Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140704_OR005_03 C20140704_OR005_03 TB413145.[MT7]-SRMGPSGGEGMEPERR.3y10_2.heavy 626.301 / 559.256 N/A N/A - - - - - - - - - 0.0 - - - - - - - LASP1 LIM and SH3 protein 1 3 1 C20140704_OR005_03 C20140704_OR005_03 TB413145.[MT7]-SRMGPSGGEGMEPERR.3y4_1.heavy 626.301 / 557.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - LASP1 LIM and SH3 protein 1 5 1 C20140704_OR005_03 C20140704_OR005_03 TB413145.[MT7]-SRMGPSGGEGMEPERR.3b15_2.heavy 626.301 / 851.891 N/A N/A - - - - - - - - - 0.0 - - - - - - - LASP1 LIM and SH3 protein 1 7 1 C20140704_OR005_03 C20140704_OR005_03 TB413145.[MT7]-SRMGPSGGEGMEPERR.3y12_2.heavy 626.301 / 651.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - LASP1 LIM and SH3 protein 1 9 2 C20140704_OR005_03 C20140704_OR005_03 TB413216.[MT7]-ANVNLDVPLQDFPTPK[MT7].4y4_1.heavy 514.788 / 586.368 3660.0 39.832499504089355 29 13 2 6 8 0.8078348577645325 68.41881723199985 0.037998199462890625 4 0.9096283227352415 4.073990000205775 3660.0 39.043152454780355 1.0 - - - - - - - 204.6 30 10 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 11 2 C20140704_OR005_03 C20140704_OR005_03 TB413216.[MT7]-ANVNLDVPLQDFPTPK[MT7].4b4_1.heavy 514.788 / 543.301 2906.0 39.832499504089355 29 13 2 6 8 0.8078348577645325 68.41881723199985 0.037998199462890625 4 0.9096283227352415 4.073990000205775 2906.0 3.281040892193308 1.0 - - - - - - - 192.21428571428572 5 14 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 13 2 C20140704_OR005_03 C20140704_OR005_03 TB413216.[MT7]-ANVNLDVPLQDFPTPK[MT7].4b5_1.heavy 514.788 / 656.385 1076.0 39.832499504089355 29 13 2 6 8 0.8078348577645325 68.41881723199985 0.037998199462890625 4 0.9096283227352415 4.073990000205775 1076.0 7.972681962705164 0.0 - - - - - - - 235.0 2 11 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 15 2 C20140704_OR005_03 C20140704_OR005_03 TB413216.[MT7]-ANVNLDVPLQDFPTPK[MT7].4b6_1.heavy 514.788 / 771.412 6351.0 39.832499504089355 29 13 2 6 8 0.8078348577645325 68.41881723199985 0.037998199462890625 4 0.9096283227352415 4.073990000205775 6351.0 0.0 1.0 - - - - - - - 228.75 12 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 17 3 C20140704_OR005_03 C20140704_OR005_03 TB413214.[MT7]-ANVNLDVPLQDFPTPK[MT7].2y4_1.heavy 1028.57 / 586.368 7975.0 39.832499504089355 40 14 10 6 10 1.4636478828874484 45.77579078164672 0.037998199462890625 3 0.9429481907474587 5.142105024649144 7975.0 12.95243619489559 1.0 - - - - - - - 269.6 15 10 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 19 3 C20140704_OR005_03 C20140704_OR005_03 TB413214.[MT7]-ANVNLDVPLQDFPTPK[MT7].2y9_1.heavy 1028.57 / 1186.66 10346.0 39.832499504089355 40 14 10 6 10 1.4636478828874484 45.77579078164672 0.037998199462890625 3 0.9429481907474587 5.142105024649144 10346.0 62.77856541606541 0.0 - - - - - - - 215.77777777777777 20 9 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 21 3 C20140704_OR005_03 C20140704_OR005_03 TB413214.[MT7]-ANVNLDVPLQDFPTPK[MT7].2b4_1.heavy 1028.57 / 543.301 9053.0 39.832499504089355 40 14 10 6 10 1.4636478828874484 45.77579078164672 0.037998199462890625 3 0.9429481907474587 5.142105024649144 9053.0 89.02328879512423 0.0 - - - - - - - 242.625 18 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 23 3 C20140704_OR005_03 C20140704_OR005_03 TB413214.[MT7]-ANVNLDVPLQDFPTPK[MT7].2b6_1.heavy 1028.57 / 771.412 11100.0 39.832499504089355 40 14 10 6 10 1.4636478828874484 45.77579078164672 0.037998199462890625 3 0.9429481907474587 5.142105024649144 11100.0 19.825879392703584 0.0 - - - - - - - 269.25 22 4 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 25 4 C20140704_OR005_03 C20140704_OR005_03 TB450808.[MT7]-TVHTEWTQR.3y3_1.heavy 434.562 / 404.225 20007.0 21.906400680541992 45 15 10 10 10 2.0461038429338765 48.87337480223465 0.0 3 0.9515112977655804 5.581763261596429 20007.0 138.69978632644356 0.0 - - - - - - - 214.2 40 15 APEH N-acylaminoacyl-peptide hydrolase 27 4 C20140704_OR005_03 C20140704_OR005_03 TB450808.[MT7]-TVHTEWTQR.3y6_1.heavy 434.562 / 820.395 2491.0 21.906400680541992 45 15 10 10 10 2.0461038429338765 48.87337480223465 0.0 3 0.9515112977655804 5.581763261596429 2491.0 25.704788278652615 0.0 - - - - - - - 200.75 4 4 APEH N-acylaminoacyl-peptide hydrolase 29 4 C20140704_OR005_03 C20140704_OR005_03 TB450808.[MT7]-TVHTEWTQR.3y4_1.heavy 434.562 / 590.305 27318.0 21.906400680541992 45 15 10 10 10 2.0461038429338765 48.87337480223465 0.0 3 0.9515112977655804 5.581763261596429 27318.0 201.30880020335536 0.0 - - - - - - - 221.0 54 12 APEH N-acylaminoacyl-peptide hydrolase 31 4 C20140704_OR005_03 C20140704_OR005_03 TB450808.[MT7]-TVHTEWTQR.3y5_1.heavy 434.562 / 719.347 5303.0 21.906400680541992 45 15 10 10 10 2.0461038429338765 48.87337480223465 0.0 3 0.9515112977655804 5.581763261596429 5303.0 129.26062499999998 0.0 - - - - - - - 214.33333333333334 10 6 APEH N-acylaminoacyl-peptide hydrolase 33 5 C20140704_OR005_03 C20140704_OR005_03 TB412764.[MT7]-TVHTEWTQR.2y4_1.heavy 651.34 / 590.305 1631.0 21.88665008544922 44 20 10 6 8 27.173516465993977 3.680053706893033 0.039501190185546875 4 0.9975746367903138 25.054524286080138 1631.0 4.414095555027335 0.0 - - - - - - - 171.9090909090909 3 11 APEH N-acylaminoacyl-peptide hydrolase 35 5 C20140704_OR005_03 C20140704_OR005_03 TB412764.[MT7]-TVHTEWTQR.2y8_1.heavy 651.34 / 1056.52 2661.0 21.88665008544922 44 20 10 6 8 27.173516465993977 3.680053706893033 0.039501190185546875 4 0.9975746367903138 25.054524286080138 2661.0 38.513775747508305 1.0 - - - - - - - 200.33333333333334 8 6 APEH N-acylaminoacyl-peptide hydrolase 37 5 C20140704_OR005_03 C20140704_OR005_03 TB412764.[MT7]-TVHTEWTQR.2y6_1.heavy 651.34 / 820.395 3777.0 21.88665008544922 44 20 10 6 8 27.173516465993977 3.680053706893033 0.039501190185546875 4 0.9975746367903138 25.054524286080138 3777.0 36.408523255813954 0.0 - - - - - - - 150.5 7 4 APEH N-acylaminoacyl-peptide hydrolase 39 5 C20140704_OR005_03 C20140704_OR005_03 TB412764.[MT7]-TVHTEWTQR.2y7_1.heavy 651.34 / 957.454 4121.0 21.88665008544922 44 20 10 6 8 27.173516465993977 3.680053706893033 0.039501190185546875 4 0.9975746367903138 25.054524286080138 4121.0 93.44127906976743 0.0 - - - - - - - 150.25 8 4 APEH N-acylaminoacyl-peptide hydrolase 41 6 C20140704_OR005_03 C20140704_OR005_03 TB450695.[MT7]-STQSTEGK[MT7].2y4_1.heavy 563.303 / 578.327 2603.0 13.232500076293945 50 20 10 10 10 5.86780108575559 17.042159156136954 0.0 3 0.994121887912416 16.089052637987386 2603.0 40.66219210694992 0.0 - - - - - - - 71.3 5 20 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 43 6 C20140704_OR005_03 C20140704_OR005_03 TB450695.[MT7]-STQSTEGK[MT7].2y5_1.heavy 563.303 / 665.359 5288.0 13.232500076293945 50 20 10 10 10 5.86780108575559 17.042159156136954 0.0 3 0.994121887912416 16.089052637987386 5288.0 42.90636788048553 0.0 - - - - - - - 85.0 10 20 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 45 6 C20140704_OR005_03 C20140704_OR005_03 TB450695.[MT7]-STQSTEGK[MT7].2y6_1.heavy 563.303 / 793.417 1546.0 13.232500076293945 50 20 10 10 10 5.86780108575559 17.042159156136954 0.0 3 0.994121887912416 16.089052637987386 1546.0 49.13807245386192 0.0 - - - - - - - 45.111111111111114 3 18 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 47 6 C20140704_OR005_03 C20140704_OR005_03 TB450695.[MT7]-STQSTEGK[MT7].2y7_1.heavy 563.303 / 894.465 4223.0 13.232500076293945 50 20 10 10 10 5.86780108575559 17.042159156136954 0.0 3 0.994121887912416 16.089052637987386 4223.0 52.72877429487599 0.0 - - - - - - - 62.8 8 20 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 49 7 C20140704_OR005_03 C20140704_OR005_03 TB413352.[MT7]-FGNAFLNRFMC[CAM]SQLPNQVLK[MT7].4b4_1.heavy 668.857 / 534.279 3204.0 44.74290084838867 44 14 10 10 10 1.473007651866972 46.84608957637282 0.0 3 0.9305295884713247 4.654955856428821 3204.0 19.14 0.0 - - - - - - - 192.83333333333334 6 12 EHD4 EH-domain containing 4 51 7 C20140704_OR005_03 C20140704_OR005_03 TB413352.[MT7]-FGNAFLNRFMC[CAM]SQLPNQVLK[MT7].4b5_1.heavy 668.857 / 681.348 1691.0 44.74290084838867 44 14 10 10 10 1.473007651866972 46.84608957637282 0.0 3 0.9305295884713247 4.654955856428821 1691.0 10.766666666666667 0.0 - - - - - - - 178.0 3 11 EHD4 EH-domain containing 4 53 7 C20140704_OR005_03 C20140704_OR005_03 TB413352.[MT7]-FGNAFLNRFMC[CAM]SQLPNQVLK[MT7].4y6_1.heavy 668.857 / 842.522 3827.0 44.74290084838867 44 14 10 10 10 1.473007651866972 46.84608957637282 0.0 3 0.9305295884713247 4.654955856428821 3827.0 18.633333333333333 0.0 - - - - - - - 259.5833333333333 7 12 EHD4 EH-domain containing 4 55 7 C20140704_OR005_03 C20140704_OR005_03 TB413352.[MT7]-FGNAFLNRFMC[CAM]SQLPNQVLK[MT7].4y3_1.heavy 668.857 / 503.367 4539.0 44.74290084838867 44 14 10 10 10 1.473007651866972 46.84608957637282 0.0 3 0.9305295884713247 4.654955856428821 4539.0 6.29 0.0 - - - - - - - 207.66666666666666 9 9 EHD4 EH-domain containing 4 57 8 C20140704_OR005_03 C20140704_OR005_03 TB450804.[MT7]-SFNLSALEK[MT7].2y4_1.heavy 648.874 / 604.379 7047.0 36.1598014831543 47 20 9 10 8 10.402736673828082 9.612855072222183 0.0 4 0.9966955345509073 21.463082602244917 7047.0 24.183431734317345 1.0 - - - - - - - 600.2857142857143 32 7 APEH N-acylaminoacyl-peptide hydrolase 59 8 C20140704_OR005_03 C20140704_OR005_03 TB450804.[MT7]-SFNLSALEK[MT7].2y5_1.heavy 648.874 / 691.411 13011.0 36.1598014831543 47 20 9 10 8 10.402736673828082 9.612855072222183 0.0 4 0.9966955345509073 21.463082602244917 13011.0 18.238036208157666 1.0 - - - - - - - 237.375 28 8 APEH N-acylaminoacyl-peptide hydrolase 61 8 C20140704_OR005_03 C20140704_OR005_03 TB450804.[MT7]-SFNLSALEK[MT7].2b4_1.heavy 648.874 / 606.337 9622.0 36.1598014831543 47 20 9 10 8 10.402736673828082 9.612855072222183 0.0 4 0.9966955345509073 21.463082602244917 9622.0 43.67180811808118 0.0 - - - - - - - 271.3333333333333 19 9 APEH N-acylaminoacyl-peptide hydrolase 63 8 C20140704_OR005_03 C20140704_OR005_03 TB450804.[MT7]-SFNLSALEK[MT7].2y7_1.heavy 648.874 / 918.538 4743.0 36.1598014831543 47 20 9 10 8 10.402736673828082 9.612855072222183 0.0 4 0.9966955345509073 21.463082602244917 4743.0 67.30875 0.0 - - - - - - - 248.83333333333334 9 6 APEH N-acylaminoacyl-peptide hydrolase 65 9 C20140704_OR005_03 C20140704_OR005_03 TB450898.[MT7]-DAHIQEIVEK[MT7].3y3_1.heavy 490.612 / 519.326 59861.0 26.273099899291992 48 18 10 10 10 8.179509780234506 12.225671548391134 0.0 3 0.986697494837745 10.688408396605693 59861.0 188.849151447116 0.0 - - - - - - - 280.72727272727275 119 11 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 67 9 C20140704_OR005_03 C20140704_OR005_03 TB450898.[MT7]-DAHIQEIVEK[MT7].3b4_1.heavy 490.612 / 581.316 19361.0 26.273099899291992 48 18 10 10 10 8.179509780234506 12.225671548391134 0.0 3 0.986697494837745 10.688408396605693 19361.0 197.77341904653545 0.0 - - - - - - - 164.0 38 12 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 69 9 C20140704_OR005_03 C20140704_OR005_03 TB450898.[MT7]-DAHIQEIVEK[MT7].3y4_1.heavy 490.612 / 632.41 16836.0 26.273099899291992 48 18 10 10 10 8.179509780234506 12.225671548391134 0.0 3 0.986697494837745 10.688408396605693 16836.0 142.15457552286526 0.0 - - - - - - - 159.3 33 10 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 71 9 C20140704_OR005_03 C20140704_OR005_03 TB450898.[MT7]-DAHIQEIVEK[MT7].3y5_1.heavy 490.612 / 761.453 12908.0 26.273099899291992 48 18 10 10 10 8.179509780234506 12.225671548391134 0.0 3 0.986697494837745 10.688408396605693 12908.0 68.75063101604277 0.0 - - - - - - - 374.25 25 4 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 73 10 C20140704_OR005_03 C20140704_OR005_03 TB450693.[MT7]-ESPSGTMK[MT7].2y5_1.heavy 562.797 / 667.357 2860.0 17.51004981994629 41 15 10 6 10 4.816121617084289 20.763595264137173 0.03459930419921875 3 0.9588845433949277 6.06541397646915 2860.0 10.556302989359907 0.0 - - - - - - - 190.73333333333332 5 15 APEH N-acylaminoacyl-peptide hydrolase 75 10 C20140704_OR005_03 C20140704_OR005_03 TB450693.[MT7]-ESPSGTMK[MT7].2y3_1.heavy 562.797 / 523.303 1478.0 17.51004981994629 41 15 10 6 10 4.816121617084289 20.763595264137173 0.03459930419921875 3 0.9588845433949277 6.06541397646915 1478.0 6.524465474645115 0.0 - - - - - - - 195.0909090909091 2 11 APEH N-acylaminoacyl-peptide hydrolase 77 10 C20140704_OR005_03 C20140704_OR005_03 TB450693.[MT7]-ESPSGTMK[MT7].2y6_1.heavy 562.797 / 764.409 9487.0 17.51004981994629 41 15 10 6 10 4.816121617084289 20.763595264137173 0.03459930419921875 3 0.9588845433949277 6.06541397646915 9487.0 82.2871951577834 0.0 - - - - - - - 121.88888888888889 18 9 APEH N-acylaminoacyl-peptide hydrolase 79 10 C20140704_OR005_03 C20140704_OR005_03 TB450693.[MT7]-ESPSGTMK[MT7].2y7_1.heavy 562.797 / 851.441 11013.0 17.51004981994629 41 15 10 6 10 4.816121617084289 20.763595264137173 0.03459930419921875 3 0.9588845433949277 6.06541397646915 11013.0 99.17465968586387 0.0 - - - - - - - 143.16666666666666 22 12 APEH N-acylaminoacyl-peptide hydrolase 81 11 C20140704_OR005_03 C20140704_OR005_03 TB426972.[MT7]-VGFLPSAGK[MT7].2y4_1.heavy 582.355 / 506.306 2185.0 32.016300201416016 44 14 10 10 10 2.5686395337916705 38.93111457814637 0.0 3 0.9412462489552768 5.06634684882679 2185.0 5.789450048511986 6.0 - - - - - - - 214.55555555555554 7 9 APEH N-acylaminoacyl-peptide hydrolase 83 11 C20140704_OR005_03 C20140704_OR005_03 TB426972.[MT7]-VGFLPSAGK[MT7].2y8_1.heavy 582.355 / 920.532 7455.0 32.016300201416016 44 14 10 10 10 2.5686395337916705 38.93111457814637 0.0 3 0.9412462489552768 5.06634684882679 7455.0 29.580719632558953 0.0 - - - - - - - 231.6 14 5 APEH N-acylaminoacyl-peptide hydrolase 85 11 C20140704_OR005_03 C20140704_OR005_03 TB426972.[MT7]-VGFLPSAGK[MT7].2y5_1.heavy 582.355 / 603.358 31364.0 32.016300201416016 44 14 10 10 10 2.5686395337916705 38.93111457814637 0.0 3 0.9412462489552768 5.06634684882679 31364.0 75.26080774095165 0.0 - - - - - - - 300.0 62 6 APEH N-acylaminoacyl-peptide hydrolase 87 11 C20140704_OR005_03 C20140704_OR005_03 TB426972.[MT7]-VGFLPSAGK[MT7].2b4_1.heavy 582.355 / 561.352 17096.0 32.016300201416016 44 14 10 10 10 2.5686395337916705 38.93111457814637 0.0 3 0.9412462489552768 5.06634684882679 17096.0 27.18810717372515 0.0 - - - - - - - 716.1428571428571 34 7 APEH N-acylaminoacyl-peptide hydrolase 89 12 C20140704_OR005_03 C20140704_OR005_03 TB412668.[MT7]-FDSDSAC[CAM]PR.2y8_1.heavy 599.768 / 907.357 1897.0 21.100799560546875 39 13 10 10 6 0.9768271191388531 63.57982082814791 0.0 6 0.90205431129968 3.9107450759614846 1897.0 10.40548523206751 0.0 - - - - - - - 177.75 3 8 HLA-G major histocompatibility complex, class I, G 91 12 C20140704_OR005_03 C20140704_OR005_03 TB412668.[MT7]-FDSDSAC[CAM]PR.2y5_1.heavy 599.768 / 590.271 1186.0 21.100799560546875 39 13 10 10 6 0.9768271191388531 63.57982082814791 0.0 6 0.90205431129968 3.9107450759614846 1186.0 8.256962025316456 3.0 - - - - - - - 187.625 3 8 HLA-G major histocompatibility complex, class I, G 93 12 C20140704_OR005_03 C20140704_OR005_03 TB412668.[MT7]-FDSDSAC[CAM]PR.2b4_1.heavy 599.768 / 609.264 1186.0 21.100799560546875 39 13 10 10 6 0.9768271191388531 63.57982082814791 0.0 6 0.90205431129968 3.9107450759614846 1186.0 22.518987341772153 0.0 - - - - - - - 189.6 2 5 HLA-G major histocompatibility complex, class I, G 95 12 C20140704_OR005_03 C20140704_OR005_03 TB412668.[MT7]-FDSDSAC[CAM]PR.2y7_1.heavy 599.768 / 792.331 1186.0 21.100799560546875 39 13 10 10 6 0.9768271191388531 63.57982082814791 0.0 6 0.90205431129968 3.9107450759614846 1186.0 14.862531645569618 0.0 - - - - - - - 169.28571428571428 2 7 HLA-G major histocompatibility complex, class I, G 97 13 C20140704_OR005_03 C20140704_OR005_03 TB426989.[MT7]-AGGTGPGEEK[MT7].2y8_1.heavy 595.816 / 918.465 1891.0 15.419125080108643 39 13 10 6 10 2.506810997302575 32.6777771973004 0.03809928894042969 3 0.9186618659275964 4.297606363450142 1891.0 27.95391304347826 0.0 - - - - - - - 130.27272727272728 3 11 APEH N-acylaminoacyl-peptide hydrolase 99 13 C20140704_OR005_03 C20140704_OR005_03 TB426989.[MT7]-AGGTGPGEEK[MT7].2y5_1.heavy 595.816 / 703.374 1662.0 15.419125080108643 39 13 10 6 10 2.506810997302575 32.6777771973004 0.03809928894042969 3 0.9186618659275964 4.297606363450142 1662.0 24.571222256004866 0.0 - - - - - - - 122.0 3 8 APEH N-acylaminoacyl-peptide hydrolase 101 13 C20140704_OR005_03 C20140704_OR005_03 TB426989.[MT7]-AGGTGPGEEK[MT7].2y9_1.heavy 595.816 / 975.486 3066.0 15.419125080108643 39 13 10 6 10 2.506810997302575 32.6777771973004 0.03809928894042969 3 0.9186618659275964 4.297606363450142 3066.0 208.8051724137931 0.0 - - - - - - - 63.4 6 5 APEH N-acylaminoacyl-peptide hydrolase 103 13 C20140704_OR005_03 C20140704_OR005_03 TB426989.[MT7]-AGGTGPGEEK[MT7].2y6_1.heavy 595.816 / 760.396 2350.0 15.419125080108643 39 13 10 6 10 2.506810997302575 32.6777771973004 0.03809928894042969 3 0.9186618659275964 4.297606363450142 2350.0 94.48997594226141 0.0 - - - - - - - 128.9 4 10 APEH N-acylaminoacyl-peptide hydrolase 105 14 C20140704_OR005_03 C20140704_OR005_03 TB412654.[MT7]-ALGQGQSVK[MT7].2y8_1.heavy 588.353 / 960.56 3994.0 19.856800079345703 47 17 10 10 10 12.289407410799067 8.137088848737086 0.0 3 0.9707115694523882 7.19363830892412 3994.0 43.84681683011705 0.0 - - - - - - - 163.5 7 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 107 14 C20140704_OR005_03 C20140704_OR005_03 TB412654.[MT7]-ALGQGQSVK[MT7].2y5_1.heavy 588.353 / 662.395 2614.0 19.856800079345703 47 17 10 10 10 12.289407410799067 8.137088848737086 0.0 3 0.9707115694523882 7.19363830892412 2614.0 34.1758904109589 1.0 - - - - - - - 205.83333333333334 5 6 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 109 14 C20140704_OR005_03 C20140704_OR005_03 TB412654.[MT7]-ALGQGQSVK[MT7].2b4_1.heavy 588.353 / 514.311 2977.0 19.856800079345703 47 17 10 10 10 12.289407410799067 8.137088848737086 0.0 3 0.9707115694523882 7.19363830892412 2977.0 39.419586206896554 0.0 - - - - - - - 130.6 5 5 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 111 14 C20140704_OR005_03 C20140704_OR005_03 TB412654.[MT7]-ALGQGQSVK[MT7].2y7_1.heavy 588.353 / 847.475 5446.0 19.856800079345703 47 17 10 10 10 12.289407410799067 8.137088848737086 0.0 3 0.9707115694523882 7.19363830892412 5446.0 85.11556616815382 0.0 - - - - - - - 91.125 10 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 113 15 C20140704_OR005_03 C20140704_OR005_03 TB413340.[MT7]-GSTGFGQDSILSLPGNVGHQDVK[MT7].4b8_1.heavy 651.093 / 894.407 5130.0 36.86309814453125 40 10 10 10 10 1.1304473897362197 60.155913629563436 0.0 3 0.8260956851516355 2.9154293450242115 5130.0 17.55513307984791 0.0 - - - - - - - 253.23076923076923 10 13 APEH N-acylaminoacyl-peptide hydrolase 115 15 C20140704_OR005_03 C20140704_OR005_03 TB413340.[MT7]-GSTGFGQDSILSLPGNVGHQDVK[MT7].4y10_2.heavy 651.093 / 597.821 42751.0 36.86309814453125 40 10 10 10 10 1.1304473897362197 60.155913629563436 0.0 3 0.8260956851516355 2.9154293450242115 42751.0 127.65172011251757 0.0 - - - - - - - 244.57142857142858 85 7 APEH N-acylaminoacyl-peptide hydrolase 117 15 C20140704_OR005_03 C20140704_OR005_03 TB413340.[MT7]-GSTGFGQDSILSLPGNVGHQDVK[MT7].4b5_1.heavy 651.093 / 594.3 15654.0 36.86309814453125 40 10 10 10 10 1.1304473897362197 60.155913629563436 0.0 3 0.8260956851516355 2.9154293450242115 15654.0 19.120528186519735 0.0 - - - - - - - 676.4285714285714 31 7 APEH N-acylaminoacyl-peptide hydrolase 119 15 C20140704_OR005_03 C20140704_OR005_03 TB413340.[MT7]-GSTGFGQDSILSLPGNVGHQDVK[MT7].4y6_1.heavy 651.093 / 827.449 8024.0 36.86309814453125 40 10 10 10 10 1.1304473897362197 60.155913629563436 0.0 3 0.8260956851516355 2.9154293450242115 8024.0 33.230644655147515 0.0 - - - - - - - 277.8888888888889 16 9 APEH N-acylaminoacyl-peptide hydrolase 121 16 C20140704_OR005_03 C20140704_OR005_03 TB413155.[MT7]-ESLMLQC[CAM]GHSYC[CAM]K[MT7].3y3_1.heavy 634.303 / 614.309 11117.0 27.564199447631836 48 18 10 10 10 4.142554819293693 24.139692620181194 0.0 3 0.9891141423179606 11.817790389662395 11117.0 24.906543430035427 0.0 - - - - - - - 691.0 22 10 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 123 16 C20140704_OR005_03 C20140704_OR005_03 TB413155.[MT7]-ESLMLQC[CAM]GHSYC[CAM]K[MT7].3b4_1.heavy 634.303 / 605.308 18228.0 27.564199447631836 48 18 10 10 10 4.142554819293693 24.139692620181194 0.0 3 0.9891141423179606 11.817790389662395 18228.0 80.68945335235378 0.0 - - - - - - - 713.5 36 8 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 125 16 C20140704_OR005_03 C20140704_OR005_03 TB413155.[MT7]-ESLMLQC[CAM]GHSYC[CAM]K[MT7].3b5_1.heavy 634.303 / 718.393 7211.0 27.564199447631836 48 18 10 10 10 4.142554819293693 24.139692620181194 0.0 3 0.9891141423179606 11.817790389662395 7211.0 34.49655991440799 0.0 - - - - - - - 155.55555555555554 14 9 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 127 16 C20140704_OR005_03 C20140704_OR005_03 TB413155.[MT7]-ESLMLQC[CAM]GHSYC[CAM]K[MT7].3y4_1.heavy 634.303 / 701.341 14823.0 27.564199447631836 48 18 10 10 10 4.142554819293693 24.139692620181194 0.0 3 0.9891141423179606 11.817790389662395 14823.0 31.979851709347948 0.0 - - - - - - - 230.0 29 10 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 129 17 C20140704_OR005_03 C20140704_OR005_03 TB413205.[MT7]-LLGNVMVIILATHFGK[MT7].4y4_1.heavy 504.309 / 632.364 1230.0 53.94852542877197 31 5 10 6 10 1.7414748694471347 40.50853304683324 0.033901214599609375 3 0.6446598462166995 2.0056228316928792 1230.0 15.216666666666667 1.0 - - - - - - - 98.0 2 7 HBE1 hemoglobin, epsilon 1 131 17 C20140704_OR005_03 C20140704_OR005_03 TB413205.[MT7]-LLGNVMVIILATHFGK[MT7].4b4_1.heavy 504.309 / 542.342 615.0 53.94852542877197 31 5 10 6 10 1.7414748694471347 40.50853304683324 0.033901214599609375 3 0.6446598462166995 2.0056228316928792 615.0 10.238218390804597 0.0 - - - - - - - 0.0 1 0 HBE1 hemoglobin, epsilon 1 133 17 C20140704_OR005_03 C20140704_OR005_03 TB413205.[MT7]-LLGNVMVIILATHFGK[MT7].4y6_1.heavy 504.309 / 804.448 868.0 53.94852542877197 31 5 10 6 10 1.7414748694471347 40.50853304683324 0.033901214599609375 3 0.6446598462166995 2.0056228316928792 868.0 19.288888888888888 0.0 - - - - - - - 0.0 1 0 HBE1 hemoglobin, epsilon 1 135 17 C20140704_OR005_03 C20140704_OR005_03 TB413205.[MT7]-LLGNVMVIILATHFGK[MT7].4b6_1.heavy 504.309 / 772.451 688.0 53.94852542877197 31 5 10 6 10 1.7414748694471347 40.50853304683324 0.033901214599609375 3 0.6446598462166995 2.0056228316928792 688.0 13.356660527931247 0.0 - - - - - - - 0.0 1 0 HBE1 hemoglobin, epsilon 1 137 18 C20140704_OR005_03 C20140704_OR005_03 TB413018.[MT7]-AIATSLHEIC[CAM]SK[MT7].2y6_1.heavy 809.447 / 917.463 2956.0 29.602949142456055 37 12 10 5 10 1.1227745119304344 53.066372686576656 0.04010009765625 3 0.8900620597476602 3.6874579000531282 2956.0 19.97662100456621 0.0 - - - - - - - 273.75 5 4 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 139 18 C20140704_OR005_03 C20140704_OR005_03 TB413018.[MT7]-AIATSLHEIC[CAM]SK[MT7].2y4_1.heavy 809.447 / 651.362 1314.0 29.602949142456055 37 12 10 5 10 1.1227745119304344 53.066372686576656 0.04010009765625 3 0.8900620597476602 3.6874579000531282 1314.0 13.175283061087491 0.0 - - - - - - - 259.625 2 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 141 18 C20140704_OR005_03 C20140704_OR005_03 TB413018.[MT7]-AIATSLHEIC[CAM]SK[MT7].2y5_1.heavy 809.447 / 780.404 657.0 29.602949142456055 37 12 10 5 10 1.1227745119304344 53.066372686576656 0.04010009765625 3 0.8900620597476602 3.6874579000531282 657.0 2.5334010152284265 5.0 - - - - - - - 0.0 1 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 143 18 C20140704_OR005_03 C20140704_OR005_03 TB413018.[MT7]-AIATSLHEIC[CAM]SK[MT7].2y3_1.heavy 809.447 / 538.278 1642.0 29.602949142456055 37 12 10 5 10 1.1227745119304344 53.066372686576656 0.04010009765625 3 0.8900620597476602 3.6874579000531282 1642.0 9.74703196347032 0.0 - - - - - - - 255.33333333333334 3 3 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 145 19 C20140704_OR005_03 C20140704_OR005_03 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 133113.0 29.902799606323242 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 133113.0 516.4674161490683 0.0 - - - - - - - 268.3333333333333 266 6 147 19 C20140704_OR005_03 C20140704_OR005_03 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 41037.0 29.902799606323242 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 41037.0 82.78535284840731 1.0 - - - - - - - 217.22222222222223 90 9 149 19 C20140704_OR005_03 C20140704_OR005_03 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 45980.0 29.902799606323242 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 45980.0 186.01432712215322 0.0 - - - - - - - 311.1764705882353 91 17 151 20 C20140704_OR005_03 C20140704_OR005_03 TB413208.[MT7]-LSHSDTFIPLLTEEK[MT7].3y7_1.heavy 673.373 / 973.569 22499.0 39.4379997253418 43 17 10 6 10 7.882181251083332 12.686843503662889 0.037200927734375 3 0.9788258647922288 8.466233047729009 22499.0 31.19521334881228 0.0 - - - - - - - 237.85714285714286 44 7 KCNF1 potassium voltage-gated channel, subfamily F, member 1 153 20 C20140704_OR005_03 C20140704_OR005_03 TB413208.[MT7]-LSHSDTFIPLLTEEK[MT7].3b5_1.heavy 673.373 / 684.343 4433.0 39.4379997253418 43 17 10 6 10 7.882181251083332 12.686843503662889 0.037200927734375 3 0.9788258647922288 8.466233047729009 4433.0 14.778917903247102 0.0 - - - - - - - 256.0 8 13 KCNF1 potassium voltage-gated channel, subfamily F, member 1 155 20 C20140704_OR005_03 C20140704_OR005_03 TB413208.[MT7]-LSHSDTFIPLLTEEK[MT7].3y4_1.heavy 673.373 / 650.348 20283.0 39.4379997253418 43 17 10 6 10 7.882181251083332 12.686843503662889 0.037200927734375 3 0.9788258647922288 8.466233047729009 20283.0 12.682664681196453 0.0 - - - - - - - 221.7 40 10 KCNF1 potassium voltage-gated channel, subfamily F, member 1 157 20 C20140704_OR005_03 C20140704_OR005_03 TB413208.