR005_02 C20140704_OR005_02 TB427668.[MT7]-GYVPFYVNATAGTTVYGAFDPIQEIADIC[CAM]EK[MT7].4b5_1.heavy 925.214 / 708.384 2970.0 52.11152458190918 43 17 10 6 10 3.8231785182360953 26.156246568924832 0.03389739990234375 3 0.9791761420229036 8.53739231525547 2970.0 7.547622860574516 0.0 - - - - - - - 233.78571428571428 5 14 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1399 178 C20140704_OR005_02 C20140704_OR005_02 TB427668.[MT7]-GYVPFYVNATAGTTVYGAFDPIQEIADIC[CAM]EK[MT7].4y6_1.heavy 925.214 / 879.436 2364.0 52.11152458190918 43 17 10 6 10 3.8231785182360953 26.156246568924832 0.03389739990234375 3 0.9791761420229036 8.53739231525547 2364.0 12.576018329105638 0.0 - - - - - - - 212.16666666666666 4 18 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1401 178 C20140704_OR005_02 C20140704_OR005_02 TB427668.[MT7]-GYVPFYVNATAGTTVYGAFDPIQEIADIC[CAM]EK[MT7].4b6_1.heavy 925.214 / 871.447 1758.0 52.11152458190918 43 17 10 6 10 3.8231785182360953 26.156246568924832 0.03389739990234375 3 0.9791761420229036 8.53739231525547 1758.0 13.426483516483515 0.0 - - - - - - - 745.0 3 7 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1403 179 C20140704_OR005_02 C20140704_OR005_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 121181.0 35.42369842529297 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 121181.0 205.68938150545065 0.0 - - - - - - - 230.375 242 8 1405 179 C20140704_OR005_02 C20140704_OR005_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 22808.0 35.42369842529297 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 22808.0 36.64541508825928 2.0 - - - - - - - 263.42857142857144 86 7 1407 179 C20140704_OR005_02 C20140704_OR005_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 24075.0 35.42369842529297 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 24075.0 144.69423913043477 0.0 - - - - - - - 211.0 48 6 1409 180 C20140704_OR005_02 C20140704_OR005_02 TB427041.[MT7]-LQVLPFEK[MT7].2y4_1.heavy 631.392 / 664.379 18584.0 38.30072498321533 39 15 10 6 8 1.4175465605057351 53.02532006098337 0.039897918701171875 4 0.953661352714203 5.710829710991514 18584.0 60.18365147564663 0.0 - - - - - - - 220.44444444444446 37 9 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1411 180 C20140704_OR005_02 C20140704_OR005_02 TB427041.[MT7]-LQVLPFEK[MT7].2y5_1.heavy 631.392 / 777.463 4072.0 38.30072498321533 39 15 10 6 8 1.4175465605057351 53.02532006098337 0.039897918701171875 4 0.953661352714203 5.710829710991514 4072.0 9.926313099041533 1.0 - - - - - - - 238.57142857142858 13 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1413 180 C20140704_OR005_02 C20140704_OR005_02 TB427041.[MT7]-LQVLPFEK[MT7].2b4_1.heavy 631.392 / 598.404 8457.0 38.30072498321533 39 15 10 6 8 1.4175465605057351 53.02532006098337 0.039897918701171875 4 0.953661352714203 5.710829710991514 8457.0 32.415610809298826 0.0 - - - - - - - 730.75 16 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1415 180 C20140704_OR005_02 C20140704_OR005_02 TB427041.[MT7]-LQVLPFEK[MT7].2y3_1.heavy 631.392 / 567.326 1357.0 38.30072498321533 39 15 10 6 8 1.4175465605057351 53.02532006098337 0.039897918701171875 4 0.953661352714203 5.710829710991514 1357.0 6.168181818181818 8.0 - - - - - - - 238.64285714285714 29 14 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1417 181 C20140704_OR005_02 C20140704_OR005_02 TB412843.[MT7]-AVFNGPYAHK[MT7].3y3_1.heavy 464.594 / 499.311 2864.0 25.529150009155273 35 13 8 6 8 2.051210314129725 39.41725905791311 0.03730010986328125 4 0.9209198264909871 4.359374045331886 2864.0 30.57078651685393 1.0 - - - - - - - 200.91666666666666 5 12 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1419 181 C20140704_OR005_02 C20140704_OR005_02 TB412843.[MT7]-AVFNGPYAHK[MT7].3b5_1.heavy 464.594 / 633.348 1611.0 25.529150009155273 35 13 8 6 8 2.051210314129725 39.41725905791311 0.03730010986328125 4 0.9209198264909871 4.359374045331886 1611.0 5.963104477611941 2.0 - - - - - - - 255.28571428571428 7 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1421 181 C20140704_OR005_02 C20140704_OR005_02 TB412843.[MT7]-AVFNGPYAHK[MT7].3b3_1.heavy 464.594 / 462.283 1700.0 25.529150009155273 35 13 8 6 8 2.051210314129725 39.41725905791311 0.03730010986328125 4 0.9209198264909871 4.359374045331886 1700.0 1.23463687150838 1.0 - - - - - - - 726.875 3 8 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1423 181 C20140704_OR005_02 C20140704_OR005_02 TB412843.[MT7]-AVFNGPYAHK[MT7].3y4_1.heavy 464.594 / 662.374 179.0 25.529150009155273 35 13 8 6 8 2.051210314129725 39.41725905791311 0.03730010986328125 4 0.9209198264909871 4.359374045331886 179.0 -0.333955223880597 30.0 - - - - - - - 0.0 1 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1425 182 C20140704_OR005_02 C20140704_OR005_02 TB427477.[MT7]-DTC[CAM]SPELLMSLIQTK[MT7].4b7_1.heavy 506.772 / 947.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 1427 182 C20140704_OR005_02 C20140704_OR005_02 TB427477.[MT7]-DTC[CAM]SPELLMSLIQTK[MT7].4b4_1.heavy 506.772 / 608.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 1429 182 C20140704_OR005_02 C20140704_OR005_02 TB427477.[MT7]-DTC[CAM]SPELLMSLIQTK[MT7].4y3_1.heavy 506.772 / 520.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 1431 182 C20140704_OR005_02 C20140704_OR005_02 TB427477.[MT7]-DTC[CAM]SPELLMSLIQTK[MT7].4b3_1.heavy 506.772 / 521.215 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 1433 183 C20140704_OR005_02 C20140704_OR005_02 TB450842.[MT7]-DYLPTVGALK[MT7].3y3_1.heavy 455.606 / 475.336 2492.0 36.39400100708008 42 12 10 10 10 1.82084069256475 41.323275798979225 0.0 3 0.8930436429361025 3.7394692580600797 2492.0 8.672953082266057 2.0 - - - - - - - 183.4 5 5 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1435 183 C20140704_OR005_02 C20140704_OR005_02 TB450842.[MT7]-DYLPTVGALK[MT7].3b5_1.heavy 455.606 / 734.384 1443.0 36.39400100708008 42 12 10 10 10 1.82084069256475 41.323275798979225 0.0 3 0.8930436429361025 3.7394692580600797 1443.0 -4.406106870229008 0.0 - - - - - - - 196.5 2 2 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1437 183 C20140704_OR005_02 C20140704_OR005_02 TB450842.[MT7]-DYLPTVGALK[MT7].3y4_1.heavy 455.606 / 532.357 14035.0 36.39400100708008 42 12 10 10 10 1.82084069256475 41.323275798979225 0.0 3 0.8930436429361025 3.7394692580600797 14035.0 61.13484383575313 0.0 - - - - - - - 189.33333333333334 28 9 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1439 183 C20140704_OR005_02 C20140704_OR005_02 TB450842.[MT7]-DYLPTVGALK[MT7].3b3_1.heavy 455.606 / 536.284 6559.0 36.39400100708008 42 12 10 10 10 1.82084069256475 41.323275798979225 0.0 3 0.8930436429361025 3.7394692580600797 6559.0 75.1030534351145 1.0 - - - - - - - 262.0 13 1 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1441 184 C20140704_OR005_02 C20140704_OR005_02 TB427470.[MT7]-GYGFVSFFNDVDVQK[MT7].3b6_1.heavy 670.679 / 755.385 6095.0 45.61980056762695 48 18 10 10 10 6.311521347673206 15.844040523900919 0.0 3 0.9848981460377342 10.029959115967378 6095.0 26.100546543182347 1.0 - - - - - - - 217.84615384615384 13 13 DAZL deleted in azoospermia-like 1443 184 C20140704_OR005_02 C20140704_OR005_02 TB427470.[MT7]-GYGFVSFFNDVDVQK[MT7].3y3_1.heavy 670.679 / 518.342 12191.0 45.61980056762695 48 18 10 10 10 6.311521347673206 15.844040523900919 0.0 3 0.9848981460377342 10.029959115967378 12191.0 22.260698487202 0.0 - - - - - - - 299.5 24 12 DAZL deleted in azoospermia-like 1445 184 C20140704_OR005_02 C20140704_OR005_02 TB427470.[MT7]-GYGFVSFFNDVDVQK[MT7].3b4_1.heavy 670.679 / 569.284 16000.0 45.61980056762695 48 18 10 10 10 6.311521347673206 15.844040523900919 0.0 3 0.9848981460377342 10.029959115967378 16000.0 40.51957880428542 0.0 - - - - - - - 367.375 32 8 DAZL deleted in azoospermia-like 1447 184 C20140704_OR005_02 C20140704_OR005_02 TB427470.[MT7]-GYGFVSFFNDVDVQK[MT7].3y4_1.heavy 670.679 / 633.369 16654.0 45.61980056762695 48 18 10 10 10 6.311521347673206 15.844040523900919 0.0 3 0.9848981460377342 10.029959115967378 16654.0 51.92486162889963 0.0 - - - - - - - 254.22222222222223 33 9 DAZL deleted in azoospermia-like 1449 185 C20140704_OR005_02 C20140704_OR005_02 TB412989.[MT7]-IVESQINFHGK[MT7].2y4_1.heavy 780.443 / 632.364 1135.0 28.86547565460205 41 16 10 5 10 3.346287686304676 29.88386217038935 0.040699005126953125 3 0.9657041350146994 6.644960471467425 1135.0 3.0246679873798517 1.0 - - - - - - - 309.5 2 2 DAZL deleted in azoospermia-like 1451 185 C20140704_OR005_02 C20140704_OR005_02 TB412989.[MT7]-IVESQINFHGK[MT7].2y8_1.heavy 780.443 / 1074.58 2166.0 28.86547565460205 41 16 10 5 10 3.346287686304676 29.88386217038935 0.040699005126953125 3 0.9657041350146994 6.644960471467425 2166.0 41.721786407766984 0.0 - - - - - - - 185.6 4 5 DAZL deleted in azoospermia-like 1453 185 C20140704_OR005_02 C20140704_OR005_02 TB412989.[MT7]-IVESQINFHGK[MT7].2y9_1.heavy 780.443 / 1203.62 825.0 28.86547565460205 41 16 10 5 10 3.346287686304676 29.88386217038935 0.040699005126953125 3 0.9657041350146994 6.644960471467425 825.0 2.135922330097087 0.0 - - - - - - - 0.0 1 0 DAZL deleted in azoospermia-like 1455 185 C20140704_OR005_02 C20140704_OR005_02 TB412989.[MT7]-IVESQINFHGK[MT7].2b5_1.heavy 780.443 / 701.395 1031.0 28.86547565460205 41 16 10 5 10 3.346287686304676 29.88386217038935 0.040699005126953125 3 0.9657041350146994 6.644960471467425 1031.0 7.006796116504853 0.0 - - - - - - - 180.375 2 8 DAZL deleted in azoospermia-like 1457 186 C20140704_OR005_02 C20140704_OR005_02 TB412986.[MT7]-QLSLPQQEAQK[MT7].3b6_1.heavy 519.966 / 811.479 1500.0 26.56190061569214 44 20 10 6 8 18.419101490816974 5.429146478717 0.03719902038574219 4 0.9986867340131 34.05167513822772 1500.0 22.31892137899647 0.0 - - - - - - - 196.8 3 10 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1459 186 C20140704_OR005_02 C20140704_OR005_02 TB412986.[MT7]-QLSLPQQEAQK[MT7].3b4_1.heavy 519.966 / 586.368 11247.0 26.56190061569214 44 20 10 6 8 18.419101490816974 5.429146478717 0.03719902038574219 4 0.9986867340131 34.05167513822772 11247.0 44.694480731707316 0.0 - - - - - - - 308.0 22 7 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1461 186 C20140704_OR005_02 C20140704_OR005_02 TB412986.[MT7]-QLSLPQQEAQK[MT7].3y4_1.heavy 519.966 / 619.353 3843.0 26.56190061569214 44 20 10 6 8 18.419101490816974 5.429146478717 0.03719902038574219 4 0.9986867340131 34.05167513822772 3843.0 37.40245989304813 0.0 - - - - - - - 249.88888888888889 7 9 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1463 186 C20140704_OR005_02 C20140704_OR005_02 TB412986.[MT7]-QLSLPQQEAQK[MT7].3y5_1.heavy 519.966 / 747.412 2437.0 26.56190061569214 44 20 10 6 8 18.419101490816974 5.429146478717 0.03719902038574219 4 0.9986867340131 34.05167513822772 2437.0 14.629631886120997 1.0 - - - - - - - 230.0909090909091 7 11 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1465 187 C20140704_OR005_02 C20140704_OR005_02 TB427257.[MT7]-TLELPGPSETGRR.3y10_2.heavy 519.622 / 535.291 3080.0 28.204424381256104 35 13 10 2 10 1.4837560602358846 52.17524344381731 0.08069992065429688 3 0.922423494782002 4.401988162949709 3080.0 2.466666666666667 2.0 - - - - - - - 267.1 6 10 ZBTB44 zinc finger and BTB domain containing 44 1467 187 C20140704_OR005_02 C20140704_OR005_02 TB427257.[MT7]-TLELPGPSETGRR.3b8_1.heavy 519.622 / 939.527 1540.0 28.204424381256104 35 13 10 2 10 1.4837560602358846 52.17524344381731 0.08069992065429688 3 0.922423494782002 4.401988162949709 1540.0 0.9654614676718327 2.0 - - - - - - - 231.125 3 8 ZBTB44 zinc finger and BTB domain containing 44 1469 187 C20140704_OR005_02 C20140704_OR005_02 TB427257.[MT7]-TLELPGPSETGRR.3b4_1.heavy 519.622 / 601.368 6672.0 28.204424381256104 35 13 10 2 10 1.4837560602358846 52.17524344381731 0.08069992065429688 3 0.922423494782002 4.401988162949709 6672.0 39.316342616778044 0.0 - - - - - - - 205.33333333333334 13 6 ZBTB44 zinc finger and BTB domain containing 44 1471 187 C20140704_OR005_02 C20140704_OR005_02 TB427257.[MT7]-TLELPGPSETGRR.3y9_1.heavy 519.622 / 956.491 1129.0 28.204424381256104 35 13 10 2 10 1.4837560602358846 52.17524344381731 0.08069992065429688 3 0.922423494782002 4.401988162949709 1129.0 0.8750304506699147 2.0 - - - - - - - 205.5 2 6 ZBTB44 zinc finger and BTB domain containing 44 1473 188 C20140704_OR005_02 C20140704_OR005_02 TB451107.[MT7]-GFK[MT7]LPDTPQGLLGEAR.3y7_1.heavy 663.045 / 715.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 1475 188 C20140704_OR005_02 C20140704_OR005_02 TB451107.[MT7]-GFK[MT7]LPDTPQGLLGEAR.3b4_1.heavy 663.045 / 734.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 1477 188 C20140704_OR005_02 C20140704_OR005_02 TB451107.[MT7]-GFK[MT7]LPDTPQGLLGEAR.3b3_1.heavy 663.045 / 621.