[MT7]-LSHSDTFIPLLTEEK[MT7].3y5_1.heavy 673.373 / 763.432 11527.0 39.4379997253418 43 17 10 6 10 7.882181251083332 12.686843503662889 0.037200927734375 3 0.9788258647922288 8.466233047729009 11527.0 24.410462085179454 0.0 - - - - - - - 680.8571428571429 23 7 KCNF1 potassium voltage-gated channel, subfamily F, member 1 159 21 C20140704_OR005_03 C20140704_OR005_03 TB426841.[MT7]-RPVTEMP.2b5_2.heavy 487.267 / 364.215 20408.0 24.924874305725098 39 13 10 6 10 2.0135556390944354 49.66339050108067 0.036899566650390625 3 0.9103275933845231 4.090090263224363 20408.0 41.215887673069034 0.0 - - - - - - - 232.88888888888889 40 9 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 161 21 C20140704_OR005_03 C20140704_OR005_03 TB426841.[MT7]-RPVTEMP.2b4_1.heavy 487.267 / 598.379 2098.0 24.924874305725098 39 13 10 6 10 2.0135556390944354 49.66339050108067 0.036899566650390625 3 0.9103275933845231 4.090090263224363 2098.0 4.545958862939995 0.0 - - - - - - - 209.86666666666667 4 15 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 163 21 C20140704_OR005_03 C20140704_OR005_03 TB426841.[MT7]-RPVTEMP.2b6_1.heavy 487.267 / 858.462 8011.0 24.924874305725098 39 13 10 6 10 2.0135556390944354 49.66339050108067 0.036899566650390625 3 0.9103275933845231 4.090090263224363 8011.0 41.10356020942408 0.0 - - - - - - - 248.0 16 5 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 165 21 C20140704_OR005_03 C20140704_OR005_03 TB426841.[MT7]-RPVTEMP.2b5_1.heavy 487.267 / 727.422 25176.0 24.924874305725098 39 13 10 6 10 2.0135556390944354 49.66339050108067 0.036899566650390625 3 0.9103275933845231 4.090090263224363 25176.0 131.62885039370076 0.0 - - - - - - - 163.14285714285714 50 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 167 22 C20140704_OR005_03 C20140704_OR005_03 TB427511.[MT7]-VYIGSFWAQPLQNTDNR.3b4_1.heavy 718.368 / 577.347 2895.0 43.471699714660645 42 17 9 6 10 4.321677725378627 23.139161768763984 0.038799285888671875 3 0.9777464083387225 8.25759582042289 2895.0 3.2886265220519366 0.0 - - - - - - - 263.75 5 12 EHD4 EH-domain containing 4 169 22 C20140704_OR005_03 C20140704_OR005_03 TB427511.[MT7]-VYIGSFWAQPLQNTDNR.3b5_1.heavy 718.368 / 664.379 2805.0 43.471699714660645 42 17 9 6 10 4.321677725378627 23.139161768763984 0.038799285888671875 3 0.9777464083387225 8.25759582042289 2805.0 16.87140221402214 1.0 - - - - - - - 164.1818181818182 5 11 EHD4 EH-domain containing 4 171 22 C20140704_OR005_03 C20140704_OR005_03 TB427511.[MT7]-VYIGSFWAQPLQNTDNR.3b3_1.heavy 718.368 / 520.325 1809.0 43.471699714660645 42 17 9 6 10 4.321677725378627 23.139161768763984 0.038799285888671875 3 0.9777464083387225 8.25759582042289 1809.0 5.66353591160221 2.0 - - - - - - - 204.86666666666667 12 15 EHD4 EH-domain containing 4 173 22 C20140704_OR005_03 C20140704_OR005_03 TB427511.[MT7]-VYIGSFWAQPLQNTDNR.3y8_1.heavy 718.368 / 957.475 5609.0 43.471699714660645 42 17 9 6 10 4.321677725378627 23.139161768763984 0.038799285888671875 3 0.9777464083387225 8.25759582042289 5609.0 47.13865303459664 0.0 - - - - - - - 186.25 11 16 EHD4 EH-domain containing 4 175 23 C20140704_OR005_03 C20140704_OR005_03 TB412658.[MT7]-EMPSVFGK[MT7].2y4_1.heavy 591.825 / 594.373 3366.0 32.85929870605469 48 18 10 10 10 4.025149484481202 24.84379782304878 0.0 3 0.9864419989971442 10.586993203140157 3366.0 15.894306681326547 0.0 - - - - - - - 663.375 6 8 EHD4;EHD3;EHD2 EH-domain containing 4;EH-domain containing 3;EH-domain containing 2 177 23 C20140704_OR005_03 C20140704_OR005_03 TB412658.[MT7]-EMPSVFGK[MT7].2y5_1.heavy 591.825 / 681.405 2331.0 32.85929870605469 48 18 10 10 10 4.025149484481202 24.84379782304878 0.0 3 0.9864419989971442 10.586993203140157 2331.0 14.655813953488371 4.0 - - - - - - - 223.36363636363637 29 11 EHD4;EHD3;EHD2 EH-domain containing 4;EH-domain containing 3;EH-domain containing 2 179 23 C20140704_OR005_03 C20140704_OR005_03 TB412658.[MT7]-EMPSVFGK[MT7].2y6_1.heavy 591.825 / 778.458 18903.0 32.85929870605469 48 18 10 10 10 4.025149484481202 24.84379782304878 0.0 3 0.9864419989971442 10.586993203140157 18903.0 87.2165444015444 0.0 - - - - - - - 258.75 37 8 EHD4;EHD3;EHD2 EH-domain containing 4;EH-domain containing 3;EH-domain containing 2 181 23 C20140704_OR005_03 C20140704_OR005_03 TB412658.[MT7]-EMPSVFGK[MT7].2y7_1.heavy 591.825 / 909.498 6992.0 32.85929870605469 48 18 10 10 10 4.025149484481202 24.84379782304878 0.0 3 0.9864419989971442 10.586993203140157 6992.0 33.1579381443299 0.0 - - - - - - - 244.22222222222223 13 9 EHD4;EHD3;EHD2 EH-domain containing 4;EH-domain containing 3;EH-domain containing 2 183 24 C20140704_OR005_03 C20140704_OR005_03 TB426985.[MT7]-VINTPEVLR.2y8_1.heavy 592.86 / 941.542 49973.0 32.15614891052246 44 18 10 6 10 3.987578806174878 25.077874284301835 0.039699554443359375 3 0.9862078714021364 10.49654326228224 49973.0 240.8407217797256 0.0 - - - - - - - 201.14285714285714 99 7 EHD4 EH-domain containing 4 185 24 C20140704_OR005_03 C20140704_OR005_03 TB426985.[MT7]-VINTPEVLR.2y5_1.heavy 592.86 / 613.367 14992.0 32.15614891052246 44 18 10 6 10 3.987578806174878 25.077874284301835 0.039699554443359375 3 0.9862078714021364 10.49654326228224 14992.0 21.617659172281897 0.0 - - - - - - - 256.0 29 5 EHD4 EH-domain containing 4 187 24 C20140704_OR005_03 C20140704_OR005_03 TB426985.[MT7]-VINTPEVLR.2y6_1.heavy 592.86 / 714.414 11660.0 32.15614891052246 44 18 10 6 10 3.987578806174878 25.077874284301835 0.039699554443359375 3 0.9862078714021364 10.49654326228224 11660.0 28.940649944188202 0.0 - - - - - - - 160.0 23 4 EHD4 EH-domain containing 4 189 24 C20140704_OR005_03 C20140704_OR005_03 TB426985.[MT7]-VINTPEVLR.2y7_1.heavy 592.86 / 828.457 24730.0 32.15614891052246 44 18 10 6 10 3.987578806174878 25.077874284301835 0.039699554443359375 3 0.9862078714021364 10.49654326228224 24730.0 93.92259641173602 0.0 - - - - - - - 277.3333333333333 49 6 EHD4 EH-domain containing 4 191 25 C20140704_OR005_03 C20140704_OR005_03 TB413402.[MT7]-QSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRK[MT7].4b7_1.heavy 940.819 / 871.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - HLA-G major histocompatibility complex, class I, G 193 25 C20140704_OR005_03 C20140704_OR005_03 TB413402.[MT7]-QSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRK[MT7].4y9_1.heavy 940.819 / 1157.73 N/A N/A - - - - - - - - - 0.0 - - - - - - - HLA-G major histocompatibility complex, class I, G 195 25 C20140704_OR005_03 C20140704_OR005_03 TB413402.[MT7]-QSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRK[MT7].4b4_1.heavy 940.819 / 560.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - HLA-G major histocompatibility complex, class I, G 197 25 C20140704_OR005_03 C20140704_OR005_03 TB413402.[MT7]-QSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRK[MT7].4y7_1.heavy 940.819 / 987.622 N/A N/A - - - - - - - - - 0.0 - - - - - - - HLA-G major histocompatibility complex, class I, G 199 26 C20140704_OR005_03 C20140704_OR005_03 TB413123.[MT7]-VQLILDDLGVDAAEGR.2y12_1.heavy 914.5 / 1230.6 1462.0 45.9275016784668 46 16 10 10 10 11.406466481727128 8.766956897668308 0.0 3 0.9672377944080592 6.799592927943706 1462.0 10.719239731823212 0.0 - - - - - - - 212.23076923076923 2 13 KCNF1 potassium voltage-gated channel, subfamily F, member 1 201 26 C20140704_OR005_03 C20140704_OR005_03 TB413123.[MT7]-VQLILDDLGVDAAEGR.2y5_1.heavy 914.5 / 503.257 3006.0 45.9275016784668 46 16 10 10 10 11.406466481727128 8.766956897668308 0.0 3 0.9672377944080592 6.799592927943706 3006.0 14.294190307461147 0.0 - - - - - - - 243.63636363636363 6 11 KCNF1 potassium voltage-gated channel, subfamily F, member 1 203 26 C20140704_OR005_03 C20140704_OR005_03 TB413123.[MT7]-VQLILDDLGVDAAEGR.2y9_1.heavy 914.5 / 887.458 2437.0 45.9275016784668 46 16 10 10 10 11.406466481727128 8.766956897668308 0.0 3 0.9672377944080592 6.799592927943706 2437.0 11.589673746265042 0.0 - - - - - - - 189.33333333333334 4 9 KCNF1 potassium voltage-gated channel, subfamily F, member 1 205 26 C20140704_OR005_03 C20140704_OR005_03 TB413123.[MT7]-VQLILDDLGVDAAEGR.2y10_1.heavy 914.5 / 1002.49 1787.0 45.9275016784668 46 16 10 10 10 11.406466481727128 8.766956897668308 0.0 3 0.9672377944080592 6.799592927943706 1787.0 10.187109098865587 0.0 - - - - - - - 249.76923076923077 3 13 KCNF1 potassium voltage-gated channel, subfamily F, member 1 207 27 C20140704_OR005_03 C20140704_OR005_03 TB426858.[MT7]-LNDLIK[MT7].2y4_1.heavy 502.323 / 632.41 4248.0 32.10689926147461 40 16 10 6 8 3.3755788094920613 29.62454904587088 0.0391998291015625 4 0.9654194835143209 6.61739578717785 4248.0 7.753631067961165 0.0 - - - - - - - 257.4 8 10 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 209 27 C20140704_OR005_03 C20140704_OR005_03 TB426858.[MT7]-LNDLIK[MT7].2y5_1.heavy 502.323 / 746.453 6050.0 32.10689926147461 40 16 10 6 8 3.3755788094920613 29.62454904587088 0.0391998291015625 4 0.9654194835143209 6.61739578717785 6050.0 5.2908513232692735 1.0 - - - - - - - 231.6 14 5 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 211 27 C20140704_OR005_03 C20140704_OR005_03 TB426858.[MT7]-LNDLIK[MT7].2b4_1.heavy 502.323 / 600.347 3990.0 32.10689926147461 40 16 10 6 8 3.3755788094920613 29.62454904587088 0.0391998291015625 4 0.9654194835143209 6.61739578717785 3990.0 16.24846474869458 0.0 - - - - - - - 231.7 7 10 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 213 27 C20140704_OR005_03 C20140704_OR005_03 TB426858.[MT7]-LNDLIK[MT7].2y3_1.heavy 502.323 / 517.383 12872.0 32.10689926147461 40 16 10 6 8 3.3755788094920613 29.62454904587088 0.0391998291015625 4 0.9654194835143209 6.61739578717785 12872.0 34.31553643043236 0.0 - - - - - - - 321.5 25 2 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 215 28 C20140704_OR005_03 C20140704_OR005_03 TB426957.[MT7]-IVYPTEK[MT7].2y4_1.heavy 569.342 / 618.358 13194.0 26.930700302124023 50 20 10 10 10 8.230835199984497 12.149435333146794 0.0 3 0.9933538984182445 15.129969698582263 13194.0 34.80266380620328 0.0 - - - - - - - 268.6666666666667 26 6 LASP1 LIM and SH3 protein 1 217 28 C20140704_OR005_03 C20140704_OR005_03 TB426957.[MT7]-IVYPTEK[MT7].2y5_1.heavy 569.342 / 781.421 4532.0 26.930700302124023 50 20 10 10 10 8.230835199984497 12.149435333146794 0.0 3 0.9933538984182445 15.129969698582263 4532.0 1.708982977841702 1.0 - - - - - - - 268.3333333333333 9 6 LASP1 LIM and SH3 protein 1 219 28 C20140704_OR005_03 C20140704_OR005_03 TB426957.[MT7]-IVYPTEK[MT7].2y3_1.heavy 569.342 / 521.305 1511.0 26.930700302124023 50 20 10 10 10 8.230835199984497 12.149435333146794 0.0 3 0.9933538984182445 15.129969698582263 1511.0 0.4749379652605458 8.0 - - - - - - - 256.27272727272725 6 11 LASP1 LIM and SH3 protein 1 221 28 C20140704_OR005_03 C20140704_OR005_03 TB426957.[MT7]-IVYPTEK[MT7].2y6_1.heavy 569.342 / 880.49 2417.0 26.930700302124023 50 20 10 10 10 8.230835199984497 12.149435333146794 0.0 3 0.9933538984182445 15.129969698582263 2417.0 11.957805467248594 2.0 - - - - - - - 184.66666666666666 4 6 LASP1 LIM and SH3 protein 1 223 29 C20140704_OR005_03 C20140704_OR005_03 TB413125.[MT7]-QVLLSEPEEAAALYR.3y7_1.heavy 611.667 / 793.42 66431.0 38.17234992980957 43 18 10 5 10 3.6799214208758673 18.48934011339315 0.044101715087890625 3 0.9833868173705248 9.561650369636155 66431.0 352.90180945947805 0.0 - - - - - - - 288.8 132 10 APEH N-acylaminoacyl-peptide hydrolase 225 29 C20140704_OR005_03 C20140704_OR005_03 TB413125.[MT7]-QVLLSEPEEAAALYR.3y6_1.heavy 611.667 / 664.378 67755.0 38.17234992980957 43 18 10 5 10 3.6799214208758673 18.48934011339315 0.044101715087890625 3 0.9833868173705248 9.561650369636155 67755.0 332.68138398005146 0.0 - - - - - - - 739.2857142857143 135 7 APEH N-acylaminoacyl-peptide hydrolase 227 29 C20140704_OR005_03 C20140704_OR005_03 TB413125.[MT7]-QVLLSEPEEAAALYR.3b4_1.heavy 611.667 / 598.404 73772.0 38.17234992980957 43 18 10 5 10 3.6799214208758673 18.48934011339315 0.044101715087890625 3 0.9833868173705248 9.561650369636155 73772.0 124.38594315975065 0.0 - - - - - - - 360.8333333333333 147 6 APEH N-acylaminoacyl-peptide hydrolase 229 29 C20140704_OR005_03 C20140704_OR005_03 TB413125.[MT7]-QVLLSEPEEAAALYR.3y5_1.heavy 611.667 / 593.341 71245.0 38.17234992980957 43 18 10 5 10 3.6799214208758673 18.48934011339315 0.044101715087890625 3 0.9833868173705248 9.561650369636155 71245.0 164.5488118021668 0.0 - - - - - - - 240.625 142 8 APEH N-acylaminoacyl-peptide hydrolase 231 30 C20140704_OR005_03 C20140704_OR005_03 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 39072.0 16.03230094909668 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 39072.0 42.53905601006923 0.0 - - - - - - - 176.44444444444446 78 9 233 30 C20140704_OR005_03 C20140704_OR005_03 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 53902.0 16.03230094909668 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 53902.0 1331.0863496041375 0.0 - - - - - - - 146.6 107 10 235 30 C20140704_OR005_03 C20140704_OR005_03 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 29864.0 16.03230094909668 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 29864.0 115.77899863627508 0.0 - - - - - - - 108.58333333333333 59 12 237 31 C20140704_OR005_03 C20140704_OR005_03 TB427117.[MT7]-LSEEELLDK[MT7].2y8_1.heavy 682.382 / 1106.57 5969.0 32.90140151977539 48 18 10 10 10 58.94986094858142 1.6963568427620934 0.0 3 0.9853100923761762 10.169971930595636 5969.0 25.23471021491795 0.0 - - - - - - - 230.77777777777777 11 9 IFI35 interferon-induced protein 35 239 31 C20140704_OR005_03 C20140704_OR005_03 TB427117.[MT7]-LSEEELLDK[MT7].2b4_1.heavy 682.382 / 603.311 5969.0 32.90140151977539 48 18 10 10 10 58.94986094858142 1.6963568427620934 0.0 3 0.9853100923761762 10.169971930595636 5969.0 42.24215384615385 0.0 - - - - - - - 202.22222222222223 11 9 IFI35 interferon-induced protein 35 241 31 C20140704_OR005_03 C20140704_OR005_03 TB427117.[MT7]-LSEEELLDK[MT7].2y3_1.heavy 682.382 / 519.326 3504.0 32.90140151977539 48 18 10 10 10 58.94986094858142 1.6963568427620934 0.0 3 0.9853100923761762 10.169971930595636 3504.0 13.632179861443946 0.0 - - - - - - - 281.1666666666667 7 12 IFI35 interferon-induced protein 35 243 31 C20140704_OR005_03 C20140704_OR005_03 TB427117.[MT7]-LSEEELLDK[MT7].2b5_1.heavy 682.382 / 732.353 6229.0 32.90140151977539 48 18 10 10 10 58.94986094858142 1.6963568427620934 0.0 3 0.9853100923761762 10.169971930595636 6229.0 15.360247126897466 0.0 - - - - - - - 216.5 12 6 IFI35 interferon-induced protein 35 245 32 C20140704_OR005_03 C20140704_OR005_03 TB427310.[MT7]-EPVQNEISATYIR.3y7_1.heavy 555.297 / 823.467 23683.0 32.17599868774414 50 20 10 10 10 5.837712337053181 17.129997887233856 0.0 3 0.9931991258592641 14.956623507160021 23683.0 122.23483870967742 0.0 - - - - - - - 210.8 47 10 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 247 32 C20140704_OR005_03 C20140704_OR005_03 TB427310.[MT7]-EPVQNEISATYIR.3y6_1.heavy 555.297 / 710.383 88657.0 32.17599868774414 50 20 10 10 10 5.837712337053181 17.129997887233856 0.0 3 0.9931991258592641 14.956623507160021 88657.0 312.2061021505376 0.0 - - - - - - - 268.6666666666667 177 6 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 249 32 C20140704_OR005_03 C20140704_OR005_03 TB427310.[MT7]-EPVQNEISATYIR.3b4_1.heavy 555.297 / 598.332 35091.0 32.17599868774414 50 20 10 10 10 5.837712337053181 17.129997887233856 0.0 3 0.9931991258592641 14.956623507160021 35091.0 64.06622983870967 0.0 - - - - - - - 261.77777777777777 70 9 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 251 32 C20140704_OR005_03 C20140704_OR005_03 TB427310.[MT7]-EPVQNEISATYIR.3b5_1.heavy 555.297 / 712.375 17979.0 32.17599868774414 50 20 10 10 10 5.837712337053181 17.129997887233856 0.0 3 0.9931991258592641 14.956623507160021 17979.0 200.08887096774197 0.0 - - - - - - - 186.0 35 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 253 33 C20140704_OR005_03 C20140704_OR005_03 TB426854.[MT7]-GNLANVIR.2y5_1.heavy 500.805 / 572.352 17758.0 28.73419952392578 47 17 10 10 10 3.4207146471277086 29.233657383251067 0.0 3 0.9779700851341793 8.299566925871632 17758.0 42.376818760531734 0.0 - - - - - - - 242.22222222222223 35 9 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 255 33 C20140704_OR005_03 C20140704_OR005_03 TB426854.[MT7]-GNLANVIR.2b4_1.heavy 500.805 / 500.295 N/A 28.73419952392578 47 17 10 10 10 3.4207146471277086 29.233657383251067 0.0 3 0.9779700851341793 8.299566925871632 73645.0 8.411024726184362 1.0 - - - - - - - 1198.0 147 1 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 257 33 C20140704_OR005_03 C20140704_OR005_03 TB426854.[MT7]-GNLANVIR.2b5_1.heavy 500.805 / 614.338 24839.0 28.73419952392578 47 17 10 10 10 3.4207146471277086 29.233657383251067 0.0 3 0.9779700851341793 8.299566925871632 24839.0 183.44399082568805 0.0 - - - - - - - 280.2857142857143 49 7 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 259 33 C20140704_OR005_03 C20140704_OR005_03 TB426854.[MT7]-GNLANVIR.2y7_1.heavy 500.805 / 799.479 8606.0 28.73419952392578 47 17 10 10 10 3.4207146471277086 29.233657383251067 0.0 3 0.9779700851341793 8.299566925871632 8606.0 94.74495412844036 0.0 - - - - - - - 218.0 17 5 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 261 34 C20140704_OR005_03 C20140704_OR005_03 TB413132.[MT7]-NDIRDTVGIWGEGK[MT7].2b8_1.heavy 924.496 / 1015.53 390.0 33.24689865112305 48 18 10 10 10 7.386281332792492 13.53861239430932 0.0 3 0.981901234736352 9.159688310821084 390.0 3.3200000000000003 9.0 - - - - - - - 0.0 1 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 263 34 C20140704_OR005_03 C20140704_OR005_03 TB413132.[MT7]-NDIRDTVGIWGEGK[MT7].2y4_1.heavy 924.496 / 534.3 1300.0 33.24689865112305 48 18 10 10 10 7.386281332792492 13.53861239430932 0.0 3 0.981901234736352 9.159688310821084 1300.0 14.7 1.0 - - - - - - - 195.0 2 2 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 265 34 C20140704_OR005_03 C20140704_OR005_03 TB413132.[MT7]-NDIRDTVGIWGEGK[MT7].2y12_2.heavy 924.496 / 737.91 1300.0 33.24689865112305 48 18 10 10 10 7.386281332792492 13.53861239430932 0.0 3 0.981901234736352 9.159688310821084 1300.0 19.200000000000003 0.0 - - - - - - - 260.0 2 4 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 267 34 C20140704_OR005_03 C20140704_OR005_03 TB413132.[MT7]-NDIRDTVGIWGEGK[MT7].2y5_1.heavy 924.496 / 720.38 1430.0 33.24689865112305 48 18 10 10 10 7.386281332792492 13.53861239430932 0.0 3 0.981901234736352 9.159688310821084 1430.0 2.0307692307692307 1.0 - - - - - - - 260.0 3 4 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 269 35 C20140704_OR005_03 C20140704_OR005_03 TB451039.[MT7]-MRLWDLQQLRK[MT7].4b7_2.heavy 444.514 / 544.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 271 35 C20140704_OR005_03 C20140704_OR005_03 TB451039.[MT7]-MRLWDLQQLRK[MT7].4b5_1.heavy 444.514 / 846.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 273 35 C20140704_OR005_03 C20140704_OR005_03 TB451039.[MT7]-MRLWDLQQLRK[MT7].4y6_2.heavy 444.514 / 465.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 275 35 C20140704_OR005_03 C20140704_OR005_03 TB451039.[MT7]-MRLWDLQQLRK[MT7].4y7_2.heavy 444.514 / 522.818 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 277 36 C20140704_OR005_03 C20140704_OR005_03 TB413136.[MT7]-LLRGYEQYAYDGK[MT7].3b6_1.heavy 622 / 876.506 3106.0 32.13629913330078 43 13 10 10 10 1.8847861557184775 35.56613687923905 0.0 3 0.9200539250998815 4.3353791546256 3106.0 10.998552735784921 0.0 - - - - - - - 262.8 6 5 HLA-G major histocompatibility complex, class I, G 279 36 C20140704_OR005_03 C20140704_OR005_03 TB413136.[MT7]-LLRGYEQYAYDGK[MT7].3y4_1.heavy 622 / 626.327 8363.0 32.13629913330078 43 13 10 10 10 1.8847861557184775 35.56613687923905 0.0 3 0.9200539250998815 4.3353791546256 8363.0 23.227410020815377 0.0 - - - - - - - 250.6 16 10 HLA-G major histocompatibility complex, class I, G 281 36 C20140704_OR005_03 C20140704_OR005_03 TB413136.[MT7]-LLRGYEQYAYDGK[MT7].3b7_1.heavy 622 / 1004.56 6571.0 32.13629913330078 43 13 10 10 10 1.8847861557184775 35.56613687923905 0.0 3 0.9200539250998815 4.3353791546256 6571.0 43.464659077627914 0.0 - - - - - - - 318.5 13 6 HLA-G major histocompatibility complex, class I, G 283 36 C20140704_OR005_03 C20140704_OR005_03 TB413136.[MT7]-LLRGYEQYAYDGK[MT7].3b7_2.heavy 622 / 502.786 10394.0 32.13629913330078 43 13 10 10 10 1.8847861557184775 35.56613687923905 0.0 3 0.9200539250998815 4.3353791546256 10394.0 60.01556485355649 0.0 - - - - - - - 298.5 20 12 HLA-G major histocompatibility complex, class I, G 285 37 C20140704_OR005_03 C20140704_OR005_03 TB451036.[MT7]-EYQISAGDFPEVK[MT7].2y4_1.heavy 885.961 / 616.379 8115.0 35.494150161743164 40 15 10 5 10 1.3496825655978966 48.414681095264214 0.047901153564453125 3 0.9578144885480603 5.98745164039469 8115.0 48.42156488549618 0.0 - - - - - - - 262.0 16 3 EHD4 EH-domain containing 4 287 37 C20140704_OR005_03 C20140704_OR005_03 TB451036.[MT7]-EYQISAGDFPEVK[MT7].2b3_1.heavy 885.961 / 565.274 13088.0 35.494150161743164 40 15 10 5 10 1.3496825655978966 48.414681095264214 0.047901153564453125 3 0.9578144885480603 5.98745164039469 13088.0 -4.995419847328243 0.0 - - - - - - - 305.6666666666667 26 3 EHD4 EH-domain containing 4 289 37 C20140704_OR005_03 C20140704_OR005_03 TB451036.[MT7]-EYQISAGDFPEVK[MT7].2y5_1.heavy 885.961 / 763.447 7199.0 35.494150161743164 40 15 10 5 10 1.3496825655978966 48.414681095264214 0.047901153564453125 3 0.9578144885480603 5.98745164039469 7199.0 12.139173510676656 0.0 - - - - - - - 229.25 14 4 EHD4 EH-domain containing 4 291 37 C20140704_OR005_03 C20140704_OR005_03 TB451036.[MT7]-EYQISAGDFPEVK[MT7].2y9_1.heavy 885.961 / 1093.56 8377.0 35.494150161743164 40 15 10 5 10 1.3496825655978966 48.414681095264214 0.047901153564453125 3 0.9578144885480603 5.98745164039469 8377.0 29.10831341469344 0.0 - - - - - - - 288.2 16 5 EHD4 EH-domain containing 4 293 38 C20140704_OR005_03 C20140704_OR005_03 TB427109.[MT7]-LALQTSDWIR.2y8_1.heavy 673.881 / 1018.53 16871.0 39.30764865875244 46 20 10 6 10 4.31440012858333 18.261962022734853 0.036998748779296875 3 0.9909905869973349 12.992344281697083 16871.0 13.75156585156585 0.0 - - - - - - - 745.2857142857143 33 7 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 295 38 C20140704_OR005_03 C20140704_OR005_03 TB427109.[MT7]-LALQTSDWIR.2y9_1.heavy 673.881 / 1089.57 37516.0 39.30764865875244 46 20 10 6 10 4.31440012858333 18.261962022734853 0.036998748779296875 3 0.9909905869973349 12.992344281697083 37516.0 129.68851480051478 0.0 - - - - - - - 277.5 75 10 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 297 38 C20140704_OR005_03 C20140704_OR005_03 TB427109.[MT7]-LALQTSDWIR.2y6_1.heavy 673.881 / 777.389 14984.0 39.30764865875244 46 20 10 6 10 4.31440012858333 18.261962022734853 0.036998748779296875 3 0.9909905869973349 12.992344281697083 14984.0 52.3465065065065 0.0 - - - - - - - 231.25 29 12 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 299 38 C20140704_OR005_03 C20140704_OR005_03 TB427109.[MT7]-LALQTSDWIR.2y7_1.heavy 673.881 / 905.448 21977.0 39.30764865875244 46 20 10 6 10 4.31440012858333 18.261962022734853 0.036998748779296875 3 0.9909905869973349 12.992344281697083 21977.0 73.91663663663664 0.0 - - - - - - - 232.0909090909091 43 11 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 301 39 C20140704_OR005_03 C20140704_OR005_03 TB427108.[MT7]-QQSELQSQVR.2y4_2.heavy 673.861 / 245.143 1033.0 20.700700759887695 44 14 10 10 10 3.0450846275801045 32.83980980176203 0.0 3 0.9449845860127262 5.237315180974036 1033.0 7.014146979546535 0.0 - - - - - - - 198.5 2 6 LASP1 LIM and SH3 protein 1 303 39 C20140704_OR005_03 C20140704_OR005_03 TB427108.[MT7]-QQSELQSQVR.2y8_1.heavy 673.861 / 946.495 2542.0 20.700700759887695 44 14 10 10 10 3.0450846275801045 32.83980980176203 0.0 3 0.9449845860127262 5.237315180974036 2542.0 31.175471698113206 0.0 - - - - - - - 198.75 5 4 LASP1 LIM and SH3 protein 1 305 39 C20140704_OR005_03 C20140704_OR005_03 TB427108.[MT7]-QQSELQSQVR.2y9_1.heavy 673.861 / 1074.55 5401.0 20.700700759887695 44 14 10 10 10 3.0450846275801045 32.83980980176203 0.0 3 0.9449845860127262 5.237315180974036 5401.0 39.74320754716981 0.0 - - - - - - - 158.71428571428572 10 7 LASP1 LIM and SH3 protein 1 307 39 C20140704_OR005_03 C20140704_OR005_03 TB427108.[MT7]-QQSELQSQVR.2y7_1.heavy 673.861 / 859.463 556.0 20.700700759887695 44 14 10 10 10 3.0450846275801045 32.83980980176203 0.0 3 0.9449845860127262 5.237315180974036 556.0 6.91074356226284 3.0 - - - - - - - 172.16666666666666 2 6 LASP1 LIM and SH3 protein 1 309 40 C20140704_OR005_03 C20140704_OR005_03 TB412794.[MT7]-VAEQVLQQK[MT7].3y3_1.heavy 444.269 / 547.332 19246.0 27.486400604248047 50 20 10 10 10 6.611738701653843 15.124614645613 0.0 3 0.9956390851179645 18.681666359259022 19246.0 281.9539 0.0 - - - - - - - 150.125 38 8 IFI35 interferon-induced protein 35 311 40 C20140704_OR005_03 C20140704_OR005_03 TB412794.[MT7]-VAEQVLQQK[MT7].3b4_1.heavy 444.269 / 572.316 89713.0 27.486400604248047 50 20 10 10 10 6.611738701653843 15.124614645613 0.0 3 0.9956390851179645 18.681666359259022 89713.0 798.1054710578842 0.0 - - - - - - - 175.25 179 8 IFI35 interferon-induced protein 35 313 40 C20140704_OR005_03 C20140704_OR005_03 TB412794.[MT7]-VAEQVLQQK[MT7].3b5_1.heavy 444.269 / 671.385 28367.0 27.486400604248047 50 20 10 10 10 6.611738701653843 15.124614645613 0.0 3 0.9956390851179645 18.681666359259022 28367.0 368.4882724252492 0.0 - - - - - - - 220.6 56 5 IFI35 interferon-induced protein 35 315 40 C20140704_OR005_03 C20140704_OR005_03 TB412794.