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 1479 188 C20140704_OR005_02 C20140704_OR005_02 TB451107.[MT7]-GFK[MT7]LPDTPQGLLGEAR.3y9_1.heavy 663.045 / 940.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENG endoglin 1481 189 C20140704_OR005_02 C20140704_OR005_02 TB451108.[MT7]-K[MT7]PPPAK[MT7]PVIPTAAK[MT7].4y4_1.heavy 498.577 / 534.337 2268.0 23.160800457000732 33 13 6 6 8 1.1698504669641259 57.60396323362757 0.03280067443847656 4 0.929495185156811 4.620273543785963 2268.0 6.65 0.0 - - - - - - - 243.0 4 14 GLRB glycine receptor, beta 1483 189 C20140704_OR005_02 C20140704_OR005_02 TB451108.[MT7]-K[MT7]PPPAK[MT7]PVIPTAAK[MT7].4y5_1.heavy 498.577 / 631.39 3321.0 23.160800457000732 33 13 6 6 8 1.1698504669641259 57.60396323362757 0.03280067443847656 4 0.929495185156811 4.620273543785963 3321.0 2.2363636363636363 3.0 - - - - - - - 739.125 10 8 GLRB glycine receptor, beta 1485 189 C20140704_OR005_02 C20140704_OR005_02 TB451108.[MT7]-K[MT7]PPPAK[MT7]PVIPTAAK[MT7].4b8_2.heavy 498.577 / 624.414 2511.0 23.160800457000732 33 13 6 6 8 1.1698504669641259 57.60396323362757 0.03280067443847656 4 0.929495185156811 4.620273543785963 2511.0 1.3285714285714285 0.0 - - - - - - - 745.2 5 10 GLRB glycine receptor, beta 1487 189 C20140704_OR005_02 C20140704_OR005_02 TB451108.[MT7]-K[MT7]PPPAK[MT7]PVIPTAAK[MT7].4b6_2.heavy 498.577 / 526.353 972.0 23.160800457000732 33 13 6 6 8 1.1698504669641259 57.60396323362757 0.03280067443847656 4 0.929495185156811 4.620273543785963 972.0 -0.5 5.0 - - - - - - - 243.0 4 9 GLRB glycine receptor, beta 1489 190 C20140704_OR005_02 C20140704_OR005_02 TB427054.[MT7]-AVLLMDAEK[MT7].2y4_1.heavy 639.372 / 606.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 1491 190 C20140704_OR005_02 C20140704_OR005_02 TB427054.[MT7]-AVLLMDAEK[MT7].2y5_1.heavy 639.372 / 737.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 1493 190 C20140704_OR005_02 C20140704_OR005_02 TB427054.[MT7]-AVLLMDAEK[MT7].2y6_1.heavy 639.372 / 850.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 1495 190 C20140704_OR005_02 C20140704_OR005_02 TB427054.[MT7]-AVLLMDAEK[MT7].2y7_1.heavy 639.372 / 963.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 1497 191 C20140704_OR005_02 C20140704_OR005_02 TB412841.[MT7]-LVGQAEDENK[MT7].2y8_1.heavy 695.874 / 1034.49 5486.0 22.25790023803711 50 20 10 10 10 8.97382855601398 11.143515766521205 0.0 3 0.990499658341632 12.651683780332526 5486.0 97.23417452830188 0.0 - - - - - - - 159.2 10 5 ZBTB44 zinc finger and BTB domain containing 44 1499 191 C20140704_OR005_02 C20140704_OR005_02 TB412841.[MT7]-LVGQAEDENK[MT7].2y9_1.heavy 695.874 / 1133.56 4452.0 22.25790023803711 50 20 10 10 10 8.97382855601398 11.143515766521205 0.0 3 0.990499658341632 12.651683780332526 4452.0 73.5805 0.0 - - - - - - - 136.57142857142858 8 7 ZBTB44 zinc finger and BTB domain containing 44 1501 191 C20140704_OR005_02 C20140704_OR005_02 TB412841.[MT7]-LVGQAEDENK[MT7].2y3_1.heavy 695.874 / 534.3 2385.0 22.25790023803711 50 20 10 10 10 8.97382855601398 11.143515766521205 0.0 3 0.990499658341632 12.651683780332526 2385.0 54.556875 0.0 - - - - - - - 209.9090909090909 4 11 ZBTB44 zinc finger and BTB domain containing 44 1503 191 C20140704_OR005_02 C20140704_OR005_02 TB412841.[MT7]-LVGQAEDENK[MT7].2y6_1.heavy 695.874 / 849.407 3339.0 22.25790023803711 50 20 10 10 10 8.97382855601398 11.143515766521205 0.0 3 0.990499658341632 12.651683780332526 3339.0 20.27071129707113 0.0 - - - - - - - 218.75 6 4 ZBTB44 zinc finger and BTB domain containing 44 1505 192 C20140704_OR005_02 C20140704_OR005_02 TB412998.[MT7]-QYDVSYDTGDK[MT7].3b4_1.heavy 526.922 / 650.327 5878.0 24.67317533493042 42 16 10 6 10 3.148461007407798 31.7615494569305 0.03849983215332031 3 0.9601816282043806 6.164089122244813 5878.0 44.222393306882864 0.0 - - - - - - - 227.25 11 12 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1507 192 C20140704_OR005_02 C20140704_OR005_02 TB412998.[MT7]-QYDVSYDTGDK[MT7].3b5_1.heavy 526.922 / 737.359 5111.0 24.67317533493042 42 16 10 6 10 3.148461007407798 31.7615494569305 0.03849983215332031 3 0.9601816282043806 6.164089122244813 5111.0 22.97420729472141 0.0 - - - - - - - 223.625 10 8 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1509 192 C20140704_OR005_02 C20140704_OR005_02 TB412998.[MT7]-QYDVSYDTGDK[MT7].3y4_1.heavy 526.922 / 564.311 10053.0 24.67317533493042 42 16 10 6 10 3.148461007407798 31.7615494569305 0.03849983215332031 3 0.9601816282043806 6.164089122244813 10053.0 76.73728400735294 0.0 - - - - - - - 178.0 20 11 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1511 192 C20140704_OR005_02 C20140704_OR005_02 TB412998.[MT7]-QYDVSYDTGDK[MT7].3b3_1.heavy 526.922 / 551.258 15590.0 24.67317533493042 42 16 10 6 10 3.148461007407798 31.7615494569305 0.03849983215332031 3 0.9601816282043806 6.164089122244813 15590.0 46.85095663526271 0.0 - - - - - - - 247.2 31 10 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1513 193 C20140704_OR005_02 C20140704_OR005_02 TB412999.[MT7]-YLLLVIWGEGK[MT7].3b6_1.heavy 526.988 / 859.577 378.0 51.43174934387207 31 7 10 6 8 0.583694507849784 90.69909254731502 0.038501739501953125 4 0.7252520604558621 2.2983127341084706 378.0 8.85 0.0 - - - - - - - 0.0 0 0 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1515 193 C20140704_OR005_02 C20140704_OR005_02 TB412999.[MT7]-YLLLVIWGEGK[MT7].3y5_1.heavy 526.988 / 720.38 441.0 51.43174934387207 31 7 10 6 8 0.583694507849784 90.69909254731502 0.038501739501953125 4 0.7252520604558621 2.2983127341084706 441.0 0.0 1.0 - - - - - - - 0.0 1 0 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1517 193 C20140704_OR005_02 C20140704_OR005_02 TB412999.[MT7]-YLLLVIWGEGK[MT7].3b4_1.heavy 526.988 / 647.425 692.0 51.43174934387207 31 7 10 6 8 0.583694507849784 90.69909254731502 0.038501739501953125 4 0.7252520604558621 2.2983127341084706 692.0 -3.6613756613756614 0.0 - - - - - - - 0.0 1 0 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1519 193 C20140704_OR005_02 C20140704_OR005_02 TB412999.[MT7]-YLLLVIWGEGK[MT7].3b5_1.heavy 526.988 / 746.493 1322.0 51.43174934387207 31 7 10 6 8 0.583694507849784 90.69909254731502 0.038501739501953125 4 0.7252520604558621 2.2983127341084706 1322.0 15.388359788359788 0.0 - - - - - - - 168.0 2 6 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1521 194 C20140704_OR005_02 C20140704_OR005_02 TB450998.[MT7]-AVQHQALALNSSK[MT7].3y6_1.heavy 552.321 / 763.443 47127.0 22.896400451660156 48 18 10 10 10 4.161011219513793 24.032619650490833 0.0 3 0.9803774454360241 8.795729492760747 47127.0 359.82519866545346 0.0 - - - - - - - 193.0909090909091 94 11 RDM1 RAD52 motif 1 1523 194 C20140704_OR005_02 C20140704_OR005_02 TB450998.[MT7]-AVQHQALALNSSK[MT7].3b4_1.heavy 552.321 / 580.332 83947.0 22.896400451660156 48 18 10 10 10 4.161011219513793 24.032619650490833 0.0 3 0.9803774454360241 8.795729492760747 83947.0 448.63278589603783 0.0 - - - - - - - 271.72727272727275 167 11 RDM1 RAD52 motif 1 1525 194 C20140704_OR005_02 C20140704_OR005_02 TB450998.[MT7]-AVQHQALALNSSK[MT7].3y4_1.heavy 552.321 / 579.322 97085.0 22.896400451660156 48 18 10 10 10 4.161011219513793 24.032619650490833 0.0 3 0.9803774454360241 8.795729492760747 97085.0 665.0988539144471 0.0 - - - - - - - 242.5 194 12 RDM1 RAD52 motif 1 1527 194 C20140704_OR005_02 C20140704_OR005_02 TB450998.[MT7]-AVQHQALALNSSK[MT7].3y5_1.heavy 552.321 / 692.406 42327.0 22.896400451660156 48 18 10 10 10 4.161011219513793 24.032619650490833 0.0 3 0.9803774454360241 8.795729492760747 42327.0 547.9232117571337 0.0 - - - - - - - 165.1 84 10 RDM1 RAD52 motif 1 1529 195 C20140704_OR005_02 C20140704_OR005_02 TB450850.[MT7]-TISVPDVEVK[MT7].2y4_1.heavy 687.908 / 618.394 4712.0 33.172000885009766 50 20 10 10 10 6.18953147165744 16.156311743128093 0.0 3 0.9949923803225098 17.432725940716203 4712.0 25.376872863363197 0.0 - - - - - - - 308.15384615384613 9 13 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1531 195 C20140704_OR005_02 C20140704_OR005_02 TB450850.[MT7]-TISVPDVEVK[MT7].2y8_1.heavy 687.908 / 1016.57 3298.0 33.172000885009766 50 20 10 10 10 6.18953147165744 16.156311743128093 0.0 3 0.9949923803225098 17.432725940716203 3298.0 34.88125445320091 0.0 - - - - - - - 235.75 6 4 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1533 195 C20140704_OR005_02 C20140704_OR005_02 TB450850.[MT7]-TISVPDVEVK[MT7].2y3_1.heavy 687.908 / 519.326 1767.0 33.172000885009766 50 20 10 10 10 6.18953147165744 16.156311743128093 0.0 3 0.9949923803225098 17.432725940716203 1767.0 2.8509554140127387 0.0 - - - - - - - 331.90909090909093 3 11 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1535 195 C20140704_OR005_02 C20140704_OR005_02 TB450850.[MT7]-TISVPDVEVK[MT7].2y6_1.heavy 687.908 / 830.474 14371.0 33.172000885009766 50 20 10 10 10 6.18953147165744 16.156311743128093 0.0 3 0.9949923803225098 17.432725940716203 14371.0 57.78089697921634 0.0 - - - - - - - 314.0 28 6 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1537 196 C20140704_OR005_02 C20140704_OR005_02 TB427408.[MT7]-NFSTSNLNTDFLAK[MT7].2y4_1.heavy 930.491 / 622.404 1465.0 37.37409973144531 47 17 10 10 10 2.631404232136621 38.00252305545735 0.0 3 0.9739259929763453 7.626236818103104 1465.0 11.207650273224044 0.0 - - - - - - - 228.75 2 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1539 196 C20140704_OR005_02 C20140704_OR005_02 TB427408.[MT7]-NFSTSNLNTDFLAK[MT7].2b6_1.heavy 930.491 / 795.375 854.0 37.37409973144531 47 17 10 10 10 2.631404232136621 38.00252305545735 0.0 3 0.9739259929763453 7.626236818103104 854.0 4.0249999999999995 3.0 - - - - - - - 0.0 1 0 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1541 196 C20140704_OR005_02 C20140704_OR005_02 TB427408.[MT7]-NFSTSNLNTDFLAK[MT7].2b10_1.heavy 930.491 / 1238.58 854.0 37.37409973144531 47 17 10 10 10 2.631404232136621 38.00252305545735 0.0 3 0.9739259929763453 7.626236818103104 854.0 2.45 4.0 - - - - - - - 0.0 1 0 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1543 196 C20140704_OR005_02 C20140704_OR005_02 TB427408.[MT7]-NFSTSNLNTDFLAK[MT7].2y7_1.heavy 930.491 / 952.522 854.0 37.37409973144531 47 17 10 10 10 2.631404232136621 38.00252305545735 0.0 3 0.9739259929763453 7.626236818103104 854.0 2.1079193205944797 3.0 - - - - - - - 228.75 2 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1545 197 C20140704_OR005_02 C20140704_OR005_02 TB426828.[MT7]-SSPLQK[MT7].2y4_1.heavy 474.292 / 629.41 9511.0 19.971975326538086 43 20 10 5 8 18.205597498667615 5.4928161521377445 0.04290008544921875 4 0.9911202494688467 13.086999746498778 9511.0 78.104903599879 0.0 - - - - - - - 183.1 19 10 F2R coagulation factor II (thrombin) receptor 1547 197 C20140704_OR005_02 C20140704_OR005_02 TB426828.[MT7]-SSPLQK[MT7].2y5_1.heavy 474.292 / 716.442 4861.0 19.971975326538086 43 20 10 5 8 18.205597498667615 5.4928161521377445 0.04290008544921875 4 0.9911202494688467 13.086999746498778 4861.0 80.44043870314081 0.0 - - - - - - - 133.6 9 10 F2R coagulation factor II (thrombin) receptor 1549 197 C20140704_OR005_02 C20140704_OR005_02 TB426828.[MT7]-SSPLQK[MT7].2b4_1.heavy 474.292 / 529.31 1761.0 19.971975326538086 43 20 10 5 8 18.205597498667615 5.4928161521377445 0.04290008544921875 4 0.9911202494688467 13.086999746498778 1761.0 7.821116223290783 1.0 - - - - - - - 231.28571428571428 4 7 F2R coagulation factor II (thrombin) receptor 1551 197 C20140704_OR005_02 C20140704_OR005_02 TB426828.[MT7]-SSPLQK[MT7].2y3_1.heavy 474.292 / 532.357 1761.0 19.971975326538086 43 20 10 5 8 18.205597498667615 5.4928161521377445 0.04290008544921875 4 0.9911202494688467 13.086999746498778 1761.0 7.505900299949197 1.0 - - - - - - - 197.2 4 10 F2R coagulation factor II (thrombin) receptor 1553 198 C20140704_OR005_02 C20140704_OR005_02 TB413397.[MT7]-LTQIVVDHVIAEDGQYDVMFLGTDIGTVLK[MT7].4b8_2.heavy 895.232 / 525.807 2262.0 52.247050285339355 41 15 10 6 10 1.5693981965617327 50.902272575394235 0.033802032470703125 3 0.9525589481745914 5.643559844084721 2262.0 36.02444444444444 0.0 - - - - - - - 161.76923076923077 4 13 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1555 198 C20140704_OR005_02 C20140704_OR005_02 TB413397.[MT7]-LTQIVVDHVIAEDGQYDVMFLGTDIGTVLK[MT7].4b7_1.heavy 895.232 / 913.547 1508.0 52.247050285339355 41 15 10 6 10 1.5693981965617327 50.902272575394235 0.033802032470703125 3 0.9525589481745914 5.643559844084721 1508.0 13.141795401349306 0.0 - - - - - - - 221.44444444444446 3 18 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1557 198 C20140704_OR005_02 C20140704_OR005_02 TB413397.