[MT7]-VAEQVLQQK[MT7].3y8_2.heavy 444.269 / 544.315 9623.0 27.486400604248047 50 20 10 10 10 6.611738701653843 15.124614645613 0.0 3 0.9956390851179645 18.681666359259022 9623.0 89.01275 0.0 - - - - - - - 200.25 19 8 IFI35 interferon-induced protein 35 317 41 C20140704_OR005_03 C20140704_OR005_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 168562.0 18.83810043334961 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 168562.0 1477.47309482378 0.0 - - - - - - - 181.30769230769232 337 13 319 41 C20140704_OR005_03 C20140704_OR005_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 99183.0 18.83810043334961 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 99183.0 673.1553790613718 0.0 - - - - - - - 169.44444444444446 198 9 321 41 C20140704_OR005_03 C20140704_OR005_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 106599.0 18.83810043334961 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 106599.0 1672.070335159192 0.0 - - - - - - - 177.22222222222223 213 9 323 42 C20140704_OR005_03 C20140704_OR005_03 TB427102.[MT7]-VLTSFGDAIK[MT7].2y8_1.heavy 669.897 / 982.533 27443.0 36.651451110839844 41 16 10 5 10 7.103345295514293 14.077873993138024 0.0457000732421875 3 0.9689571325518666 6.986369102703021 27443.0 29.593639042934843 0.0 - - - - - - - 310.25 54 8 HBE1 hemoglobin, epsilon 1 325 42 C20140704_OR005_03 C20140704_OR005_03 TB427102.[MT7]-VLTSFGDAIK[MT7].2y5_1.heavy 669.897 / 647.385 18295.0 36.651451110839844 41 16 10 5 10 7.103345295514293 14.077873993138024 0.0457000732421875 3 0.9689571325518666 6.986369102703021 18295.0 30.799235669677707 0.0 - - - - - - - 653.4 36 10 HBE1 hemoglobin, epsilon 1 327 42 C20140704_OR005_03 C20140704_OR005_03 TB427102.[MT7]-VLTSFGDAIK[MT7].2y9_1.heavy 669.897 / 1095.62 24045.0 36.651451110839844 41 16 10 5 10 7.103345295514293 14.077873993138024 0.0457000732421875 3 0.9689571325518666 6.986369102703021 24045.0 210.80199874476375 0.0 - - - - - - - 246.88888888888889 48 9 HBE1 hemoglobin, epsilon 1 329 42 C20140704_OR005_03 C20140704_OR005_03 TB427102.[MT7]-VLTSFGDAIK[MT7].2y7_1.heavy 669.897 / 881.485 12415.0 36.651451110839844 41 16 10 5 10 7.103345295514293 14.077873993138024 0.0457000732421875 3 0.9689571325518666 6.986369102703021 12415.0 28.303826530612245 1.0 - - - - - - - 261.27272727272725 24 11 HBE1 hemoglobin, epsilon 1 331 43 C20140704_OR005_03 C20140704_OR005_03 TB412907.[MT7]-MNVEEAGGEALGR.2y8_1.heavy 738.865 / 730.384 23019.0 29.37619972229004 41 11 10 10 10 3.7951592618480574 26.349355349926704 0.0 3 0.8657194630753663 3.3294445790058185 23019.0 94.96349472450176 0.0 - - - - - - - 248.83333333333334 46 12 HBE1 hemoglobin, epsilon 1 333 43 C20140704_OR005_03 C20140704_OR005_03 TB412907.[MT7]-MNVEEAGGEALGR.2y12_1.heavy 738.865 / 1201.58 9378.0 29.37619972229004 41 11 10 10 10 3.7951592618480574 26.349355349926704 0.0 3 0.8657194630753663 3.3294445790058185 9378.0 49.30122616118753 0.0 - - - - - - - 239.75 18 4 HBE1 hemoglobin, epsilon 1 335 43 C20140704_OR005_03 C20140704_OR005_03 TB412907.[MT7]-MNVEEAGGEALGR.2y9_1.heavy 738.865 / 859.427 18223.0 29.37619972229004 41 11 10 10 10 3.7951592618480574 26.349355349926704 0.0 3 0.8657194630753663 3.3294445790058185 18223.0 111.16029999999999 0.0 - - - - - - - 213.42857142857142 36 7 HBE1 hemoglobin, epsilon 1 337 43 C20140704_OR005_03 C20140704_OR005_03 TB412907.[MT7]-MNVEEAGGEALGR.2y10_1.heavy 738.865 / 988.469 41881.0 29.37619972229004 41 11 10 10 10 3.7951592618480574 26.349355349926704 0.0 3 0.8657194630753663 3.3294445790058185 41881.0 264.9818310739987 0.0 - - - - - - - 253.125 83 8 HBE1 hemoglobin, epsilon 1 339 44 C20140704_OR005_03 C20140704_OR005_03 TB412778.[MT7]-VTSVVVDVVPR.2y9_1.heavy 657.399 / 969.573 14703.0 35.840599060058594 47 17 10 10 10 3.848228835379024 25.985980636245273 0.0 3 0.9779027132298297 8.28685818389664 14703.0 50.57550774546317 1.0 - - - - - - - 244.8 29 5 APEH N-acylaminoacyl-peptide hydrolase 341 44 C20140704_OR005_03 C20140704_OR005_03 TB412778.[MT7]-VTSVVVDVVPR.2y10_1.heavy 657.399 / 1070.62 26411.0 35.840599060058594 47 17 10 10 10 3.848228835379024 25.985980636245273 0.0 3 0.9779027132298297 8.28685818389664 26411.0 38.32025653394974 1.0 - - - - - - - 244.8 69 5 APEH N-acylaminoacyl-peptide hydrolase 343 44 C20140704_OR005_03 C20140704_OR005_03 TB412778.[MT7]-VTSVVVDVVPR.2b5_1.heavy 657.399 / 630.394 9258.0 35.840599060058594 47 17 10 10 10 3.848228835379024 25.985980636245273 0.0 3 0.9779027132298297 8.28685818389664 9258.0 6.014309368658427 2.0 - - - - - - - 294.6666666666667 18 6 APEH N-acylaminoacyl-peptide hydrolase 345 44 C20140704_OR005_03 C20140704_OR005_03 TB412778.[MT7]-VTSVVVDVVPR.2y7_1.heavy 657.399 / 783.472 21646.0 35.840599060058594 47 17 10 10 10 3.848228835379024 25.985980636245273 0.0 3 0.9779027132298297 8.28685818389664 21646.0 21.80829533114116 1.0 - - - - - - - 326.4 43 5 APEH N-acylaminoacyl-peptide hydrolase 347 45 C20140704_OR005_03 C20140704_OR005_03 TB412908.[MT7]-MNVEEAGGEALGR.3y7_1.heavy 492.913 / 659.347 23350.0 29.37619972229004 50 20 10 10 10 5.794737076195397 17.257038358271153 0.0 3 0.993363673910617 15.141121394875084 23350.0 170.94236760124608 0.0 - - - - - - - 192.6 46 10 HBE1 hemoglobin, epsilon 1 349 45 C20140704_OR005_03 C20140704_OR005_03 TB412908.[MT7]-MNVEEAGGEALGR.3y6_1.heavy 492.913 / 602.326 10497.0 29.37619972229004 50 20 10 10 10 5.794737076195397 17.257038358271153 0.0 3 0.993363673910617 15.141121394875084 10497.0 50.8482450132515 0.0 - - - - - - - 229.28571428571428 20 7 HBE1 hemoglobin, epsilon 1 351 45 C20140704_OR005_03 C20140704_OR005_03 TB412908.[MT7]-MNVEEAGGEALGR.3b4_1.heavy 492.913 / 618.304 19066.0 29.37619972229004 50 20 10 10 10 5.794737076195397 17.257038358271153 0.0 3 0.993363673910617 15.141121394875084 19066.0 126.51271028037382 0.0 - - - - - - - 224.7 38 10 HBE1 hemoglobin, epsilon 1 353 45 C20140704_OR005_03 C20140704_OR005_03 TB412908.[MT7]-MNVEEAGGEALGR.3b5_1.heavy 492.913 / 747.346 11032.0 29.37619972229004 50 20 10 10 10 5.794737076195397 17.257038358271153 0.0 3 0.993363673910617 15.141121394875084 11032.0 138.1577570093458 0.0 - - - - - - - 154.55555555555554 22 9 HBE1 hemoglobin, epsilon 1 355 46 C20140704_OR005_03 C20140704_OR005_03 TB427301.[MT7]-LDISDEFSEAIK[MT7].3b6_1.heavy 552.297 / 817.406 12050.0 39.81350040435791 43 17 10 6 10 2.8225404866351442 30.626743821717298 0.037998199462890625 3 0.9789362975911717 8.488476149232643 12050.0 61.947946603195035 0.0 - - - - - - - 163.16666666666666 24 6 EHD4 EH-domain containing 4 357 46 C20140704_OR005_03 C20140704_OR005_03 TB427301.[MT7]-LDISDEFSEAIK[MT7].3b5_1.heavy 552.297 / 688.363 9553.0 39.81350040435791 43 17 10 6 10 2.8225404866351442 30.626743821717298 0.037998199462890625 3 0.9789362975911717 8.488476149232643 9553.0 81.88285714285715 0.0 - - - - - - - 232.85714285714286 19 7 EHD4 EH-domain containing 4 359 46 C20140704_OR005_03 C20140704_OR005_03 TB427301.[MT7]-LDISDEFSEAIK[MT7].3y4_1.heavy 552.297 / 604.379 5428.0 39.81350040435791 43 17 10 6 10 2.8225404866351442 30.626743821717298 0.037998199462890625 3 0.9789362975911717 8.488476149232643 5428.0 21.660744677843432 1.0 - - - - - - - 178.57142857142858 10 14 EHD4 EH-domain containing 4 361 46 C20140704_OR005_03 C20140704_OR005_03 TB427301.[MT7]-LDISDEFSEAIK[MT7].3y5_1.heavy 552.297 / 691.411 4668.0 39.81350040435791 43 17 10 6 10 2.8225404866351442 30.626743821717298 0.037998199462890625 3 0.9789362975911717 8.488476149232643 4668.0 14.614364640883979 0.0 - - - - - - - 279.2857142857143 9 7 EHD4 EH-domain containing 4 363 47 C20140704_OR005_03 C20140704_OR005_03 TB426965.[MT7]-QLFLGGVDR.2y8_1.heavy 574.831 / 876.494 13187.0 34.331199645996094 50 20 10 10 10 12.435720236448313 8.041351694846455 0.0 3 0.9986921134334629 34.12164693103919 13187.0 45.838703756027066 1.0 - - - - - - - 240.5 26 4 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 365 47 C20140704_OR005_03 C20140704_OR005_03 TB426965.[MT7]-QLFLGGVDR.2y5_1.heavy 574.831 / 503.257 N/A 34.331199645996094 50 20 10 10 10 12.435720236448313 8.041351694846455 0.0 3 0.9986921134334629 34.12164693103919 11951.0 5.869365495496133 0.0 - - - - - - - 137.0 23 2 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 367 47 C20140704_OR005_03 C20140704_OR005_03 TB426965.[MT7]-QLFLGGVDR.2y6_1.heavy 574.831 / 616.341 7143.0 34.331199645996094 50 20 10 10 10 12.435720236448313 8.041351694846455 0.0 3 0.9986921134334629 34.12164693103919 7143.0 9.232154126213592 0.0 - - - - - - - 255.14285714285714 14 7 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 369 47 C20140704_OR005_03 C20140704_OR005_03 TB426965.[MT7]-QLFLGGVDR.2y7_1.heavy 574.831 / 763.41 8517.0 34.331199645996094 50 20 10 10 10 12.435720236448313 8.041351694846455 0.0 3 0.9986921134334629 34.12164693103919 8517.0 28.39 0.0 - - - - - - - 219.6 17 5 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 371 48 C20140704_OR005_03 C20140704_OR005_03 TB412904.[MT7]-DAHIQEIVEK[MT7].2b4_1.heavy 735.414 / 581.316 4161.0 26.252750396728516 40 15 10 5 10 3.0085959598168226 26.566967993417627 0.040699005126953125 3 0.9576901667025034 5.978585585854822 4161.0 16.92622228555144 0.0 - - - - - - - 258.0 8 6 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 373 48 C20140704_OR005_03 C20140704_OR005_03 TB412904.[MT7]-DAHIQEIVEK[MT7].2y3_1.heavy 735.414 / 519.326 2032.0 26.252750396728516 40 15 10 5 10 3.0085959598168226 26.566967993417627 0.040699005126953125 3 0.9576901667025034 5.978585585854822 2032.0 40.409567010309274 0.0 - - - - - - - 174.2 4 5 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 375 48 C20140704_OR005_03 C20140704_OR005_03 TB412904.[MT7]-DAHIQEIVEK[MT7].2y6_1.heavy 735.414 / 889.511 4257.0 26.252750396728516 40 15 10 5 10 3.0085959598168226 26.566967993417627 0.040699005126953125 3 0.9576901667025034 5.978585585854822 4257.0 54.17724848915748 0.0 - - - - - - - 258.0 8 6 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 377 48 C20140704_OR005_03 C20140704_OR005_03 TB412904.[MT7]-DAHIQEIVEK[MT7].2y7_1.heavy 735.414 / 1002.6 2806.0 26.252750396728516 40 15 10 5 10 3.0085959598168226 26.566967993417627 0.040699005126953125 3 0.9576901667025034 5.978585585854822 2806.0 18.232502439803394 0.0 - - - - - - - 210.0 5 6 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 379 49 C20140704_OR005_03 C20140704_OR005_03 TB426867.[MT7]-MHQHNIHLAK[MT7].3b6_1.heavy 506.285 / 905.453 608.0 18.928999423980713 38 13 10 5 10 2.4891992759678763 40.173561420114495 0.04039955139160156 3 0.9140999698302551 4.1802931097915925 608.0 4.783309185743263 0.0 - - - - - - - 0.0 1 0 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 381 49 C20140704_OR005_03 C20140704_OR005_03 TB426867.[MT7]-MHQHNIHLAK[MT7].3b5_1.heavy 506.285 / 792.369 1958.0 18.928999423980713 38 13 10 5 10 2.4891992759678763 40.173561420114495 0.04039955139160156 3 0.9140999698302551 4.1802931097915925 1958.0 57.559441176470585 0.0 - - - - - - - 203.0 3 2 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 383 49 C20140704_OR005_03 C20140704_OR005_03 TB426867.[MT7]-MHQHNIHLAK[MT7].3b3_1.heavy 506.285 / 541.267 2228.0 18.928999423980713 38 13 10 5 10 2.4891992759678763 40.173561420114495 0.04039955139160156 3 0.9140999698302551 4.1802931097915925 2228.0 37.07993899782135 0.0 - - - - - - - 172.77777777777777 4 9 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 385 49 C20140704_OR005_03 C20140704_OR005_03 TB426867.[MT7]-MHQHNIHLAK[MT7].3y4_1.heavy 506.285 / 612.395 5198.0 18.928999423980713 38 13 10 5 10 2.4891992759678763 40.173561420114495 0.04039955139160156 3 0.9140999698302551 4.1802931097915925 5198.0 42.31613939062215 0.0 - - - - - - - 190.54545454545453 10 11 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 387 50 C20140704_OR005_03 C20140704_OR005_03 TB426961.[MT7]-LEIFFGK[MT7].2b3_1.heavy 571.347 / 500.32 14104.0 42.28070068359375 50 20 10 10 10 7.163040996342108 13.96055111942905 0.0 3 0.9928783820160815 14.615543027279022 14104.0 86.48474857258789 0.0 - - - - - - - 247.58333333333334 28 12 IFI35 interferon-induced protein 35 389 50 C20140704_OR005_03 C20140704_OR005_03 TB426961.[MT7]-LEIFFGK[MT7].2y4_1.heavy 571.347 / 642.373 21619.0 42.28070068359375 50 20 10 10 10 7.163040996342108 13.96055111942905 0.0 3 0.9928783820160815 14.615543027279022 21619.0 53.972814371257485 0.0 - - - - - - - 232.1 43 10 IFI35 interferon-induced protein 35 391 50 C20140704_OR005_03 C20140704_OR005_03 TB426961.[MT7]-LEIFFGK[MT7].2y5_1.heavy 571.347 / 755.457 7701.0 42.28070068359375 50 20 10 10 10 7.163040996342108 13.96055111942905 0.0 3 0.9928783820160815 14.615543027279022 7701.0 46.223489293659625 0.0 - - - - - - - 195.0 15 10 IFI35 interferon-induced protein 35 393 50 C20140704_OR005_03 C20140704_OR005_03 TB426961.[MT7]-LEIFFGK[MT7].2y6_1.heavy 571.347 / 884.5 11134.0 42.28070068359375 50 20 10 10 10 7.163040996342108 13.96055111942905 0.0 3 0.9928783820160815 14.615543027279022 11134.0 138.9531461032374 0.0 - - - - - - - 220.375 22 8 IFI35 interferon-induced protein 35 395 51 C20140704_OR005_03 C20140704_OR005_03 TB450598.[MT7]-VTTNVK[MT7].2y4_1.heavy 475.3 / 605.374 898.0 19.107374668121338 31 17 2 6 6 3.4556582852246867 28.93804645776716 0.03809928894042969 5 0.9773234131855633 8.179926470972383 898.0 1.9582554517133957 3.0 - - - - - - - 0.0 1 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 397 51 C20140704_OR005_03 C20140704_OR005_03 TB450598.[MT7]-VTTNVK[MT7].2y5_1.heavy 475.3 / 706.422 3016.0 19.107374668121338 31 17 2 6 6 3.4556582852246867 28.93804645776716 0.03809928894042969 5 0.9773234131855633 8.179926470972383 3016.0 19.153950129870132 1.0 - - - - - - - 88.0 19 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 399 51 C20140704_OR005_03 C20140704_OR005_03 TB450598.[MT7]-VTTNVK[MT7].2b4_1.heavy 475.3 / 560.316 642.0 19.107374668121338 31 17 2 6 6 3.4556582852246867 28.93804645776716 0.03809928894042969 5 0.9773234131855633 8.179926470972383 642.0 2.6750000000000003 1.0 - - - - - - - 0.0 1 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 401 51 C20140704_OR005_03 C20140704_OR005_03 TB450598.[MT7]-VTTNVK[MT7].2y3_1.heavy 475.3 / 504.326 1091.0 19.107374668121338 31 17 2 6 6 3.4556582852246867 28.93804645776716 0.03809928894042969 5 0.9773234131855633 8.179926470972383 1091.0 20.967656249999997 2.0 - - - - - - - 134.5 3 10 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 403 52 C20140704_OR005_03 C20140704_OR005_03 TB413044.[MT7]-TLDFIDVLLLSK[MT7].2y4_1.heavy 833.007 / 604.415 2704.0 53.134324073791504 35 9 10 6 10 30.998873296146638 3.225923698731033 0.033901214599609375 3 0.8064431754391254 2.7586101538111687 2704.0 33.42534466477809 0.0 - - - - - - - 119.9375 5 16 CYP4F3;CYP4F11;CYP4F12;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12;cytochrome P450, family 4, subfamily F, polypeptide 2 405 52 C20140704_OR005_03 C20140704_OR005_03 TB413044.[MT7]-TLDFIDVLLLSK[MT7].2b4_1.heavy 833.007 / 621.336 6271.0 53.134324073791504 35 9 10 6 10 30.998873296146638 3.225923698731033 0.033901214599609375 3 0.8064431754391254 2.7586101538111687 6271.0 89.97670485542827 0.0 - - - - - - - 167.13333333333333 12 15 CYP4F3;CYP4F11;CYP4F12;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12;cytochrome P450, family 4, subfamily F, polypeptide 2 407 52 C20140704_OR005_03 C20140704_OR005_03 TB413044.[MT7]-TLDFIDVLLLSK[MT7].2b6_1.heavy 833.007 / 849.447 1529.0 53.134324073791504 35 9 10 6 10 30.998873296146638 3.225923698731033 0.033901214599609375 3 0.8064431754391254 2.7586101538111687 1529.0 18.426410256410254 1.0 - - - - - - - 156.8 3 10 CYP4F3;CYP4F11;CYP4F12;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12;cytochrome P450, family 4, subfamily F, polypeptide 2 409 52 C20140704_OR005_03 C20140704_OR005_03 TB413044.[MT7]-TLDFIDVLLLSK[MT7].2b7_1.heavy 833.007 / 948.516 2861.0 53.134324073791504 35 9 10 6 10 30.998873296146638 3.225923698731033 0.033901214599609375 3 0.8064431754391254 2.7586101538111687 2861.0 71.13484239751757 0.0 - - - - - - - 167.26666666666668 5 15 CYP4F3;CYP4F11;CYP4F12;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12;cytochrome P450, family 4, subfamily F, polypeptide 2 411 53 C20140704_OR005_03 C20140704_OR005_03 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 197509.0 37.93870162963867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 197509.0 173.65356127886324 0.0 - - - - - - - 324.3333333333333 395 6 413 53 C20140704_OR005_03 C20140704_OR005_03 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 103515.0 37.93870162963867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 103515.0 44.29479069767442 0.0 - - - - - - - 234.0 207 7 415 53 C20140704_OR005_03 C20140704_OR005_03 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 189522.0 37.93870162963867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 189522.0 745.3083011266806 0.0 - - - - - - - 250.22222222222223 379 9 417 54 C20140704_OR005_03 C20140704_OR005_03 TB451003.[MT7]-EPVQNEISATYIR.2y9_1.heavy 832.442 / 1066.55 10751.0 32.17599868774414 44 14 10 10 10 3.605824076161949 22.833789098461416 0.0 3 0.9432597898781716 5.156341844422237 10751.0 51.515208333333334 0.0 - - - - - - - 298.6666666666667 21 6 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 419 54 C20140704_OR005_03 C20140704_OR005_03 TB451003.[MT7]-EPVQNEISATYIR.2y6_1.heavy 832.442 / 710.383 6383.0 32.17599868774414 44 14 10 10 10 3.605824076161949 22.833789098461416 0.0 3 0.9432597898781716 5.156341844422237 6383.0 54.14151785714286 0.0 - - - - - - - 224.0 12 2 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 421 54 C20140704_OR005_03 C20140704_OR005_03 TB451003.[MT7]-EPVQNEISATYIR.2y10_1.heavy 832.442 / 1194.61 6383.0 32.17599868774414 44 14 10 10 10 3.605824076161949 22.833789098461416 0.0 3 0.9432597898781716 5.156341844422237 6383.0 62.69017857142857 0.0 - - - - - - - 224.0 12 10 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 423 54 C20140704_OR005_03 C20140704_OR005_03 TB451003.[MT7]-EPVQNEISATYIR.2y7_1.heavy 832.442 / 823.467 11535.0 32.17599868774414 44 14 10 10 10 3.605824076161949 22.833789098461416 0.0 3 0.9432597898781716 5.156341844422237 11535.0 18.113350340136055 0.0 - - - - - - - 280.0 23 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 425 55 C20140704_OR005_03 C20140704_OR005_03 TB451006.[MT7]-TLDFIDVLLLSK[MT7].3b6_1.heavy 555.674 / 849.447 703.0 51.49369812011719 33 3 10 10 10 0.30670329600382423 136.8466752292975 0.0 3 0.5043514945224695 1.674714018744193 703.0 6.1676369463869465 0.0 - - - - - - - 0.0 1 0 CYP4F3;CYP4F11;CYP4F12;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12;cytochrome P450, family 4, subfamily F, polypeptide 2 427 55 C20140704_OR005_03 C20140704_OR005_03 TB451006.[MT7]-TLDFIDVLLLSK[MT7].3b4_1.heavy 555.674 / 621.336 10432.0 51.49369812011719 33 3 10 10 10 0.30670329600382423 136.8466752292975 0.0 3 0.5043514945224695 1.674714018744193 10432.0 175.77126310133758 1.0 - - - - - - - 78.33333333333333 26 3 CYP4F3;CYP4F11;CYP4F12;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12;cytochrome P450, family 4, subfamily F, polypeptide 2 429 55 C20140704_OR005_03 C20140704_OR005_03 TB451006.[MT7]-TLDFIDVLLLSK[MT7].3y4_1.heavy 555.674 / 604.415 3516.0 51.49369812011719 33 3 10 10 10 0.30670329600382423 136.8466752292975 0.0 3 0.5043514945224695 1.674714018744193 3516.0 -2.9796610169491586 0.0 - - - - - - - 192.57142857142858 7 7 CYP4F3;CYP4F11;CYP4F12;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12;cytochrome P450, family 4, subfamily F, polypeptide 2 431 55 C20140704_OR005_03 C20140704_OR005_03 TB451006.[MT7]-TLDFIDVLLLSK[MT7].3b7_1.heavy 555.674 / 948.516 527.0 51.49369812011719 33 3 10 10 10 0.30670329600382423 136.8466752292975 0.0 3 0.5043514945224695 1.674714018744193 527.0 7.259046231546232 0.0 - - - - - - - 0.0 1 0 CYP4F3;CYP4F11;CYP4F12;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12;cytochrome P450, family 4, subfamily F, polypeptide 2 433 56 C20140704_OR005_03 C20140704_OR005_03 TB450798.[MT7]-LSELHC[CAM]DK[MT7].3y3_1.heavy 430.564 / 566.273 33624.0 22.563899993896484 50 20 10 10 10 35.514045023053455 2.8157873859507236 0.0 3 0.9977786728286102 26.180363971120727 33624.0 218.42362204724407 0.0 - - - - - - - 223.27272727272728 67 11 HBE1 hemoglobin, epsilon 1 435 56 C20140704_OR005_03 C20140704_OR005_03 TB450798.[MT7]-LSELHC[CAM]DK[MT7].3b4_1.heavy 430.564 / 587.352 16939.0 22.563899993896484 50 20 10 10 10 35.514045023053455 2.8157873859507236 0.0 3 0.9977786728286102 26.180363971120727 16939.0 13.135052036742584 0.0 - - - - - - - 169.6 33 10 HBE1 hemoglobin, epsilon 1 437 56 C20140704_OR005_03 C20140704_OR005_03 TB450798.[MT7]-LSELHC[CAM]DK[MT7].3y4_1.heavy 430.564 / 703.331 1694.0 22.563899993896484 50 20 10 10 10 35.514045023053455 2.8157873859507236 0.0 3 0.9977786728286102 26.180363971120727 1694.0 29.80331500174034 0.0 - - - - - - - 169.5 3 6 HBE1 hemoglobin, epsilon 1 439 56 C20140704_OR005_03 C20140704_OR005_03 TB450798.[MT7]-LSELHC[CAM]DK[MT7].3b3_1.heavy 430.564 / 474.268 37435.0 22.563899993896484 50 20 10 10 10 35.514045023053455 2.8157873859507236 0.0 3 0.9977786728286102 26.180363971120727 37435.0 96.06385793846665 0.0 - - - - - - - 220.1 74 10 HBE1 hemoglobin, epsilon 1 441 57 C20140704_OR005_03 C20140704_OR005_03 TB412628.[MT7]-DHGLYTK[MT7].2y4_1.heavy 561.313 / 668.41 1036.0 19.38939921061198 43 20 10 5 8 4.828990193441275 20.70826321739477 0.04109954833984375 4 0.9913533557886911 13.262492320470677 1036.0 21.020289855072463 0.0 - - - - - - - 138.0 2 5 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 443 57 C20140704_OR005_03 C20140704_OR005_03 TB412628.[MT7]-DHGLYTK[MT7].2y5_1.heavy 561.313 / 725.431 3800.0 19.38939921061198 43 20 10 5 8 4.828990193441275 20.70826321739477 0.04109954833984375 4 0.9913533557886911 13.262492320470677 3800.0 65.20579710144928 0.0 - - - - - - - 167.57142857142858 7 7 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 445 57 C20140704_OR005_03 C20140704_OR005_03 TB412628.[MT7]-DHGLYTK[MT7].2y3_1.heavy 561.313 / 555.326 N/A 19.38939921061198 43 20 10 5 8 4.828990193441275 20.70826321739477 0.04109954833984375 4 0.9913533557886911 13.262492320470677 3455.0 6.364473684210527 0.0 - - - - - - - 299.3333333333333 6 9 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 447 57 C20140704_OR005_03 C20140704_OR005_03 TB412628.[MT7]-DHGLYTK[MT7].2y6_1.heavy 561.313 / 862.49 2073.0 19.38939921061198 43 20 10 5 8 4.828990193441275 20.70826321739477 0.04109954833984375 4 0.9913533557886911 13.262492320470677 2073.0 14.287141658362616 1.0 - - - - - - - 138.0 4 7 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 449 58 C20140704_OR005_03 C20140704_OR005_03 TB412910.[MT7]-SVLHSQPIVSIR.2y8_1.heavy 740.442 / 899.531 7622.0 29.662900924682617 50 20 10 10 10 7.6408254467931656 13.087591215942478 0.0 3 0.9920819706329439 13.860115064665903 7622.0 102.08035714285714 0.0 - - - - - - - 252.0 15 4 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 451 58 C20140704_OR005_03 C20140704_OR005_03 TB412910.[MT7]-SVLHSQPIVSIR.2y9_1.heavy 740.442 / 1036.59 7846.0 29.662900924682617 50 20 10 10 10 7.6408254467931656 13.087591215942478 0.0 3 0.9920819706329439 13.860115064665903 7846.0 104.80014285714286 0.0 - - - - - - - 182.0 15 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 453 58 C20140704_OR005_03 C20140704_OR005_03 TB412910.[MT7]-SVLHSQPIVSIR.2y6_1.heavy 740.442 / 684.44 3587.0 29.662900924682617 50 20 10 10 10 7.6408254467931656 13.087591215942478 0.0 3 0.9920819706329439 13.860115064665903 3587.0 24.714002976190475 0.0 - - - - - - - 224.0 7 13 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 455 58 C20140704_OR005_03 C20140704_OR005_03 TB412910.[MT7]-SVLHSQPIVSIR.2y10_1.heavy 740.442 / 1149.67 1457.0 29.662900924682617 50 20 10 10 10 7.6408254467931656 13.087591215942478 0.0 3 0.9920819706329439 13.860115064665903 1457.0 12.956892857142858 0.0 - - - - - - - 205.33333333333334 2 6 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 457 59 C20140704_OR005_03 C20140704_OR005_03 TB412627.[MT7]-LPNSVLGK[MT7].2y4_1.heavy 558.355 / 560.389 1885.0 31.020824909210205 46 20 10 6 10 8.339174335753478 11.991594847856673 0.03989982604980469 3 0.9989498719647295 38.08055159921788 1885.0 3.3599720117598655 1.0 - - - - - - - 736.4166666666666 3 12 EHD4;EHD3 EH-domain containing 4;EH-domain containing 3 459 59 C20140704_OR005_03 C20140704_OR005_03 TB412627.[MT7]-LPNSVLGK[MT7].2y5_1.heavy 558.355 / 647.421 2120.0 31.020824909210205 46 20 10 6 10 8.339174335753478 11.991594847856673 0.03989982604980469 3 0.9989498719647295 38.08055159921788 2120.0 0.45010615711252644 1.0 - - - - - - - 809.75 4 8 EHD4;EHD3 EH-domain containing 4;EH-domain containing 3 461 59 C20140704_OR005_03 C20140704_OR005_03 TB412627.[MT7]-LPNSVLGK[MT7].2y6_1.heavy 558.355 / 761.464 1531.0 31.020824909210205 46 20 10 6 10 8.339174335753478 11.991594847856673 0.03989982604980469 3 0.9989498719647295 38.08055159921788 1531.0 2.6004246284501065 3.0 - - - - - - - 341.6 3 10 EHD4;EHD3 EH-domain containing 4;EH-domain containing 3 463 59 C20140704_OR005_03 C20140704_OR005_03 TB412627.[MT7]-LPNSVLGK[MT7].2y7_1.heavy 558.355 / 858.516 10837.0 31.020824909210205 46 20 10 6 10 8.339174335753478 11.991594847856673 0.03989982604980469 3 0.9989498719647295 38.08055159921788 10837.0 5.76501414827391 2.0 - - - - - - - 294.5 24 6 EHD4;EHD3 EH-domain containing 4;EH-domain containing 3 465 60 C20140704_OR005_03 C20140704_OR005_03 TB450905.[MT7]-SVLHSQPIVSIR.3y6_1.heavy 493.964 / 684.44 61871.0 29.672900676727295 46 20 10 6 10 13.867634050579845 7.211035396179835 0.03999900817871094 3 0.9933893680836272 15.170550639498872 61871.0 201.9932068762715 0.0 - - - - - - - 207.57142857142858 123 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 467 60 C20140704_OR005_03 C20140704_OR005_03 TB450905.[MT7]-SVLHSQPIVSIR.3b3_1.heavy 493.964 / 444.294 40798.0 29.672900676727295 46 20 10 6 10 13.867634050579845 7.211035396179835 0.03999900817871094 3 0.9933893680836272 15.170550639498872 40798.0 222.93571053345212 0.0 - - - - - - - 249.2 81 10 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 469 60 C20140704_OR005_03 C20140704_OR005_03 TB450905.