[MT7]-LTQIVVDHVIAEDGQYDVMFLGTDIGTVLK[MT7].4b4_1.heavy 895.232 / 600.384 2316.0 52.247050285339355 41 15 10 6 10 1.5693981965617327 50.902272575394235 0.033802032470703125 3 0.9525589481745914 5.643559844084721 2316.0 5.707837336408765 0.0 - - - - - - - 161.64705882352942 4 17 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1559 198 C20140704_OR005_02 C20140704_OR005_02 TB413397.[MT7]-LTQIVVDHVIAEDGQYDVMFLGTDIGTVLK[MT7].4b5_1.heavy 895.232 / 699.452 1508.0 52.247050285339355 41 15 10 6 10 1.5693981965617327 50.902272575394235 0.033802032470703125 3 0.9525589481745914 5.643559844084721 1508.0 22.340740740740742 0.0 - - - - - - - 114.625 3 16 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1561 199 C20140704_OR005_02 C20140704_OR005_02 TB413396.[MT7]-LTQIVVDHVIAEDGQYDVMFLGTDIGTVLK[MT7].3b4_1.heavy 1193.31 / 600.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1563 199 C20140704_OR005_02 C20140704_OR005_02 TB413396.[MT7]-LTQIVVDHVIAEDGQYDVMFLGTDIGTVLK[MT7].3b5_1.heavy 1193.31 / 699.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1565 199 C20140704_OR005_02 C20140704_OR005_02 TB413396.[MT7]-LTQIVVDHVIAEDGQYDVMFLGTDIGTVLK[MT7].3y5_1.heavy 1193.31 / 661.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1567 199 C20140704_OR005_02 C20140704_OR005_02 TB413396.[MT7]-LTQIVVDHVIAEDGQYDVMFLGTDIGTVLK[MT7].3b7_1.heavy 1193.31 / 913.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1569 200 C20140704_OR005_02 C20140704_OR005_02 TB427023.[MT7]-MMGVLLQC[CAM]SAILVK[MT7].3b6_1.heavy 617.688 / 789.448 8832.0 46.619598388671875 40 10 10 10 10 0.6227387336368149 83.77539462821264 0.0 3 0.8435214712439932 3.0782365935057494 8832.0 15.252872625068479 1.0 - - - - - - - 239.375 18 8 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1571 200 C20140704_OR005_02 C20140704_OR005_02 TB427023.[MT7]-MMGVLLQC[CAM]SAILVK[MT7].3y3_1.heavy 617.688 / 503.367 34050.0 46.619598388671875 40 10 10 10 10 0.6227387336368149 83.77539462821264 0.0 3 0.8435214712439932 3.0782365935057494 34050.0 169.4687334533517 0.0 - - - - - - - 202.1 68 10 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1573 200 C20140704_OR005_02 C20140704_OR005_02 TB427023.[MT7]-MMGVLLQC[CAM]SAILVK[MT7].3b4_1.heavy 617.688 / 563.28 16174.0 46.619598388671875 40 10 10 10 10 0.6227387336368149 83.77539462821264 0.0 3 0.8435214712439932 3.0782365935057494 16174.0 104.13272123971902 0.0 - - - - - - - 212.6 32 10 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1575 200 C20140704_OR005_02 C20140704_OR005_02 TB427023.[MT7]-MMGVLLQC[CAM]SAILVK[MT7].3b5_1.heavy 617.688 / 676.364 25537.0 46.619598388671875 40 10 10 10 10 0.6227387336368149 83.77539462821264 0.0 3 0.8435214712439932 3.0782365935057494 25537.0 250.45110725962107 0.0 - - - - - - - 248.33333333333334 51 9 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1577 201 C20140704_OR005_02 C20140704_OR005_02 TB412670.[MT7]-FWLMWK[MT7].3y3_1.heavy 400.228 / 608.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1579 201 C20140704_OR005_02 C20140704_OR005_02 TB412670.[MT7]-FWLMWK[MT7].3b4_1.heavy 400.228 / 722.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1581 201 C20140704_OR005_02 C20140704_OR005_02 TB412670.[MT7]-FWLMWK[MT7].3y4_2.heavy 400.228 / 361.213 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1583 201 C20140704_OR005_02 C20140704_OR005_02 TB412670.[MT7]-FWLMWK[MT7].3b3_1.heavy 400.228 / 591.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1585 202 C20140704_OR005_02 C20140704_OR005_02 TB426827.[MT7]-DLLAESR.2b3_1.heavy 474.268 / 486.304 10020.0 26.37420082092285 48 18 10 10 10 3.790223145183471 26.383670873594266 0.0 3 0.9804236115684098 8.80612879978653 10020.0 59.67270460118874 0.0 - - - - - - - 249.9090909090909 20 11 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1587 202 C20140704_OR005_02 C20140704_OR005_02 TB426827.[MT7]-DLLAESR.2y5_1.heavy 474.268 / 575.315 6680.0 26.37420082092285 48 18 10 10 10 3.790223145183471 26.383670873594266 0.0 3 0.9804236115684098 8.80612879978653 6680.0 11.398929979303494 0.0 - - - - - - - 235.7 13 10 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1589 202 C20140704_OR005_02 C20140704_OR005_02 TB426827.[MT7]-DLLAESR.2b4_1.heavy 474.268 / 557.341 6287.0 26.37420082092285 48 18 10 10 10 3.790223145183471 26.383670873594266 0.0 3 0.9804236115684098 8.80612879978653 6287.0 21.655093907767668 0.0 - - - - - - - 231.35714285714286 12 14 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1591 202 C20140704_OR005_02 C20140704_OR005_02 TB426827.[MT7]-DLLAESR.2y6_1.heavy 474.268 / 688.399 11985.0 26.37420082092285 48 18 10 10 10 3.790223145183471 26.383670873594266 0.0 3 0.9804236115684098 8.80612879978653 11985.0 40.00991731149543 0.0 - - - - - - - 240.9090909090909 23 11 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1593 203 C20140704_OR005_02 C20140704_OR005_02 TB427024.[MT7]-QQQLYIGSR.2b3_1.heavy 618.844 / 529.285 2471.0 25.761000156402588 43 17 10 6 10 3.0821851727833973 25.354841188762116 0.03719902038574219 3 0.9727492941045719 7.4590289198014075 2471.0 2.1984399375975037 1.0 - - - - - - - 253.6153846153846 4 13 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1595 203 C20140704_OR005_02 C20140704_OR005_02 TB427024.[MT7]-QQQLYIGSR.2y8_1.heavy 618.844 / 964.521 9059.0 25.761000156402588 43 17 10 6 10 3.0821851727833973 25.354841188762116 0.03719902038574219 3 0.9727492941045719 7.4590289198014075 9059.0 30.522001216980456 0.0 - - - - - - - 241.54545454545453 18 11 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1597 203 C20140704_OR005_02 C20140704_OR005_02 TB427024.[MT7]-QQQLYIGSR.2y5_1.heavy 618.844 / 595.32 4118.0 25.761000156402588 43 17 10 6 10 3.0821851727833973 25.354841188762116 0.03719902038574219 3 0.9727492941045719 7.4590289198014075 4118.0 43.55628211217132 0.0 - - - - - - - 252.0 8 12 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1599 203 C20140704_OR005_02 C20140704_OR005_02 TB427024.[MT7]-QQQLYIGSR.2b4_1.heavy 618.844 / 642.369 3660.0 25.761000156402588 43 17 10 6 10 3.0821851727833973 25.354841188762116 0.03719902038574219 3 0.9727492941045719 7.4590289198014075 3660.0 40.36582946390882 0.0 - - - - - - - 183.44444444444446 7 9 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1601 204 C20140704_OR005_02 C20140704_OR005_02 TB427027.[MT7]-AC[CAM]ADC[CAM]C[CAM]LAR.2y8_1.heavy 620.771 / 1025.4 2805.0 20.33639907836914 43 13 10 10 10 0.9688055470786667 64.14815609797964 0.0 3 0.9074094302777783 4.024108183060688 2805.0 52.69392857142857 0.0 - - - - - - - 154.0 5 5 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1603 204 C20140704_OR005_02 C20140704_OR005_02 TB427027.[MT7]-AC[CAM]ADC[CAM]C[CAM]LAR.2y5_1.heavy 620.771 / 679.301 2665.0 20.33639907836914 43 13 10 10 10 0.9688055470786667 64.14815609797964 0.0 3 0.9074094302777783 4.024108183060688 2665.0 17.766666666666666 0.0 - - - - - - - 230.14285714285714 5 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1605 204 C20140704_OR005_02 C20140704_OR005_02 TB427027.[MT7]-AC[CAM]ADC[CAM]C[CAM]LAR.2b4_1.heavy 620.771 / 562.241 1052.0 20.33639907836914 43 13 10 10 10 0.9688055470786667 64.14815609797964 0.0 3 0.9074094302777783 4.024108183060688 1052.0 2.8282983007258435 2.0 - - - - - - - 233.75 2 12 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1607 204 C20140704_OR005_02 C20140704_OR005_02 TB427027.[MT7]-AC[CAM]ADC[CAM]C[CAM]LAR.2y7_1.heavy 620.771 / 865.365 561.0 20.33639907836914 43 13 10 10 10 0.9688055470786667 64.14815609797964 0.0 3 0.9074094302777783 4.024108183060688 561.0 8.615357142857142 0.0 - - - - - - - 0.0 1 0 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1609 205 C20140704_OR005_02 C20140704_OR005_02 TB426925.[MT7]-AEHEEGK[MT7].2y4_1.heavy 544.285 / 606.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1611 205 C20140704_OR005_02 C20140704_OR005_02 TB426925.[MT7]-AEHEEGK[MT7].2y5_1.heavy 544.285 / 743.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1613 205 C20140704_OR005_02 C20140704_OR005_02 TB426925.[MT7]-AEHEEGK[MT7].2b4_1.heavy 544.285 / 611.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1615 205 C20140704_OR005_02 C20140704_OR005_02 TB426925.[MT7]-AEHEEGK[MT7].2y6_1.heavy 544.285 / 872.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1617 206 C20140704_OR005_02 C20140704_OR005_02 TB413394.[MT7]-TFNILNDFSPVEPNSSSLMETNPLEWPER.4y4_1.heavy 877.677 / 587.294 1275.0 51.42212390899658 42 16 10 6 10 2.2655952670046635 35.21006972369328 0.038501739501953125 3 0.9654146150841606 6.616927301122618 1275.0 4.370855148342059 0.0 - - - - - - - 173.0 2 14 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1619 206 C20140704_OR005_02 C20140704_OR005_02 TB413394.[MT7]-TFNILNDFSPVEPNSSSLMETNPLEWPER.4b4_1.heavy 877.677 / 620.352 1657.0 51.42212390899658 42 16 10 6 10 2.2655952670046635 35.21006972369328 0.038501739501953125 3 0.9654146150841606 6.616927301122618 1657.0 12.18892670157068 0.0 - - - - - - - 186.57142857142858 3 14 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1621 206 C20140704_OR005_02 C20140704_OR005_02 TB413394.[MT7]-TFNILNDFSPVEPNSSSLMETNPLEWPER.4y7_1.heavy 877.677 / 926.473 1211.0 51.42212390899658 42 16 10 6 10 2.2655952670046635 35.21006972369328 0.038501739501953125 3 0.9654146150841606 6.616927301122618 1211.0 10.821553677741502 1.0 - - - - - - - 191.0 2 16 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1623 206 C20140704_OR005_02 C20140704_OR005_02 TB413394.[MT7]-TFNILNDFSPVEPNSSSLMETNPLEWPER.4b3_1.heavy 877.677 / 507.268 1275.0 51.42212390899658 42 16 10 6 10 2.2655952670046635 35.21006972369328 0.038501739501953125 3 0.9654146150841606 6.616927301122618 1275.0 3.5559991250136713 1.0 - - - - - - - 191.0 2 13 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1625 207 C20140704_OR005_02 C20140704_OR005_02 TB450712.[MT7]-ALSDAFQK[MT7].2y4_1.heavy 584.334 / 637.379 29512.0 29.483999252319336 50 20 10 10 10 7.893699431040938 12.668331353834313 0.0 3 0.9950157742916089 17.47362330921497 29512.0 113.37283168316831 0.0 - - - - - - - 202.0 59 8 RDM1 RAD52 motif 1 1627 207 C20140704_OR005_02 C20140704_OR005_02 TB450712.[MT7]-ALSDAFQK[MT7].2b4_1.heavy 584.334 / 531.289 34263.0 29.483999252319336 50 20 10 10 10 7.893699431040938 12.668331353834313 0.0 3 0.9950157742916089 17.47362330921497 34263.0 94.09695110050575 0.0 - - - - - - - 232.3 68 10 RDM1 RAD52 motif 1 1629 207 C20140704_OR005_02 C20140704_OR005_02 TB450712.[MT7]-ALSDAFQK[MT7].2y6_1.heavy 584.334 / 839.438 19607.0 29.483999252319336 50 20 10 10 10 7.893699431040938 12.668331353834313 0.0 3 0.9950157742916089 17.47362330921497 19607.0 93.18178217821782 0.0 - - - - - - - 158.71428571428572 39 7 RDM1 RAD52 motif 1 1631 207 C20140704_OR005_02 C20140704_OR005_02 TB450712.[MT7]-ALSDAFQK[MT7].2y7_1.heavy 584.334 / 952.522 18900.0 29.483999252319336 50 20 10 10 10 7.893699431040938 12.668331353834313 0.0 3 0.9950157742916089 17.47362330921497 18900.0 97.3069306930693 0.0 - - - - - - - 235.66666666666666 37 6 RDM1 RAD52 motif 1 1633 208 C20140704_OR005_02 C20140704_OR005_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 142968.0 43.903900146484375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 142968.0 -0.3858279649298235 2.0 - - - - - - - 260.8 303 10 1635 208 C20140704_OR005_02 C20140704_OR005_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 214556.0 43.903900146484375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 214556.0 354.7646442787647 0.0 - - - - - - - 250.6 429 5 1637 208 C20140704_OR005_02 C20140704_OR005_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 239288.0 43.903900146484375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 239288.0 802.8633089064592 0.0 - - - - - - - 166.8 478 5 1639 209 C20140704_OR005_02 C20140704_OR005_02 TB413118.[MT7]-GRLVEC[CAM]LETVLNK[MT7].4b8_2.heavy 455.514 / 551.296 4260.0 41.203673362731934 33 7 10 6 10 1.108928536679038 76.5519466083443 0.031299591064453125 3 0.7057438745322165 2.2167872469066836 4260.0 23.432610145340554 0.0 - - - - - - - 322.5 8 6 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1641 209 C20140704_OR005_02 C20140704_OR005_02 TB413118.[MT7]-GRLVEC[CAM]LETVLNK[MT7].4b5_1.heavy 455.514 / 699.427 290.0 41.203673362731934 33 7 10 6 10 1.108928536679038 76.5519466083443 0.031299591064453125 3 0.7057438745322165 2.2167872469066836 290.0 0.09999999999999998 4.0 - - - - - - - 0.0 0 0 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1643 209 C20140704_OR005_02 C20140704_OR005_02 TB413118.[MT7]-GRLVEC[CAM]LETVLNK[MT7].4y3_1.heavy 455.514 / 518.342 2517.0 41.203673362731934 33 7 10 6 10 1.108928536679038 76.5519466083443 0.031299591064453125 3 0.7057438745322165 2.2167872469066836 2517.0 45.40979381443299 0.0 - - - - - - - 217.875 5 8 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1645 209 C20140704_OR005_02 C20140704_OR005_02 TB413118.[MT7]-GRLVEC[CAM]LETVLNK[MT7].4b6_1.heavy 455.514 / 859.458 484.0 41.203673362731934 33 7 10 6 10 1.108928536679038 76.5519466083443 0.031299591064453125 3 0.7057438745322165 2.2167872469066836 484.0 0.0 0.0 - - - - - - - 0.0 0 0 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1647 210 C20140704_OR005_02 C20140704_OR005_02 TB427553.[MT7]-ALMMESGTTMVGYQPQGDK[MT7].3b6_1.heavy 778.046 / 807.386 1723.0 34.947200775146484 48 18 10 10 10 4.991609585355998 20.033618072489553 0.0 3 0.9883021911328569 11.399500987528468 1723.0 21.505112781954885 0.0 - - - - - - - 166.0 3 4 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1649 210 C20140704_OR005_02 C20140704_OR005_02 TB427553.[MT7]-ALMMESGTTMVGYQPQGDK[MT7].3b5_1.heavy 778.046 / 720.354 5700.0 34.947200775146484 48 18 10 10 10 4.991609585355998 20.033618072489553 0.0 3 0.9883021911328569 11.399500987528468 5700.0 20.884922349303075 0.0 - - - - - - - 280.0 11 9 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1651 210 C20140704_OR005_02 C20140704_OR005_02 TB427553.[MT7]-ALMMESGTTMVGYQPQGDK[MT7].3y8_1.heavy 778.046 / 1036.52 4375.0 34.947200775146484 48 18 10 10 10 4.991609585355998 20.033618072489553 0.0 3 0.9883021911328569 11.399500987528468 4375.0 48.07187189672294 0.0 - - - - - - - 234.69230769230768 8 13 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1653 210 C20140704_OR005_02 C20140704_OR005_02 TB427553.[MT7]-ALMMESGTTMVGYQPQGDK[MT7].3y5_1.heavy 778.046 / 688.375 14582.0 34.947200775146484 48 18 10 10 10 4.991609585355998 20.033618072489553 0.0 3 0.9883021911328569 11.399500987528468 14582.0 46.442791857496715 0.0 - - - - - - - 243.33333333333334 29 6 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1655 211 C20140704_OR005_02 C20140704_OR005_02 TB450867.[MT7]-EYQDLLNVK[MT7].2b3_1.heavy 705.398 / 565.274 1358.0 34.70899963378906 48 20 10 10 8 9.41149334288216 10.62530635221978 0.0 4 0.9946212055842961 16.81996314237654 1358.0 7.468024265251084 1.0 - - - - - - - 197.3 2 10 DES;NEFM;NEFH;NEFL;VIM;INA desmin;neurofilament, medium polypeptide;neurofilament, heavy polypeptide;neurofilament, light polypeptide;vimentin;internexin neuronal intermediate filament protein, alpha 1657 211 C20140704_OR005_02 C20140704_OR005_02 TB450867.[MT7]-EYQDLLNVK[MT7].2b4_1.heavy 705.398 / 680.301 4321.0 34.70899963378906 48 20 10 10 8 9.41149334288216 10.62530635221978 0.0 4 0.9946212055842961 16.81996314237654 4321.0 24.40402834008097 0.0 - - - - - - - 219.33333333333334 8 9 DES;NEFM;NEFH;NEFL;VIM;INA desmin;neurofilament, medium polypeptide;neurofilament, heavy polypeptide;neurofilament, light polypeptide;vimentin;internexin neuronal intermediate filament protein, alpha 1659 211 C20140704_OR005_02 C20140704_OR005_02 TB450867.[MT7]-EYQDLLNVK[MT7].2y3_1.heavy 705.398 / 504.326 2345.0 34.70899963378906 48 20 10 10 8 9.41149334288216 10.62530635221978 0.0 4 0.9946212055842961 16.81996314237654 2345.0 16.96858113781624 1.0 - - - - - - - 329.1666666666667 4 6 DES;NEFM;NEFH;NEFL;VIM;INA desmin;neurofilament, medium polypeptide;neurofilament, heavy polypeptide;neurofilament, light polypeptide;vimentin;internexin neuronal intermediate filament protein, alpha 1661 211 C20140704_OR005_02 C20140704_OR005_02 TB450867.[MT7]-EYQDLLNVK[MT7].2b5_1.heavy 705.398 / 793.385 2099.0 34.70899963378906 48 20 10 10 8 9.41149334288216 10.62530635221978 0.0 4 0.9946212055842961 16.81996314237654 2099.0 4.92937683318132 1.0 - - - - - - - 320.8 7 5 DES;NEFM;NEFH;NEFL;VIM;INA desmin;neurofilament, medium polypeptide;neurofilament, heavy polypeptide;neurofilament, light polypeptide;vimentin;internexin neuronal intermediate filament protein, alpha 1663 212 C20140704_OR005_02 C20140704_OR005_02 TB413119.[MT7]-MQLESFGYTTDDLR.2b3_1.heavy 910.436 / 517.292 2489.0 38.47887420654297 39 13 10 6 10 1.2200025137895478 56.34962995748493 0.038299560546875 3 0.904496382041245 3.9612650667766913 2489.0 15.418584070796458 0.0 - - - - - - - 238.55555555555554 4 9 GLRB glycine receptor, beta 1665 212 C20140704_OR005_02 C20140704_OR005_02 TB413119.[MT7]-MQLESFGYTTDDLR.2y8_1.heavy 910.436 / 940.437 1357.0 38.47887420654297 39 13 10 6 10 1.2200025137895478 56.34962995748493 0.038299560546875 3 0.904496382041245 3.9612650667766913 1357.0 5.403982300884956 1.0 - - - - - - - 188.33333333333334 4 9 GLRB glycine receptor, beta 1667 212 C20140704_OR005_02 C20140704_OR005_02 TB413119.[MT7]-MQLESFGYTTDDLR.2b4_1.heavy 910.436 / 646.335 4185.0 38.47887420654297 39 13 10 6 10 1.2200025137895478 56.34962995748493 0.038299560546875 3 0.904496382041245 3.9612650667766913 4185.0 17.718071198712792 0.0 - - - - - - - 290.57142857142856 8 7 GLRB glycine receptor, beta 1669 212 C20140704_OR005_02 C20140704_OR005_02 TB413119.[MT7]-MQLESFGYTTDDLR.2y10_1.heavy 910.436 / 1174.54 2149.0 38.47887420654297 39 13 10 6 10 1.2200025137895478 56.34962995748493 0.038299560546875 3 0.904496382041245 3.9612650667766913 2149.0 27.480575221238936 0.0 - - - - - - - 236.27272727272728 4 11 GLRB glycine receptor, beta 1671 213 C20140704_OR005_02 C20140704_OR005_02 TB450865.[MT7]-SMDDDFGVVK[MT7].2y5_1.heavy 700.852 / 693.442 4377.0 31.838699340820312 45 15 10 10 10 5.157415392660053 19.389557052611725 0.0 3 0.9527152405888073 5.65295403387147 4377.0 45.75331282166032 0.0 - - - - - - - 291.6666666666667 8 6 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1673 213 C20140704_OR005_02 C20140704_OR005_02 TB450865.[MT7]-SMDDDFGVVK[MT7].2b4_1.heavy 700.852 / 593.236 5143.0 31.838699340820312 45 15 10 10 10 5.157415392660053 19.389557052611725 0.0 3 0.9527152405888073 5.65295403387147 5143.0 25.93265675464974 0.0 - - - - - - - 328.25 10 8 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1675 213 C20140704_OR005_02 C20140704_OR005_02 TB450865.[MT7]-SMDDDFGVVK[MT7].2b7_1.heavy 700.852 / 912.353 1860.0 31.838699340820312 45 15 10 10 10 5.157415392660053 19.389557052611725 0.0 3 0.9527152405888073 5.65295403387147 1860.0 8.053564287078903 0.0 - - - - - - - 246.0 3 4 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1677 213 C20140704_OR005_02 C20140704_OR005_02 TB450865.[MT7]-SMDDDFGVVK[MT7].2b5_1.heavy 700.852 / 708.263 5143.0 31.838699340820312 45 15 10 10 10 5.157415392660053 19.389557052611725 0.0 3 0.9527152405888073 5.65295403387147 5143.0 68.31479368271124 0.0 - - - - - - - 163.875 10 8 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1679 214 C20140704_OR005_02 C20140704_OR005_02 TB450862.[MT7]-FINLFPETK[MT7].2b3_1.heavy 698.908 / 519.305 2600.0 42.004000663757324 35 14 9 6 6 3.291137344089513 30.38463289281682 0.034801483154296875 6 0.9372504443965748 4.900715299620669 2600.0 0.0 3.0 - - - - - - - 257.14285714285717 9 14 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1681 214 C20140704_OR005_02 C20140704_OR005_02 TB450862.[MT7]-FINLFPETK[MT7].2y4_1.heavy 698.908 / 618.358 5400.0 42.004000663757324 35 14 9 6 6 3.291137344089513 30.38463289281682 0.034801483154296875 6 0.9372504443965748 4.900715299620669 5400.0 6.6825 2.0 - - - - - - - 190.0 12 10 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1683 214 C20140704_OR005_02 C20140704_OR005_02 TB450862.[MT7]-FINLFPETK[MT7].2y5_1.heavy 698.908 / 765.426 2800.0 42.004000663757324 35 14 9 6 6 3.291137344089513 30.38463289281682 0.034801483154296875 6 0.9372504443965748 4.900715299620669 2800.0 4.4799999999999995 1.0 - - - - - - - 184.6153846153846 5 13 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1685 214 C20140704_OR005_02 C20140704_OR005_02 TB450862.[MT7]-FINLFPETK[MT7].2b4_1.heavy 698.908 / 632.389 3300.0 42.004000663757324 35 14 9 6 6 3.291137344089513 30.38463289281682 0.034801483154296875 6 0.9372504443965748 4.900715299620669 3300.0 5.23695652173913 1.0 - - - - - - - 220.0 9 10 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1687 215 C20140704_OR005_02 C20140704_OR005_02 TB412485.[MT7]-EWFFLLSK[MT7].3y3_1.heavy 453.263 / 491.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 1689 215 C20140704_OR005_02 C20140704_OR005_02 TB412485.[MT7]-EWFFLLSK[MT7].3b4_1.heavy 453.263 / 754.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 1691 215 C20140704_OR005_02 C20140704_OR005_02 TB412485.[MT7]-EWFFLLSK[MT7].3y4_1.heavy 453.263 / 604.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 1693 215 C20140704_OR005_02 C20140704_OR005_02 TB412485.[MT7]-EWFFLLSK[MT7].3b3_1.heavy 453.263 / 607.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like 1695 216 C20140704_OR005_02 C20140704_OR005_02 TB412685.[MT7]-NADVELQQR.2y8_1.heavy 608.824 / 958.495 5279.0 21.620200157165527 39 13 10 6 10 1.8425264516978879 42.49404532008018 0.03940010070800781 3 0.9222029198063744 4.395660165614247 5279.0 47.5173224414164 1.0 - - - - - - - 133.7 10 10 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1697 216 C20140704_OR005_02 C20140704_OR005_02 TB412685.[MT7]-NADVELQQR.2b6_1.heavy 608.824 / 786.411 669.0 21.620200157165527 39 13 10 6 10 1.8425264516978879 42.49404532008018 0.03940010070800781 3 0.9222029198063744 4.395660165614247 669.0 13.462821059314347 0.0 - - - - - - - 0.0 1 0 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1699 216 C20140704_OR005_02 C20140704_OR005_02 TB412685.[MT7]-NADVELQQR.2y6_1.heavy 608.824 / 772.431 4164.0 21.620200157165527 39 13 10 6 10 1.8425264516978879 42.49404532008018 0.03940010070800781 3 0.9222029198063744 4.395660165614247 4164.0 41.95705901826828 0.0 - - - - - - - 123.88888888888889 8 9 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1701 216 C20140704_OR005_02 C20140704_OR005_02 TB412685.[MT7]-NADVELQQR.2y7_1.heavy 608.824 / 887.458 1785.0 21.620200157165527 39 13 10 6 10 1.8425264516978879 42.49404532008018 0.03940010070800781 3 0.9222029198063744 4.395660165614247 1785.0 18.38613928431697 0.0 - - - - - - - 141.9090909090909 3 11 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1703 217 C20140704_OR005_02 C20140704_OR005_02 TB412687.[MT7]-SLLVLTRK[MT7].3y6_1.heavy 406.611 / 873.6 N/A 30.997699737548828 46 16 10 10 10 2.160063316098344 37.47318196494729 0.0 3 0.9686596083994284 6.952953739036701 117.0 2.0 3.0 - - - - - - - 0.0 0 0 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1705 217 C20140704_OR005_02 C20140704_OR005_02 TB412687.[MT7]-SLLVLTRK[MT7].3y5_1.heavy 406.611 / 760.516 2107.0 30.997699737548828 46 16 10 10 10 2.160063316098344 37.47318196494729 0.0 3 0.9686596083994284 6.952953739036701 2107.0 17.39625641025641 0.0 - - - - - - - 250.71428571428572 4 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1707 217 C20140704_OR005_02 C20140704_OR005_02 TB412687.[MT7]-SLLVLTRK[MT7].3b4_1.heavy 406.611 / 557.378 3394.0 30.997699737548828 46 16 10 10 10 2.160063316098344 37.47318196494729 0.0 3 0.9686596083994284 6.952953739036701 3394.0 35.753034188034185 0.0 - - - - - - - 234.0 6 5 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1709 217 C20140704_OR005_02 C20140704_OR005_02 TB412687.[MT7]-SLLVLTRK[MT7].3b3_1.heavy 406.611 / 458.31 10768.0 30.997699737548828 46 16 10 10 10 2.160063316098344 37.47318196494729 0.0 3 0.9686596083994284 6.952953739036701 10768.0 91.46456776396329 0.0 - - - - - - - 234.0 21 10 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1711 218 C20140704_OR005_02 C20140704_OR005_02 TB426817.[MT7]-LVGQAEDENK[MT7].3y3_1.heavy 464.252 / 534.3 5262.0 22.25790023803711 50 20 10 10 10 9.643249188922425 10.369948763210836 0.0 3 0.995013148656652 17.469018841820706 5262.0 79.90444444444444 0.0 - - - - - - - 147.27272727272728 10 11 ZBTB44 zinc finger and BTB domain containing 44 1713 218 C20140704_OR005_02 C20140704_OR005_02 TB426817.[MT7]-LVGQAEDENK[MT7].3b4_1.heavy 464.252 / 542.342 20483.0 22.25790023803711 50 20 10 10 10 9.643249188922425 10.369948763210836 0.0 3 0.995013148656652 17.469018841820706 20483.0 152.1473868312757 0.0 - - - - - - - 191.45454545454547 40 11 ZBTB44 zinc finger and BTB domain containing 44 1715 218 C20140704_OR005_02 C20140704_OR005_02 TB426817.[MT7]-LVGQAEDENK[MT7].3b5_1.heavy 464.252 / 613.379 6396.0 22.25790023803711 50 20 10 10 10 9.643249188922425 10.369948763210836 0.0 3 0.995013148656652 17.469018841820706 6396.0 147.66074074074072 0.0 - - - - - - - 218.7 12 10 ZBTB44 zinc finger and BTB domain containing 44 1717 218 C20140704_OR005_02 C20140704_OR005_02 TB426817.[MT7]-LVGQAEDENK[MT7].3y4_1.heavy 464.252 / 649.327 7610.0 22.25790023803711 50 20 10 10 10 9.643249188922425 10.369948763210836 0.0 3 0.995013148656652 17.469018841820706 7610.0 136.2283950617284 0.0 - - - - - - - 108.0 15 3 ZBTB44 zinc finger and BTB domain containing 44 1719 219 C20140704_OR005_02 C20140704_OR005_02 TB427138.[MT7]-RIQEEYEK[MT7].2y4_1.heavy 691.88 / 712.