[MT7]-SVLHSQPIVSIR.3y8_1.heavy 493.964 / 899.531 2388.0 29.672900676727295 46 20 10 6 10 13.867634050579845 7.211035396179835 0.03999900817871094 3 0.9933893680836272 15.170550639498872 2388.0 4.446165467474099 0.0 - - - - - - - 230.77777777777777 4 9 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 471 60 C20140704_OR005_03 C20140704_OR005_03 TB450905.[MT7]-SVLHSQPIVSIR.3y5_1.heavy 493.964 / 587.388 12354.0 29.672900676727295 46 20 10 6 10 13.867634050579845 7.211035396179835 0.03999900817871094 3 0.9933893680836272 15.170550639498872 12354.0 14.03671199076927 0.0 - - - - - - - 259.5 24 4 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 473 61 C20140704_OR005_03 C20140704_OR005_03 TB427234.[MT7]-TPLLLMLGQEDR.3y6_1.heavy 510.621 / 717.353 7699.0 45.85500144958496 37 14 10 5 8 4.838895159533386 16.27358152709796 0.04199981689453125 4 0.9300704501852 4.639466918848645 7699.0 0.8201896307421607 0.0 - - - - - - - 165.6 15 5 APEH N-acylaminoacyl-peptide hydrolase 475 61 C20140704_OR005_03 C20140704_OR005_03 TB427234.[MT7]-TPLLLMLGQEDR.3b4_1.heavy 510.621 / 569.378 4982.0 45.85500144958496 37 14 10 5 8 4.838895159533386 16.27358152709796 0.04199981689453125 4 0.9300704501852 4.639466918848645 4982.0 54.86127128875344 0.0 - - - - - - - 180.8 9 5 APEH N-acylaminoacyl-peptide hydrolase 477 61 C20140704_OR005_03 C20140704_OR005_03 TB427234.[MT7]-TPLLLMLGQEDR.3b5_1.heavy 510.621 / 682.462 5888.0 45.85500144958496 37 14 10 5 8 4.838895159533386 16.27358152709796 0.04199981689453125 4 0.9300704501852 4.639466918848645 5888.0 39.1337049526178 1.0 - - - - - - - 188.75 13 4 APEH N-acylaminoacyl-peptide hydrolase 479 61 C20140704_OR005_03 C20140704_OR005_03 TB427234.[MT7]-TPLLLMLGQEDR.3y5_1.heavy 510.621 / 604.268 12454.0 45.85500144958496 37 14 10 5 8 4.838895159533386 16.27358152709796 0.04199981689453125 4 0.9300704501852 4.639466918848645 12454.0 39.390087260772816 2.0 - - - - - - - 211.4 25 5 APEH N-acylaminoacyl-peptide hydrolase 481 62 C20140704_OR005_03 C20140704_OR005_03 TB450790.[MT7]-LLC[CAM]GADVLK[MT7].2y3_1.heavy 638.88 / 503.367 24451.0 35.277000427246094 46 16 10 10 10 5.347612611519343 18.699933459014783 0.0 3 0.9694156068345059 7.038810778166982 24451.0 95.03652448777515 0.0 - - - - - - - 221.66666666666666 48 6 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 483 62 C20140704_OR005_03 C20140704_OR005_03 TB450790.[MT7]-LLC[CAM]GADVLK[MT7].2b6_1.heavy 638.88 / 774.394 14617.0 35.277000427246094 46 16 10 10 10 5.347612611519343 18.699933459014783 0.0 3 0.9694156068345059 7.038810778166982 14617.0 47.36170331756013 0.0 - - - - - - - 266.0 29 7 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 485 62 C20140704_OR005_03 C20140704_OR005_03 TB450790.[MT7]-LLC[CAM]GADVLK[MT7].2y6_1.heavy 638.88 / 746.453 14883.0 35.277000427246094 46 16 10 10 10 5.347612611519343 18.699933459014783 0.0 3 0.9694156068345059 7.038810778166982 14883.0 137.08026315789473 0.0 - - - - - - - 228.0 29 7 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 487 62 C20140704_OR005_03 C20140704_OR005_03 TB450790.[MT7]-LLC[CAM]GADVLK[MT7].2y7_1.heavy 638.88 / 906.484 20597.0 35.277000427246094 46 16 10 10 10 5.347612611519343 18.699933459014783 0.0 3 0.9694156068345059 7.038810778166982 20597.0 65.18495934096765 0.0 - - - - - - - 282.625 41 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 489 63 C20140704_OR005_03 C20140704_OR005_03 TB412914.[MT7]-LFEAEAQDLFR.3b4_1.heavy 494.928 / 605.341 3584.0 43.90527629852295 43 17 10 6 10 2.737877552339062 29.14233743160014 0.037899017333984375 3 0.9741084236048216 7.653174148936574 3584.0 33.0935652173913 0.0 - - - - - - - 210.28571428571428 7 7 EHD4 EH-domain containing 4 491 63 C20140704_OR005_03 C20140704_OR005_03 TB412914.[MT7]-LFEAEAQDLFR.3b5_1.heavy 494.928 / 734.384 2389.0 43.90527629852295 43 17 10 6 10 2.737877552339062 29.14233743160014 0.037899017333984375 3 0.9741084236048216 7.653174148936574 2389.0 34.36351449275362 0.0 - - - - - - - 92.0 4 1 EHD4 EH-domain containing 4 493 63 C20140704_OR005_03 C20140704_OR005_03 TB412914.[MT7]-LFEAEAQDLFR.3y4_1.heavy 494.928 / 550.298 4595.0 43.90527629852295 43 17 10 6 10 2.737877552339062 29.14233743160014 0.037899017333984375 3 0.9741084236048216 7.653174148936574 4595.0 68.925 0.0 - - - - - - - 239.0 9 5 EHD4 EH-domain containing 4 495 63 C20140704_OR005_03 C20140704_OR005_03 TB412914.[MT7]-LFEAEAQDLFR.3b3_1.heavy 494.928 / 534.304 3768.0 43.90527629852295 43 17 10 6 10 2.737877552339062 29.14233743160014 0.037899017333984375 3 0.9741084236048216 7.653174148936574 3768.0 68.80695652173914 0.0 - - - - - - - 199.16666666666666 7 6 EHD4 EH-domain containing 4 497 64 C20140704_OR005_03 C20140704_OR005_03 TB427237.[MT7]-VRPPPPPADSVTR.2y10_1.heavy 766.937 / 1036.54 440.0 22.526024341583252 33 10 10 3 10 1.1200127310326855 57.86592403124209 0.07570075988769531 3 0.839806148995708 3.0413306272290193 440.0 4.75 4.0 - - - - - - - 0.0 0 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 499 64 C20140704_OR005_03 C20140704_OR005_03 TB427237.[MT7]-VRPPPPPADSVTR.2y11_1.heavy 766.937 / 1133.59 1056.0 22.526024341583252 33 10 10 3 10 1.1200127310326855 57.86592403124209 0.07570075988769531 3 0.839806148995708 3.0413306272290193 1056.0 12.685714285714285 0.0 - - - - - - - 213.71428571428572 2 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 501 64 C20140704_OR005_03 C20140704_OR005_03 TB427237.[MT7]-VRPPPPPADSVTR.2b9_1.heavy 766.937 / 1071.61 1232.0 22.526024341583252 33 10 10 3 10 1.1200127310326855 57.86592403124209 0.07570075988769531 3 0.839806148995708 3.0413306272290193 1232.0 11.666666666666666 0.0 - - - - - - - 220.0 2 10 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 503 64 C20140704_OR005_03 C20140704_OR005_03 TB427237.[MT7]-VRPPPPPADSVTR.2y9_1.heavy 766.937 / 939.489 88.0 22.526024341583252 33 10 10 3 10 1.1200127310326855 57.86592403124209 0.07570075988769531 3 0.839806148995708 3.0413306272290193 88.0 0.0 12.0 - - - - - - - 0.0 0 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 505 65 C20140704_OR005_03 C20140704_OR005_03 TB426771.[MT7]-GELLSR.2y4_1.heavy 409.746 / 488.319 7177.0 23.106825351715088 40 14 10 6 10 2.874675877434895 34.786530469386726 0.03769874572753906 3 0.9384576145275751 4.949055776985701 7177.0 52.26728260869565 0.0 - - - - - - - 237.66666666666666 14 12 APEH N-acylaminoacyl-peptide hydrolase 507 65 C20140704_OR005_03 C20140704_OR005_03 TB426771.[MT7]-GELLSR.2b3_1.heavy 409.746 / 444.258 8373.0 23.106825351715088 40 14 10 6 10 2.874675877434895 34.786530469386726 0.03769874572753906 3 0.9384576145275751 4.949055776985701 8373.0 45.32341304347826 0.0 - - - - - - - 276.0 16 8 APEH N-acylaminoacyl-peptide hydrolase 509 65 C20140704_OR005_03 C20140704_OR005_03 TB426771.[MT7]-GELLSR.2y5_1.heavy 409.746 / 617.362 4416.0 23.106825351715088 40 14 10 6 10 2.874675877434895 34.786530469386726 0.03769874572753906 3 0.9384576145275751 4.949055776985701 4416.0 60.0 0.0 - - - - - - - 163.55555555555554 8 9 APEH N-acylaminoacyl-peptide hydrolase 511 65 C20140704_OR005_03 C20140704_OR005_03 TB426771.[MT7]-GELLSR.2b4_1.heavy 409.746 / 557.341 4876.0 23.106825351715088 40 14 10 6 10 2.874675877434895 34.786530469386726 0.03769874572753906 3 0.9384576145275751 4.949055776985701 4876.0 38.14675 0.0 - - - - - - - 214.66666666666666 9 3 APEH N-acylaminoacyl-peptide hydrolase 513 66 C20140704_OR005_03 C20140704_OR005_03 TB427230.[MT7]-GHTQQDPEVPK[MT7].3b6_1.heavy 508.607 / 811.381 8003.0 18.248674869537354 43 17 10 6 10 2.416318606475761 29.893872597087807 0.03949928283691406 3 0.9700027628395721 7.107716300256167 8003.0 61.43346812837474 0.0 - - - - - - - 179.0 16 6 IFI35 interferon-induced protein 35 515 66 C20140704_OR005_03 C20140704_OR005_03 TB427230.[MT7]-GHTQQDPEVPK[MT7].3b4_1.heavy 508.607 / 568.296 6211.0 18.248674869537354 43 17 10 6 10 2.416318606475761 29.893872597087807 0.03949928283691406 3 0.9700027628395721 7.107716300256167 6211.0 36.31381343380538 0.0 - - - - - - - 152.55555555555554 12 9 IFI35 interferon-induced protein 35 517 66 C20140704_OR005_03 C20140704_OR005_03 TB427230.[MT7]-GHTQQDPEVPK[MT7].3b5_1.heavy 508.607 / 696.355 1553.0 18.248674869537354 43 17 10 6 10 2.416318606475761 29.893872597087807 0.03949928283691406 3 0.9700027628395721 7.107716300256167 1553.0 12.313535564853556 0.0 - - - - - - - 166.57142857142858 3 14 IFI35 interferon-induced protein 35 519 66 C20140704_OR005_03 C20140704_OR005_03 TB427230.[MT7]-GHTQQDPEVPK[MT7].3y5_1.heavy 508.607 / 713.431 8063.0 18.248674869537354 43 17 10 6 10 2.416318606475761 29.893872597087807 0.03949928283691406 3 0.9700027628395721 7.107716300256167 8063.0 124.67159663865547 0.0 - - - - - - - 102.14285714285714 16 7 IFI35 interferon-induced protein 35 521 67 C20140704_OR005_03 C20140704_OR005_03 TB427233.[MT7]-VRFLSFMGVGK[MT7].3b6_1.heavy 510.302 / 894.532 1058.0 40.33474922180176 40 16 10 6 8 3.4947149950016745 28.61463671373067 0.03620147705078125 4 0.9662376367826829 6.69755695979248 1058.0 1.0004728132387706 0.0 - - - - - - - 290.75 2 4 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 523 67 C20140704_OR005_03 C20140704_OR005_03 TB427233.[MT7]-VRFLSFMGVGK[MT7].3b5_1.heavy 510.302 / 747.463 635.0 40.33474922180176 40 16 10 6 8 3.4947149950016745 28.61463671373067 0.03620147705078125 4 0.9662376367826829 6.69755695979248 635.0 6.031132075471699 4.0 - - - - - - - 0.0 1 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 525 67 C20140704_OR005_03 C20140704_OR005_03 TB427233.[MT7]-VRFLSFMGVGK[MT7].3y4_1.heavy 510.302 / 504.326 4337.0 40.33474922180176 40 16 10 6 8 3.4947149950016745 28.61463671373067 0.03620147705078125 4 0.9662376367826829 6.69755695979248 4337.0 7.206578449905481 2.0 - - - - - - - 229.25 8 12 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 527 67 C20140704_OR005_03 C20140704_OR005_03 TB427233.[MT7]-VRFLSFMGVGK[MT7].3y5_1.heavy 510.302 / 635.367 1058.0 40.33474922180176 40 16 10 6 8 3.4947149950016745 28.61463671373067 0.03620147705078125 4 0.9662376367826829 6.69755695979248 1058.0 4.950641509433963 1.0 - - - - - - - 226.85714285714286 2 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 529 68 C20140704_OR005_03 C20140704_OR005_03 TB426775.[MT7]-SQPVPR.2y4_1.heavy 414.246 / 468.293 11934.0 15.742974758148193 44 18 10 6 10 4.510069366164416 22.172607975882396 0.03809928894042969 3 0.9830353585545991 9.461808147587103 11934.0 306.0442894736842 0.0 - - - - - - - 117.66666666666667 23 9 IFI35 interferon-induced protein 35 531 68 C20140704_OR005_03 C20140704_OR005_03 TB426775.[MT7]-SQPVPR.2y5_1.heavy 414.246 / 596.352 6005.0 15.742974758148193 44 18 10 6 10 4.510069366164416 22.172607975882396 0.03809928894042969 3 0.9830353585545991 9.461808147587103 6005.0 191.6453656264555 0.0 - - - - - - - 141.75 12 8 IFI35 interferon-induced protein 35 533 68 C20140704_OR005_03 C20140704_OR005_03 TB426775.[MT7]-SQPVPR.2b4_1.heavy 414.246 / 556.321 4494.0 15.742974758148193 44 18 10 6 10 4.510069366164416 22.172607975882396 0.03809928894042969 3 0.9830353585545991 9.461808147587103 4494.0 89.01134140661387 0.0 - - - - - - - 90.8 8 5 IFI35 interferon-induced protein 35 535 68 C20140704_OR005_03 C20140704_OR005_03 TB426775.[MT7]-SQPVPR.2b5_1.heavy 414.246 / 653.374 642.0 15.742974758148193 44 18 10 6 10 4.510069366164416 22.172607975882396 0.03809928894042969 3 0.9830353585545991 9.461808147587103 642.0 19.031753224119903 0.0 - - - - - - - 0.0 1 0 IFI35 interferon-induced protein 35 537 69 C20140704_OR005_03 C20140704_OR005_03 TB412728.[MT7]-MENIRFC[CAM]R.3y3_1.heavy 423.882 / 482.218 7874.0 27.564199447631836 41 13 10 10 8 1.3559184035831129 62.3039433010408 0.0 4 0.9075591963276626 4.027418688417541 7874.0 78.7597343358396 0.0 - - - - - - - 221.44444444444446 15 9 APEH N-acylaminoacyl-peptide hydrolase 539 69 C20140704_OR005_03 C20140704_OR005_03 TB412728.[MT7]-MENIRFC[CAM]R.3b4_1.heavy 423.882 / 632.319 897.0 27.564199447631836 41 13 10 10 8 1.3559184035831129 62.3039433010408 0.0 4 0.9075591963276626 4.027418688417541 897.0 10.365408270676692 3.0 - - - - - - - 243.77777777777777 2 9 APEH N-acylaminoacyl-peptide hydrolase 541 69 C20140704_OR005_03 C20140704_OR005_03 TB412728.[MT7]-MENIRFC[CAM]R.3y7_2.heavy 423.882 / 497.748 3090.0 27.564199447631836 41 13 10 10 8 1.3559184035831129 62.3039433010408 0.0 4 0.9075591963276626 4.027418688417541 3090.0 18.009565901798148 0.0 - - - - - - - 365.3333333333333 6 6 APEH N-acylaminoacyl-peptide hydrolase 543 69 C20140704_OR005_03 C20140704_OR005_03 TB412728.[MT7]-MENIRFC[CAM]R.3b3_1.heavy 423.882 / 519.235 3289.0 27.564199447631836 41 13 10 10 8 1.3559184035831129 62.3039433010408 0.0 4 0.9075591963276626 4.027418688417541 3289.0 12.983632447954056 1.0 - - - - - - - 254.77777777777777 6 9 APEH N-acylaminoacyl-peptide hydrolase 545 70 C20140704_OR005_03 C20140704_OR005_03 TB413055.[MT7]-NMDNLK[MT7]PAFAK[MT7].4b4_1.heavy 420.992 / 619.263 7472.0 29.15084934234619 38 13 10 5 10 1.3607677857215996 53.45593397267859 0.04030036926269531 3 0.92399085955163 4.4477404895842305 7472.0 67.48903225806453 0.0 - - - - - - - 189.75 14 4 HBE1 hemoglobin, epsilon 1 547 70 C20140704_OR005_03 C20140704_OR005_03 TB413055.[MT7]-NMDNLK[MT7]PAFAK[MT7].4y3_1.heavy 420.992 / 509.32 10287.0 29.15084934234619 38 13 10 5 10 1.3607677857215996 53.45593397267859 0.04030036926269531 3 0.92399085955163 4.4477404895842305 10287.0 47.42011627082595 0.0 - - - - - - - 232.14285714285714 20 7 HBE1 hemoglobin, epsilon 1 549 70 C20140704_OR005_03 C20140704_OR005_03 TB413055.[MT7]-NMDNLK[MT7]PAFAK[MT7].4b3_1.heavy 420.992 / 505.22 6714.0 29.15084934234619 38 13 10 5 10 1.3607677857215996 53.45593397267859 0.04030036926269531 3 0.92399085955163 4.4477404895842305 6714.0 60.02377880184332 0.0 - - - - - - - 189.75 13 4 HBE1 hemoglobin, epsilon 1 551 70 C20140704_OR005_03 C20140704_OR005_03 TB413055.[MT7]-NMDNLK[MT7]PAFAK[MT7].4b6_2.heavy 420.992 / 502.776 10179.0 29.15084934234619 38 13 10 5 10 1.3607677857215996 53.45593397267859 0.04030036926269531 3 0.92399085955163 4.4477404895842305 10179.0 97.32030470914127 0.0 - - - - - - - 289.0 20 3 HBE1 hemoglobin, epsilon 1 553 71 C20140704_OR005_03 C20140704_OR005_03 TB413058.[MT7]-VRPPPPPADSVTRR.4y8_2.heavy 422.997 / 451.246 1838.0 21.090824604034424 38 18 4 6 10 2.7491149241022867 28.061525583064114 0.03989982604980469 3 0.9881596923677028 11.330561394735096 1838.0 2.4441489361702127 2.0 - - - - - - - 630.1818181818181 3 11 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 555 71 C20140704_OR005_03 C20140704_OR005_03 TB413058.[MT7]-VRPPPPPADSVTRR.4y9_2.heavy 422.997 / 499.772 2088.0 21.090824604034424 38 18 4 6 10 2.7491149241022867 28.061525583064114 0.03989982604980469 3 0.9881596923677028 11.330561394735096 2088.0 5.945801793542103 0.0 - - - - - - - 237.0 4 12 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 557 71 C20140704_OR005_03 C20140704_OR005_03 TB413058.[MT7]-VRPPPPPADSVTRR.4b5_2.heavy 422.997 / 346.222 4427.0 21.090824604034424 38 18 4 6 10 2.7491149241022867 28.061525583064114 0.03989982604980469 3 0.9881596923677028 11.330561394735096 4427.0 3.5321808510638295 1.0 - - - - - - - 695.8888888888889 8 9 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 559 71 C20140704_OR005_03 C20140704_OR005_03 TB413058.[MT7]-VRPPPPPADSVTRR.4b9_2.heavy 422.997 / 536.307 1253.0 21.090824604034424 38 18 4 6 10 2.7491149241022867 28.061525583064114 0.03989982604980469 3 0.9881596923677028 11.330561394735096 1253.0 3.750499267422602 2.0 - - - - - - - 203.75 15 16 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 561 72 C20140704_OR005_03 C20140704_OR005_03 TB451014.[MT7]-YLIPDAVITYIK[MT7].3b6_1.heavy 566.342 / 817.458 40440.0 46.32659912109375 48 18 10 10 10 5.058259381951945 19.76964652243886 0.0 3 0.9821006652907466 9.210728696849653 40440.0 374.06999999999994 0.0 - - - - - - - 171.72727272727272 80 11 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 563 72 C20140704_OR005_03 C20140704_OR005_03 TB451014.[MT7]-YLIPDAVITYIK[MT7].3b5_1.heavy 566.342 / 746.42 25612.0 46.32659912109375 48 18 10 10 10 5.058259381951945 19.76964652243886 0.0 3 0.9821006652907466 9.210728696849653 25612.0 150.85685605873135 0.0 - - - - - - - 239.77777777777777 51 9 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 565 72 C20140704_OR005_03 C20140704_OR005_03 TB451014.[MT7]-YLIPDAVITYIK[MT7].3y4_1.heavy 566.342 / 668.41 74948.0 46.32659912109375 48 18 10 10 10 5.058259381951945 19.76964652243886 0.0 3 0.9821006652907466 9.210728696849653 74948.0 280.7613199230533 0.0 - - - - - - - 247.25 149 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 567 72 C20140704_OR005_03 C20140704_OR005_03 TB451014.[MT7]-YLIPDAVITYIK[MT7].3b3_1.heavy 566.342 / 534.341 110355.0 46.32659912109375 48 18 10 10 10 5.058259381951945 19.76964652243886 0.0 3 0.9821006652907466 9.210728696849653 110355.0 573.3515045928282 0.0 - - - - - - - 168.625 220 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 569 73 C20140704_OR005_03 C20140704_OR005_03 TB426886.[MT7]-LLLYPK[MT7].2y4_1.heavy 517.846 / 664.415 5663.0 35.39834976196289 41 16 10 5 10 2.5994582836213556 38.46955368742755 0.0478973388671875 3 0.9667831010280992 6.752635050085072 5663.0 34.00596543209876 0.0 - - - - - - - 286.875 11 8 APEH N-acylaminoacyl-peptide hydrolase 571 73 C20140704_OR005_03 C20140704_OR005_03 TB426886.[MT7]-LLLYPK[MT7].2y5_1.heavy 517.846 / 777.499 4450.0 35.39834976196289 41 16 10 5 10 2.5994582836213556 38.46955368742755 0.0478973388671875 3 0.9667831010280992 6.752635050085072 4450.0 29.016210572590392 0.0 - - - - - - - 162.0 8 5 APEH N-acylaminoacyl-peptide hydrolase 573 73 C20140704_OR005_03 C20140704_OR005_03 TB426886.[MT7]-LLLYPK[MT7].2b4_1.heavy 517.846 / 647.425 4719.0 35.39834976196289 41 16 10 5 10 2.5994582836213556 38.46955368742755 0.0478973388671875 3 0.9667831010280992 6.752635050085072 4719.0 7.61256918429834 1.0 - - - - - - - 135.0 9 3 APEH N-acylaminoacyl-peptide hydrolase 575 73 C20140704_OR005_03 C20140704_OR005_03 TB426886.[MT7]-LLLYPK[MT7].2y3_1.heavy 517.846 / 551.331 12001.0 35.39834976196289 41 16 10 5 10 2.5994582836213556 38.46955368742755 0.0478973388671875 3 0.9667831010280992 6.752635050085072 12001.0 175.5701851851852 1.0 - - - - - - - 202.5 24 4 APEH N-acylaminoacyl-peptide hydrolase 577 74 C20140704_OR005_03 C20140704_OR005_03 TB426887.[MT7]-EAPSC[CAM]SSR.2y6_1.heavy 519.244 / 693.298 2289.0 13.972625017166138 46 20 10 6 10 9.806472456479874 10.197346746629822 0.03609943389892578 3 0.9963366004333315 20.38391280559086 2289.0 97.86642857142857 0.0 - - - - - - - 34.22222222222222 4 18 KCNF1 potassium voltage-gated channel, subfamily F, member 1 579 74 C20140704_OR005_03 C20140704_OR005_03 TB426887.[MT7]-EAPSC[CAM]SSR.2y5_1.heavy 519.244 / 596.246 419.0 13.972625017166138 46 20 10 6 10 9.806472456479874 10.197346746629822 0.03609943389892578 3 0.9963366004333315 20.38391280559086 419.0 34.71714285714286 0.0 - - - - - - - 0.0 0 0 KCNF1 potassium voltage-gated channel, subfamily F, member 1 581 74 C20140704_OR005_03 C20140704_OR005_03 TB426887.[MT7]-EAPSC[CAM]SSR.2b4_1.heavy 519.244 / 529.274 223.0 13.972625017166138 46 20 10 6 10 9.806472456479874 10.197346746629822 0.03609943389892578 3 0.9963366004333315 20.38391280559086 223.0 4.7785714285714285 0.0 - - - - - - - 0.0 0 0 KCNF1 potassium voltage-gated channel, subfamily F, member 1 583 74 C20140704_OR005_03 C20140704_OR005_03 TB426887.[MT7]-EAPSC[CAM]SSR.2y7_1.heavy 519.244 / 764.336 2875.0 13.972625017166138 46 20 10 6 10 9.806472456479874 10.197346746629822 0.03609943389892578 3 0.9963366004333315 20.38391280559086 2875.0 26.240079365079364 0.0 - - - - - - - 62.94444444444444 5 18 KCNF1 potassium voltage-gated channel, subfamily F, member 1 585 75 C20140704_OR005_03 C20140704_OR005_03 TB412829.[MT7]-TAVAPIERVK[MT7].3y7_1.heavy 457.957 / 956.601 N/A 24.465932846069336 34 8 10 6 10 0.6220203764489227 81.84800532816547 0.03460121154785156 3 0.7660856590075087 2.5002296446361925 0.0 0.0 7.0 - - - - - - - 0.0 0 0 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 587 75 C20140704_OR005_03 C20140704_OR005_03 TB412829.[MT7]-TAVAPIERVK[MT7].3y6_1.heavy 457.957 / 885.564 1507.0 24.465932846069336 34 8 10 6 10 0.6220203764489227 81.84800532816547 0.03460121154785156 3 0.7660856590075087 2.5002296446361925 1507.0 31.10191489361702 0.0 - - - - - - - 220.0 3 3 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 589 75 C20140704_OR005_03 C20140704_OR005_03 TB412829.[MT7]-TAVAPIERVK[MT7].3b4_1.heavy 457.957 / 487.3 4333.0 24.465932846069336 34 8 10 6 10 0.6220203764489227 81.84800532816547 0.03460121154785156 3 0.7660856590075087 2.5002296446361925 4333.0 51.6096178343949 0.0 - - - - - - - 254.4 8 10 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 591 75 C20140704_OR005_03 C20140704_OR005_03 TB412829.[MT7]-TAVAPIERVK[MT7].3y9_2.heavy 457.957 / 563.857 1884.0 24.465932846069336 34 8 10 6 10 0.6220203764489227 81.84800532816547 0.03460121154785156 3 0.7660856590075087 2.5002296446361925 1884.0 6.362859408395487 0.0 - - - - - - - 251.0 3 3 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 593 76 C20140704_OR005_03 C20140704_OR005_03 TB426782.[MT7]-YHEEFEK[MT7].3y3_1.heavy 423.883 / 567.326 2331.0 22.450300216674805 33 5 10 10 8 0.5514838898832244 100.97138992375353 0.0 4 0.6140238914901833 1.9186871402984629 2331.0 19.744079668258355 0.0 - - - - - - - 107.75 4 4 LASP1 LIM and SH3 protein 1 595 76 C20140704_OR005_03 C20140704_OR005_03 TB426782.[MT7]-YHEEFEK[MT7].3b4_1.heavy 423.883 / 703.317 691.0 22.450300216674805 33 5 10 10 8 0.5514838898832244 100.97138992375353 0.0 4 0.6140238914901833 1.9186871402984629 691.0 4.861690137701698 8.0 - - - - - - - 172.75 6 8 LASP1 LIM and SH3 protein 1 597 76 C20140704_OR005_03 C20140704_OR005_03 TB426782.[MT7]-YHEEFEK[MT7].3b3_1.heavy 423.883 / 574.274 1727.0 22.450300216674805 33 5 10 10 8 0.5514838898832244 100.97138992375353 0.0 4 0.6140238914901833 1.9186871402984629 1727.0 3.3359095741704436 1.0 - - - - - - - 223.41176470588235 8 17 LASP1 LIM and SH3 protein 1 599 76 C20140704_OR005_03 C20140704_OR005_03 TB426782.[MT7]-YHEEFEK[MT7].3b4_2.heavy 423.883 / 352.162 7512.0 22.450300216674805 33 5 10 10 8 0.5514838898832244 100.97138992375353 0.0 4 0.6140238914901833 1.9186871402984629 7512.0 28.3024820040311 0.0 - - - - - - - 259.0 15 6 LASP1 LIM and SH3 protein 1 601 77 C20140704_OR005_03 C20140704_OR005_03 TB450536.[MT7]-DIQSLPQK[MT7].3y3_1.heavy 406.243 / 516.326 28150.0 25.2694993019104 37 15 10 6 6 1.1106208934463422 56.3372958888275 0.03560066223144531 6 0.9577249762975751 5.981064110827335 28150.0 389.43053661666795 0.0 - - - - - - - 191.0 56 11 EHD4 EH-domain containing 4 603 77 C20140704_OR005_03 C20140704_OR005_03 TB450536.[MT7]-DIQSLPQK[MT7].3b4_1.heavy 406.243 / 588.311 9048.0 25.2694993019104 37 15 10 6 6 1.1106208934463422 56.3372958888275 0.03560066223144531 6 0.9577249762975751 5.981064110827335 9048.0 190.90285714285716 1.0 - - - - - - - 200.8 18 5 EHD4 EH-domain containing 4 605 77 C20140704_OR005_03 C20140704_OR005_03 TB450536.[MT7]-DIQSLPQK[MT7].3b3_1.heavy 406.243 / 501.279 10053.0 25.2694993019104 37 15 10 6 6 1.1106208934463422 56.3372958888275 0.03560066223144531 6 0.9577249762975751 5.981064110827335 10053.0 68.13551745166265 2.0 - - - - - - - 232.0 34 13 EHD4 EH-domain containing 4 607 77 C20140704_OR005_03 C20140704_OR005_03 TB450536.[MT7]-DIQSLPQK[MT7].3y3_2.heavy 406.243 / 258.667 13892.0 25.2694993019104 37 15 10 6 6 1.1106208934463422 56.3372958888275 0.03560066223144531 6 0.9577249762975751 5.981064110827335 13892.0 36.11820124417107 2.0 - - - - - - - 266.5833333333333 39 12 EHD4 EH-domain containing 4 609 78 C20140704_OR005_03 C20140704_OR005_03 TB427223.[MT7]-VYGALMWSLGK[MT7].2y4_1.heavy 756.928 / 548.352 4521.0 43.8578987121582 47 17 10 10 10 2.707800594014178 36.93034125964019 0.0 3 0.9734704725781299 7.560191092395001 4521.0 32.17301143972146 0.0 - - - - - - - 239.3 9 10 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 611 78 C20140704_OR005_03 C20140704_OR005_03 TB427223.[MT7]-VYGALMWSLGK[MT7].2b4_1.heavy 756.928 / 535.3 5939.0 43.8578987121582 47 17 10 10 10 2.707800594014178 36.93034125964019 0.0 3 0.9734704725781299 7.560191092395001 5939.0 72.12299185837117 1.0 - - - - - - - 232.8125 11 16 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 613 78 C20140704_OR005_03 C20140704_OR005_03 TB427223.[MT7]-VYGALMWSLGK[MT7].2y6_1.heavy 756.928 / 865.472 4698.0 43.8578987121582 47 17 10 10 10 2.707800594014178 36.93034125964019 0.0 3 0.9734704725781299 7.560191092395001 4698.0 32.629167280766396 0.0 - - - - - - - 163.76923076923077 9 13 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 615 78 C20140704_OR005_03 C20140704_OR005_03 TB427223.[MT7]-VYGALMWSLGK[MT7].2b5_1.heavy 756.928 / 648.384 4698.0 43.8578987121582 47 17 10 10 10 2.707800594014178 36.93034125964019 0.0 3 0.9734704725781299 7.560191092395001 4698.0 17.658810068649885 0.0 - - - - - - - 236.53333333333333 9 15 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 617 79 C20140704_OR005_03 C20140704_OR005_03 TB427221.[MT7]-YLLEQDFPGMR.3b6_1.heavy 504.926 / 906.469 2551.0 40.878501892089844 47 17 10 10 10 7.855127873661502 12.730537504717553 0.0 3 0.9751656226672494 7.815069157319647 2551.0 25.00980392156863 0.0 - - - - - - - 255.0 5 2 EHD4;EHD3 EH-domain containing 4;EH-domain containing 3 619 79 C20140704_OR005_03 C20140704_OR005_03 TB427221.[MT7]-YLLEQDFPGMR.3b4_1.heavy 504.926 / 663.383 6225.0 40.878501892089844 47 17 10 10 10 7.855127873661502 12.730537504717553 0.0 3 0.9751656226672494 7.815069157319647 6225.0 91.2389705882353 0.0 - - - - - - - 153.0 12 2 EHD4;EHD3 EH-domain containing 4;EH-domain containing 3 621 79 C20140704_OR005_03 C20140704_OR005_03 TB427221.