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC13A4 solute carrier family 13 (sodium/sulfate symporters), member 4 1721 219 C20140704_OR005_02 C20140704_OR005_02 TB427138.[MT7]-RIQEEYEK[MT7].2y3_1.heavy 691.88 / 583.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC13A4 solute carrier family 13 (sodium/sulfate symporters), member 4 1723 219 C20140704_OR005_02 C20140704_OR005_02 TB427138.[MT7]-RIQEEYEK[MT7].2b7_1.heavy 691.88 / 1092.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC13A4 solute carrier family 13 (sodium/sulfate symporters), member 4 1725 219 C20140704_OR005_02 C20140704_OR005_02 TB427138.[MT7]-RIQEEYEK[MT7].2b5_1.heavy 691.88 / 800.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC13A4 solute carrier family 13 (sodium/sulfate symporters), member 4 1727 220 C20140704_OR005_02 C20140704_OR005_02 TB413387.[MT7]-TSVQFQNFSPTVVHPGDLQTQLAVQTK[MT7].4y5_1.heavy 815.439 / 690.427 3497.0 38.12174987792969 45 20 10 5 10 5.30635824428517 18.845316391462596 0.0410003662109375 3 0.9900587371241404 12.367478012958621 3497.0 7.606958370097056 0.0 - - - - - - - 239.75 6 8 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1729 220 C20140704_OR005_02 C20140704_OR005_02 TB413387.[MT7]-TSVQFQNFSPTVVHPGDLQTQLAVQTK[MT7].4b7_1.heavy 815.439 / 949.486 2256.0 38.12174987792969 45 20 10 5 10 5.30635824428517 18.845316391462596 0.0410003662109375 3 0.9900587371241404 12.367478012958621 2256.0 9.84045112579814 0.0 - - - - - - - 282.0 4 6 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1731 220 C20140704_OR005_02 C20140704_OR005_02 TB413387.[MT7]-TSVQFQNFSPTVVHPGDLQTQLAVQTK[MT7].4b4_1.heavy 815.439 / 560.316 7219.0 38.12174987792969 45 20 10 5 10 5.30635824428517 18.845316391462596 0.0410003662109375 3 0.9900587371241404 12.367478012958621 7219.0 21.288847006651885 0.0 - - - - - - - 282.0 14 8 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1733 220 C20140704_OR005_02 C20140704_OR005_02 TB413387.[MT7]-TSVQFQNFSPTVVHPGDLQTQLAVQTK[MT7].4b5_1.heavy 815.439 / 707.385 1918.0 38.12174987792969 45 20 10 5 10 5.30635824428517 18.845316391462596 0.0410003662109375 3 0.9900587371241404 12.367478012958621 1918.0 5.35849223946785 0.0 - - - - - - - 375.8333333333333 3 6 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1735 221 C20140704_OR005_02 C20140704_OR005_02 TB427136.[MT7]-IITDRTGVSK[MT7].2y8_1.heavy 689.419 / 1007.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - DAZL deleted in azoospermia-like 1737 221 C20140704_OR005_02 C20140704_OR005_02 TB427136.[MT7]-IITDRTGVSK[MT7].2y5_1.heavy 689.419 / 635.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - DAZL deleted in azoospermia-like 1739 221 C20140704_OR005_02 C20140704_OR005_02 TB427136.[MT7]-IITDRTGVSK[MT7].2b4_1.heavy 689.419 / 587.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - DAZL deleted in azoospermia-like 1741 221 C20140704_OR005_02 C20140704_OR005_02 TB427136.[MT7]-IITDRTGVSK[MT7].2y9_1.heavy 689.419 / 1120.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - DAZL deleted in azoospermia-like 1743 222 C20140704_OR005_02 C20140704_OR005_02 TB451169.[MT7]-YFTSDGLPIGDLQPLPIQK[MT7].4y4_1.heavy 598.336 / 629.41 2315.0 44.34614944458008 35 10 10 5 10 0.675641685412167 77.6380493527571 0.04270172119140625 3 0.8364402559199245 3.0089763784747716 2315.0 14.396768645324963 0.0 - - - - - - - 303.0 4 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1745 222 C20140704_OR005_02 C20140704_OR005_02 TB451169.[MT7]-YFTSDGLPIGDLQPLPIQK[MT7].4b7_1.heavy 598.336 / 928.453 3183.0 44.34614944458008 35 10 10 5 10 0.675641685412167 77.6380493527571 0.04270172119140625 3 0.8364402559199245 3.0089763784747716 3183.0 21.587128027681658 0.0 - - - - - - - 192.5 6 2 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1747 222 C20140704_OR005_02 C20140704_OR005_02 TB451169.[MT7]-YFTSDGLPIGDLQPLPIQK[MT7].4b5_1.heavy 598.336 / 758.348 1640.0 44.34614944458008 35 10 10 5 10 0.675641685412167 77.6380493527571 0.04270172119140625 3 0.8364402559199245 3.0089763784747716 1640.0 5.362409236782185 0.0 - - - - - - - 278.55555555555554 3 9 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1749 222 C20140704_OR005_02 C20140704_OR005_02 TB451169.[MT7]-YFTSDGLPIGDLQPLPIQK[MT7].4b6_1.heavy 598.336 / 815.369 5208.0 44.34614944458008 35 10 10 5 10 0.675641685412167 77.6380493527571 0.04270172119140625 3 0.8364402559199245 3.0089763784747716 5208.0 23.476476683937825 0.0 - - - - - - - 221.7 10 10 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1751 223 C20140704_OR005_02 C20140704_OR005_02 TB427132.[MT7]-TISVPDVEVK[MT7].3b6_1.heavy 458.941 / 757.421 1788.0 33.193599700927734 38 13 10 5 10 2.561488386609874 39.03980221918938 0.0431976318359375 3 0.9122654181228247 4.135703544461925 1788.0 8.690637945318972 0.0 - - - - - - - 191.5 3 4 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1753 223 C20140704_OR005_02 C20140704_OR005_02 TB427132.[MT7]-TISVPDVEVK[MT7].3y3_1.heavy 458.941 / 519.326 7664.0 33.193599700927734 38 13 10 5 10 2.561488386609874 39.03980221918938 0.0431976318359375 3 0.9122654181228247 4.135703544461925 7664.0 23.74108661596095 0.0 - - - - - - - 255.375 15 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1755 223 C20140704_OR005_02 C20140704_OR005_02 TB427132.[MT7]-TISVPDVEVK[MT7].3b4_1.heavy 458.941 / 545.341 2938.0 33.193599700927734 38 13 10 5 10 2.561488386609874 39.03980221918938 0.0431976318359375 3 0.9122654181228247 4.135703544461925 2938.0 18.1625 1.0 - - - - - - - 223.5 5 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1757 223 C20140704_OR005_02 C20140704_OR005_02 TB427132.[MT7]-TISVPDVEVK[MT7].3y4_1.heavy 458.941 / 618.394 1661.0 33.193599700927734 38 13 10 5 10 2.561488386609874 39.03980221918938 0.0431976318359375 3 0.9122654181228247 4.135703544461925 1661.0 0.18579418344519014 1.0 - - - - - - - 276.6666666666667 3 6 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1759 224 C20140704_OR005_02 C20140704_OR005_02 TB426912.[MT7]-IVVPMTK[MT7].2y4_1.heavy 538.343 / 620.356 49365.0 31.2208251953125 43 20 10 3 10 5.847780477395991 17.10050512096683 0.07249832153320312 3 0.9926299317047497 14.366782626324582 49365.0 501.47326083007897 0.0 - - - - - - - 279.1 98 10 C1orf101 chromosome 1 open reading frame 101 1761 224 C20140704_OR005_02 C20140704_OR005_02 TB426912.[MT7]-IVVPMTK[MT7].2y5_1.heavy 538.343 / 719.424 10552.0 31.2208251953125 43 20 10 3 10 5.847780477395991 17.10050512096683 0.07249832153320312 3 0.9926299317047497 14.366782626324582 10552.0 28.57678044705434 0.0 - - - - - - - 218.4 21 10 C1orf101 chromosome 1 open reading frame 101 1763 224 C20140704_OR005_02 C20140704_OR005_02 TB426912.[MT7]-IVVPMTK[MT7].2y3_1.heavy 538.343 / 523.303 5943.0 31.2208251953125 43 20 10 3 10 5.847780477395991 17.10050512096683 0.07249832153320312 3 0.9926299317047497 14.366782626324582 5943.0 12.181731958762887 0.0 - - - - - - - 288.125 11 8 C1orf101 chromosome 1 open reading frame 101 1765 224 C20140704_OR005_02 C20140704_OR005_02 TB426912.[MT7]-IVVPMTK[MT7].2y6_1.heavy 538.343 / 818.493 9218.0 31.2208251953125 43 20 10 3 10 5.847780477395991 17.10050512096683 0.07249832153320312 3 0.9926299317047497 14.366782626324582 9218.0 25.843190891582644 0.0 - - - - - - - 264.72727272727275 18 11 C1orf101 chromosome 1 open reading frame 101 1767 225 C20140704_OR005_02 C20140704_OR005_02 TB413381.[MT7]-IVSSASTDLQDYTYYFVPAPWLSVK[MT7].4y4_1.heavy 785.412 / 590.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1769 225 C20140704_OR005_02 C20140704_OR005_02 TB413381.[MT7]-IVSSASTDLQDYTYYFVPAPWLSVK[MT7].4b8_1.heavy 785.412 / 905.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1771 225 C20140704_OR005_02 C20140704_OR005_02 TB413381.[MT7]-IVSSASTDLQDYTYYFVPAPWLSVK[MT7].4y6_1.heavy 785.412 / 873.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1773 225 C20140704_OR005_02 C20140704_OR005_02 TB413381.[MT7]-IVSSASTDLQDYTYYFVPAPWLSVK[MT7].4b6_1.heavy 785.412 / 689.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1775 226 C20140704_OR005_02 C20140704_OR005_02 TB413242.[MT7]-TQILEWAAERGPITSAAELNDPQSILLR.3y7_1.heavy 1079.58 / 826.515 10763.0 45.90225028991699 38 17 10 1 10 2.021755669032248 39.35893324642644 0.090301513671875 3 0.9720491874741557 7.364586263615104 10763.0 38.744328998444274 0.0 - - - - - - - 265.55555555555554 21 9 ENG endoglin 1777 226 C20140704_OR005_02 C20140704_OR005_02 TB413242.[MT7]-TQILEWAAERGPITSAAELNDPQSILLR.3b4_1.heavy 1079.58 / 600.384 2718.0 45.90225028991699 38 17 10 1 10 2.021755669032248 39.35893324642644 0.090301513671875 3 0.9720491874741557 7.364586263615104 2718.0 12.918214512375714 0.0 - - - - - - - 295.14285714285717 5 7 ENG endoglin 1779 226 C20140704_OR005_02 C20140704_OR005_02 TB413242.[MT7]-TQILEWAAERGPITSAAELNDPQSILLR.3y10_1.heavy 1079.58 / 1168.67 1305.0 45.90225028991699 38 17 10 1 10 2.021755669032248 39.35893324642644 0.090301513671875 3 0.9720491874741557 7.364586263615104 1305.0 13.173853211009174 1.0 - - - - - - - 181.33333333333334 2 6 ENG endoglin 1781 226 C20140704_OR005_02 C20140704_OR005_02 TB413242.[MT7]-TQILEWAAERGPITSAAELNDPQSILLR.3y9_1.heavy 1079.58 / 1055.58 2935.0 45.90225028991699 38 17 10 1 10 2.021755669032248 39.35893324642644 0.090301513671875 3 0.9720491874741557 7.364586263615104 2935.0 13.885247522794248 0.0 - - - - - - - 271.75 5 4 ENG endoglin 1783 227 C20140704_OR005_02 C20140704_OR005_02 TB426919.[MT7]-VTLADFK[MT7].2y4_1.heavy 541.328 / 624.347 11784.0 35.3765983581543 43 13 10 10 10 1.3094948831628819 52.409263549992886 0.0 3 0.9264595868314566 4.522735519045243 11784.0 60.69871698113207 0.0 - - - - - - - 264.75 23 8 DVL1;DVL3 dishevelled, dsh homolog 1 (Drosophila);dishevelled, dsh homolog 3 (Drosophila) 1785 227 C20140704_OR005_02 C20140704_OR005_02 TB426919.[MT7]-VTLADFK[MT7].2y3_1.heavy 541.328 / 553.31 7547.0 35.3765983581543 43 13 10 10 10 1.3094948831628819 52.409263549992886 0.0 3 0.9264595868314566 4.522735519045243 7547.0 79.94685105774728 0.0 - - - - - - - 238.2 15 5 DVL1;DVL3 dishevelled, dsh homolog 1 (Drosophila);dishevelled, dsh homolog 3 (Drosophila) 1787 227 C20140704_OR005_02 C20140704_OR005_02 TB426919.[MT7]-VTLADFK[MT7].2y6_1.heavy 541.328 / 838.479 13505.0 35.3765983581543 43 13 10 10 10 1.3094948831628819 52.409263549992886 0.0 3 0.9264595868314566 4.522735519045243 13505.0 117.51622996336157 0.0 - - - - - - - 185.2 27 5 DVL1;DVL3 dishevelled, dsh homolog 1 (Drosophila);dishevelled, dsh homolog 3 (Drosophila) 1789 227 C20140704_OR005_02 C20140704_OR005_02 TB426919.[MT7]-VTLADFK[MT7].2b5_1.heavy 541.328 / 644.374 18139.0 35.3765983581543 43 13 10 10 10 1.3094948831628819 52.409263549992886 0.0 3 0.9264595868314566 4.522735519045243 18139.0 81.26830225315992 0.0 - - - - - - - 220.66666666666666 36 3 DVL1;DVL3 dishevelled, dsh homolog 1 (Drosophila);dishevelled, dsh homolog 3 (Drosophila) 1791 228 C20140704_OR005_02 C20140704_OR005_02 TB412587.[MT7]-RTETDFSNLFAR.3y6_1.heavy 534.278 / 707.383 7161.0 35.60540008544922 35 5 10 10 10 0.4458568066956673 102.17714613745679 0.0 3 0.673838750064371 2.0992543088237405 7161.0 60.334017623243625 0.0 - - - - - - - 265.3333333333333 14 6 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1793 228 C20140704_OR005_02 C20140704_OR005_02 TB412587.[MT7]-RTETDFSNLFAR.3b5_1.heavy 534.278 / 747.375 3050.0 35.60540008544922 35 5 10 10 10 0.4458568066956673 102.17714613745679 0.0 3 0.673838750064371 2.0992543088237405 3050.0 9.007547169811321 1.0 - - - - - - - 221.0 6 3 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1795 228 C20140704_OR005_02 C20140704_OR005_02 TB412587.[MT7]-RTETDFSNLFAR.3y4_1.heavy 534.278 / 506.309 N/A 35.60540008544922 35 5 10 10 10 0.4458568066956673 102.17714613745679 0.0 3 0.673838750064371 2.0992543088237405 6100.0 0.7980788531204962 5.0 - - - - - - - 331.5 15 4 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1797 228 C20140704_OR005_02 C20140704_OR005_02 TB412587.[MT7]-RTETDFSNLFAR.3y5_1.heavy 534.278 / 620.352 7957.0 35.60540008544922 35 5 10 10 10 0.4458568066956673 102.17714613745679 0.0 3 0.673838750064371 2.0992543088237405 7957.0 18.81340044299489 0.0 - - - - - - - 353.6666666666667 15 6 GAD1 glutamate decarboxylase 1 (brain, 67kDa) 1799 229 C20140704_OR005_02 C20140704_OR005_02 TB427522.[MT7]-AMVDIILLLSDK[MT7]DPPK[MT7].4y8_2.heavy 550.83 / 594.347 4108.0 48.552799224853516 45 15 10 10 10 3.907841508077586 25.5895741404297 0.0 3 0.95556884139114 5.833071127280696 4108.0 40.201283422459895 0.0 - - - - - - - 140.0 8 4 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1801 229 C20140704_OR005_02 C20140704_OR005_02 TB427522.