[MT7]-YLLEQDFPGMR.3b3_1.heavy 504.926 / 534.341 10510.0 40.878501892089844 47 17 10 10 10 7.855127873661502 12.730537504717553 0.0 3 0.9751656226672494 7.815069157319647 10510.0 142.19411764705882 0.0 - - - - - - - 178.5 21 4 EHD4;EHD3 EH-domain containing 4;EH-domain containing 3 623 79 C20140704_OR005_03 C20140704_OR005_03 TB427221.[MT7]-YLLEQDFPGMR.3y5_1.heavy 504.926 / 607.302 6531.0 40.878501892089844 47 17 10 10 10 7.855127873661502 12.730537504717553 0.0 3 0.9751656226672494 7.815069157319647 6531.0 43.21985294117648 0.0 - - - - - - - 160.28571428571428 13 7 EHD4;EHD3 EH-domain containing 4;EH-domain containing 3 625 80 C20140704_OR005_03 C20140704_OR005_03 TB412711.[MT7]-NEMDFWK[MT7].2y4_1.heavy 629.312 / 739.39 4817.0 36.10317325592041 32 17 0 5 10 3.3781366174691403 29.60211836397511 0.045299530029296875 3 0.9765309127505627 8.040095679535083 4817.0 48.75260948616601 0.0 - - - - - - - 229.5 9 6 KCNF1 potassium voltage-gated channel, subfamily F, member 1 627 80 C20140704_OR005_03 C20140704_OR005_03 TB412711.[MT7]-NEMDFWK[MT7].2y5_1.heavy 629.312 / 870.43 2202.0 36.10317325592041 32 17 0 5 10 3.3781366174691403 29.60211836397511 0.045299530029296875 3 0.9765309127505627 8.040095679535083 2202.0 0.9785229933570667 2.0 - - - - - - - 275.14285714285717 50 7 KCNF1 potassium voltage-gated channel, subfamily F, member 1 629 80 C20140704_OR005_03 C20140704_OR005_03 TB412711.[MT7]-NEMDFWK[MT7].2b4_1.heavy 629.312 / 634.262 6330.0 36.10317325592041 32 17 0 5 10 3.3781366174691403 29.60211836397511 0.045299530029296875 3 0.9765309127505627 8.040095679535083 6330.0 31.074545454545458 0.0 - - - - - - - 229.5 12 6 KCNF1 potassium voltage-gated channel, subfamily F, member 1 631 80 C20140704_OR005_03 C20140704_OR005_03 TB412711.[MT7]-NEMDFWK[MT7].2y3_1.heavy 629.312 / 624.363 5505.0 36.10317325592041 32 17 0 5 10 3.3781366174691403 29.60211836397511 0.045299530029296875 3 0.9765309127505627 8.040095679535083 5505.0 9.49904214629625 0.0 - - - - - - - 216.57142857142858 11 7 KCNF1 potassium voltage-gated channel, subfamily F, member 1 633 81 C20140704_OR005_03 C20140704_OR005_03 TB427619.[MT7]-LLTIDQDLMVAQFSTPSLPPTLK[MT7].4b8_1.heavy 704.898 / 1056.61 5257.0 49.437923431396484 42 17 10 5 10 2.5891758718222007 30.633916938826733 0.04010009765625 3 0.978110960706943 8.326330206871118 5257.0 21.334646976037924 0.0 - - - - - - - 787.0 10 8 APEH N-acylaminoacyl-peptide hydrolase 635 81 C20140704_OR005_03 C20140704_OR005_03 TB427619.[MT7]-LLTIDQDLMVAQFSTPSLPPTLK[MT7].4y4_1.heavy 704.898 / 602.399 6425.0 49.437923431396484 42 17 10 5 10 2.5891758718222007 30.633916938826733 0.04010009765625 3 0.978110960706943 8.326330206871118 6425.0 7.159433636468286 0.0 - - - - - - - 335.1666666666667 12 6 APEH N-acylaminoacyl-peptide hydrolase 637 81 C20140704_OR005_03 C20140704_OR005_03 TB427619.[MT7]-LLTIDQDLMVAQFSTPSLPPTLK[MT7].4y5_1.heavy 704.898 / 699.452 10578.0 49.437923431396484 42 17 10 5 10 2.5891758718222007 30.633916938826733 0.04010009765625 3 0.978110960706943 8.326330206871118 10578.0 23.67426722907021 0.0 - - - - - - - 1316.5714285714287 21 7 APEH N-acylaminoacyl-peptide hydrolase 639 81 C20140704_OR005_03 C20140704_OR005_03 TB427619.[MT7]-LLTIDQDLMVAQFSTPSLPPTLK[MT7].4b7_1.heavy 704.898 / 943.522 5516.0 49.437923431396484 42 17 10 5 10 2.5891758718222007 30.633916938826733 0.04010009765625 3 0.978110960706943 8.326330206871118 5516.0 8.512045323696006 1.0 - - - - - - - 65.0 12 1 APEH N-acylaminoacyl-peptide hydrolase 641 82 C20140704_OR005_03 C20140704_OR005_03 TB427323.[MT7]-NMDNLK[MT7]PAFAK[MT7].3y3_1.heavy 560.987 / 509.32 13641.0 29.15084934234619 45 20 10 5 10 11.168268963384177 8.953939086518766 0.04030036926269531 3 0.9964198100378568 20.61957349739645 13641.0 21.33991195435714 0.0 - - - - - - - 270.61538461538464 27 13 HBE1 hemoglobin, epsilon 1 643 82 C20140704_OR005_03 C20140704_OR005_03 TB427323.[MT7]-NMDNLK[MT7]PAFAK[MT7].3b4_1.heavy 560.987 / 619.263 10550.0 29.15084934234619 45 20 10 5 10 11.168268963384177 8.953939086518766 0.04030036926269531 3 0.9964198100378568 20.61957349739645 10550.0 102.33630616515651 0.0 - - - - - - - 239.875 21 8 HBE1 hemoglobin, epsilon 1 645 82 C20140704_OR005_03 C20140704_OR005_03 TB427323.[MT7]-NMDNLK[MT7]PAFAK[MT7].3b3_1.heavy 560.987 / 505.22 17158.0 29.15084934234619 45 20 10 5 10 11.168268963384177 8.953939086518766 0.04030036926269531 3 0.9964198100378568 20.61957349739645 17158.0 43.74594792933713 0.0 - - - - - - - 710.5 34 12 HBE1 hemoglobin, epsilon 1 647 82 C20140704_OR005_03 C20140704_OR005_03 TB427323.[MT7]-NMDNLK[MT7]PAFAK[MT7].3y5_1.heavy 560.987 / 677.41 49128.0 29.15084934234619 45 20 10 5 10 11.168268963384177 8.953939086518766 0.04030036926269531 3 0.9964198100378568 20.61957349739645 49128.0 111.71470908174106 0.0 - - - - - - - 715.4285714285714 98 7 HBE1 hemoglobin, epsilon 1 649 83 C20140704_OR005_03 C20140704_OR005_03 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1039740.0 34.89500045776367 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1039740.0 1380.8224185176036 0.0 - - - - - - - 215.57142857142858 2079 7 651 83 C20140704_OR005_03 C20140704_OR005_03 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 198947.0 34.89500045776367 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 198947.0 724.2914043822628 0.0 - - - - - - - 274.6666666666667 397 6 653 83 C20140704_OR005_03 C20140704_OR005_03 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 293127.0 34.89500045776367 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 293127.0 1942.1036007753673 0.0 - - - - - - - 329.8 586 5 655 84 C20140704_OR005_03 C20140704_OR005_03 TB412822.[MT7]-QFLEVWEK[MT7].3y3_1.heavy 456.258 / 606.337 12069.0 39.15049934387207 43 17 10 6 10 3.5707037733643645 28.00568357026679 0.036998748779296875 3 0.9753412923386333 7.842973061276862 12069.0 83.78334782608695 0.0 - - - - - - - 207.0 24 5 APEH N-acylaminoacyl-peptide hydrolase 657 84 C20140704_OR005_03 C20140704_OR005_03 TB412822.[MT7]-QFLEVWEK[MT7].3b4_1.heavy 456.258 / 662.363 13104.0 39.15049934387207 43 17 10 6 10 3.5707037733643645 28.00568357026679 0.036998748779296875 3 0.9753412923386333 7.842973061276862 13104.0 164.65460869565217 0.0 - - - - - - - 253.0 26 5 APEH N-acylaminoacyl-peptide hydrolase 659 84 C20140704_OR005_03 C20140704_OR005_03 TB412822.[MT7]-QFLEVWEK[MT7].3b5_1.heavy 456.258 / 761.431 3448.0 39.15049934387207 43 17 10 6 10 3.5707037733643645 28.00568357026679 0.036998748779296875 3 0.9753412923386333 7.842973061276862 3448.0 56.966956521739135 0.0 - - - - - - - 230.0 6 2 APEH N-acylaminoacyl-peptide hydrolase 661 84 C20140704_OR005_03 C20140704_OR005_03 TB412822.[MT7]-QFLEVWEK[MT7].3b3_1.heavy 456.258 / 533.32 10920.0 39.15049934387207 43 17 10 6 10 3.5707037733643645 28.00568357026679 0.036998748779296875 3 0.9753412923386333 7.842973061276862 10920.0 103.66086956521738 0.0 - - - - - - - 209.0909090909091 21 11 APEH N-acylaminoacyl-peptide hydrolase 663 85 C20140704_OR005_03 C20140704_OR005_03 TB427489.[MT7]-GADIMYTGTVDC[CAM]WRK[MT7].3b4_1.heavy 687.676 / 501.279 10617.0 33.11629867553711 47 17 10 10 10 22.04431582309501 4.536316790346186 0.0 3 0.9786019085979129 8.421653556443646 10617.0 55.4904140625 0.0 - - - - - - - 179.2 21 10 SLC25A4;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 665 85 C20140704_OR005_03 C20140704_OR005_03 TB427489.[MT7]-GADIMYTGTVDC[CAM]WRK[MT7].3b5_1.heavy 687.676 / 632.319 7547.0 33.11629867553711 47 17 10 10 10 22.04431582309501 4.536316790346186 0.0 3 0.9786019085979129 8.421653556443646 7547.0 94.3375 0.0 - - - - - - - 213.33333333333334 15 9 SLC25A4;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 667 85 C20140704_OR005_03 C20140704_OR005_03 TB427489.[MT7]-GADIMYTGTVDC[CAM]WRK[MT7].3y4_1.heavy 687.676 / 793.426 4733.0 33.11629867553711 47 17 10 10 10 22.04431582309501 4.536316790346186 0.0 3 0.9786019085979129 8.421653556443646 4733.0 19.597578125000002 0.0 - - - - - - - 243.2 9 10 SLC25A4;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 669 85 C20140704_OR005_03 C20140704_OR005_03 TB427489.[MT7]-GADIMYTGTVDC[CAM]WRK[MT7].3y5_1.heavy 687.676 / 908.453 1151.0 33.11629867553711 47 17 10 10 10 22.04431582309501 4.536316790346186 0.0 3 0.9786019085979129 8.421653556443646 1151.0 -0.27849897333209656 3.0 - - - - - - - 153.6 3 5 SLC25A4;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 671 86 C20140704_OR005_03 C20140704_OR005_03 TB412821.[MT7]-DYLALNEDLR.3y6_1.heavy 455.909 / 759.399 1921.0 36.205101013183594 43 13 10 10 10 1.424181932923887 58.5157354496307 0.0 3 0.9082150967945929 4.042011841676995 1921.0 28.043795620437955 0.0 - - - - - - - 137.0 3 1 HLA-G major histocompatibility complex, class I, G 673 86 C20140704_OR005_03 C20140704_OR005_03 TB412821.[MT7]-DYLALNEDLR.3b4_1.heavy 455.909 / 607.321 2607.0 36.205101013183594 43 13 10 10 10 1.424181932923887 58.5157354496307 0.0 3 0.9082150967945929 4.042011841676995 2607.0 0.0 0.0 - - - - - - - 343.0 5 2 HLA-G major histocompatibility complex, class I, G 675 86 C20140704_OR005_03 C20140704_OR005_03 TB412821.[MT7]-DYLALNEDLR.3b5_1.heavy 455.909 / 720.405 412.0 36.205101013183594 43 13 10 10 10 1.424181932923887 58.5157354496307 0.0 3 0.9082150967945929 4.042011841676995 412.0 1.2783760786034328 5.0 - - - - - - - 0.0 1 0 HLA-G major histocompatibility complex, class I, G 677 86 C20140704_OR005_03 C20140704_OR005_03 TB412821.[MT7]-DYLALNEDLR.3y5_1.heavy 455.909 / 646.315 6175.0 36.205101013183594 43 13 10 10 10 1.424181932923887 58.5157354496307 0.0 3 0.9082150967945929 4.042011841676995 6175.0 37.185218978102185 0.0 - - - - - - - 308.5 12 4 HLA-G major histocompatibility complex, class I, G 679 87 C20140704_OR005_03 C20140704_OR005_03 TB412718.[MT7]-SSVAVNNC[CAM]IR.2y8_1.heavy 632.333 / 945.494 2954.0 22.186675548553467 32 16 4 6 6 2.7397111991604506 28.70174879786488 0.03909873962402344 5 0.9674849687004297 6.825531024685626 2954.0 7.922605363984674 0.0 - - - - - - - 191.4 5 5 APBB1;APBB2 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);amyloid beta (A4) precursor protein-binding, family B, member 2 681 87 C20140704_OR005_03 C20140704_OR005_03 TB412718.[MT7]-SSVAVNNC[CAM]IR.2y9_1.heavy 632.333 / 1032.53 8515.0 22.186675548553467 32 16 4 6 6 2.7397111991604506 28.70174879786488 0.03909873962402344 5 0.9674849687004297 6.825531024685626 8515.0 112.55459770114942 0.0 - - - - - - - 134.45454545454547 17 11 APBB1;APBB2 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);amyloid beta (A4) precursor protein-binding, family B, member 2 683 87 C20140704_OR005_03 C20140704_OR005_03 TB412718.[MT7]-SSVAVNNC[CAM]IR.2y6_1.heavy 632.333 / 775.388 4084.0 22.186675548553467 32 16 4 6 6 2.7397111991604506 28.70174879786488 0.03909873962402344 5 0.9674849687004297 6.825531024685626 4084.0 23.471264367816094 1.0 - - - - - - - 295.4 33 5 APBB1;APBB2 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);amyloid beta (A4) precursor protein-binding, family B, member 2 685 87 C20140704_OR005_03 C20140704_OR005_03 TB412718.[MT7]-SSVAVNNC[CAM]IR.2y7_1.heavy 632.333 / 846.425 5908.0 22.186675548553467 32 16 4 6 6 2.7397111991604506 28.70174879786488 0.03909873962402344 5 0.9674849687004297 6.825531024685626 5908.0 59.78724508713385 1.0 - - - - - - - 195.66666666666666 17 12 APBB1;APBB2 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);amyloid beta (A4) precursor protein-binding, family B, member 2 687 88 C20140704_OR005_03 C20140704_OR005_03 TB412717.[MT7]-GYIAESPILR.2y8_1.heavy 631.865 / 898.536 21157.0 34.000999450683594 50 20 10 10 10 9.881887711372823 10.11952401411245 0.0 3 0.99677582167754 21.72881723305832 21157.0 228.71988881706528 0.0 - - - - - - - 218.0 42 5 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 689 88 C20140704_OR005_03 C20140704_OR005_03 TB412717.[MT7]-GYIAESPILR.2y5_1.heavy 631.865 / 585.372 28255.0 34.000999450683594 50 20 10 10 10 9.881887711372823 10.11952401411245 0.0 3 0.99677582167754 21.72881723305832 28255.0 121.92084249084249 0.0 - - - - - - - 272.7142857142857 56 7 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 691 88 C20140704_OR005_03 C20140704_OR005_03 TB412717.[MT7]-GYIAESPILR.2b4_1.heavy 631.865 / 549.315 22932.0 34.000999450683594 50 20 10 10 10 9.881887711372823 10.11952401411245 0.0 3 0.99677582167754 21.72881723305832 22932.0 58.1070684039088 0.0 - - - - - - - 341.0 45 4 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 693 88 C20140704_OR005_03 C20140704_OR005_03 TB412717.[MT7]-GYIAESPILR.2y7_1.heavy 631.865 / 785.452 38766.0 34.000999450683594 50 20 10 10 10 9.881887711372823 10.11952401411245 0.0 3 0.99677582167754 21.72881723305832 38766.0 101.5226432062561 0.0 - - - - - - - 181.66666666666666 77 3 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 695 89 C20140704_OR005_03 C20140704_OR005_03 TB427487.[MT7]-ANVNLDVPLQDFPTPK[MT7].3b6_1.heavy 686.049 / 771.412 60523.0 39.84224987030029 37 14 10 3 10 3.2548728514559495 30.723166330527665 0.07699966430664062 3 0.9409213702248347 5.052257683794023 60523.0 262.4252129691689 0.0 - - - - - - - 226.75 121 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 697 89 C20140704_OR005_03 C20140704_OR005_03 TB427487.[MT7]-ANVNLDVPLQDFPTPK[MT7].3b4_1.heavy 686.049 / 543.301 19393.0 39.84224987030029 37 14 10 3 10 3.2548728514559495 30.723166330527665 0.07699966430664062 3 0.9409213702248347 5.052257683794023 19393.0 131.56284037558683 0.0 - - - - - - - 248.66666666666666 38 12 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 699 89 C20140704_OR005_03 C20140704_OR005_03 TB427487.[MT7]-ANVNLDVPLQDFPTPK[MT7].3y4_1.heavy 686.049 / 586.368 34417.0 39.84224987030029 37 14 10 3 10 3.2548728514559495 30.723166330527665 0.07699966430664062 3 0.9409213702248347 5.052257683794023 34417.0 90.5328045738911 0.0 - - - - - - - 593.7142857142857 68 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 701 89 C20140704_OR005_03 C20140704_OR005_03 TB427487.[MT7]-ANVNLDVPLQDFPTPK[MT7].3b7_1.heavy 686.049 / 870.48 35909.0 39.84224987030029 37 14 10 3 10 3.2548728514559495 30.723166330527665 0.07699966430664062 3 0.9409213702248347 5.052257683794023 35909.0 112.215625 1.0 - - - - - - - 260.55555555555554 71 9 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 703 90 C20140704_OR005_03 C20140704_OR005_03 TB427326.[MT7]-LQC[CAM]PIC[CAM]LEVFK[MT7].2b3_1.heavy 847.964 / 546.283 8464.0 41.632198333740234 46 16 10 10 10 3.345974641412808 29.886658064382665 0.0 3 0.9666219823291303 6.736225981198792 8464.0 30.74345742464743 0.0 - - - - - - - 308.75 16 12 TRIM73 tripartite motif-containing 73 705 90 C20140704_OR005_03 C20140704_OR005_03 TB427326.[MT7]-LQC[CAM]PIC[CAM]LEVFK[MT7].2y8_1.heavy 847.964 / 1149.65 7893.0 41.632198333740234 46 16 10 10 10 3.345974641412808 29.886658064382665 0.0 3 0.9666219823291303 6.736225981198792 7893.0 36.53765176513964 0.0 - - - - - - - 285.0 15 11 TRIM73 tripartite motif-containing 73 707 90 C20140704_OR005_03 C20140704_OR005_03 TB427326.[MT7]-LQC[CAM]PIC[CAM]LEVFK[MT7].2y3_1.heavy 847.964 / 537.352 3804.0 41.632198333740234 46 16 10 10 10 3.345974641412808 29.886658064382665 0.0 3 0.9666219823291303 6.736225981198792 3804.0 20.953030878421973 0.0 - - - - - - - 200.55555555555554 7 9 TRIM73 tripartite motif-containing 73 709 90 C20140704_OR005_03 C20140704_OR005_03 TB427326.[MT7]-LQC[CAM]PIC[CAM]LEVFK[MT7].2y6_1.heavy 847.964 / 939.509 4184.0 41.632198333740234 46 16 10 10 10 3.345974641412808 29.886658064382665 0.0 3 0.9666219823291303 6.736225981198792 4184.0 20.585225118871946 2.0 - - - - - - - 155.45454545454547 8 11 TRIM73 tripartite motif-containing 73 711 91 C20140704_OR005_03 C20140704_OR005_03 TB427625.[MT7]-GLSRQPALSAAC[CAM]LGPEVTTQYGGQYR.3y6_1.heavy 975.498 / 743.347 5090.0 34.37770080566406 43 13 10 10 10 4.60324989664681 21.72378259821262 0.0 3 0.9219949138399487 4.38971725004183 5090.0 7.017164179104477 1.0 - - - - - - - 287.14285714285717 10 7 APEH N-acylaminoacyl-peptide hydrolase 713 91 C20140704_OR005_03 C20140704_OR005_03 TB427625.[MT7]-GLSRQPALSAAC[CAM]LGPEVTTQYGGQYR.3y4_1.heavy 975.498 / 523.262 3081.0 34.37770080566406 43 13 10 10 10 4.60324989664681 21.72378259821262 0.0 3 0.9219949138399487 4.38971725004183 3081.0 12.317430703624733 1.0 - - - - - - - 187.6 6 5 APEH N-acylaminoacyl-peptide hydrolase 715 91 C20140704_OR005_03 C20140704_OR005_03 TB427625.[MT7]-GLSRQPALSAAC[CAM]LGPEVTTQYGGQYR.3y8_1.heavy 975.498 / 972.453 5492.0 34.37770080566406 43 13 10 10 10 4.60324989664681 21.72378259821262 0.0 3 0.9219949138399487 4.38971725004183 5492.0 19.921913733440526 1.0 - - - - - - - 223.33333333333334 13 6 APEH N-acylaminoacyl-peptide hydrolase 717 91 C20140704_OR005_03 C20140704_OR005_03 TB427625.[MT7]-GLSRQPALSAAC[CAM]LGPEVTTQYGGQYR.3y9_1.heavy 975.498 / 1073.5 14869.0 34.37770080566406 43 13 10 10 10 4.60324989664681 21.72378259821262 0.0 3 0.9219949138399487 4.38971725004183 14869.0 80.72535447761194 0.0 - - - - - - - 229.71428571428572 29 7 APEH N-acylaminoacyl-peptide hydrolase 719 92 C20140704_OR005_03 C20140704_OR005_03 TB427624.[MT7]-GLSRQPALSAAC[CAM]LGPEVTTQYGGQYR.4b11_2.heavy 731.876 / 598.847 14735.0 34.35445022583008 38 13 10 5 10 4.220961476385866 23.691284689388702 0.04650115966796875 3 0.9245728151111845 4.465088447812184 14735.0 135.25410447761195 0.0 - - - - - - - 201.0 29 4 APEH N-acylaminoacyl-peptide hydrolase 721 92 C20140704_OR005_03 C20140704_OR005_03 TB427624.[MT7]-GLSRQPALSAAC[CAM]LGPEVTTQYGGQYR.4y6_1.heavy 731.876 / 743.347 9511.0 34.35445022583008 38 13 10 5 10 4.220961476385866 23.691284689388702 0.04650115966796875 3 0.9245728151111845 4.465088447812184 9511.0 18.54881592039801 0.0 - - - - - - - 290.3333333333333 19 6 APEH N-acylaminoacyl-peptide hydrolase 723 92 C20140704_OR005_03 C20140704_OR005_03 TB427624.[MT7]-GLSRQPALSAAC[CAM]LGPEVTTQYGGQYR.4b10_2.heavy 731.876 / 563.328 12324.0 34.35445022583008 38 13 10 5 10 4.220961476385866 23.691284689388702 0.04650115966796875 3 0.9245728151111845 4.465088447812184 12324.0 32.49611940298507 0.0 - - - - - - - 301.5 24 4 APEH N-acylaminoacyl-peptide hydrolase 725 92 C20140704_OR005_03 C20140704_OR005_03 TB427624.[MT7]-GLSRQPALSAAC[CAM]LGPEVTTQYGGQYR.4b9_2.heavy 731.876 / 527.81 5626.0 34.35445022583008 38 13 10 5 10 4.220961476385866 23.691284689388702 0.04650115966796875 3 0.9245728151111845 4.465088447812184 5626.0 12.81091289341958 1.0 - - - - - - - 223.33333333333334 11 3 APEH N-acylaminoacyl-peptide hydrolase 727 93 C20140704_OR005_03 C20140704_OR005_03 TB450919.[MT7]-DFLAGGVAAAVSK[MT7].3b6_1.heavy 498.624 / 705.369 31037.0 36.58290100097656 43 13 10 10 10 1.4703589003852207 56.78588218429804 0.0 3 0.9167846420345587 4.248170442630503 31037.0 95.05159773312857 0.0 - - - - - - - 240.25 62 4 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 729 93 C20140704_OR005_03 C20140704_OR005_03 TB450919.[MT7]-DFLAGGVAAAVSK[MT7].3y4_1.heavy 498.624 / 548.352 30762.0 36.58290100097656 43 13 10 10 10 1.4703589003852207 56.78588218429804 0.0 3 0.9167846420345587 4.248170442630503 30762.0 96.8877843796979 0.0 - - - - - - - 215.85714285714286 61 7 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 731 93 C20140704_OR005_03 C20140704_OR005_03 TB450919.[MT7]-DFLAGGVAAAVSK[MT7].3b3_1.heavy 498.624 / 520.289 20600.0 36.58290100097656 43 13 10 10 10 1.4703589003852207 56.78588218429804 0.0 3 0.9167846420345587 4.248170442630503 20600.0 98.1590909090909 0.0 - - - - - - - 329.6 41 5 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 733 93 C20140704_OR005_03 C20140704_OR005_03 TB450919.[MT7]-DFLAGGVAAAVSK[MT7].3b7_1.heavy 498.624 / 804.437 13047.0 36.58290100097656 43 13 10 10 10 1.4703589003852207 56.78588218429804 0.0 3 0.9167846420345587 4.248170442630503 13047.0 134.12350630391506 0.0 - - - - - - - 219.6 26 5 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 735 94 C20140704_OR005_03 C20140704_OR005_03 TB427213.[MT7]-VDPWESEQAQWMETVK[MT7].3y6_1.heavy 751.036 / 937.493 8354.0 41.832698822021484 48 18 10 10 10 3.5529777184688456 22.54496622139292 0.0 3 0.9867766681865536 10.720429596973766 8354.0 46.928368097470596 0.0 - - - - - - - 178.8 16 10 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 737 94 C20140704_OR005_03 C20140704_OR005_03 TB427213.[MT7]-VDPWESEQAQWMETVK[MT7].3b4_1.heavy 751.036 / 642.337 10144.0 41.832698822021484 48 18 10 10 10 3.5529777184688456 22.54496622139292 0.0 3 0.9867766681865536 10.720429596973766 10144.0 74.54784580621227 0.0 - - - - - - - 258.5 20 10 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 739 94 C20140704_OR005_03 C20140704_OR005_03 TB427213.[MT7]-VDPWESEQAQWMETVK[MT7].3b5_1.heavy 751.036 / 771.379 12133.0 41.832698822021484 48 18 10 10 10 3.5529777184688456 22.54496622139292 0.0 3 0.9867766681865536 10.720429596973766 12133.0 73.57028475711893 0.0 - - - - - - - 278.4 24 10 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 741 94 C20140704_OR005_03 C20140704_OR005_03 TB427213.[MT7]-VDPWESEQAQWMETVK[MT7].3y4_1.heavy 751.036 / 620.374 12431.0 41.832698822021484 48 18 10 10 10 3.5529777184688456 22.54496622139292 0.0 3 0.9867766681865536 10.720429596973766 12431.0 39.98915058188326 0.0 - - - - - - - 260.0769230769231 24 13 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 743 95 C20140704_OR005_03 C20140704_OR005_03 TB427351.[MT7]-YFPTQALNFAFK[MT7].2y4_1.heavy 867.977 / 656.389 5440.0 45.11454963684082 42 17 10 5 10 1.8931157468067814 37.67831174791464 0.042697906494140625 3 0.9702790802987552 7.140846576065356 5440.0 22.352985676449034 0.0 - - - - - - - 172.0909090909091 10 11 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 745 95 C20140704_OR005_03 C20140704_OR005_03 TB427351.[MT7]-YFPTQALNFAFK[MT7].2y5_1.heavy 867.977 / 770.432 5440.0 45.11454963684082 42 17 10 5 10 1.8931157468067814 37.67831174791464 0.042697906494140625 3 0.9702790802987552 7.140846576065356 5440.0 31.62780364289798 0.0 - - - - - - - 192.11111111111111 10 9 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 747 95 C20140704_OR005_03 C20140704_OR005_03 TB427351.[MT7]-YFPTQALNFAFK[MT7].2y3_1.heavy 867.977 / 509.32 6100.0 45.11454963684082 42 17 10 5 10 1.8931157468067814 37.67831174791464 0.042697906494140625 3 0.9702790802987552 7.140846576065356 6100.0 5.788801137985738 1.0 - - - - - - - 192.22222222222223 12 9 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 749 95 C20140704_OR005_03 C20140704_OR005_03 TB427351.[MT7]-YFPTQALNFAFK[MT7].2y7_1.heavy 867.977 / 954.553 6512.0 45.11454963684082 42 17 10 5 10 1.8931157468067814 37.67831174791464 0.042697906494140625 3 0.9702790802987552 7.140846576065356 6512.0 149.29951219512196 0.0 - - - - - - - 141.0 13 7 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 751 96 C20140704_OR005_03 C20140704_OR005_03 TB450929.[MT7]-YLLEQDFPGMR.2y8_1.heavy 756.885 / 979.43 21839.0 40.888001441955566 42 16 10 6 10 3.051438800355617 25.723098120648796 0.037998199462890625 3 0.9637511714874049 6.462412660215355 21839.0 -55.52288135593221 0.0 - - - - - - - 236.0 43 7 EHD4;EHD3 EH-domain containing 4;EH-domain containing 3 753 96 C20140704_OR005_03 C20140704_OR005_03 TB450929.[MT7]-YLLEQDFPGMR.2y5_1.heavy 756.885 / 607.302 40491.0 40.888001441955566 42 16 10 6 10 3.051438800355617 25.723098120648796 0.037998199462890625 3 0.9637511714874049 6.462412660215355 40491.0 -25.735805084745763 0.0 - - - - - - - 354.0 80 4 EHD4;EHD3 EH-domain containing 4;EH-domain containing 3 755 96 C20140704_OR005_03 C20140704_OR005_03 TB450929.[MT7]-YLLEQDFPGMR.2y9_1.heavy 756.885 / 1092.51 16173.0 40.888001441955566 42 16 10 6 10 3.051438800355617 25.723098120648796 0.037998199462890625 3 0.9637511714874049 6.462412660215355 16173.0 123.35338983050848 0.0 - - - - - - - 275.3333333333333 32 6 EHD4;EHD3 EH-domain containing 4;EH-domain containing 3 757 96 C20140704_OR005_03 C20140704_OR005_03 TB450929.[MT7]-YLLEQDFPGMR.2y10_1.heavy 756.885 / 1205.6 7201.0 40.888001441955566 42 16 10 6 10 3.051438800355617 25.723098120648796 0.037998199462890625 3 0.9637511714874049 6.462412660215355 7201.0 11.387795342451335 0.0 - - - - - - - 236.0 14 4 EHD4;EHD3 EH-domain containing 4;EH-domain containing 3 759 97 C20140704_OR005_03 C20140704_OR005_03 TB426896.[MT7]-DLAASHHR.2y5_1.heavy 525.782 / 607.306 1823.0 13.783599853515625 50 20 10 10 10 8.14222023041979 12.281662393065028 0.0 3 0.9910260885978693 13.018056996598844 1823.0 38.48555555555555 0.0 - - - - - - - 55.38461538461539 3 13 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 761 97 C20140704_OR005_03 C20140704_OR005_03 TB426896.[MT7]-DLAASHHR.2b4_1.heavy 525.782 / 515.295 1317.0 13.783599853515625 50 20 10 10 10 8.14222023041979 12.281662393065028 0.0 3 0.9910260885978693 13.018056996598844 1317.0 18.202979797979797 0.0 - - - - - - - 112.89473684210526 2 19 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 763 97 C20140704_OR005_03 C20140704_OR005_03 TB426896.[MT7]-DLAASHHR.2y6_1.heavy 525.782 / 678.343 1949.0 13.783599853515625 50 20 10 10 10 8.14222023041979 12.281662393065028 0.0 3 0.9910260885978693 13.018056996598844 1949.0 25.264814814814816 0.0 - - - - - - - 61.875 3 16 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 765 97 C20140704_OR005_03 C20140704_OR005_03 TB426896.[MT7]-DLAASHHR.2y7_1.heavy 525.782 / 791.427 2436.0 13.783599853515625 50 20 10 10 10 8.14222023041979 12.281662393065028 0.0 3 0.9910260885978693 13.018056996598844 2436.0 100.14666666666668 0.0 - - - - - - - 56.76923076923077 4 13 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 767 98 C20140704_OR005_03 C20140704_OR005_03 TB450923.[MT7]-RGVLSLIDTLK[MT7].3y3_1.heavy 501.655 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 769 98 C20140704_OR005_03 C20140704_OR005_03 TB450923.[MT7]-RGVLSLIDTLK[MT7].3b6_1.heavy 501.655 / 770.