[MT7]-AMVDIILLLSDK[MT7]DPPK[MT7].4b4_1.heavy 550.83 / 561.282 12511.0 48.552799224853516 45 15 10 10 10 3.907841508077586 25.5895741404297 0.0 3 0.95556884139114 5.833071127280696 12511.0 14.891184321987403 1.0 - - - - - - - 264.3333333333333 27 6 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1803 229 C20140704_OR005_02 C20140704_OR005_02 TB427522.[MT7]-AMVDIILLLSDK[MT7]DPPK[MT7].4b5_1.heavy 550.83 / 674.366 8590.0 48.552799224853516 45 15 10 10 10 3.907841508077586 25.5895741404297 0.0 3 0.95556884139114 5.833071127280696 8590.0 75.08211229946524 0.0 - - - - - - - 249.0 17 6 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1805 229 C20140704_OR005_02 C20140704_OR005_02 TB427522.[MT7]-AMVDIILLLSDK[MT7]DPPK[MT7].4b6_1.heavy 550.83 / 787.45 4762.0 48.552799224853516 45 15 10 10 10 3.907841508077586 25.5895741404297 0.0 3 0.95556884139114 5.833071127280696 4762.0 68.19443678955453 0.0 - - - - - - - 130.4 9 5 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1807 230 C20140704_OR005_02 C20140704_OR005_02 TB450970.[MT7]-TFVLTPELSPGK[MT7].3b4_1.heavy 526.311 / 605.378 1838.0 37.39629936218262 35 10 10 5 10 92.64054002494503 1.0794410306014335 0.044399261474609375 3 0.8381200843303299 3.024998682209582 1838.0 27.34551145038168 1.0 - - - - - - - 236.2 3 5 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1809 230 C20140704_OR005_02 C20140704_OR005_02 TB450970.[MT7]-TFVLTPELSPGK[MT7].3b5_1.heavy 526.311 / 706.426 4201.0 37.39629936218262 35 10 10 5 10 92.64054002494503 1.0794410306014335 0.044399261474609375 3 0.8381200843303299 3.024998682209582 4201.0 42.6026003541056 0.0 - - - - - - - 223.2 8 10 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1811 230 C20140704_OR005_02 C20140704_OR005_02 TB450970.[MT7]-TFVLTPELSPGK[MT7].3y4_1.heavy 526.311 / 532.321 6433.0 37.39629936218262 35 10 10 5 10 92.64054002494503 1.0794410306014335 0.044399261474609375 3 0.8381200843303299 3.024998682209582 6433.0 5.109824663749798 1.0 - - - - - - - 187.57142857142858 12 7 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1813 230 C20140704_OR005_02 C20140704_OR005_02 TB450970.[MT7]-TFVLTPELSPGK[MT7].3b7_1.heavy 526.311 / 932.521 2626.0 37.39629936218262 35 10 10 5 10 92.64054002494503 1.0794410306014335 0.044399261474609375 3 0.8381200843303299 3.024998682209582 2626.0 20.71229898864649 0.0 - - - - - - - 295.75 5 4 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1815 231 C20140704_OR005_02 C20140704_OR005_02 TB451063.[MT7]-LPLPAERVTLADFK[MT7].3y3_1.heavy 620.04 / 553.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 1817 231 C20140704_OR005_02 C20140704_OR005_02 TB451063.[MT7]-LPLPAERVTLADFK[MT7].3y6_1.heavy 620.04 / 838.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 1819 231 C20140704_OR005_02 C20140704_OR005_02 TB451063.[MT7]-LPLPAERVTLADFK[MT7].3y11_2.heavy 620.04 / 695.894 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 1821 231 C20140704_OR005_02 C20140704_OR005_02 TB451063.[MT7]-LPLPAERVTLADFK[MT7].3y13_2.heavy 620.04 / 800.963 N/A N/A - - - - - - - - - 0.0 - - - - - - - DVL3 dishevelled, dsh homolog 3 (Drosophila) 1823 232 C20140704_OR005_02 C20140704_OR005_02 TB450876.[MT7]-VVLAAC[CAM]SDFFR.2y8_1.heavy 714.875 / 973.42 14604.0 40.46099853515625 44 14 10 10 10 4.47504998673255 22.346119104026997 0.0 3 0.9321759382490751 4.711777048396344 14604.0 45.090922524832635 0.0 - - - - - - - 312.0 29 9 ZBTB44 zinc finger and BTB domain containing 44 1825 232 C20140704_OR005_02 C20140704_OR005_02 TB450876.[MT7]-VVLAAC[CAM]SDFFR.2y9_1.heavy 714.875 / 1086.5 11121.0 40.46099853515625 44 14 10 10 10 4.47504998673255 22.346119104026997 0.0 3 0.9321759382490751 4.711777048396344 11121.0 69.24133333333334 0.0 - - - - - - - 241.84615384615384 22 13 ZBTB44 zinc finger and BTB domain containing 44 1827 232 C20140704_OR005_02 C20140704_OR005_02 TB450876.[MT7]-VVLAAC[CAM]SDFFR.2y10_1.heavy 714.875 / 1185.57 5841.0 40.46099853515625 44 14 10 10 10 4.47504998673255 22.346119104026997 0.0 3 0.9321759382490751 4.711777048396344 5841.0 40.00228011869436 0.0 - - - - - - - 243.5 11 12 ZBTB44 zinc finger and BTB domain containing 44 1829 232 C20140704_OR005_02 C20140704_OR005_02 TB450876.[MT7]-VVLAAC[CAM]SDFFR.2y7_1.heavy 714.875 / 902.383 9661.0 40.46099853515625 44 14 10 10 10 4.47504998673255 22.346119104026997 0.0 3 0.9321759382490751 4.711777048396344 9661.0 95.34527834265378 0.0 - - - - - - - 179.6 19 10 ZBTB44 zinc finger and BTB domain containing 44 1831 233 C20140704_OR005_02 C20140704_OR005_02 TB413374.[MT7]-LTLNVIENEQMENTQRAEHEEGK[MT7].4y5_1.heavy 750.879 / 743.38 1776.0 33.685298919677734 50 20 10 10 10 10.130151140122768 9.871521028341547 0.0 3 0.994651764587208 16.867991090085553 1776.0 0.28010161699177516 1.0 - - - - - - - 222.25 3 4 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1833 233 C20140704_OR005_02 C20140704_OR005_02 TB413374.[MT7]-LTLNVIENEQMENTQRAEHEEGK[MT7].4b4_1.heavy 750.879 / 586.368 28665.0 33.685298919677734 50 20 10 10 10 10.130151140122768 9.871521028341547 0.0 3 0.994651764587208 16.867991090085553 28665.0 45.91513979496738 0.0 - - - - - - - 225.77777777777777 57 9 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1835 233 C20140704_OR005_02 C20140704_OR005_02 TB413374.[MT7]-LTLNVIENEQMENTQRAEHEEGK[MT7].4y13_2.heavy 750.879 / 851.9 5327.0 33.685298919677734 50 20 10 10 10 10.130151140122768 9.871521028341547 0.0 3 0.994651764587208 16.867991090085553 5327.0 37.7503937007874 0.0 - - - - - - - 177.8 10 5 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1837 233 C20140704_OR005_02 C20140704_OR005_02 TB413374.[MT7]-LTLNVIENEQMENTQRAEHEEGK[MT7].4b5_1.heavy 750.879 / 685.437 21816.0 33.685298919677734 50 20 10 10 10 10.130151140122768 9.871521028341547 0.0 3 0.994651764587208 16.867991090085553 21816.0 98.48692913385827 0.0 - - - - - - - 301.625 43 8 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1839 234 C20140704_OR005_02 C20140704_OR005_02 TB413271.[MT7]-VFHYYGPALEFVQMIK[MT7].3b6_1.heavy 744.071 / 911.453 2147.0 44.07170104980469 43 13 10 10 10 1.9772545296927648 40.10726944411084 0.0 3 0.9062979372097583 3.9997863568837246 2147.0 19.259814476409268 0.0 - - - - - - - 295.0 4 4 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1841 234 C20140704_OR005_02 C20140704_OR005_02 TB413271.[MT7]-VFHYYGPALEFVQMIK[MT7].3y3_1.heavy 744.071 / 535.339 751.0 44.07170104980469 43 13 10 10 10 1.9772545296927648 40.10726944411084 0.0 3 0.9062979372097583 3.9997863568837246 751.0 3.493023255813954 10.0 - - - - - - - 178.83333333333334 3 6 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1843 234 C20140704_OR005_02 C20140704_OR005_02 TB413271.[MT7]-VFHYYGPALEFVQMIK[MT7].3b3_1.heavy 744.071 / 528.305 2469.0 44.07170104980469 43 13 10 10 10 1.9772545296927648 40.10726944411084 0.0 3 0.9062979372097583 3.9997863568837246 2469.0 4.455773802392377 2.0 - - - - - - - 204.8181818181818 6 11 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1845 234 C20140704_OR005_02 C20140704_OR005_02 TB413271.[MT7]-VFHYYGPALEFVQMIK[MT7].3b8_2.heavy 744.071 / 540.275 3435.0 44.07170104980469 43 13 10 10 10 1.9772545296927648 40.10726944411084 0.0 3 0.9062979372097583 3.9997863568837246 3435.0 20.24308067311859 2.0 - - - - - - - 343.2 6 5 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1847 235 C20140704_OR005_02 C20140704_OR005_02 TB412871.[MT7]-SNDFSIVGSLPR.2y8_1.heavy 718.387 / 828.494 951.0 37.59640121459961 36 13 9 10 4 2.707726472238432 36.931352197229764 0.0 10 0.908286232263733 4.04360388855905 951.0 8.790756302521007 2.0 - - - - - - - 0.0 1 0 GLRB glycine receptor, beta 1849 235 C20140704_OR005_02 C20140704_OR005_02 TB412871.[MT7]-SNDFSIVGSLPR.2y9_1.heavy 718.387 / 975.562 3449.0 37.59640121459961 36 13 9 10 4 2.707726472238432 36.931352197229764 0.0 10 0.908286232263733 4.04360388855905 3449.0 12.825063025210085 1.0 - - - - - - - 273.7 8 10 GLRB glycine receptor, beta 1851 235 C20140704_OR005_02 C20140704_OR005_02 TB412871.[MT7]-SNDFSIVGSLPR.2b5_1.heavy 718.387 / 695.312 476.0 37.59640121459961 36 13 9 10 4 2.707726472238432 36.931352197229764 0.0 10 0.908286232263733 4.04360388855905 476.0 3.7314285714285713 21.0 - - - - - - - 297.5 3 8 GLRB glycine receptor, beta 1853 235 C20140704_OR005_02 C20140704_OR005_02 TB412871.[MT7]-SNDFSIVGSLPR.2y11_1.heavy 718.387 / 1204.63 595.0 37.59640121459961 36 13 9 10 4 2.707726472238432 36.931352197229764 0.0 10 0.908286232263733 4.04360388855905 595.0 1.7125 8.0 - - - - - - - 0.0 1 0 GLRB glycine receptor, beta 1855 236 C20140704_OR005_02 C20140704_OR005_02 TB427008.[MT7]-NESGLTEYR.2y8_1.heavy 606.802 / 954.453 13148.0 23.40704917907715 37 11 10 6 10 1.8510412729461527 42.65606966517213 0.03260040283203125 3 0.8583835111558735 3.2399750971111105 13148.0 118.26501157943491 0.0 - - - - - - - 144.4 26 10 F2R coagulation factor II (thrombin) receptor 1857 236 C20140704_OR005_02 C20140704_OR005_02 TB427008.[MT7]-NESGLTEYR.2b4_1.heavy 606.802 / 532.248 3054.0 23.40704917907715 37 11 10 6 10 1.8510412729461527 42.65606966517213 0.03260040283203125 3 0.8583835111558735 3.2399750971111105 3054.0 15.381161788738673 0.0 - - - - - - - 223.54545454545453 6 11 F2R coagulation factor II (thrombin) receptor 1859 236 C20140704_OR005_02 C20140704_OR005_02 TB427008.[MT7]-NESGLTEYR.2b5_1.heavy 606.802 / 645.332 5429.0 23.40704917907715 37 11 10 6 10 1.8510412729461527 42.65606966517213 0.03260040283203125 3 0.8583835111558735 3.2399750971111105 5429.0 81.83481982399258 0.0 - - - - - - - 212.1 10 10 F2R coagulation factor II (thrombin) receptor 1861 236 C20140704_OR005_02 C20140704_OR005_02 TB427008.[MT7]-NESGLTEYR.2y7_1.heavy 606.802 / 825.41 7041.0 23.40704917907715 37 11 10 6 10 1.8510412729461527 42.65606966517213 0.03260040283203125 3 0.8583835111558735 3.2399750971111105 7041.0 148.27517647058824 0.0 - - - - - - - 119.0 14 5 F2R coagulation factor II (thrombin) receptor 1863 237 C20140704_OR005_02 C20140704_OR005_02 TB427141.[MT7]-AMASPESGLEVR.2y8_1.heavy 695.859 / 886.463 9902.0 28.506200790405273 39 14 10 5 10 4.136844289137435 24.1730152286807 0.04199981689453125 3 0.9486123194265693 5.420699169807732 9902.0 55.285216170259446 0.0 - - - - - - - 278.4 19 10 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1865 237 C20140704_OR005_02 C20140704_OR005_02 TB427141.[MT7]-AMASPESGLEVR.2y9_1.heavy 695.859 / 973.495 8664.0 28.506200790405273 39 14 10 5 10 4.136844289137435 24.1730152286807 0.04199981689453125 3 0.9486123194265693 5.420699169807732 8664.0 100.47136039869295 0.0 - - - - - - - 235.71428571428572 17 7 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1867 237 C20140704_OR005_02 C20140704_OR005_02 TB427141.[MT7]-AMASPESGLEVR.2y10_1.heavy 695.859 / 1044.53 7632.0 28.506200790405273 39 14 10 5 10 4.136844289137435 24.1730152286807 0.04199981689453125 3 0.9486123194265693 5.420699169807732 7632.0 69.65126213592232 0.0 - - - - - - - 163.08333333333334 15 12 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1869 237 C20140704_OR005_02 C20140704_OR005_02 TB427141.[MT7]-AMASPESGLEVR.2y11_1.heavy 695.859 / 1175.57 4023.0 28.506200790405273 39 14 10 5 10 4.136844289137435 24.1730152286807 0.04199981689453125 3 0.9486123194265693 5.420699169807732 4023.0 31.57169285083848 0.0 - - - - - - - 164.9 8 10 DVL3 dishevelled, dsh homolog 3 (Drosophila) 1871 238 C20140704_OR005_02 C20140704_OR005_02 TB427003.[MT7]-EVVTETLK[MT7].3y3_1.heavy 402.911 / 505.347 2756.0 26.914475440979004 25 7 6 6 6 0.3903835500712986 103.57141018641029 0.036899566650390625 5 0.705708460616753 2.216646516948932 2756.0 3.6 2.0 - - - - - - - 334.6 8 5 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1873 238 C20140704_OR005_02 C20140704_OR005_02 TB427003.[MT7]-EVVTETLK[MT7].3b4_1.heavy 402.911 / 573.336 1083.0 26.914475440979004 25 7 6 6 6 0.3903835500712986 103.57141018641029 0.036899566650390625 5 0.705708460616753 2.216646516948932 1083.0 0.6419136325148179 3.0 - - - - - - - 283.0 2 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1875 238 C20140704_OR005_02 C20140704_OR005_02 TB427003.[MT7]-EVVTETLK[MT7].3b5_1.heavy 402.911 / 702.379 7579.0 26.914475440979004 25 7 6 6 6 0.3903835500712986 103.57141018641029 0.036899566650390625 5 0.705708460616753 2.216646516948932 7579.0 0.48888888888888893 2.0 - - - - - - - 221.25 24 4 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1877 238 C20140704_OR005_02 C20140704_OR005_02 TB427003.[MT7]-EVVTETLK[MT7].3b3_1.heavy 402.911 / 472.289 4725.0 26.914475440979004 25 7 6 6 6 0.3903835500712986 103.57141018641029 0.036899566650390625 5 0.705708460616753 2.216646516948932 4725.0 6.786281646552552 1.0 - - - - - - - 246.0 9 4 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1879 239 C20140704_OR005_02 C20140704_OR005_02 TB427142.