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 771 98 C20140704_OR005_03 C20140704_OR005_03 TB450923.[MT7]-RGVLSLIDTLK[MT7].3b5_1.heavy 501.655 / 657.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 773 98 C20140704_OR005_03 C20140704_OR005_03 TB450923.[MT7]-RGVLSLIDTLK[MT7].3y4_1.heavy 501.655 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 775 99 C20140704_OR005_03 C20140704_OR005_03 TB427216.[MT7]-RGVLSLIDTLK[MT7].2b8_1.heavy 751.979 / 998.612 5410.0 41.21972465515137 30 18 2 6 4 8.771892844154742 11.400048059939108 0.03949737548828125 8 0.9845968279642886 9.931120384844196 5410.0 41.87357973421926 0.0 - - - - - - - 215.6153846153846 10 13 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 777 99 C20140704_OR005_03 C20140704_OR005_03 TB427216.[MT7]-RGVLSLIDTLK[MT7].2y4_1.heavy 751.979 / 620.374 1202.0 41.21972465515137 30 18 2 6 4 8.771892844154742 11.400048059939108 0.03949737548828125 8 0.9845968279642886 9.931120384844196 1202.0 1.6059171978623399 6.0 - - - - - - - 280.6 23 5 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 779 99 C20140704_OR005_03 C20140704_OR005_03 TB427216.[MT7]-RGVLSLIDTLK[MT7].2b6_1.heavy 751.979 / 770.5 301.0 41.21972465515137 30 18 2 6 4 8.771892844154742 11.400048059939108 0.03949737548828125 8 0.9845968279642886 9.931120384844196 301.0 4.3344 17.0 - - - - - - - 220.3 3 10 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 781 99 C20140704_OR005_03 C20140704_OR005_03 TB427216.[MT7]-RGVLSLIDTLK[MT7].2y3_1.heavy 751.979 / 505.347 3707.0 41.21972465515137 30 18 2 6 4 8.771892844154742 11.400048059939108 0.03949737548828125 8 0.9845968279642886 9.931120384844196 3707.0 20.075471297836938 0.0 - - - - - - - 210.4 7 10 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 783 100 C20140704_OR005_03 C20140704_OR005_03 TB427350.[MT7]-YFPTQALNFAFK[MT7].3b6_1.heavy 578.987 / 852.437 62461.0 45.13589859008789 45 15 10 10 10 3.787520867016488 26.402494800978396 0.0 3 0.954883288346192 5.7882482090941325 62461.0 216.24755303030304 0.0 - - - - - - - 246.4 124 10 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 785 100 C20140704_OR005_03 C20140704_OR005_03 TB427350.[MT7]-YFPTQALNFAFK[MT7].3y3_1.heavy 578.987 / 509.32 108736.0 45.13589859008789 45 15 10 10 10 3.787520867016488 26.402494800978396 0.0 3 0.954883288346192 5.7882482090941325 108736.0 312.79251948051945 0.0 - - - - - - - 176.0 217 7 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 787 100 C20140704_OR005_03 C20140704_OR005_03 TB427350.[MT7]-YFPTQALNFAFK[MT7].3b5_1.heavy 578.987 / 781.4 39588.0 45.13589859008789 45 15 10 10 10 3.787520867016488 26.402494800978396 0.0 3 0.954883288346192 5.7882482090941325 39588.0 60.22314878669717 1.0 - - - - - - - 234.66666666666666 84 6 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 789 100 C20140704_OR005_03 C20140704_OR005_03 TB427350.[MT7]-YFPTQALNFAFK[MT7].3y5_1.heavy 578.987 / 770.432 56303.0 45.13589859008789 45 15 10 10 10 3.787520867016488 26.402494800978396 0.0 3 0.954883288346192 5.7882482090941325 56303.0 193.54156249999997 0.0 - - - - - - - 234.66666666666666 112 6 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 791 101 C20140704_OR005_03 C20140704_OR005_03 TB412605.[MT7]-QLSYC[CAM]K[MT7].2y4_1.heavy 543.796 / 701.341 5212.0 22.07890033721924 44 18 10 6 10 5.073205107213806 19.71140489821824 0.03740119934082031 3 0.9864150391097157 10.57645895385953 5212.0 23.069508196721312 0.0 - - - - - - - 241.83333333333334 10 6 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 793 101 C20140704_OR005_03 C20140704_OR005_03 TB412605.[MT7]-QLSYC[CAM]K[MT7].2y5_1.heavy 543.796 / 814.425 6750.0 22.07890033721924 44 18 10 6 10 5.073205107213806 19.71140489821824 0.03740119934082031 3 0.9864150391097157 10.57645895385953 6750.0 48.779296875 0.0 - - - - - - - 170.66666666666666 13 12 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 795 101 C20140704_OR005_03 C20140704_OR005_03 TB412605.[MT7]-QLSYC[CAM]K[MT7].2y3_1.heavy 543.796 / 614.309 2734.0 22.07890033721924 44 18 10 6 10 5.073205107213806 19.71140489821824 0.03740119934082031 3 0.9864150391097157 10.57645895385953 2734.0 14.093685963114753 0.0 - - - - - - - 195.14285714285714 5 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 797 101 C20140704_OR005_03 C20140704_OR005_03 TB412605.[MT7]-QLSYC[CAM]K[MT7].2b5_1.heavy 543.796 / 796.378 598.0 22.07890033721924 44 18 10 6 10 5.073205107213806 19.71140489821824 0.03740119934082031 3 0.9864150391097157 10.57645895385953 598.0 4.92470588235294 0.0 - - - - - - - 0.0 1 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 799 102 C20140704_OR005_03 C20140704_OR005_03 TB427218.[MT7]-ALDVSASDDEIAR.2y5_1.heavy 753.382 / 603.31 5198.0 29.010099411010742 44 14 10 10 10 2.1495668969452 46.520999249715075 0.0 3 0.9400268759825384 5.014057001666102 5198.0 15.373012939001848 0.0 - - - - - - - 252.83333333333334 10 6 APEH N-acylaminoacyl-peptide hydrolase 801 102 C20140704_OR005_03 C20140704_OR005_03 TB427218.[MT7]-ALDVSASDDEIAR.2y9_1.heavy 753.382 / 963.438 17217.0 29.010099411010742 44 14 10 10 10 2.1495668969452 46.520999249715075 0.0 3 0.9400268759825384 5.014057001666102 17217.0 178.38970256410255 0.0 - - - - - - - 162.33333333333334 34 6 APEH N-acylaminoacyl-peptide hydrolase 803 102 C20140704_OR005_03 C20140704_OR005_03 TB427218.[MT7]-ALDVSASDDEIAR.2y10_1.heavy 753.382 / 1062.51 21116.0 29.010099411010742 44 14 10 10 10 2.1495668969452 46.520999249715075 0.0 3 0.9400268759825384 5.014057001666102 21116.0 32.623904859268116 0.0 - - - - - - - 276.8888888888889 42 9 APEH N-acylaminoacyl-peptide hydrolase 805 102 C20140704_OR005_03 C20140704_OR005_03 TB427218.[MT7]-ALDVSASDDEIAR.2y11_1.heavy 753.382 / 1177.53 4007.0 29.010099411010742 44 14 10 10 10 2.1495668969452 46.520999249715075 0.0 3 0.9400268759825384 5.014057001666102 4007.0 49.43108262108262 0.0 - - - - - - - 108.0 8 2 APEH N-acylaminoacyl-peptide hydrolase 807 103 C20140704_OR005_03 C20140704_OR005_03 TB450921.[MT7]-VHAYIISYLK[MT7].2y4_1.heavy 747.95 / 654.394 5835.0 36.48929977416992 39 17 2 10 10 4.419244094385168 22.628304267477354 0.0 3 0.9704156082667676 7.157386958608247 5835.0 53.23414962422315 0.0 - - - - - - - 237.5 11 4 EHD4;EHD2 EH-domain containing 4;EH-domain containing 2 809 103 C20140704_OR005_03 C20140704_OR005_03 TB450921.[MT7]-VHAYIISYLK[MT7].2y5_1.heavy 747.95 / 767.478 5700.0 36.48929977416992 39 17 2 10 10 4.419244094385168 22.628304267477354 0.0 3 0.9704156082667676 7.157386958608247 5700.0 -1.4004914004914006 0.0 - - - - - - - 271.25 11 4 EHD4;EHD2 EH-domain containing 4;EH-domain containing 2 811 103 C20140704_OR005_03 C20140704_OR005_03 TB450921.[MT7]-VHAYIISYLK[MT7].2b4_1.heavy 747.95 / 615.337 2578.0 36.48929977416992 39 17 2 10 10 4.419244094385168 22.628304267477354 0.0 3 0.9704156082667676 7.157386958608247 2578.0 -0.6659040590405905 1.0 - - - - - - - 248.66666666666666 32 6 EHD4;EHD2 EH-domain containing 4;EH-domain containing 2 813 103 C20140704_OR005_03 C20140704_OR005_03 TB450921.[MT7]-VHAYIISYLK[MT7].2y7_1.heavy 747.95 / 1043.63 3800.0 36.48929977416992 39 17 2 10 10 4.419244094385168 22.628304267477354 0.0 3 0.9704156082667676 7.157386958608247 3800.0 -0.5588235294117645 0.0 - - - - - - - 136.0 7 4 EHD4;EHD2 EH-domain containing 4;EH-domain containing 2 815 104 C20140704_OR005_03 C20140704_OR005_03 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 12596.0 22.50079917907715 23 -3 10 6 10 null 0.0 0.037799835205078125 3 0.0 0.0 12596.0 201.98983867930448 0.0 - - - - - - - 178.57142857142858 25 7 817 104 C20140704_OR005_03 C20140704_OR005_03 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 18045.0 22.50079917907715 23 -3 10 6 10 null 0.0 0.037799835205078125 3 0.0 0.0 18045.0 286.3685204946331 0.0 - - - - - - - 163.66666666666666 36 6 819 104 C20140704_OR005_03 C20140704_OR005_03 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 65213.0 22.50079917907715 23 -3 10 6 10 null 0.0 0.037799835205078125 3 0.0 0.0 65213.0 508.7293652880146 0.0 - - - - - - - 162.45454545454547 130 11 821 105 C20140704_OR005_03 C20140704_OR005_03 TB427356.[MT7]-QSFTMVADTPENLR.2y8_1.heavy 876.939 / 915.453 2188.0 34.09590148925781 34 14 2 10 8 1.7025398846422093 46.46496483016948 0.0 4 0.9379462535728406 4.928407059922792 2188.0 12.92411507191995 0.0 - - - - - - - 273.1666666666667 4 6 LASP1 LIM and SH3 protein 1 823 105 C20140704_OR005_03 C20140704_OR005_03 TB427356.[MT7]-QSFTMVADTPENLR.2y5_1.heavy 876.939 / 628.341 820.0 34.09590148925781 34 14 2 10 8 1.7025398846422093 46.46496483016948 0.0 4 0.9379462535728406 4.928407059922792 820.0 5.433198337355542 2.0 - - - - - - - 159.66666666666666 2 6 LASP1 LIM and SH3 protein 1 825 105 C20140704_OR005_03 C20140704_OR005_03 TB427356.[MT7]-QSFTMVADTPENLR.2y6_1.heavy 876.939 / 729.389 2871.0 34.09590148925781 34 14 2 10 8 1.7025398846422093 46.46496483016948 0.0 4 0.9379462535728406 4.928407059922792 2871.0 22.410284289522654 0.0 - - - - - - - 273.25 5 4 LASP1 LIM and SH3 protein 1 827 105 C20140704_OR005_03 C20140704_OR005_03 TB427356.[MT7]-QSFTMVADTPENLR.2y11_1.heavy 876.939 / 1246.61 957.0 34.09590148925781 34 14 2 10 8 1.7025398846422093 46.46496483016948 0.0 4 0.9379462535728406 4.928407059922792 957.0 2.9206754221388365 7.0 - - - - - - - 239.125 16 8 LASP1 LIM and SH3 protein 1 829 106 C20140704_OR005_03 C20140704_OR005_03 TB427629.[MT7]-QLGENFSGIYC[CAM]SLLPLGC[CAM]WSADSQR.3b9_1.heavy 1001.48 / 1090.56 6035.0 49.698875427246094 38 13 10 5 10 2.038625937232449 38.860944616557454 0.04010009765625 3 0.9137328563970716 4.171257131388004 6035.0 43.40557692307692 0.0 - - - - - - - 183.2941176470588 12 17 APEH N-acylaminoacyl-peptide hydrolase 831 106 C20140704_OR005_03 C20140704_OR005_03 TB427629.[MT7]-QLGENFSGIYC[CAM]SLLPLGC[CAM]WSADSQR.3b5_1.heavy 1001.48 / 686.359 1752.0 49.698875427246094 38 13 10 5 10 2.038625937232449 38.860944616557454 0.04010009765625 3 0.9137328563970716 4.171257131388004 1752.0 12.039384615384616 0.0 - - - - - - - 157.0 3 12 APEH N-acylaminoacyl-peptide hydrolase 833 106 C20140704_OR005_03 C20140704_OR005_03 TB427629.[MT7]-QLGENFSGIYC[CAM]SLLPLGC[CAM]WSADSQR.3b8_1.heavy 1001.48 / 977.481 4737.0 49.698875427246094 38 13 10 5 10 2.038625937232449 38.860944616557454 0.04010009765625 3 0.9137328563970716 4.171257131388004 4737.0 35.831153846153846 0.0 - - - - - - - 146.25 9 12 APEH N-acylaminoacyl-peptide hydrolase 835 106 C20140704_OR005_03 C20140704_OR005_03 TB427629.[MT7]-QLGENFSGIYC[CAM]SLLPLGC[CAM]WSADSQR.3y9_1.heavy 1001.48 / 1066.44 3569.0 49.698875427246094 38 13 10 5 10 2.038625937232449 38.860944616557454 0.04010009765625 3 0.9137328563970716 4.171257131388004 3569.0 27.521633428300092 0.0 - - - - - - - 178.58333333333334 7 12 APEH N-acylaminoacyl-peptide hydrolase 837 107 C20140704_OR005_03 C20140704_OR005_03 TB427211.[MT7]-VHAYIISYLK[MT7].3y3_1.heavy 498.969 / 567.362 12136.0 36.48929977416992 44 14 10 10 10 1.2471627744696019 47.50631358679527 0.0 3 0.9448804337727874 5.232318354633382 12136.0 44.36661874895085 0.0 - - - - - - - 303.75 24 4 EHD4;EHD2 EH-domain containing 4;EH-domain containing 2 839 107 C20140704_OR005_03 C20140704_OR005_03 TB427211.[MT7]-VHAYIISYLK[MT7].3b4_1.heavy 498.969 / 615.337 11462.0 36.48929977416992 44 14 10 10 10 1.2471627744696019 47.50631358679527 0.0 3 0.9448804337727874 5.232318354633382 11462.0 97.63925925925925 0.0 - - - - - - - 162.0 22 5 EHD4;EHD2 EH-domain containing 4;EH-domain containing 2 841 107 C20140704_OR005_03 C20140704_OR005_03 TB427211.[MT7]-VHAYIISYLK[MT7].3b5_1.heavy 498.969 / 728.421 6877.0 36.48929977416992 44 14 10 10 10 1.2471627744696019 47.50631358679527 0.0 3 0.9448804337727874 5.232318354633382 6877.0 53.131624293785315 0.0 - - - - - - - 202.5 13 2 EHD4;EHD2 EH-domain containing 4;EH-domain containing 2 843 107 C20140704_OR005_03 C20140704_OR005_03 TB427211.[MT7]-VHAYIISYLK[MT7].3y4_1.heavy 498.969 / 654.394 19957.0 36.48929977416992 44 14 10 10 10 1.2471627744696019 47.50631358679527 0.0 3 0.9448804337727874 5.232318354633382 19957.0 218.78785185185188 0.0 - - - - - - - 225.0 39 3 EHD4;EHD2 EH-domain containing 4;EH-domain containing 2 845 108 C20140704_OR005_03 C20140704_OR005_03 TB450683.[MT7]-RVTTNVK[MT7].2y5_1.heavy 553.35 / 706.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 847 108 C20140704_OR005_03 C20140704_OR005_03 TB450683.[MT7]-RVTTNVK[MT7].2b6_1.heavy 553.35 / 815.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 849 108 C20140704_OR005_03 C20140704_OR005_03 TB450683.[MT7]-RVTTNVK[MT7].2y6_1.heavy 553.35 / 805.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 851 108 C20140704_OR005_03 C20140704_OR005_03 TB450683.[MT7]-RVTTNVK[MT7].2b5_1.heavy 553.35 / 716.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 853 109 C20140704_OR005_03 C20140704_OR005_03 TB427099.[MT7]-TQDQISNIK[MT7].2y4_1.heavy 667.88 / 605.374 1086.0 23.646400451660156 44 17 9 10 8 5.497608708014936 18.18972671776558 0.0 4 0.972527792031715 7.428759330973555 1086.0 13.370133333333333 1.0 - - - - - - - 154.85714285714286 2 7 LASP1 LIM and SH3 protein 1 855 109 C20140704_OR005_03 C20140704_OR005_03 TB427099.[MT7]-TQDQISNIK[MT7].2b4_1.heavy 667.88 / 617.301 1176.0 23.646400451660156 44 17 9 10 8 5.497608708014936 18.18972671776558 0.0 4 0.972527792031715 7.428759330973555 1176.0 12.152 0.0 - - - - - - - 162.6 2 10 LASP1 LIM and SH3 protein 1 857 109 C20140704_OR005_03 C20140704_OR005_03 TB427099.[MT7]-TQDQISNIK[MT7].2y3_1.heavy 667.88 / 518.342 181.0 23.646400451660156 44 17 9 10 8 5.497608708014936 18.18972671776558 0.0 4 0.972527792031715 7.428759330973555 181.0 0.475 14.0 - - - - - - - 0.0 1 0 LASP1 LIM and SH3 protein 1 859 109 C20140704_OR005_03 C20140704_OR005_03 TB427099.[MT7]-TQDQISNIK[MT7].2y7_1.heavy 667.88 / 961.544 633.0 23.646400451660156 44 17 9 10 8 5.497608708014936 18.18972671776558 0.0 4 0.972527792031715 7.428759330973555 633.0 14.059633333333334 0.0 - - - - - - - 0.0 1 0 LASP1 LIM and SH3 protein 1 861 110 C20140704_OR005_03 C20140704_OR005_03 TB451217.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGRR.3y18_2.heavy 1014.23 / 995.532 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 863 110 C20140704_OR005_03 C20140704_OR005_03 TB451217.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGRR.3y22_2.heavy 1014.23 / 1221.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 865 110 C20140704_OR005_03 C20140704_OR005_03 TB451217.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGRR.3b4_1.heavy 1014.23 / 599.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 867 110 C20140704_OR005_03 C20140704_OR005_03 TB451217.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGRR.3b8_1.heavy 1014.23 / 1051.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 869 111 C20140704_OR005_03 C20140704_OR005_03 TB427630.[MT7]-LSRFGNAFLNRFMC[CAM]SQLPNQVLK[MT7].4y5_1.heavy 757.911 / 745.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD4 EH-domain containing 4 871 111 C20140704_OR005_03 C20140704_OR005_03 TB427630.[MT7]-LSRFGNAFLNRFMC[CAM]SQLPNQVLK[MT7].4y3_1.heavy 757.911 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD4 EH-domain containing 4 873 111 C20140704_OR005_03 C20140704_OR005_03 TB427630.[MT7]-LSRFGNAFLNRFMC[CAM]SQLPNQVLK[MT7].4y6_1.heavy 757.911 / 842.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD4 EH-domain containing 4 875 111 C20140704_OR005_03 C20140704_OR005_03 TB427630.[MT7]-LSRFGNAFLNRFMC[CAM]SQLPNQVLK[MT7].4b3_1.heavy 757.911 / 501.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD4 EH-domain containing 4 877 112 C20140704_OR005_03 C20140704_OR005_03 TB427094.[MT7]-RALGQGQSVK[MT7].2b8_1.heavy 666.404 / 942.524 899.0 17.530266443888348 37 15 10 6 6 3.605038735434203 27.738952987409625 0.03470039367675781 6 0.9585181075119702 6.038377491792576 899.0 25.400990566037738 0.0 - - - - - - - 0.0 1 0 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 879 112 C20140704_OR005_03 C20140704_OR005_03 TB427094.[MT7]-RALGQGQSVK[MT7].2y5_1.heavy 666.404 / 662.395 N/A 17.530266443888348 37 15 10 6 6 3.605038735434203 27.738952987409625 0.03470039367675781 6 0.9585181075119702 6.038377491792576 741.0 0.5092783505154639 3.0 - - - - - - - 158.92307692307693 3 13 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 881 112 C20140704_OR005_03 C20140704_OR005_03 TB427094.[MT7]-RALGQGQSVK[MT7].2b5_1.heavy 666.404 / 670.412 423.0 17.530266443888348 37 15 10 6 6 3.605038735434203 27.738952987409625 0.03470039367675781 6 0.9585181075119702 6.038377491792576 423.0 0.0 0.0 - - - - - - - 0.0 0 0 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 883 112 C20140704_OR005_03 C20140704_OR005_03 TB427094.[MT7]-RALGQGQSVK[MT7].2b9_1.heavy 666.404 / 1041.59 1905.0 17.530266443888348 37 15 10 6 6 3.605038735434203 27.738952987409625 0.03470039367675781 6 0.9585181075119702 6.038377491792576 1905.0 19.572538449342 0.0 - - - - - - - 192.0 3 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 885 113 C20140704_OR005_03 C20140704_OR005_03 TB427631.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGRR.4y15_2.heavy 760.925 / 831.951 2216.0 54.680800437927246 39 13 10 6 10 1.5613432278761854 37.92411784380953 0.030002593994140625 3 0.9011502277902935 3.892515784255552 2216.0 20.558876698311636 0.0 - - - - - - - 135.21428571428572 4 14 IFI35 interferon-induced protein 35 887 113 C20140704_OR005_03 C20140704_OR005_03 TB427631.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGRR.4b4_1.heavy 760.925 / 599.363 9484.0 54.680800437927246 39 13 10 6 10 1.5613432278761854 37.92411784380953 0.030002593994140625 3 0.9011502277902935 3.892515784255552 9484.0 87.04461538461538 1.0 - - - - - - - 138.58333333333334 18 12 IFI35 interferon-induced protein 35 889 113 C20140704_OR005_03 C20140704_OR005_03 TB427631.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGRR.4y17_2.heavy 760.925 / 947.006 1825.0 54.680800437927246 39 13 10 6 10 1.5613432278761854 37.92411784380953 0.030002593994140625 3 0.9011502277902935 3.892515784255552 1825.0 16.299110815151398 0.0 - - - - - - - 109.81818181818181 3 11 IFI35 interferon-induced protein 35 891 113 C20140704_OR005_03 C20140704_OR005_03 TB427631.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGRR.4y18_2.heavy 760.925 / 995.532 11864.0 54.680800437927246 39 13 10 6 10 1.5613432278761854 37.92411784380953 0.030002593994140625 3 0.9011502277902935 3.892515784255552 11864.0 12.21485213581599 0.0 - - - - - - - 150.0 23 15 IFI35 interferon-induced protein 35 893 114 C20140704_OR005_03 C20140704_OR005_03 TB451211.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGR.4y8_1.heavy 721.899 / 833.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 895 114 C20140704_OR005_03 C20140704_OR005_03 TB451211.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGR.4b7_1.heavy 721.899 / 938.543 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 897 114 C20140704_OR005_03 C20140704_OR005_03 TB451211.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGR.4b4_1.heavy 721.899 / 599.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 899 114 C20140704_OR005_03 C20140704_OR005_03 TB451211.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGR.4y7_1.heavy 721.899 / 734.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 901 115 C20140704_OR005_03 C20140704_OR005_03 TB450908.[MT7]-LVSAVAIALAHK[MT7].3y3_1.heavy 494.32 / 499.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBE1 hemoglobin, epsilon 1 903 115 C20140704_OR005_03 C20140704_OR005_03 TB450908.[MT7]-LVSAVAIALAHK[MT7].3b6_1.heavy 494.32 / 685.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBE1 hemoglobin, epsilon 1 905 115 C20140704_OR005_03 C20140704_OR005_03 TB450908.[MT7]-LVSAVAIALAHK[MT7].3b4_1.heavy 494.32 / 515.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBE1 hemoglobin, epsilon 1 907 115 C20140704_OR005_03 C20140704_OR005_03 TB450908.[MT7]-LVSAVAIALAHK[MT7].3y5_1.heavy 494.32 / 683.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBE1 hemoglobin, epsilon 1 909 116 C20140704_OR005_03 C20140704_OR005_03 TB427342.[MT7]-RK[MT7]C[CAM]EAANVAEQR.3y6_1.heavy 573.977 / 716.369 2057.0 16.28407573699951 44 18 10 6 10 3.785388951474521 22.04299161571893 0.037700653076171875 3 0.9859802062001264 10.410770054541254 2057.0 45.80276487969607 0.0 - - - - - - - 99.81818181818181 4 11 HLA-G major histocompatibility complex, class I, G 911 116 C20140704_OR005_03 C20140704_OR005_03 TB427342.[MT7]-RK[MT7]C[CAM]EAANVAEQR.3b10_2.heavy 573.977 / 709.377 4594.0 16.28407573699951 44 18 10 6 10 3.785388951474521 22.04299161571893 0.037700653076171875 3 0.9859802062001264 10.410770054541254 4594.0 249.96764705882356 0.0 - - - - - - - 80.0 9 6 HLA-G major histocompatibility complex, class I, G 913 116 C20140704_OR005_03 C20140704_OR005_03 TB427342.[MT7]-RK[MT7]C[CAM]EAANVAEQR.3y4_1.heavy 573.977 / 503.257 4354.0 16.28407573699951 44 18 10 6 10 3.785388951474521 22.04299161571893 0.037700653076171875 3 0.9859802062001264 10.410770054541254 4354.0 18.161510502011023 0.0 - - - - - - - 167.78947368421052 8 19 HLA-G major histocompatibility complex, class I, G 915 116 C20140704_OR005_03 C20140704_OR005_03 TB427342.[MT7]-RK[MT7]C[CAM]EAANVAEQR.3b7_2.heavy 573.977 / 559.803 10181.0 16.28407573699951 44 18 10 6 10 3.785388951474521 22.04299161571893 0.037700653076171875 3 0.9859802062001264 10.410770054541254 10181.0 119.97108294947202 0.0 - - - - - - - 155.46666666666667 20 15 HLA-G major histocompatibility complex, class I, G 917 117 C20140704_OR005_03 C20140704_OR005_03 TB427208.[MT7]-DFLAGGVAAAVSK[MT7].2b3_1.heavy 747.432 / 520.289 9932.0 36.58290100097656 44 14 10 10 10 1.6744073747365367 41.61040965305176 0.0 3 0.9352548580263078 4.823777310256534 9932.0 48.69312690593479 0.0 - - - - - - - 228.5 19 4 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 919 117 C20140704_OR005_03 C20140704_OR005_03 TB427208.[MT7]-DFLAGGVAAAVSK[MT7].2y9_1.heavy 747.432 / 903.538 11892.0 36.58290100097656 44 14 10 10 10 1.6744073747365367 41.61040965305176 0.0 3 0.9352548580263078 4.823777310256534 11892.0 38.191790359602145 0.0 - - - - - - - 313.6 23 5 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 921 117 C20140704_OR005_03 C20140704_OR005_03 TB427208.[MT7]-DFLAGGVAAAVSK[MT7].2b6_1.heavy 747.432 / 705.369 5227.0 36.58290100097656 44 14 10 10 10 1.6744073747365367 41.61040965305176 0.0 3 0.9352548580263078 4.823777310256534 5227.0 31.251648135116117 0.0 - - - - - - - 217.83333333333334 10 6 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 923 117 C20140704_OR005_03 C20140704_OR005_03 TB427208.[MT7]-DFLAGGVAAAVSK[MT7].2y10_1.heavy 747.432 / 974.575 12807.0 36.58290100097656 44 14 10 10 10 1.6744073747365367 41.61040965305176 0.0 3 0.9352548580263078 4.823777310256534 12807.0 22.44057217563914 0.0 - - - - - - - 705.9 25 10 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 925 118 C20140704_OR005_03 C20140704_OR005_03 TB412532.[MT7]-ISGVNAK[MT7].2y5_1.heavy 488.805 / 632.385 1801.0 20.92215061187744 29 18 2 5 4 9.12680129153089 10.956741229021151 0.04030036926269531 7 0.9898948508707301 12.266611455730581 1801.0 11.8264127258632 2.0 - - - - - - - 409.0 30 1 EHD4 EH-domain containing 4 927 118 C20140704_OR005_03 C20140704_OR005_03 TB412532.[MT7]-ISGVNAK[MT7].2b4_1.heavy 488.805 / 501.315 1555.0 20.92215061187744 29 18 2 5 4 9.12680129153089 10.956741229021151 0.04030036926269531 7 0.9898948508707301 12.266611455730581 1555.0 18.706550778221718 2.0 - - - - - - - 327.0 41 1 EHD4 EH-domain containing 4 929 118 C20140704_OR005_03 C20140704_OR005_03 TB412532.[MT7]-ISGVNAK[MT7].2y6_1.heavy 488.805 / 719.417 9414.0 20.92215061187744 29 18 2 5 4 9.12680129153089 10.956741229021151 0.04030036926269531 7 0.9898948508707301 12.266611455730581 9414.0 118.26655185254143 1.0 - - - - - - - 246.0 18 3 EHD4 EH-domain containing 4 931 118 C20140704_OR005_03 C20140704_OR005_03 TB412532.[MT7]-ISGVNAK[MT7].2b5_1.heavy 488.805 / 615.358 900.0 20.92215061187744 29 18 2 5 4 9.12680129153089 10.956741229021151 0.04030036926269531 7 0.9898948508707301 12.266611455730581 900.0 14.707317073170733 3.0 - - - - - - - 261.8 3 5 EHD4 EH-domain containing 4 933 119 C20140704_OR005_03 C20140704_OR005_03 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 99785.0 32.215599060058594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 99785.0 385.23974272389717 0.0 - - - - - - - 298.1666666666667 199 6 935 119 C20140704_OR005_03 C20140704_OR005_03 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 91352.0 32.215599060058594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 91352.0 343.5624222214975 0.0 - - - - - - - 230.4 182 5 937 119 C20140704_OR005_03 C20140704_OR005_03 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 190115.0 32.215599060058594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 190115.0 1425.9180998224008 0.0 - - - - - - - 200.85714285714286 380 7 939 120 C20140704_OR005_03 C20140704_OR005_03 TB451210.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGR.3b4_1.heavy 962.197 / 599.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 941 120 C20140704_OR005_03 C20140704_OR005_03 TB451210.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGR.3b8_1.heavy 962.197 / 1051.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 943 120 C20140704_OR005_03 C20140704_OR005_03 TB451210.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGR.3b7_1.heavy 962.197 / 938.543 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 945 120 C20140704_OR005_03 C20140704_OR005_03 TB451210.[MT7]-VQVQPLELPMVTTIQVMVSSQLSGR.3y9_1.heavy 962.197 / 964.488 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 947 121 C20140704_OR005_03 C20140704_OR005_03 TB412733.[MT7]-FLSFMGVGK[MT7].3b6_1.heavy 425.245 / 827.424 749.0 42.884575843811035 34 8 10 6 10 0.7920014888040634 80.19218198550216 0.039096832275390625 3 0.7885438512483706 2.635021089756857 749.0 11.973432699965866 0.0 - - - - - - - 0.0 1 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 949 121 C20140704_OR005_03 C20140704_OR005_03 TB412733.[MT7]-FLSFMGVGK[MT7].3y3_1.heavy 425.245 / 447.305 3088.0 42.884575843811035 34 8 10 6 10 0.7920014888040634 80.19218198550216 0.039096832275390625 3 0.7885438512483706 2.635021089756857 3088.0 33.026737967914436 0.0 - - - - - - - 280.6666666666667 6 3 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 951 121 C20140704_OR005_03 C20140704_OR005_03 TB412733.[MT7]-FLSFMGVGK[MT7].3b4_1.heavy 425.245 / 639.362 2059.0 42.884575843811035 34 8 10 6 10 0.7920014888040634 80.19218198550216 0.039096832275390625 3 0.7885438512483706 2.635021089756857 2059.0 43.808510638297875 0.0 - - - - - - - 187.0 4 1 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 953 121 C20140704_OR005_03 C20140704_OR005_03 TB412733.[MT7]-FLSFMGVGK[MT7].3y4_1.heavy 425.245 / 504.326 2059.0 42.884575843811035 34 8 10 6 10 0.7920014888040634 80.19218198550216 0.039096832275390625 3 0.7885438512483706 2.635021089756857 2059.0 22.02139037433155 0.0 - - - - - - - 468.0 4 1 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 955 122 C20140704_OR005_03 C20140704_OR005_03 TB427346.[MT7]-EFTPEVQAAWQK[MT7].3y3_1.heavy 574.642 / 605.353 46772.0 34.517398834228516 45 15 10 10 10 2.069479156977987 39.42941245905091 0.0 3 0.9532730515571727 5.68686447601368 46772.0 113.42295225947521 0.0 - - - - - - - 313.14285714285717 93 7 HBE1 hemoglobin, epsilon 1 957 122 C20140704_OR005_03 C20140704_OR005_03 TB427346.[MT7]-EFTPEVQAAWQK[MT7].3b5_1.heavy 574.642 / 748.363 61448.0 34.517398834228516 45 15 10 10 10 2.069479156977987 39.42941245905091 0.0 3 0.9532730515571727 5.68686447601368 61448.0 148.27451464430692 0.0 - - - - - - - 342.5 122 4 HBE1 hemoglobin, epsilon 1 959 122 C20140704_OR005_03 C20140704_OR005_03 TB427346.[MT7]-EFTPEVQAAWQK[MT7].3y4_1.heavy 574.642 / 676.39 32782.0 34.517398834228516 45 15 10 10 10 2.069479156977987 39.42941245905091 0.0 3 0.9532730515571727 5.68686447601368 32782.0 99.57688733041007 0.0 - - - - - - - 350.1111111111111 65 9 HBE1 hemoglobin, epsilon 1 961 122 C20140704_OR005_03 C20140704_OR005_03 TB427346.[MT7]-EFTPEVQAAWQK[MT7].3b3_1.heavy 574.642 / 522.268 43755.0 34.517398834228516 45 15 10 10 10 2.069479156977987 39.42941245905091 0.0 3 0.9532730515571727 5.68686447601368 43755.0 121.82514577259474 0.0 - - - - - - - 646.8571428571429 87 7 HBE1 hemoglobin, epsilon 1 963 123 C20140704_OR005_03 C20140704_OR005_03 TB412736.[MT7]-ALAC[CAM]SSLQER.2y8_1.heavy 639.833 / 950.436 18982.0 24.375949382781982 44 18 10 6 10 8.287972645950262 12.065676887684088 0.03579902648925781 3 0.9897917403378799 12.20439830514893 18982.0 54.88358644888438 0.0 - - - - - - - 241.75 37 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 965 123 C20140704_OR005_03 C20140704_OR005_03 TB412736.[MT7]-ALAC[CAM]SSLQER.2y9_1.heavy 639.833 / 1063.52 19535.0 24.375949382781982 44 18 10 6 10 8.287972645950262 12.065676887684088 0.03579902648925781 3 0.9897917403378799 12.20439830514893 19535.0 118.35264364934221 0.0 - - - - - - - 276.4 39 10 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 967 123 C20140704_OR005_03 C20140704_OR005_03 TB412736.[MT7]-ALAC[CAM]SSLQER.2y6_1.heavy 639.833 / 719.368 4239.0 24.375949382781982 44 18 10 6 10 8.287972645950262 12.065676887684088 0.03579902648925781 3 0.9897917403378799 12.20439830514893 4239.0 49.71209556011896 0.0 - - - - - - - 161.0 8 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 969 123 C20140704_OR005_03 C20140704_OR005_03 TB412736.[MT7]-ALAC[CAM]SSLQER.2y7_1.heavy 639.833 / 879.399 14928.0 24.375949382781982 44 18 10 6 10 8.287972645950262 12.065676887684088 0.03579902648925781 3 0.9897917403378799 12.20439830514893 14928.0 76.70011468452326 0.0 - - - - - - - 235.33333333333334 29 9 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 971 124 C20140704_OR005_03 C20140704_OR005_03 TB427345.[MT7]-EFTPEVQAAWQK[MT7].2b3_1.heavy 861.459 / 522.268 6585.0 34.517398834228516 40 10 10 10 10 0.9336152398385045 61.652805058072325 0.0 3 0.8353031927650166 2.998268970859729 6585.0 31.20553518008855 0.0 - - - - - - - 274.0 13 2 HBE1 hemoglobin, epsilon 1 973 124 C20140704_OR005_03 C20140704_OR005_03 TB427345.[MT7]-EFTPEVQAAWQK[MT7].2y4_1.heavy 861.459 / 676.39 2195.0 34.517398834228516 40 10 10 10 10 0.9336152398385045 61.652805058072325 0.0 3 0.8353031927650166 2.998268970859729 2195.0 16.184643767564925 0.0 - - - - - - - 205.75 4 4 HBE1 hemoglobin, epsilon 1 975 124 C20140704_OR005_03 C20140704_OR005_03 TB427345.[MT7]-EFTPEVQAAWQK[MT7].2y9_1.heavy 861.459 / 1200.65 3430.0 34.517398834228516 40 10 10 10 10 0.9336152398385045 61.652805058072325 0.0 3 0.8353031927650166 2.998268970859729 3430.0 11.553008697411002 0.0 - - - - - - - 246.8 6 5 HBE1 hemoglobin, epsilon 1 977 124 C20140704_OR005_03 C20140704_OR005_03 TB427345.[MT7]-EFTPEVQAAWQK[MT7].2y3_1.heavy 861.459 / 605.353 1646.0 34.517398834228516 40 10 10 10 10 0.9336152398385045 61.652805058072325 0.0 3 0.8353031927650166 2.998268970859729 1646.0 5.847338142764927 1.0 - - - - - - - 274.0 4 2 HBE1 hemoglobin, epsilon 1 979 125 C20140704_OR005_03 C20140704_OR005_03 TB412735.[MT7]-LLC[CAM]GADVLK[MT7].3y3_1.heavy 426.256 / 503.367 13626.0 35.277000427246094 40 10 10 10 10 0.7443530523306878 80.5335176068027 0.0 3 0.8249406917533536 2.905496870350761 13626.0 142.1161280632411 0.0 - - - - - - - 275.4 27 5 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 981 125 C20140704_OR005_03 C20140704_OR005_03 TB412735.[MT7]-LLC[CAM]GADVLK[MT7].3b6_1.heavy 426.256 / 774.394 8258.0 35.277000427246094 40 10 10 10 10 0.7443530523306878 80.5335176068027 0.0 3 0.8249406917533536 2.905496870350761 8258.0 119.68115942028986 0.0 - - - - - - - 275.3333333333333 16 3 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 983 125 C20140704_OR005_03 C20140704_OR005_03 TB412735.[MT7]-LLC[CAM]GADVLK[MT7].3b4_1.heavy 426.256 / 588.33 8258.0 35.277000427246094 40 10 10 10 10 0.7443530523306878 80.5335176068027 0.0 3 0.8249406917533536 2.905496870350761 8258.0 75.44259816822824 0.0 - - - - - - - 275.5 16 4 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 985 125 C20140704_OR005_03 C20140704_OR005_03 TB412735.[MT7]-LLC[CAM]GADVLK[MT7].3y4_1.heavy 426.256 / 618.394 8121.0 35.277000427246094 40 10 10 10 10 0.7443530523306878 80.5335176068027 0.0 3 0.8249406917533536 2.905496870350761 8121.0 80.72209802371542 0.0 - - - - - - - 192.8 16 5 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 987 126 C20140704_OR005_03 C20140704_OR005_03 TB427582.[MT7]-LFEAEAQDLFRDIQSLPQK[MT7].4b4_1.heavy 634.847 / 605.341 2195.0 49.5885009765625 47 17 10 10 10 5.707756522826976 17.520018522176088 0.0 3 0.9761218246849553 7.970651360835984 2195.0 -0.35123327177798147 2.0 - - - - - - - 216.3846153846154 5 13 EHD4 EH-domain containing 4 989 126 C20140704_OR005_03 C20140704_OR005_03 TB427582.[MT7]-LFEAEAQDLFRDIQSLPQK[MT7].4b5_1.heavy 634.847 / 734.384 3361.0 49.5885009765625 47 17 10 10 10 5.707756522826976 17.520018522176088 0.0 3 0.9761218246849553 7.970651360835984 3361.0 9.239483722060253 0.0 - - - - - - - 188.75 6 8 EHD4 EH-domain containing 4 991 126 C20140704_OR005_03 C20140704_OR005_03 TB427582.[MT7]-LFEAEAQDLFRDIQSLPQK[MT7].4y3_1.heavy 634.847 / 516.326 10632.0 49.5885009765625 47 17 10 10 10 5.707756522826976 17.520018522176088 0.0 3 0.9761218246849553 7.970651360835984 10632.0 77.23299829905042 1.0 - - - - - - - 237.0909090909091 21 11 EHD4 EH-domain containing 4 993 126 C20140704_OR005_03 C20140704_OR005_03 TB427582.[MT7]-LFEAEAQDLFRDIQSLPQK[MT7].4b3_1.heavy 634.847 / 534.304 2058.0 49.5885009765625 47 17 10 10 10 5.707756522826976 17.520018522176088 0.0 3 0.9761218246849553 7.970651360835984 2058.0 14.67573786407767 0.0 - - - - - - - 211.58333333333334 4 12 EHD4 EH-domain containing 4 995 127 C20140704_OR005_03 C20140704_OR005_03 TB427444.[MT7]-MK[MT7]EELAALFSELK[MT7].2y4_1.heavy 971.058 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 997 127 C20140704_OR005_03 C20140704_OR005_03 TB427444.[MT7]-MK[MT7]EELAALFSELK[MT7].2b4_1.heavy 971.058 / 806.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 999 127 C20140704_OR005_03 C20140704_OR005_03 TB427444.[MT7]-MK[MT7]EELAALFSELK[MT7].2b7_1.heavy 971.058 / 1061.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1001 127 C20140704_OR005_03 C20140704_OR005_03 TB427444.[MT7]-MK[MT7]EELAALFSELK[MT7].2b5_1.heavy 971.058 / 919.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1003 128 C20140704_OR005_03 C20140704_OR005_03 TB412859.[MT7]-LLVVYPWTQR.2y8_1.heavy 709.917 / 1048.56 63051.0 43.25210189819336 46 16 10 10 10 9.163674786390278 10.912652656390446 0.0 3 0.9636998384164315 6.4578137066290795 63051.0 245.77110778910537 0.0 - - - - - - - 256.7857142857143 126 14 HBB;HBD;HBE1;HBG1;HBG2 hemoglobin, beta;hemoglobin, delta;hemoglobin, epsilon 1;hemoglobin, gamma A;hemoglobin, gamma G 1005 128 C20140704_OR005_03 C20140704_OR005_03 TB412859.[MT7]-LLVVYPWTQR.2y5_1.heavy 709.917 / 687.357 49777.0 43.25210189819336 46 16 10 10 10 9.163674786390278 10.912652656390446 0.0 3 0.9636998384164315 6.4578137066290795 49777.0 233.4303664709098 0.0 - - - - - - - 293.3636363636364 99 11 HBB;HBD;HBE1;HBG1;HBG2 hemoglobin, beta;hemoglobin, delta;hemoglobin, epsilon 1;hemoglobin, gamma A;hemoglobin, gamma G 1007 128 C20140704_OR005_03 C20140704_OR005_03 TB412859.[MT7]-LLVVYPWTQR.2y9_1.heavy 709.917 / 1161.64 33738.0 43.25210189819336 46 16 10 10 10 9.163674786390278 10.912652656390446 0.0 3 0.9636998384164315 6.4578137066290795 33738.0 242.25223592379513 0.0 - - - - - - - 184.11111111111111 67 9 HBB;HBD;HBE1;HBG1;HBG2 hemoglobin, beta;hemoglobin, delta;hemoglobin, epsilon 1;hemoglobin, gamma A;hemoglobin, gamma G 1009 128 C20140704_OR005_03 C20140704_OR005_03 TB412859.[MT7]-LLVVYPWTQR.2y7_1.heavy 709.917 / 949.489 80749.0 43.25210189819336 46 16 10 10 10 9.163674786390278 10.912652656390446 0.0 3 0.9636998384164315 6.4578137066290795 80749.0 288.0861008929022 0.0 - - - - - - - 251.27272727272728 161 11 HBB;HBD;HBE1;HBG1;HBG2 hemoglobin, beta;hemoglobin, delta;hemoglobin, epsilon 1;hemoglobin, gamma A;hemoglobin, gamma G 1011 129 C20140704_OR005_03 C20140704_OR005_03 TB450810.[MT7]-QRVLETAAK[MT7].3y3_1.heavy 435.269 / 433.289 10323.0 19.6914005279541 41 15 8 10 8 7.119627632501727 14.045678392433222 0.0 4 0.9521021416399547 5.616366166268085 10323.0 78.63975229046487 0.0 - - - - - - - 280.75 20 8 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1013 129 C20140704_OR005_03 C20140704_OR005_03 TB450810.[MT7]-QRVLETAAK[MT7].3b5_1.heavy 435.269 / 770.464 1334.0 19.6914005279541 41 15 8 10 8 7.119627632501727 14.045678392433222 0.0 4 0.9521021416399547 5.616366166268085 1334.0 19.898098627351295 0.0 - - - - - - - 151.83333333333334 2 6 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1015 129 C20140704_OR005_03 C20140704_OR005_03 TB450810.[MT7]-QRVLETAAK[MT7].3y4_1.heavy 435.269 / 534.337 9902.0 19.6914005279541 41 15 8 10 8 7.119627632501727 14.045678392433222 0.0 4 0.9521021416399547 5.616366166268085 9902.0 113.88537907361105 1.0 - - - - - - - 170.42857142857142 26 7 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1017 129 C20140704_OR005_03 C20140704_OR005_03 TB450810.[MT7]-QRVLETAAK[MT7].3y5_1.heavy 435.269 / 663.379 2739.0 19.6914005279541 41 15 8 10 8 7.119627632501727 14.045678392433222 0.0 4 0.9521021416399547 5.616366166268085 2739.0 59.475428571428566 0.0 - - - - - - - 196.4 5 10 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1019 130 C20140704_OR005_03 C20140704_OR005_03 TB427262.[MT7]-GFSVVADTPELQR.2y6_1.heavy 781.918 / 743.405 5764.0 34.57557487487793 35 14 10 1 10 1.5855464224808586 44.270251489612136 0.09310150146484375 3 0.947482578635866 5.361563259407289 5764.0 21.33965373936725 0.0 - - - - - - - 274.0 11 2 LASP1 LIM and SH3 protein 1 1021 130 C20140704_OR005_03 C20140704_OR005_03 TB427262.[MT7]-GFSVVADTPELQR.2y8_1.heavy 781.918 / 929.469 4803.0 34.57557487487793 35 14 10 1 10 1.5855464224808586 44.270251489612136 0.09310150146484375 3 0.947482578635866 5.361563259407289 4803.0 22.372196876302652 0.0 - - - - - - - 228.33333333333334 9 6 LASP1 LIM and SH3 protein 1 1023 130 C20140704_OR005_03 C20140704_OR005_03 TB427262.[MT7]-GFSVVADTPELQR.2b4_1.heavy 781.918 / 535.3 6450.0 34.57557487487793 35 14 10 1 10 1.5855464224808586 44.270251489612136 0.09310150146484375 3 0.947482578635866 5.361563259407289 6450.0 52.56345841722025 0.0 - - - - - - - 308.75 12 4 LASP1 LIM and SH3 protein 1 1025 130 C20140704_OR005_03 C20140704_OR005_03 TB427262.[MT7]-GFSVVADTPELQR.2y9_1.heavy 781.918 / 1028.54 7410.0 34.57557487487793 35 14 10 1 10 1.5855464224808586 44.270251489612136 0.09310150146484375 3 0.947482578635866 5.361563259407289 7410.0 32.14399759274541 0.0 - - - - - - - 246.8 14 5 LASP1 LIM and SH3 protein 1 1027 131 C20140704_OR005_03 C20140704_OR005_03 TB451231.[MT7]-LLVVYPWTQRFFDSFGNLSSPSAILGNPK[MT7].4y4_1.heavy 886.233 / 559.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBE1 hemoglobin, epsilon 1 1029 131 C20140704_OR005_03 C20140704_OR005_03 TB451231.[MT7]-LLVVYPWTQRFFDSFGNLSSPSAILGNPK[MT7].4b15_2.heavy 886.233 / 1022.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBE1 hemoglobin, epsilon 1 1031 131 C20140704_OR005_03 C20140704_OR005_03 TB451231.[MT7]-LLVVYPWTQRFFDSFGNLSSPSAILGNPK[MT7].4y9_1.heavy 886.233 / 1040.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBE1 hemoglobin, epsilon 1 1033 131 C20140704_OR005_03 C20140704_OR005_03 TB451231.[MT7]-LLVVYPWTQRFFDSFGNLSSPSAILGNPK[MT7].4b4_1.heavy 886.233 / 569.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBE1 hemoglobin, epsilon 1 1035 132 C20140704_OR005_03 C20140704_OR005_03 TB450811.[MT7]-VLVTGFPASLR.2y8_1.heavy 652.396 / 848.463 27375.0 39.270649909973145 38 12 10 6 10 1.2914379918692651 50.239955628182116 0.036998748779296875 3 0.8844798147412795 3.595515307511631 27375.0 107.39937558356677 0.0 - - - - - - - 212.0 54 6 IFI35 interferon-induced protein 35 1037 132 C20140704_OR005_03 C20140704_OR005_03 TB450811.[MT7]-VLVTGFPASLR.2y9_1.heavy 652.396 / 947.531 6621.0 39.270649909973145 38 12 10 6 10 1.2914379918692651 50.239955628182116 0.036998748779296875 3 0.8844798147412795 3.595515307511631 6621.0 1.2986658659743033 2.0 - - - - - - - 286.5 13 4 IFI35 interferon-induced protein 35 1039 132 C20140704_OR005_03 C20140704_OR005_03 TB450811.[MT7]-VLVTGFPASLR.2y10_1.heavy 652.396 / 1060.61 9040.0 39.270649909973145 38 12 10 6 10 1.2914379918692651 50.239955628182116 0.036998748779296875 3 0.8844798147412795 3.595515307511631 9040.0 1.212798184141461 3.0 - - - - - - - 203.6 20 5 IFI35 interferon-induced protein 35 1041 132 C20140704_OR005_03 C20140704_OR005_03 TB450811.[MT7]-VLVTGFPASLR.2y7_1.heavy 652.396 / 747.415 5348.0 39.270649909973145 38 12 10 6 10 1.2914379918692651 50.239955628182116 0.036998748779296875 3 0.8844798147412795 3.595515307511631 5348.0 0.0 2.0 - - - - - - - 691.1428571428571 12 7 IFI35 interferon-induced protein 35 1043 133 C20140704_OR005_03 C20140704_OR005_03 TB427447.[MT7]-EFQELRHPVDEEK[MT7].4y4_1.heavy 486.757 / 664.327 36468.0 25.127800464630127 34 8 10 6 10 0.5581875138775174 95.19045545537614 0.03679847717285156 3 0.7789317159617865 2.574855432565227 36468.0 378.9829117193323 0.0 - - - - - - - 186.0 72 5 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1045 133 C20140704_OR005_03 C20140704_OR005_03 TB427447.[MT7]-EFQELRHPVDEEK[MT7].4b7_2.heavy 486.757 / 542.786 52376.0 25.127800464630127 34 8 10 6 10 0.5581875138775174 95.19045545537614 0.03679847717285156 3 0.7789317159617865 2.574855432565227 52376.0 104.17144539667254 0.0 - - - - - - - 332.14285714285717 104 7 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1047 133 C20140704_OR005_03 C20140704_OR005_03 TB427447.[MT7]-EFQELRHPVDEEK[MT7].4b4_1.heavy 486.757 / 678.321 13768.0 25.127800464630127 34 8 10 6 10 0.5581875138775174 95.19045545537614 0.03679847717285156 3 0.7789317159617865 2.574855432565227 13768.0 85.86494623655915 0.0 - - - - - - - 193.15384615384616 27 13 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1049 133 C20140704_OR005_03 C20140704_OR005_03 TB427447.[MT7]-EFQELRHPVDEEK[MT7].4b6_1.heavy 486.757 / 947.507 1395.0 25.127800464630127 34 8 10 6 10 0.5581875138775174 95.19045545537614 0.03679847717285156 3 0.7789317159617865 2.574855432565227 1395.0 15.0 0.0 - - - - - - - 465.0 2 1 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1051 134 C20140704_OR005_03 C20140704_OR005_03 TB427448.[MT7]-EFQELRHPVDEEK[MT7].3y6_1.heavy 648.674 / 860.448 4757.0 25.127800464630127 43 17 10 6 10 7.876778000613981 12.695546325185905 0.03679847717285156 3 0.9751790899228412 7.8171978620121845 4757.0 49.35069518716577 0.0 - - - - - - - 179.46153846153845 9 13 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1053 134 C20140704_OR005_03 C20140704_OR005_03 TB427448.[MT7]-EFQELRHPVDEEK[MT7].3b4_1.heavy 648.674 / 678.321 2239.0 25.127800464630127 43 17 10 6 10 7.876778000613981 12.695546325185905 0.03679847717285156 3 0.9751790899228412 7.8171978620121845 2239.0 13.930422812031676 0.0 - - - - - - - 226.71428571428572 4 7 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1055 134 C20140704_OR005_03 C20140704_OR005_03 TB427448.[MT7]-EFQELRHPVDEEK[MT7].3y4_1.heavy 648.674 / 664.327 5410.0 25.127800464630127 43 17 10 6 10 7.876778000613981 12.695546325185905 0.03679847717285156 3 0.9751790899228412 7.8171978620121845 5410.0 25.09195710455764 1.0 - - - - - - - 223.9 10 10 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1057 134 C20140704_OR005_03 C20140704_OR005_03 TB427448.[MT7]-EFQELRHPVDEEK[MT7].3y12_2.heavy 648.674 / 835.935 3545.0 25.127800464630127 43 17 10 6 10 7.876778000613981 12.695546325185905 0.03679847717285156 3 0.9751790899228412 7.8171978620121845 3545.0 52.50538209418664 0.0 - - - - - - - 254.36363636363637 7 11 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1059 135 C20140704_OR005_03 C20140704_OR005_03 TB412953.[MT7]-AGGADAVQTVTGGLR.2y8_1.heavy 758.914 / 831.468 5410.0 31.010849952697754 44 18 10 6 10 3.235521000800425 30.906923483192145 0.03989982604980469 3 0.9804539853147601 8.81299080272808 5410.0 59.74521739130435 0.0 - - - - - - - 230.0 10 6 EHD4 EH-domain containing 4 1061 135 C20140704_OR005_03 C20140704_OR005_03 TB412953.[MT7]-AGGADAVQTVTGGLR.2b6_1.heavy 758.914 / 587.291 6215.0 31.010849952697754 44 18 10 6 10 3.235521000800425 30.906923483192145 0.03989982604980469 3 0.9804539853147601 8.81299080272808 6215.0 30.307463625371554 0.0 - - - - - - - 271.8181818181818 12 11 EHD4 EH-domain containing 4 1063 135 C20140704_OR005_03 C20140704_OR005_03 TB412953.[MT7]-AGGADAVQTVTGGLR.2y10_1.heavy 758.914 / 1001.57 16574.0 31.010849952697754 44 18 10 6 10 3.235521000800425 30.906923483192145 0.03989982604980469 3 0.9804539853147601 8.81299080272808 16574.0 27.641973081989338 0.0 - - - - - - - 191.66666666666666 33 9 EHD4 EH-domain containing 4 1065 135 C20140704_OR005_03 C20140704_OR005_03 TB412953.[MT7]-AGGADAVQTVTGGLR.2b5_1.heavy 758.914 / 516.253 15308.0 31.010849952697754 44 18 10 6 10 3.235521000800425 30.906923483192145 0.03989982604980469 3 0.9804539853147601 8.81299080272808 15308.0 83.83232165104134 0.0 - - - - - - - 186.875 30 8 EHD4 EH-domain containing 4 1067 136 C20140704_OR005_03 C20140704_OR005_03 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 183584.0 26.472400665283203 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 183584.0 37.63548541020562 0.0 - - - - - - - 222.2 367 5 1069 136 C20140704_OR005_03 C20140704_OR005_03 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 237739.0 26.472400665283203 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 237739.0 40.52633183702892 1.0 - - - - - - - 235.66666666666666 480 3 1071 136 C20140704_OR005_03 C20140704_OR005_03 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 337261.0 26.472400665283203 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 337261.0 52.95851437089853 0.0 - - - - - - - 235.66666666666666 674 3 1073 137 C20140704_OR005_03 C20140704_OR005_03 TB450952.[MT7]-EELAALFSELK[MT7].3b4_1.heavy 513.295 / 587.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1075 137 C20140704_OR005_03 C20140704_OR005_03 TB450952.[MT7]-EELAALFSELK[MT7].3b5_1.heavy 513.295 / 658.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1077 137 C20140704_OR005_03 C20140704_OR005_03 TB450952.[MT7]-EELAALFSELK[MT7].3y4_1.heavy 513.295 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1079 137 C20140704_OR005_03 C20140704_OR005_03 TB450952.[MT7]-EELAALFSELK[MT7].3b3_1.heavy 513.295 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1081 138 C20140704_OR005_03 C20140704_OR005_03 TB427441.[MT7]-RAYLEGTC[CAM]VEWLHR.4y5_1.heavy 484.251 / 740.384 2114.0 32.806650161743164 41 16 10 5 10 6.2128875367046925 16.09557543239224 0.04219818115234375 3 0.9678099941780341 6.860091527579916 2114.0 11.042072515413768 0.0 - - - - - - - 331.55555555555554 4 9 HLA-G major histocompatibility complex, class I, G 1083 138 C20140704_OR005_03 C20140704_OR005_03 TB427441.[MT7]-RAYLEGTC[CAM]VEWLHR.4y4_1.heavy 484.251 / 611.341 4353.0 32.806650161743164 41 16 10 5 10 6.2128875367046925 16.09557543239224 0.04219818115234375 3 0.9678099941780341 6.860091527579916 4353.0 35.0907120140196 0.0 - - - - - - - 207.0 8 9 HLA-G major histocompatibility complex, class I, G 1085 138 C20140704_OR005_03 C20140704_OR005_03 TB427441.[MT7]-RAYLEGTC[CAM]VEWLHR.4b5_1.heavy 484.251 / 777.438 1244.0 32.806650161743164 41 16 10 5 10 6.2128875367046925 16.09557543239224 0.04219818115234375 3 0.9678099941780341 6.860091527579916 1244.0 14.968249902837155 0.0 - - - - - - - 279.75 2 4 HLA-G major histocompatibility complex, class I, G 1087 138 C20140704_OR005_03 C20140704_OR005_03 TB427441.[MT7]-RAYLEGTC[CAM]VEWLHR.4b6_1.heavy 484.251 / 834.459 871.0 32.806650161743164 41 16 10 5 10 6.2128875367046925 16.09557543239224 0.04219818115234375 3 0.9678099941780341 6.860091527579916 871.0 13.556693548387097 0.0 - - - - - - - 0.0 1 0 HLA-G major histocompatibility complex, class I, G 1089 139 C20140704_OR005_03 C20140704_OR005_03 TB413297.[MT7]-VYIGSFWAQPLQNTDNRR.3y15_2.heavy 770.402 / 895.44 4770.0 40.79325008392334 35 9 10 6 10 1.1853226271079156 68.6983565919188 0.037799835205078125 3 0.8014231891668039 2.7222901415162557 4770.0 19.197958898364323 0.0 - - - - - - - 241.91666666666666 9 12 EHD4 EH-domain containing 4 1091 139 C20140704_OR005_03 C20140704_OR005_03 TB413297.[MT7]-VYIGSFWAQPLQNTDNRR.3y17_2.heavy 770.402 / 1033.51 11717.0 40.79325008392334 35 9 10 6 10 1.1853226271079156 68.6983565919188 0.037799835205078125 3 0.8014231891668039 2.7222901415162557 11717.0 31.327337502792044 0.0 - - - - - - - 172.91666666666666 23 12 EHD4 EH-domain containing 4 1093 139 C20140704_OR005_03 C20140704_OR005_03 TB413297.[MT7]-VYIGSFWAQPLQNTDNRR.3b5_1.heavy 770.402 / 664.379 1452.0 40.79325008392334 35 9 10 6 10 1.1853226271079156 68.6983565919188 0.037799835205078125 3 0.8014231891668039 2.7222901415162557 1452.0 15.644469854469854 0.0 - - - - - - - 207.5 2 8 EHD4 EH-domain containing 4 1095 139 C20140704_OR005_03 C20140704_OR005_03 TB413297.[MT7]-VYIGSFWAQPLQNTDNRR.3b3_1.heavy 770.402 / 520.325 2489.0 40.79325008392334 35 9 10 6 10 1.1853226271079156 68.6983565919188 0.037799835205078125 3 0.8014231891668039 2.7222901415162557 2489.0 34.5174168524712 0.0 - - - - - - - 276.4166666666667 4 12 EHD4 EH-domain containing 4 1097 140 C20140704_OR005_03 C20140704_OR005_03 TB413298.[MT7]-LDMFEHISLMTLDSLQK[MT7].3b4_1.heavy 770.409 / 651.329 1850.0 49.608551025390625 38 13 10 5 10 1.6227761045621163 51.96241640482435 0.04010009765625 3 0.9286545325997234 4.592642536264649 1850.0 12.165151515151516 0.0 - - - - - - - 181.5 3 16 CYP4F3;CYP4F11;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12 1099 140 C20140704_OR005_03 C20140704_OR005_03 TB413298.[MT7]-LDMFEHISLMTLDSLQK[MT7].3b5_1.heavy 770.409 / 780.372 5352.0 49.608551025390625 38 13 10 5 10 1.6227761045621163 51.96241640482435 0.04010009765625 3 0.9286545325997234 4.592642536264649 5352.0 21.987370901236993 0.0 - - - - - - - 183.44444444444446 10 9 CYP4F3;CYP4F11;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12 1101 140 C20140704_OR005_03 C20140704_OR005_03 TB413298.[MT7]-LDMFEHISLMTLDSLQK[MT7].3y4_1.heavy 770.409 / 619.39 4559.0 49.608551025390625 38 13 10 5 10 1.6227761045621163 51.96241640482435 0.04010009765625 3 0.9286545325997234 4.592642536264649 4559.0 80.12787878787879 0.0 - - - - - - - 105.6 9 10 CYP4F3;CYP4F11;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12 1103 140 C20140704_OR005_03 C20140704_OR005_03 TB413298.[MT7]-LDMFEHISLMTLDSLQK[MT7].3b3_1.heavy 770.409 / 504.261 3238.0 49.608551025390625 38 13 10 5 10 1.6227761045621163 51.96241640482435 0.04010009765625 3 0.9286545325997234 4.592642536264649 3238.0 24.031520202020204 0.0 - - - - - - - 192.92307692307693 6 13 CYP4F3;CYP4F11;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12 1105 141 C20140704_OR005_03 C20140704_OR005_03 TB413299.[MT7]-LDMFEHISLMTLDSLQK[MT7].4b8_2.heavy 578.059 / 559.277 14496.0 49.59852600097656 30 5 10 5 10 0.5557247955434048 99.39752597087053 0.04010009765625 3 0.6273606294560319 1.9552506438212016 14496.0 135.72088848179527 0.0 - - - - - - - 225.0 28 10 CYP4F3;CYP4F11;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12 1107 141 C20140704_OR005_03 C20140704_OR005_03 TB413299.[MT7]-LDMFEHISLMTLDSLQK[MT7].4b4_1.heavy 578.059 / 651.329 2912.0 49.59852600097656 30 5 10 5 10 0.5557247955434048 99.39752597087053 0.04010009765625 3 0.6273606294560319 1.9552506438212016 2912.0 60.00484848484849 0.0 - - - - - - - 121.16666666666667 5 6 CYP4F3;CYP4F11;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12 1109 141 C20140704_OR005_03 C20140704_OR005_03 TB413299.