[MT7]-VWQLYIGDTR.2b3_1.heavy 697.881 / 558.316 18527.0 40.236650466918945 39 13 10 6 10 1.6233783641101711 48.52442560697503 0.03659820556640625 3 0.9116715781278255 4.121566943065354 18527.0 57.830555555555556 0.0 - - - - - - - 230.375 37 16 GNMT glycine N-methyltransferase 1881 239 C20140704_OR005_02 C20140704_OR005_02 TB427142.[MT7]-VWQLYIGDTR.2y8_1.heavy 697.881 / 965.505 9603.0 40.236650466918945 39 13 10 6 10 1.6233783641101711 48.52442560697503 0.03659820556640625 3 0.9116715781278255 4.121566943065354 9603.0 64.35 0.0 - - - - - - - 266.75 19 12 GNMT glycine N-methyltransferase 1883 239 C20140704_OR005_02 C20140704_OR005_02 TB427142.[MT7]-VWQLYIGDTR.2y9_1.heavy 697.881 / 1151.58 11737.0 40.236650466918945 39 13 10 6 10 1.6233783641101711 48.52442560697503 0.03659820556640625 3 0.9116715781278255 4.121566943065354 11737.0 77.03666666666666 0.0 - - - - - - - 264.54545454545456 23 11 GNMT glycine N-methyltransferase 1885 239 C20140704_OR005_02 C20140704_OR005_02 TB427142.[MT7]-VWQLYIGDTR.2y7_1.heavy 697.881 / 837.446 9021.0 40.236650466918945 39 13 10 6 10 1.6233783641101711 48.52442560697503 0.03659820556640625 3 0.9116715781278255 4.121566943065354 9021.0 21.028333333333336 0.0 - - - - - - - 232.8 18 15 GNMT glycine N-methyltransferase 1887 240 C20140704_OR005_02 C20140704_OR005_02 TB412691.[MT7]-YNFLGISIVGQSNER.3y7_1.heavy 614.327 / 789.385 3035.0 43.27619934082031 44 14 10 10 10 4.769042144686093 20.96857124892994 0.0 3 0.9486076620387759 5.420451396805371 3035.0 12.263877551020409 0.0 - - - - - - - 311.8181818181818 6 11 DVL2;DVL3 dishevelled, dsh homolog 2 (Drosophila);dishevelled, dsh homolog 3 (Drosophila) 1889 240 C20140704_OR005_02 C20140704_OR005_02 TB412691.[MT7]-YNFLGISIVGQSNER.3y6_1.heavy 614.327 / 690.317 5092.0 43.27619934082031 44 14 10 10 10 4.769042144686093 20.96857124892994 0.0 3 0.9486076620387759 5.420451396805371 5092.0 22.73994005264941 0.0 - - - - - - - 213.8181818181818 10 11 DVL2;DVL3 dishevelled, dsh homolog 2 (Drosophila);dishevelled, dsh homolog 3 (Drosophila) 1891 240 C20140704_OR005_02 C20140704_OR005_02 TB412691.[MT7]-YNFLGISIVGQSNER.3b5_1.heavy 614.327 / 739.39 1958.0 43.27619934082031 44 14 10 10 10 4.769042144686093 20.96857124892994 0.0 3 0.9486076620387759 5.420451396805371 1958.0 2.8968991170936462 1.0 - - - - - - - 209.06666666666666 4 15 DVL2;DVL3 dishevelled, dsh homolog 2 (Drosophila);dishevelled, dsh homolog 3 (Drosophila) 1893 240 C20140704_OR005_02 C20140704_OR005_02 TB412691.[MT7]-YNFLGISIVGQSNER.3b3_1.heavy 614.327 / 569.284 3133.0 43.27619934082031 44 14 10 10 10 4.769042144686093 20.96857124892994 0.0 3 0.9486076620387759 5.420451396805371 3133.0 11.185376303203274 1.0 - - - - - - - 228.66666666666666 6 15 DVL2;DVL3 dishevelled, dsh homolog 2 (Drosophila);dishevelled, dsh homolog 3 (Drosophila) 1895 241 C20140704_OR005_02 C20140704_OR005_02 TB413373.[MT7]-SFLLRNPNDK[MT7]YEPFWEDEEK[MT7].4y5_1.heavy 747.883 / 793.37 4357.0 37.48504829406738 39 16 8 5 10 3.8729427780213768 25.82015943212266 0.044300079345703125 3 0.9682215149994206 6.904606197055345 4357.0 9.298029033592368 0.0 - - - - - - - 261.2 8 10 F2R coagulation factor II (thrombin) receptor 1897 241 C20140704_OR005_02 C20140704_OR005_02 TB413373.[MT7]-SFLLRNPNDK[MT7]YEPFWEDEEK[MT7].4y4_1.heavy 747.883 / 664.327 6598.0 37.48504829406738 39 16 8 5 10 3.8729427780213768 25.82015943212266 0.044300079345703125 3 0.9682215149994206 6.904606197055345 6598.0 48.16425979262673 0.0 - - - - - - - 207.16666666666666 13 6 F2R coagulation factor II (thrombin) receptor 1899 241 C20140704_OR005_02 C20140704_OR005_02 TB413373.[MT7]-SFLLRNPNDK[MT7]YEPFWEDEEK[MT7].4y3_1.heavy 747.883 / 549.3 3237.0 37.48504829406738 39 16 8 5 10 3.8729427780213768 25.82015943212266 0.044300079345703125 3 0.9682215149994206 6.904606197055345 3237.0 11.970804289544235 0.0 - - - - - - - 262.44444444444446 6 9 F2R coagulation factor II (thrombin) receptor 1901 241 C20140704_OR005_02 C20140704_OR005_02 TB413373.[MT7]-SFLLRNPNDK[MT7]YEPFWEDEEK[MT7].4b9_1.heavy 747.883 / 1201.64 2739.0 37.48504829406738 39 16 8 5 10 3.8729427780213768 25.82015943212266 0.044300079345703125 3 0.9682215149994206 6.904606197055345 2739.0 20.834844850352113 1.0 - - - - - - - 269.3333333333333 18 6 F2R coagulation factor II (thrombin) receptor 1903 242 C20140704_OR005_02 C20140704_OR005_02 TB427145.[MT7]-FINLFPETK[MT7].3y3_1.heavy 466.274 / 521.305 1064.0 42.004000663757324 30 8 10 6 6 0.6641225358493572 82.3281867856467 0.034801483154296875 5 0.7862759242876746 2.6204654244489696 1064.0 0.5498708010335918 2.0 - - - - - - - 279.3333333333333 2 9 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1905 242 C20140704_OR005_02 C20140704_OR005_02 TB427145.[MT7]-FINLFPETK[MT7].3b4_1.heavy 466.274 / 632.389 1548.0 42.004000663757324 30 8 10 6 6 0.6641225358493572 82.3281867856467 0.034801483154296875 5 0.7862759242876746 2.6204654244489696 1548.0 7.539481865284974 1.0 - - - - - - - 193.36363636363637 4 11 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1907 242 C20140704_OR005_02 C20140704_OR005_02 TB427145.[MT7]-FINLFPETK[MT7].3y4_1.heavy 466.274 / 618.358 4062.0 42.004000663757324 30 8 10 6 6 0.6641225358493572 82.3281867856467 0.034801483154296875 5 0.7862759242876746 2.6204654244489696 4062.0 7.444296777788095 0.0 - - - - - - - 322.5 8 6 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1909 242 C20140704_OR005_02 C20140704_OR005_02 TB427145.[MT7]-FINLFPETK[MT7].3b3_1.heavy 466.274 / 519.305 1354.0 42.004000663757324 30 8 10 6 6 0.6641225358493572 82.3281867856467 0.034801483154296875 5 0.7862759242876746 2.6204654244489696 1354.0 0.622528735632184 1.0 - - - - - - - 183.6 3 10 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1911 243 C20140704_OR005_02 C20140704_OR005_02 TB427431.[MT7]-SIQTVVSC[CAM]LFNPENR.2y4_1.heavy 954.492 / 515.257 14081.0 46.9536018371582 43 13 10 10 10 0.9988596446258757 57.42766496303983 0.0 3 0.9270800464007177 4.54217758418454 14081.0 165.60672955974843 0.0 - - - - - - - 194.33333333333334 28 6 DAZL deleted in azoospermia-like 1913 243 C20140704_OR005_02 C20140704_OR005_02 TB427431.[MT7]-SIQTVVSC[CAM]LFNPENR.2b4_1.heavy 954.492 / 574.332 5717.0 46.9536018371582 43 13 10 10 10 0.9988596446258757 57.42766496303983 0.0 3 0.9270800464007177 4.54217758418454 5717.0 17.331268886338634 0.0 - - - - - - - 188.44444444444446 11 9 DAZL deleted in azoospermia-like 1915 243 C20140704_OR005_02 C20140704_OR005_02 TB427431.[MT7]-SIQTVVSC[CAM]LFNPENR.2y9_1.heavy 954.492 / 1136.52 10375.0 46.9536018371582 43 13 10 10 10 0.9988596446258757 57.42766496303983 0.0 3 0.9270800464007177 4.54217758418454 10375.0 61.471868395589844 0.0 - - - - - - - 240.8181818181818 20 11 DAZL deleted in azoospermia-like 1917 243 C20140704_OR005_02 C20140704_OR005_02 TB427431.[MT7]-SIQTVVSC[CAM]LFNPENR.2y10_1.heavy 954.492 / 1235.58 6246.0 46.9536018371582 43 13 10 10 10 0.9988596446258757 57.42766496303983 0.0 3 0.9270800464007177 4.54217758418454 6246.0 38.03069851465275 0.0 - - - - - - - 258.8888888888889 12 9 DAZL deleted in azoospermia-like 1919 244 C20140704_OR005_02 C20140704_OR005_02 TB427534.[MT7]-TVFEALQAPAC[CAM]HENMVK[MT7].4y4_1.heavy 559.039 / 635.367 4508.0 35.60540008544922 38 16 10 2 10 2.9454754232292975 25.723791778289346 0.08660125732421875 3 0.9608976518400234 6.220646661957618 4508.0 16.538467326951807 0.0 - - - - - - - 208.57142857142858 9 7 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1921 244 C20140704_OR005_02 C20140704_OR005_02 TB427534.[MT7]-TVFEALQAPAC[CAM]HENMVK[MT7].4y5_1.heavy 559.039 / 764.409 3050.0 35.60540008544922 38 16 10 2 10 2.9454754232292975 25.723791778289346 0.08660125732421875 3 0.9608976518400234 6.220646661957618 3050.0 11.881331190778317 0.0 - - - - - - - 265.2 6 5 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1923 244 C20140704_OR005_02 C20140704_OR005_02 TB427534.[MT7]-TVFEALQAPAC[CAM]HENMVK[MT7].4b5_1.heavy 559.039 / 692.374 16574.0 35.60540008544922 38 16 10 2 10 2.9454754232292975 25.723791778289346 0.08660125732421875 3 0.9608976518400234 6.220646661957618 16574.0 185.53757128670733 0.0 - - - - - - - 232.25 33 4 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1925 244 C20140704_OR005_02 C20140704_OR005_02 TB427534.[MT7]-TVFEALQAPAC[CAM]HENMVK[MT7].4b4_1.heavy 559.039 / 621.336 12066.0 35.60540008544922 38 16 10 2 10 2.9454754232292975 25.723791778289346 0.08660125732421875 3 0.9608976518400234 6.220646661957618 12066.0 108.93463469995744 0.0 - - - - - - - 309.3333333333333 24 3 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1927 245 C20140704_OR005_02 C20140704_OR005_02 TB451141.[MT7]-AMVDIILLLSDK[MT7]DPPK[MT7].3b6_1.heavy 734.104 / 787.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1929 245 C20140704_OR005_02 C20140704_OR005_02 TB451141.[MT7]-AMVDIILLLSDK[MT7]DPPK[MT7].3b4_1.heavy 734.104 / 561.282 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1931 245 C20140704_OR005_02 C20140704_OR005_02 TB451141.[MT7]-AMVDIILLLSDK[MT7]DPPK[MT7].3b5_1.heavy 734.104 / 674.366 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1933 245 C20140704_OR005_02 C20140704_OR005_02 TB451141.[MT7]-AMVDIILLLSDK[MT7]DPPK[MT7].3b7_1.heavy 734.104 / 900.534 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1935 246 C20140704_OR005_02 C20140704_OR005_02 TB427535.[MT7]-TVFEALQAPAC[CAM]HENMVK[MT7].3b4_1.heavy 745.05 / 621.336 2253.0 35.616225242614746 42 17 10 5 10 4.370568844811534 22.880316853654815 0.043300628662109375 3 0.9729612654144751 7.488343134514882 2253.0 5.751450084474094 0.0 - - - - - - - 331.5 4 8 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1937 246 C20140704_OR005_02 C20140704_OR005_02 TB427535.[MT7]-TVFEALQAPAC[CAM]HENMVK[MT7].3b5_1.heavy 745.05 / 692.374 5168.0 35.616225242614746 42 17 10 5 10 4.370568844811534 22.880316853654815 0.043300628662109375 3 0.9729612654144751 7.488343134514882 5168.0 16.563537182769192 0.0 - - - - - - - 331.6666666666667 10 6 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1939 246 C20140704_OR005_02 C20140704_OR005_02 TB427535.[MT7]-TVFEALQAPAC[CAM]HENMVK[MT7].3y5_1.heavy 745.05 / 764.409 1325.0 35.616225242614746 42 17 10 5 10 4.370568844811534 22.880316853654815 0.043300628662109375 3 0.9729612654144751 7.488343134514882 1325.0 3.5 1.0 - - - - - - - 309.5 2 6 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1941 246 C20140704_OR005_02 C20140704_OR005_02 TB427535.[MT7]-TVFEALQAPAC[CAM]HENMVK[MT7].3y9_1.heavy 745.05 / 1229.59 928.0 35.616225242614746 42 17 10 5 10 4.370568844811534 22.880316853654815 0.043300628662109375 3 0.9729612654144751 7.488343134514882 928.0 8.729703504043126 7.0 - - - - - - - 206.44444444444446 2 9 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1943 247 C20140704_OR005_02 C20140704_OR005_02 TB412887.[MT7]-SIQTVVSC[CAM]LFNPENRLR.3b6_1.heavy 726.392 / 772.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - DAZL deleted in azoospermia-like 1945 247 C20140704_OR005_02 C20140704_OR005_02 TB412887.[MT7]-SIQTVVSC[CAM]LFNPENRLR.3b4_1.heavy 726.392 / 574.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - DAZL deleted in azoospermia-like 1947 247 C20140704_OR005_02 C20140704_OR005_02 TB412887.[MT7]-SIQTVVSC[CAM]LFNPENRLR.3y14_2.heavy 726.392 / 852.946 N/A N/A - - - - - - - - - 0.0 - - - - - - - DAZL deleted in azoospermia-like 1949 247 C20140704_OR005_02 C20140704_OR005_02 TB412887.[MT7]-SIQTVVSC[CAM]LFNPENRLR.3b5_1.heavy 726.392 / 673.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - DAZL deleted in azoospermia-like 1951 248 C20140704_OR005_02 C20140704_OR005_02 TB450886.[MT7]-ANSVTWNPHK[MT7].3y3_1.heavy 481.265 / 525.326 5386.0 23.61432456970215 43 17 10 6 10 8.949924314852437 11.173278843715984 0.03730010986328125 3 0.9751753667896368 7.816609191150107 5386.0 33.736300241530934 0.0 - - - - - - - 235.35714285714286 10 14 GAD1;GAD2 glutamate decarboxylase 1 (brain, 67kDa);glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) 1953 248 C20140704_OR005_02 C20140704_OR005_02 TB450886.[MT7]-ANSVTWNPHK[MT7].3b4_1.heavy 481.265 / 516.29 2733.0 23.61432456970215 43 17 10 6 10 8.949924314852437 11.173278843715984 0.03730010986328125 3 0.9751753667896368 7.816609191150107 2733.0 14.148074070640586 1.0 - - - - - - - 219.1818181818182 5 11 GAD1;GAD2 glutamate decarboxylase 1 (brain, 67kDa);glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) 1955 248 C20140704_OR005_02 C20140704_OR005_02 TB450886.[MT7]-ANSVTWNPHK[MT7].3b5_1.heavy 481.265 / 617.338 3376.0 23.61432456970215 43 17 10 6 10 8.949924314852437 11.173278843715984 0.03730010986328125 3 0.9751753667896368 7.816609191150107 3376.0 18.203819078879462 0.0 - - - - - - - 205.44444444444446 6 9 GAD1;GAD2 glutamate decarboxylase 1 (brain, 67kDa);glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) 1957 248 C20140704_OR005_02 C20140704_OR005_02 TB450886.[MT7]-ANSVTWNPHK[MT7].3b3_1.heavy 481.265 / 417.221 2733.0 23.61432456970215 43 17 10 6 10 8.949924314852437 11.173278843715984 0.03730010986328125 3 0.9751753667896368 7.816609191150107 2733.0 8.734511241433225 1.0 - - - - - - - 252.64285714285714 5 14 GAD1;GAD2 glutamate decarboxylase 1 (brain, 67kDa);glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) 1959 249 C20140704_OR005_02 C20140704_OR005_02 TB413365.[MT7]-AHMVTLDYTVQVPGAGQDGSPGLSK[MT7].4y4_1.heavy 704.868 / 548.352 5419.0 35.56209945678711 44 14 10 10 10 2.7606698657382465 36.223092533108236 0.0 3 0.9320147253922357 4.706122391742343 5419.0 20.162303030303033 1.0 - - - - - - - 211.2 10 5 GNMT glycine N-methyltransferase 1961 249 C20140704_OR005_02 C20140704_OR005_02 TB413365.[MT7]-AHMVTLDYTVQVPGAGQDGSPGLSK[MT7].4y5_1.heavy 704.868 / 645.405 24714.0 35.56209945678711 44 14 10 10 10 2.7606698657382465 36.223092533108236 0.0 3 0.9320147253922357 4.706122391742343 24714.0 56.60990480579724 0.0 - - - - - - - 642.1428571428571 49 7 GNMT glycine N-methyltransferase 1963 249 C20140704_OR005_02 C20140704_OR005_02 TB413365.[MT7]-AHMVTLDYTVQVPGAGQDGSPGLSK[MT7].4b7_1.heavy 704.868 / 912.473 7930.0 35.56209945678711 44 14 10 10 10 2.7606698657382465 36.223092533108236 0.0 3 0.9320147253922357 4.706122391742343 7930.0 47.159469696969694 0.0 - - - - - - - 264.0 15 9 GNMT glycine N-methyltransferase 1965 249 C20140704_OR005_02 C20140704_OR005_02 TB413365.[MT7]-AHMVTLDYTVQVPGAGQDGSPGLSK[MT7].4b4_1.heavy 704.868 / 583.314 7269.0 35.56209945678711 44 14 10 10 10 2.7606698657382465 36.223092533108236 0.0 3 0.9320147253922357 4.706122391742343 7269.0 21.166543670157353 0.0 - - - - - - - 245.14285714285714 14 7 GNMT glycine N-methyltransferase 1967 250 C20140704_OR005_02 C20140704_OR005_02 TB412886.[MT7]-EMGEAFAADIPR.2b4_1.heavy 725.859 / 591.256 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1969 250 C20140704_OR005_02 C20140704_OR005_02 TB412886.[MT7]-EMGEAFAADIPR.2y10_1.heavy 725.859 / 1046.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1971 250 C20140704_OR005_02 C20140704_OR005_02 TB412886.[MT7]-EMGEAFAADIPR.2b5_1.heavy 725.859 / 662.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1973 250 C20140704_OR005_02 C20140704_OR005_02 TB412886.[MT7]-EMGEAFAADIPR.2y11_1.heavy 725.859 / 1177.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1 adaptor-related protein complex 2, alpha 1 subunit 1975 251 C20140704_OR005_02 C20140704_OR005_02 TB450606.[MT7]-NVIDSK[MT7].2y4_1.heavy 482.289 / 606.358 4627.0 20.33639907836914 38 18 2 10 8 4.770613976705272 20.96166247956683 0.0 4 0.9835957689574771 9.622522794116492 4627.0 35.426442396518524 1.0 - - - - - - - 184.25 26 8 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1977 251 C20140704_OR005_02 C20140704_OR005_02 TB450606.[MT7]-NVIDSK[MT7].2y5_1.heavy 482.289 / 705.426 2347.0 20.33639907836914 38 18 2 10 8 4.770613976705272 20.96166247956683 0.0 4 0.9835957689574771 9.622522794116492 2347.0 35.93942524513896 2.0 - - - - - - - 260.55555555555554 8 9 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1979 251 C20140704_OR005_02 C20140704_OR005_02 TB450606.[MT7]-NVIDSK[MT7].2b4_1.heavy 482.289 / 586.332 3353.0 20.33639907836914 38 18 2 10 8 4.770613976705272 20.96166247956683 0.0 4 0.9835957689574771 9.622522794116492 3353.0 4.023647423706297 1.0 - - - - - - - 201.0 8 12 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1981 251 C20140704_OR005_02 C20140704_OR005_02 TB450606.[MT7]-NVIDSK[MT7].2y3_1.heavy 482.289 / 493.274 5029.0 20.33639907836914 38 18 2 10 8 4.770613976705272 20.96166247956683 0.0 4 0.9835957689574771 9.622522794116492 5029.0 13.930867539799252 0.0 - - - - - - - 237.54545454545453 10 11 MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa 1983 252 C20140704_OR005_02 C20140704_OR005_02 TB450701.[MT7]-TYDPLIK[MT7].2b3_1.heavy 569.342 / 524.247 80263.0 30.83799934387207 50 20 10 10 10 9.269546143589984 10.788014693594395 0.0 3 0.9918755345405051 13.68265883292623 80263.0 175.55061455063213 0.0 - - - - - - - 344.5 160 4 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1985 252 C20140704_OR005_02 C20140704_OR005_02 TB450701.[MT7]-TYDPLIK[MT7].2y4_1.heavy 569.342 / 614.436 90958.0 30.83799934387207 50 20 10 10 10 9.269546143589984 10.788014693594395 0.0 3 0.9918755345405051 13.68265883292623 90958.0 237.67580658299323 0.0 - - - - - - - 680.4285714285714 181 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1987 252 C20140704_OR005_02 C20140704_OR005_02 TB450701.[MT7]-TYDPLIK[MT7].2y3_1.heavy 569.342 / 517.383 3071.0 30.83799934387207 50 20 10 10 10 9.269546143589984 10.788014693594395 0.0 3 0.9918755345405051 13.68265883292623 3071.0 3.1543967979517773 3.0 - - - - - - - 619.8571428571429 7 7 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1989 252 C20140704_OR005_02 C20140704_OR005_02 TB450701.[MT7]-TYDPLIK[MT7].2b5_1.heavy 569.342 / 734.384 4659.0 30.83799934387207 50 20 10 10 10 9.269546143589984 10.788014693594395 0.0 3 0.9918755345405051 13.68265883292623 4659.0 32.19544811320755 0.0 - - - - - - - 201.4 9 10 SEMA3D sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 1991 253 C20140704_OR005_02 C20140704_OR005_02 TB427152.[MT7]-EYQDLLNVK[MT7].3y3_1.heavy 470.601 / 504.326 8569.0 34.70899963378906 42 12 10 10 10 1.328710753386575 48.66498260117945 0.0 3 0.8880121814228292 3.652902870214679 8569.0 103.86666666666667 0.0 - - - - - - - 132.0 17 4 DES;NEFM;NEFH;NEFL;VIM;INA desmin;neurofilament, medium polypeptide;neurofilament, heavy polypeptide;neurofilament, light polypeptide;vimentin;internexin neuronal intermediate filament protein, alpha 1993 253 C20140704_OR005_02 C20140704_OR005_02 TB427152.[MT7]-EYQDLLNVK[MT7].3b4_1.heavy 470.601 / 680.301 7515.0 34.70899963378906 42 12 10 10 10 1.328710753386575 48.66498260117945 0.0 3 0.8880121814228292 3.652902870214679 7515.0 76.85795454545455 0.0 - - - - - - - 264.0 15 2 DES;NEFM;NEFH;NEFL;VIM;INA desmin;neurofilament, medium polypeptide;neurofilament, heavy polypeptide;neurofilament, light polypeptide;vimentin;internexin neuronal intermediate filament protein, alpha 1995 253 C20140704_OR005_02 C20140704_OR005_02 TB427152.[MT7]-EYQDLLNVK[MT7].3b5_1.heavy 470.601 / 793.385 1318.0 34.70899963378906 42 12 10 10 10 1.328710753386575 48.66498260117945 0.0 3 0.8880121814228292 3.652902870214679 1318.0 19.96969696969697 0.0 - - - - - - - 264.0 2 1 DES;NEFM;NEFH;NEFL;VIM;INA desmin;neurofilament, medium polypeptide;neurofilament, heavy polypeptide;neurofilament, light polypeptide;vimentin;internexin neuronal intermediate filament protein, alpha 1997 253 C20140704_OR005_02 C20140704_OR005_02 TB427152.[MT7]-EYQDLLNVK[MT7].3b3_1.heavy 470.601 / 565.274 791.0 34.70899963378906 42 12 10 10 10 1.328710753386575 48.66498260117945 0.0 3 0.8880121814228292 3.652902870214679 791.0 5.722623150940686 5.0 - - - - - - - 231.0 2 4 DES;NEFM;NEFH;NEFL;VIM;INA desmin;neurofilament, medium polypeptide;neurofilament, heavy polypeptide;neurofilament, light polypeptide;vimentin;internexin neuronal intermediate filament protein, alpha 1999 254 C20140704_OR005_02 C20140704_OR005_02 TB450603.[MT7]-LVSAFK[MT7].2y4_1.heavy 476.807 / 596.352 6270.0 31.368099212646484 50 20 10 10 10 15.466708488820064 6.465499758548102 0.0 3 0.9974108064621603 24.24858282815491 6270.0 56.43 0.0 - - - - - - - 176.0 12 5 ABCA6;GAD1 ATP-binding cassette, sub-family A (ABC1), member 6;glutamate decarboxylase 1 (brain, 67kDa) 2001 254 C20140704_OR005_02 C20140704_OR005_02 TB450603.[MT7]-LVSAFK[MT7].2y5_1.heavy 476.807 / 695.421 4950.0 31.368099212646484 50 20 10 10 10 15.466708488820064 6.465499758548102 0.0 3 0.9974108064621603 24.24858282815491 4950.0 10.05 0.0 - - - - - - - 256.6666666666667 9 6 ABCA6;GAD1 ATP-binding cassette, sub-family A (ABC1), member 6;glutamate decarboxylase 1 (brain, 67kDa) 2003 254 C20140704_OR005_02 C20140704_OR005_02 TB450603.[MT7]-LVSAFK[MT7].2b4_1.heavy 476.807 / 515.331 1100.0 31.368099212646484 50 20 10 10 10 15.466708488820064 6.465499758548102 0.0 3 0.9974108064621603 24.24858282815491 1100.0 3.3428571428571425 2.0 - - - - - - - 198.0 5 5 ABCA6;GAD1 ATP-binding cassette, sub-family A (ABC1), member 6;glutamate decarboxylase 1 (brain, 67kDa) 2005 254 C20140704_OR005_02 C20140704_OR005_02 TB450603.[MT7]-LVSAFK[MT7].2y3_1.heavy 476.807 / 509.32 2750.0 31.368099212646484 50 20 10 10 10 15.466708488820064 6.465499758548102 0.0 3 0.9974108064621603 24.24858282815491 2750.0 9.28846153846154 0.0 - - - - - - - 256.6666666666667 5 9 ABCA6;GAD1 ATP-binding cassette, sub-family A (ABC1), member 6;glutamate decarboxylase 1 (brain, 67kDa) 2007 255 C20140704_OR005_02 C20140704_OR005_02 TB426937.[MT7]-ATNATLDPR.2b7_1.heavy 551.802 / 831.433 33103.0 20.800399780273438 35 13 10 2 10 2.654870249063729 37.66662421083146 0.08599853515625 3 0.9037657648462949 3.9459502627553253 33103.0 447.3378378378378 0.0 - - - - - - - 197.33333333333334 66 6 F2R coagulation factor II (thrombin) receptor 2009 255 C20140704_OR005_02 C20140704_OR005_02 TB426937.[MT7]-ATNATLDPR.2b5_1.heavy 551.802 / 603.322 3851.0 20.800399780273438 35 13 10 2 10 2.654870249063729 37.66662421083146 0.08599853515625 3 0.9037657648462949 3.9459502627553253 3851.0 36.428378378378376 0.0 - - - - - - - 137.42857142857142 7 7 F2R coagulation factor II (thrombin) receptor 2011 255 C20140704_OR005_02 C20140704_OR005_02 TB426937.[MT7]-ATNATLDPR.2b4_1.heavy 551.802 / 502.274 10590.0 20.800399780273438 35 13 10 2 10 2.654870249063729 37.66662421083146 0.08599853515625 3 0.9037657648462949 3.9459502627553253 10590.0 46.081661559648815 1.0 - - - - - - - 248.9090909090909 21 11 F2R coagulation factor II (thrombin) receptor 2013 255 C20140704_OR005_02 C20140704_OR005_02 TB426937.[MT7]-ATNATLDPR.2b6_1.heavy 551.802 / 716.406 815.0 20.800399780273438 35 13 10 2 10 2.654870249063729 37.66662421083146 0.08599853515625 3 0.9037657648462949 3.9459502627553253 815.0 2.477885595218178 3.0 - - - - - - - 159.3846153846154 3 13 F2R coagulation factor II (thrombin) receptor 2015 256 C20140704_OR005_02 C20140704_OR005_02 TB426934.[MT7]-ELVAHLK[MT7].2y4_1.heavy 549.35 / 612.395 3409.0 25.78934955596924 41 15 10 6 10 2.090632793965717 40.700233007760744 0.03809928894042969 3 0.9540842945664179 5.7372771043257265 3409.0 11.223681855423205 0.0 - - - - - - - 207.16666666666666 6 12 ENG endoglin 2017 256 C20140704_OR005_02 C20140704_OR005_02 TB426934.[MT7]-ELVAHLK[MT7].2y5_1.heavy 549.35 / 711.463 737.0 25.78934955596924 41 15 10 6 10 2.090632793965717 40.700233007760744 0.03809928894042969 3 0.9540842945664179 5.7372771043257265 737.0 2.6538394793926248 2.0 - - - - - - - 258.0 2 15 ENG endoglin 2019 256 C20140704_OR005_02 C20140704_OR005_02 TB426934.[MT7]-ELVAHLK[MT7].2b4_1.heavy 549.35 / 557.341 2303.0 25.78934955596924 41 15 10 6 10 2.090632793965717 40.700233007760744 0.03809928894042969 3 0.9540842945664179 5.7372771043257265 2303.0 5.41166683818737 1.0 - - - - - - - 276.3636363636364 4 11 ENG endoglin 2021 256 C20140704_OR005_02 C20140704_OR005_02 TB426934.[MT7]-ELVAHLK[MT7].2y3_1.heavy 549.35 / 541.358 1474.0 25.78934955596924 41 15 10 6 10 2.090632793965717 40.700233007760744 0.03809928894042969 3 0.9540842945664179 5.7372771043257265 1474.0 12.868800020978652 2.0 - - - - - - - 276.45454545454544 2 11 ENG endoglin 2023 257 C20140704_OR005_02 C20140704_OR005_02 TB427015.[MT7]-FIWQSGDPVQLEK[MT7].3y3_1.heavy 612.336 / 533.341 17674.0 39.757598876953125 44 18 10 6 10 6.919339361978424 14.452246777994038 0.0352020263671875 3 0.9863803403186138 10.56294684896502 17674.0 28.67030886754825 0.0 - - - - - - - 723.4285714285714 35 7 GLRB glycine receptor, beta 2025 257 C20140704_OR005_02 C20140704_OR005_02 TB427015.[MT7]-FIWQSGDPVQLEK[MT7].3b4_1.heavy 612.336 / 719.4 5461.0 39.757598876953125 44 18 10 6 10 6.919339361978424 14.452246777994038 0.0352020263671875 3 0.9863803403186138 10.56294684896502 5461.0 35.92495258550818 0.0 - - - - - - - 248.14285714285714 10 14 GLRB glycine receptor, beta 2027 257 C20140704_OR005_02 C20140704_OR005_02 TB427015.[MT7]-FIWQSGDPVQLEK[MT7].3y4_1.heavy 612.336 / 661.4 12808.0 39.757598876953125 44 18 10 6 10 6.919339361978424 14.452246777994038 0.0352020263671875 3 0.9863803403186138 10.56294684896502 12808.0 137.8828825164396 0.0 - - - - - - - 206.07692307692307 25 13 GLRB glycine receptor, beta 2029 257 C20140704_OR005_02 C20140704_OR005_02 TB427015.[MT7]-FIWQSGDPVQLEK[MT7].3b7_1.heavy 612.336 / 978.48 16284.0 39.757598876953125 44 18 10 6 10 6.919339361978424 14.452246777994038 0.0352020263671875 3 0.9863803403186138 10.56294684896502 16284.0 100.41369802030286 0.0 - - - - - - - 258.1 32 10 GLRB glycine receptor, beta