[MT7]-LDMFEHISLMTLDSLQK[MT7].4b5_1.heavy 578.059 / 780.372 3972.0 49.59852600097656 30 5 10 5 10 0.5557247955434048 99.39752597087053 0.04010009765625 3 0.6273606294560319 1.9552506438212016 3972.0 19.53304535637149 0.0 - - - - - - - 224.07692307692307 7 13 CYP4F3;CYP4F11;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12 1111 141 C20140704_OR005_03 C20140704_OR005_03 TB413299.[MT7]-LDMFEHISLMTLDSLQK[MT7].4b3_1.heavy 578.059 / 504.261 2912.0 49.59852600097656 30 5 10 5 10 0.5557247955434048 99.39752597087053 0.04010009765625 3 0.6273606294560319 1.9552506438212016 2912.0 9.26397832556267 0.0 - - - - - - - 662.1428571428571 5 7 CYP4F3;CYP4F11;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 12 1113 142 C20140704_OR005_03 C20140704_OR005_03 TB450754.[MT7]-VLPLEEAYR.2y4_1.heavy 617.352 / 538.262 2996.0 35.74959945678711 42 18 6 10 8 3.8017491154767433 26.303682058583156 0.0 4 0.9816129343978088 9.087375046021961 2996.0 1.274916194250165 1.0 - - - - - - - 741.4444444444445 6 9 EHD4 EH-domain containing 4 1115 142 C20140704_OR005_03 C20140704_OR005_03 TB450754.[MT7]-VLPLEEAYR.2y8_1.heavy 617.352 / 990.526 34320.0 35.74959945678711 42 18 6 10 8 3.8017491154767433 26.303682058583156 0.0 4 0.9816129343978088 9.087375046021961 34320.0 121.3005706966569 1.0 - - - - - - - 289.375 155 8 EHD4 EH-domain containing 4 1117 142 C20140704_OR005_03 C20140704_OR005_03 TB450754.[MT7]-VLPLEEAYR.2y6_1.heavy 617.352 / 780.389 1770.0 35.74959945678711 42 18 6 10 8 3.8017491154767433 26.303682058583156 0.0 4 0.9816129343978088 9.087375046021961 1770.0 4.434114597784821 2.0 - - - - - - - 323.5 3 8 EHD4 EH-domain containing 4 1119 142 C20140704_OR005_03 C20140704_OR005_03 TB450754.[MT7]-VLPLEEAYR.2y7_1.heavy 617.352 / 877.441 51344.0 35.74959945678711 42 18 6 10 8 3.8017491154767433 26.303682058583156 0.0 4 0.9816129343978088 9.087375046021961 51344.0 214.4076423588524 0.0 - - - - - - - 272.3 102 10 EHD4 EH-domain containing 4 1121 143 C20140704_OR005_03 C20140704_OR005_03 TB427160.[MT7]-LLLQVQHASK[MT7].2y8_1.heavy 712.945 / 1054.61 5345.0 29.602949142456055 35 10 10 5 10 0.9106847645480798 65.70228213175139 0.04010009765625 3 0.8456989898819405 3.1004775839019647 5345.0 54.55146733559908 0.0 - - - - - - - 190.85714285714286 10 7 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1123 143 C20140704_OR005_03 C20140704_OR005_03 TB427160.[MT7]-LLLQVQHASK[MT7].2b4_1.heavy 712.945 / 612.42 3563.0 29.602949142456055 35 10 10 5 10 0.9106847645480798 65.70228213175139 0.04010009765625 3 0.8456989898819405 3.1004775839019647 3563.0 20.695269461077842 0.0 - - - - - - - 185.33333333333334 7 6 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1125 143 C20140704_OR005_03 C20140704_OR005_03 TB427160.[MT7]-LLLQVQHASK[MT7].2y6_1.heavy 712.945 / 813.47 2338.0 29.602949142456055 35 10 10 5 10 0.9106847645480798 65.70228213175139 0.04010009765625 3 0.8456989898819405 3.1004775839019647 2338.0 15.03744394618834 0.0 - - - - - - - 233.9 4 10 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1127 143 C20140704_OR005_03 C20140704_OR005_03 TB427160.[MT7]-LLLQVQHASK[MT7].2y7_1.heavy 712.945 / 941.529 3675.0 29.602949142456055 35 10 10 5 10 0.9106847645480798 65.70228213175139 0.04010009765625 3 0.8456989898819405 3.1004775839019647 3675.0 49.422982062780264 0.0 - - - - - - - 222.66666666666666 7 3 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1129 144 C20140704_OR005_03 C20140704_OR005_03 TB427064.[MT7]-LSELHC[CAM]DK[MT7].2y4_1.heavy 645.342 / 703.331 1408.0 22.573349952697754 38 12 10 6 10 1.0835946766444624 61.523619581734636 0.037799835205078125 3 0.889224349755732 3.673221446383181 1408.0 9.77142857142857 0.0 - - - - - - - 176.0 2 5 HBE1 hemoglobin, epsilon 1 1131 144 C20140704_OR005_03 C20140704_OR005_03 TB427064.[MT7]-LSELHC[CAM]DK[MT7].2b4_1.heavy 645.342 / 587.352 2112.0 22.573349952697754 38 12 10 6 10 1.0835946766444624 61.523619581734636 0.037799835205078125 3 0.889224349755732 3.673221446383181 2112.0 23.999999999999996 0.0 - - - - - - - 195.55555555555554 4 9 HBE1 hemoglobin, epsilon 1 1133 144 C20140704_OR005_03 C20140704_OR005_03 TB427064.[MT7]-LSELHC[CAM]DK[MT7].2y3_1.heavy 645.342 / 566.273 2024.0 22.573349952697754 38 12 10 6 10 1.0835946766444624 61.523619581734636 0.037799835205078125 3 0.889224349755732 3.673221446383181 2024.0 9.200000000000001 0.0 - - - - - - - 188.57142857142858 4 7 HBE1 hemoglobin, epsilon 1 1135 144 C20140704_OR005_03 C20140704_OR005_03 TB427064.[MT7]-LSELHC[CAM]DK[MT7].2y7_1.heavy 645.342 / 1032.49 3168.0 22.573349952697754 38 12 10 6 10 1.0835946766444624 61.523619581734636 0.037799835205078125 3 0.889224349755732 3.673221446383181 3168.0 23.939999999999998 0.0 - - - - - - - 195.55555555555554 6 9 HBE1 hemoglobin, epsilon 1 1137 145 C20140704_OR005_03 C20140704_OR005_03 TB450613.[MT7]-C[CAM]DTPAK[MT7].2y4_1.heavy 490.26 / 560.352 841.0 15.347033182779947 41 15 10 6 10 1.6982054856976083 45.95495100492959 0.03670024871826172 3 0.952782633627662 5.657019139224145 841.0 9.787645514898873 0.0 - - - - - - - 0.0 1 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1139 145 C20140704_OR005_03 C20140704_OR005_03 TB450613.[MT7]-C[CAM]DTPAK[MT7].2b3_1.heavy 490.26 / 521.215 484.0 15.347033182779947 41 15 10 6 10 1.6982054856976083 45.95495100492959 0.03670024871826172 3 0.952782633627662 5.657019139224145 484.0 16.1238431372549 0.0 - - - - - - - 0.0 0 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1141 145 C20140704_OR005_03 C20140704_OR005_03 TB450613.[MT7]-C[CAM]DTPAK[MT7].2b5_1.heavy 490.26 / 689.305 N/A 15.347033182779947 41 15 10 6 10 1.6982054856976083 45.95495100492959 0.03670024871826172 3 0.952782633627662 5.657019139224145 892.0 19.131052631578946 0.0 - - - - - - - 0.0 1 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1143 145 C20140704_OR005_03 C20140704_OR005_03 TB450613.[MT7]-C[CAM]DTPAK[MT7].2y5_1.heavy 490.26 / 675.379 280.0 15.347033182779947 41 15 10 6 10 1.6982054856976083 45.95495100492959 0.03670024871826172 3 0.952782633627662 5.657019139224145 280.0 4.778565531475748 0.0 - - - - - - - 0.0 0 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1145 146 C20140704_OR005_03 C20140704_OR005_03 TB427063.[MT7]-REELEEIAR.2y8_1.heavy 644.852 / 988.495 2255.0 25.044925689697266 43 20 10 3 10 6.655672926672822 15.024776773396841 0.073699951171875 3 0.9940937778658607 16.050682211463606 2255.0 27.347872340425532 1.0 - - - - - - - 172.33333333333334 4 6 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1147 146 C20140704_OR005_03 C20140704_OR005_03 TB427063.[MT7]-REELEEIAR.2b6_1.heavy 644.852 / 930.465 2819.0 25.044925689697266 43 20 10 3 10 6.655672926672822 15.024776773396841 0.073699951171875 3 0.9940937778658607 16.050682211463606 2819.0 43.48457446808511 0.0 - - - - - - - 214.85714285714286 5 7 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1149 146 C20140704_OR005_03 C20140704_OR005_03 TB427063.[MT7]-REELEEIAR.2y6_1.heavy 644.852 / 730.409 1410.0 25.044925689697266 43 20 10 3 10 6.655672926672822 15.024776773396841 0.073699951171875 3 0.9940937778658607 16.050682211463606 1410.0 7.35 0.0 - - - - - - - 223.25 2 8 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1151 146 C20140704_OR005_03 C20140704_OR005_03 TB427063.[MT7]-REELEEIAR.2b5_1.heavy 644.852 / 801.422 1410.0 25.044925689697266 43 20 10 3 10 6.655672926672822 15.024776773396841 0.073699951171875 3 0.9940937778658607 16.050682211463606 1410.0 7.324999999999999 0.0 - - - - - - - 170.9090909090909 2 11 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1153 147 C20140704_OR005_03 C20140704_OR005_03 TB427648.[MT7]-LAELINC[CAM]LAGGYDTIFSLC[CAM]DDYDPGK[MT7]R.4y4_1.heavy 841.916 / 601.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNF1 potassium voltage-gated channel, subfamily F, member 1 1155 147 C20140704_OR005_03 C20140704_OR005_03 TB427648.[MT7]-LAELINC[CAM]LAGGYDTIFSLC[CAM]DDYDPGK[MT7]R.4b7_1.heavy 841.916 / 958.515 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNF1 potassium voltage-gated channel, subfamily F, member 1 1157 147 C20140704_OR005_03 C20140704_OR005_03 TB427648.[MT7]-LAELINC[CAM]LAGGYDTIFSLC[CAM]DDYDPGK[MT7]R.4b4_1.heavy 841.916 / 571.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNF1 potassium voltage-gated channel, subfamily F, member 1 1159 147 C20140704_OR005_03 C20140704_OR005_03 TB427648.[MT7]-LAELINC[CAM]LAGGYDTIFSLC[CAM]DDYDPGK[MT7]R.4b5_1.heavy 841.916 / 684.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNF1 potassium voltage-gated channel, subfamily F, member 1 1161 148 C20140704_OR005_03 C20140704_OR005_03 TB413099.[MT7]-EYQISAGDFPEVK[MT7].3y3_1.heavy 590.977 / 519.326 21707.0 35.51810073852539 47 17 10 10 10 3.136465627755387 24.72933690849815 0.0 3 0.9701235579954692 7.122143103216204 21707.0 26.41687399340634 0.0 - - - - - - - 274.6 43 5 EHD4 EH-domain containing 4 1163 148 C20140704_OR005_03 C20140704_OR005_03 TB413099.[MT7]-EYQISAGDFPEVK[MT7].3b4_1.heavy 590.977 / 678.358 28164.0 35.51810073852539 47 17 10 10 10 3.136465627755387 24.72933690849815 0.0 3 0.9701235579954692 7.122143103216204 28164.0 215.61873094509835 0.0 - - - - - - - 205.83333333333334 56 6 EHD4 EH-domain containing 4 1165 148 C20140704_OR005_03 C20140704_OR005_03 TB413099.[MT7]-EYQISAGDFPEVK[MT7].3y4_1.heavy 590.977 / 616.379 73914.0 35.51810073852539 47 17 10 10 10 3.136465627755387 24.72933690849815 0.0 3 0.9701235579954692 7.122143103216204 73914.0 114.6433760462086 0.0 - - - - - - - 687.1428571428571 147 7 EHD4 EH-domain containing 4 1167 148 C20140704_OR005_03 C20140704_OR005_03 TB413099.[MT7]-EYQISAGDFPEVK[MT7].3b3_1.heavy 590.977 / 565.274 53993.0 35.51810073852539 47 17 10 10 10 3.136465627755387 24.72933690849815 0.0 3 0.9701235579954692 7.122143103216204 53993.0 113.19217626941395 0.0 - - - - - - - 247.2 107 5 EHD4 EH-domain containing 4 1169 149 C20140704_OR005_03 C20140704_OR005_03 TB450966.[MT7]-SPPQMEGPDHGK[MT7].3y6_1.heavy 523.264 / 754.396 4060.0 19.43399953842163 36 12 9 5 10 0.9347061900645415 64.09901272344602 0.04120063781738281 3 0.8987035689820502 3.8444056732345717 4060.0 15.40379403794038 0.0 - - - - - - - 246.28571428571428 16 7 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1171 149 C20140704_OR005_03 C20140704_OR005_03 TB450966.[MT7]-SPPQMEGPDHGK[MT7].3y11_2.heavy 523.264 / 668.825 7320.0 19.43399953842163 36 12 9 5 10 0.9347061900645415 64.09901272344602 0.04120063781738281 3 0.8987035689820502 3.8444056732345717 7320.0 75.17837837837837 0.0 - - - - - - - 211.14285714285714 14 7 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1173 149 C20140704_OR005_03 C20140704_OR005_03 TB450966.[MT7]-SPPQMEGPDHGK[MT7].3b4_1.heavy 523.264 / 554.305 6828.0 19.43399953842163 36 12 9 5 10 0.9347061900645415 64.09901272344602 0.04120063781738281 3 0.8987035689820502 3.8444056732345717 6828.0 204.83999999999997 0.0 - - - - - - - 177.0 13 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1175 149 C20140704_OR005_03 C20140704_OR005_03 TB450966.[MT7]-SPPQMEGPDHGK[MT7].3y5_1.heavy 523.264 / 697.375 1722.0 19.43399953842163 36 12 9 5 10 0.9347061900645415 64.09901272344602 0.04120063781738281 3 0.8987035689820502 3.8444056732345717 1722.0 13.300056887444129 1.0 - - - - - - - 136.88888888888889 4 9 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1177 150 C20140704_OR005_03 C20140704_OR005_03 TB427082.[MT7]-EQGFLSFWR.2y8_1.heavy 657.342 / 1040.53 25270.0 45.01169967651367 48 18 10 10 10 4.49422467237696 22.25077900858721 0.0 3 0.9883742678760351 11.434852445715297 25270.0 99.01657460165572 0.0 - - - - - - - 166.2 50 10 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 1179 150 C20140704_OR005_03 C20140704_OR005_03 TB427082.[MT7]-EQGFLSFWR.2y5_1.heavy 657.342 / 708.383 5902.0 45.01169967651367 48 18 10 10 10 4.49422467237696 22.25077900858721 0.0 3 0.9883742678760351 11.434852445715297 5902.0 37.94045180722892 0.0 - - - - - - - 264.45454545454544 11 11 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 1181 150 C20140704_OR005_03 C20140704_OR005_03 TB427082.[MT7]-EQGFLSFWR.2b4_1.heavy 657.342 / 606.3 8728.0 45.01169967651367 48 18 10 10 10 4.49422467237696 22.25077900858721 0.0 3 0.9883742678760351 11.434852445715297 8728.0 30.67540526993158 0.0 - - - - - - - 249.44444444444446 17 9 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 1183 150 C20140704_OR005_03 C20140704_OR005_03 TB427082.[MT7]-EQGFLSFWR.2y7_1.heavy 657.342 / 912.473 15711.0 45.01169967651367 48 18 10 10 10 4.49422467237696 22.25077900858721 0.0 3 0.9883742678760351 11.434852445715297 15711.0 205.10572173308617 0.0 - - - - - - - 207.8 31 10 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 1185 151 C20140704_OR005_03 C20140704_OR005_03 TB412866.[MT7]-MGFAVLLVNYR.3b6_1.heavy 476.271 / 763.429 N/A N/A - - - - - - - - - 0.0 - - - - - - - APEH N-acylaminoacyl-peptide hydrolase 1187 151 C20140704_OR005_03 C20140704_OR005_03 TB412866.[MT7]-MGFAVLLVNYR.3b5_1.heavy 476.271 / 650.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - APEH N-acylaminoacyl-peptide hydrolase 1189 151 C20140704_OR005_03 C20140704_OR005_03 TB412866.[MT7]-MGFAVLLVNYR.3b3_1.heavy 476.271 / 480.24 N/A N/A - - - - - - - - - 0.0 - - - - - - - APEH N-acylaminoacyl-peptide hydrolase 1191 151 C20140704_OR005_03 C20140704_OR005_03 TB412866.[MT7]-MGFAVLLVNYR.3y5_1.heavy 476.271 / 664.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - APEH N-acylaminoacyl-peptide hydrolase 1193 152 C20140704_OR005_03 C20140704_OR005_03 TB427375.[MT7]-SISVIDSPGILSGEK[MT7].2y4_1.heavy 895.511 / 564.311 5468.0 37.09299850463867 41 11 10 10 10 1.0471961598720483 59.13880153864943 0.0 3 0.8542573360008412 3.1926222396595083 5468.0 11.29024284407651 1.0 - - - - - - - 254.0 11 3 EHD4 EH-domain containing 4 1195 152 C20140704_OR005_03 C20140704_OR005_03 TB427375.[MT7]-SISVIDSPGILSGEK[MT7].2y8_1.heavy 895.511 / 944.553 13605.0 37.09299850463867 41 11 10 10 10 1.0471961598720483 59.13880153864943 0.0 3 0.8542573360008412 3.1926222396595083 13605.0 36.79760163456069 0.0 - - - - - - - 254.0 27 6 EHD4 EH-domain containing 4 1197 152 C20140704_OR005_03 C20140704_OR005_03 TB427375.[MT7]-SISVIDSPGILSGEK[MT7].2y5_1.heavy 895.511 / 677.395 6485.0 37.09299850463867 41 11 10 10 10 1.0471961598720483 59.13880153864943 0.0 3 0.8542573360008412 3.1926222396595083 6485.0 72.50944881889764 0.0 - - - - - - - 169.33333333333334 12 3 EHD4 EH-domain containing 4 1199 152 C20140704_OR005_03 C20140704_OR005_03 TB427375.[MT7]-SISVIDSPGILSGEK[MT7].2y9_1.heavy 895.511 / 1031.59 18310.0 37.09299850463867 41 11 10 10 10 1.0471961598720483 59.13880153864943 0.0 3 0.8542573360008412 3.1926222396595083 18310.0 84.8651538026773 0.0 - - - - - - - 211.66666666666666 36 9 EHD4 EH-domain containing 4 1201 153 C20140704_OR005_03 C20140704_OR005_03 TB412966.[MT7]-VRPPPPPADSVTR.3y7_1.heavy 511.627 / 745.384 57869.0 22.48819923400879 48 18 10 10 10 4.431524473566782 22.565598045657058 0.0 3 0.982305198549274 9.263967844393276 57869.0 56.253261889943765 0.0 - - - - - - - 299.2 115 5 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1203 153 C20140704_OR005_03 C20140704_OR005_03 TB412966.[MT7]-VRPPPPPADSVTR.3y6_1.heavy 511.627 / 648.331 12312.0 22.48819923400879 48 18 10 10 10 4.431524473566782 22.565598045657058 0.0 3 0.982305198549274 9.263967844393276 12312.0 30.706769990878684 0.0 - - - - - - - 297.0 24 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1205 153 C20140704_OR005_03 C20140704_OR005_03 TB412966.[MT7]-VRPPPPPADSVTR.3y8_1.heavy 511.627 / 842.437 19172.0 22.48819923400879 48 18 10 10 10 4.431524473566782 22.565598045657058 0.0 3 0.982305198549274 9.263967844393276 19172.0 45.54166284942448 0.0 - - - - - - - 352.0 38 5 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1207 153 C20140704_OR005_03 C20140704_OR005_03 TB412966.[MT7]-VRPPPPPADSVTR.3y5_1.heavy 511.627 / 577.294 8355.0 22.48819923400879 48 18 10 10 10 4.431524473566782 22.565598045657058 0.0 3 0.982305198549274 9.263967844393276 8355.0 16.157351632887437 0.0 - - - - - - - 769.75 16 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1209 154 C20140704_OR005_03 C20140704_OR005_03 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 187848.0 37.60300064086914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 187848.0 112.19027307822108 0.0 - - - - - - - 269.57142857142856 375 7 1211 154 C20140704_OR005_03 C20140704_OR005_03 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 445815.0 37.60300064086914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 445815.0 124.02235865768334 0.0 - - - - - - - 247.8 891 10 1213 154 C20140704_OR005_03 C20140704_OR005_03 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 550018.0 37.60300064086914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 550018.0 218.92732457991264 0.0 - - - - - - - 740.7142857142857 1100 7 1215 155 C20140704_OR005_03 C20140704_OR005_03 TB427376.[MT7]-SISVIDSPGILSGEK[MT7].4y5_1.heavy 448.259 / 677.395 382.0 37.08177375793457 39 14 10 5 10 2.211614909090858 36.61627918210813 0.04489898681640625 3 0.943119200275258 5.149903935236519 382.0 0.34940176817288804 3.0 - - - - - - - 0.0 1 0 EHD4 EH-domain containing 4 1217 155 C20140704_OR005_03 C20140704_OR005_03 TB427376.[MT7]-SISVIDSPGILSGEK[MT7].4y4_1.heavy 448.259 / 564.311 1146.0 37.08177375793457 39 14 10 5 10 2.211614909090858 36.61627918210813 0.04489898681640625 3 0.943119200275258 5.149903935236519 1146.0 17.596062992125983 0.0 - - - - - - - 127.0 2 1 EHD4 EH-domain containing 4 1219 155 C20140704_OR005_03 C20140704_OR005_03 TB427376.[MT7]-SISVIDSPGILSGEK[MT7].4b4_1.heavy 448.259 / 531.326 1146.0 37.08177375793457 39 14 10 5 10 2.211614909090858 36.61627918210813 0.04489898681640625 3 0.943119200275258 5.149903935236519 1146.0 17.975055118110234 0.0 - - - - - - - 178.0 2 5 EHD4 EH-domain containing 4 1221 155 C20140704_OR005_03 C20140704_OR005_03 TB427376.[MT7]-SISVIDSPGILSGEK[MT7].4y3_1.heavy 448.259 / 477.279 1401.0 37.08177375793457 39 14 10 5 10 2.211614909090858 36.61627918210813 0.04489898681640625 3 0.943119200275258 5.149903935236519 1401.0 4.034293193717278 2.0 - - - - - - - 212.0 2 3 EHD4 EH-domain containing 4 1223 156 C20140704_OR005_03 C20140704_OR005_03 TB427181.[MT7]-ADQVDTQQLMR.2y9_1.heavy 724.868 / 1118.56 7496.0 27.794099807739258 48 18 10 10 10 4.164591555526237 24.0119585958686 0.0 3 0.9852399182955249 10.145707848483873 7496.0 102.04713237035283 0.0 - - - - - - - 149.45454545454547 14 11 EHD4 EH-domain containing 4 1225 156 C20140704_OR005_03 C20140704_OR005_03 TB427181.[MT7]-ADQVDTQQLMR.2y6_1.heavy 724.868 / 776.408 10782.0 27.794099807739258 48 18 10 10 10 4.164591555526237 24.0119585958686 0.0 3 0.9852399182955249 10.145707848483873 10782.0 137.2356506115244 0.0 - - - - - - - 154.16666666666666 21 6 EHD4 EH-domain containing 4 1227 156 C20140704_OR005_03 C20140704_OR005_03 TB427181.[MT7]-ADQVDTQQLMR.2b5_1.heavy 724.868 / 673.327 8728.0 27.794099807739258 48 18 10 10 10 4.164591555526237 24.0119585958686 0.0 3 0.9852399182955249 10.145707848483873 8728.0 69.39824390243902 0.0 - - - - - - - 228.11111111111111 17 9 EHD4 EH-domain containing 4 1229 156 C20140704_OR005_03 C20140704_OR005_03 TB427181.[MT7]-ADQVDTQQLMR.2y7_1.heavy 724.868 / 891.435 9447.0 27.794099807739258 48 18 10 10 10 4.164591555526237 24.0119585958686 0.0 3 0.9852399182955249 10.145707848483873 9447.0 155.92135922330095 0.0 - - - - - - - 154.0 18 2 EHD4 EH-domain containing 4 1231 157 C20140704_OR005_03 C20140704_OR005_03 TB427374.[MT7]-SISVIDSPGILSGEK[MT7].3b6_1.heavy 597.343 / 759.437 42156.0 37.09299850463867 50 20 10 10 10 9.645943728320873 10.367051977132734 0.0 3 0.9914149013295062 13.310014512387767 42156.0 114.8466743810091 0.0 - - - - - - - 306.4 84 5 EHD4 EH-domain containing 4 1233 157 C20140704_OR005_03 C20140704_OR005_03 TB427374.[MT7]-SISVIDSPGILSGEK[MT7].3b4_1.heavy 597.343 / 531.326 56847.0 37.09299850463867 50 20 10 10 10 9.645943728320873 10.367051977132734 0.0 3 0.9914149013295062 13.310014512387767 56847.0 70.805871886121 0.0 - - - - - - - 234.0 113 6 EHD4 EH-domain containing 4 1235 157 C20140704_OR005_03 C20140704_OR005_03 TB427374.[MT7]-SISVIDSPGILSGEK[MT7].3y4_1.heavy 597.343 / 564.311 115865.0 37.09299850463867 50 20 10 10 10 9.645943728320873 10.367051977132734 0.0 3 0.9914149013295062 13.310014512387767 115865.0 80.05960971521942 0.0 - - - - - - - 287.25 231 4 EHD4 EH-domain containing 4 1237 157 C20140704_OR005_03 C20140704_OR005_03 TB427374.[MT7]-SISVIDSPGILSGEK[MT7].3y5_1.heavy 597.343 / 677.395 66172.0 37.09299850463867 50 20 10 10 10 9.645943728320873 10.367051977132734 0.0 3 0.9914149013295062 13.310014512387767 66172.0 107.75879101428708 0.0 - - - - - - - 306.2 132 5 EHD4 EH-domain containing 4 1239 158 C20140704_OR005_03 C20140704_OR005_03 TB412968.[MT7]-ELLPGSVMLGFAR.2b3_1.heavy 767.433 / 500.32 46634.0 45.33862495422363 41 16 10 5 10 3.5141588792802634 28.45631157703406 0.04270172119140625 3 0.9630033421204653 6.396361400384872 46634.0 229.37474718856927 0.0 - - - - - - - 187.0 93 4 IFI35 interferon-induced protein 35 1241 158 C20140704_OR005_03 C20140704_OR005_03 TB412968.[MT7]-ELLPGSVMLGFAR.2y9_1.heavy 767.433 / 937.492 7315.0 45.33862495422363 41 16 10 5 10 3.5141588792802634 28.45631157703406 0.04270172119140625 3 0.9630033421204653 6.396361400384872 7315.0 53.86684469838115 0.0 - - - - - - - 176.625 14 8 IFI35 interferon-induced protein 35 1243 158 C20140704_OR005_03 C20140704_OR005_03 TB412968.[MT7]-ELLPGSVMLGFAR.2y10_1.heavy 767.433 / 1034.55 99586.0 45.33862495422363 41 16 10 5 10 3.5141588792802634 28.45631157703406 0.04270172119140625 3 0.9630033421204653 6.396361400384872 99586.0 862.6787228915663 0.0 - - - - - - - 166.11111111111111 199 9 IFI35 interferon-induced protein 35 1245 158 C20140704_OR005_03 C20140704_OR005_03 TB412968.[MT7]-ELLPGSVMLGFAR.2y11_1.heavy 767.433 / 1147.63 5736.0 45.33862495422363 41 16 10 5 10 3.5141588792802634 28.45631157703406 0.04270172119140625 3 0.9630033421204653 6.396361400384872 5736.0 34.36771060832503 1.0 - - - - - - - 221.5 12 6 IFI35 interferon-induced protein 35 1247 159 C20140704_OR005_03 C20140704_OR005_03 TB450963.[MT7]-LLVVY[MT7]PWTQR.3y7_1.heavy 521.648 / 1093.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBB;HBD;HBE1;HBG1;HBG2 hemoglobin, beta;hemoglobin, delta;hemoglobin, epsilon 1;hemoglobin, gamma A;hemoglobin, gamma G 1249 159 C20140704_OR005_03 C20140704_OR005_03 TB450963.[MT7]-LLVVY[MT7]PWTQR.3y6_1.heavy 521.648 / 994.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBB;HBD;HBE1;HBG1;HBG2 hemoglobin, beta;hemoglobin, delta;hemoglobin, epsilon 1;hemoglobin, gamma A;hemoglobin, gamma G 1251 159 C20140704_OR005_03 C20140704_OR005_03 TB450963.[MT7]-LLVVY[MT7]PWTQR.3y4_1.heavy 521.648 / 590.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBB;HBD;HBE1;HBG1;HBG2 hemoglobin, beta;hemoglobin, delta;hemoglobin, epsilon 1;hemoglobin, gamma A;hemoglobin, gamma G 1253 159 C20140704_OR005_03 C20140704_OR005_03 TB450963.[MT7]-LLVVY[MT7]PWTQR.3y5_1.heavy 521.648 / 687.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBB;HBD;HBE1;HBG1;HBG2 hemoglobin, beta;hemoglobin, delta;hemoglobin, epsilon 1;hemoglobin, gamma A;hemoglobin, gamma G 1255 160 C20140704_OR005_03 C20140704_OR005_03 TB451129.[MT7]-REFQELRHPVDEEK[MT7].4y4_1.heavy 525.782 / 664.327 27493.0 22.67840003967285 47 17 10 10 10 4.955471115275589 15.78241861251941 0.0 3 0.9770876385349397 8.137569528903326 27493.0 341.26711651977035 0.0 - - - - - - - 193.22222222222223 54 9 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1257 160 C20140704_OR005_03 C20140704_OR005_03 TB451129.[MT7]-REFQELRHPVDEEK[MT7].4b7_2.heavy 525.782 / 552.307 15320.0 22.67840003967285 47 17 10 10 10 4.955471115275589 15.78241861251941 0.0 3 0.9770876385349397 8.137569528903326 15320.0 193.856780140697 0.0 - - - - - - - 264.9 30 10 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1259 160 C20140704_OR005_03 C20140704_OR005_03 TB451129.[MT7]-REFQELRHPVDEEK[MT7].4b5_1.heavy 525.782 / 834.423 3064.0 22.67840003967285 47 17 10 10 10 4.955471115275589 15.78241861251941 0.0 3 0.9770876385349397 8.137569528903326 3064.0 28.843338515351732 0.0 - - - - - - - 189.42857142857142 6 7 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1261 160 C20140704_OR005_03 C20140704_OR005_03 TB451129.[MT7]-REFQELRHPVDEEK[MT7].4y3_1.heavy 525.782 / 549.3 11676.0 22.67840003967285 47 17 10 10 10 4.955471115275589 15.78241861251941 0.0 3 0.9770876385349397 8.137569528903326 11676.0 58.8176510676965 0.0 - - - - - - - 257.55555555555554 23 9 TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1263 161 C20140704_OR005_03 C20140704_OR005_03 TB427174.[MT7]-C[CAM]LVARPPSQK[MT7].2b3_1.heavy 722.421 / 517.292 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1265 161 C20140704_OR005_03 C20140704_OR005_03 TB427174.[MT7]-C[CAM]LVARPPSQK[MT7].2y5_1.heavy 722.421 / 700.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1267 161 C20140704_OR005_03 C20140704_OR005_03 TB427174.[MT7]-C[CAM]LVARPPSQK[MT7].2y9_1.heavy 722.421 / 1139.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1269 161 C20140704_OR005_03 C20140704_OR005_03 TB427174.[MT7]-C[CAM]LVARPPSQK[MT7].2y7_1.heavy 722.421 / 927.549 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1271 162 C20140704_OR005_03 C20140704_OR005_03 TB450628.[MT7]-TELVQK[MT7].2y4_1.heavy 503.313 / 631.426 8400.0 21.66550064086914 50 20 10 10 10 18.507556217664856 5.403198500326763 0.0 3 0.9968214279792408 21.88422837237012 8400.0 78.13821686746988 0.0 - - - - - - - 178.14285714285714 16 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1273 162 C20140704_OR005_03 C20140704_OR005_03 TB450628.[MT7]-TELVQK[MT7].2y5_1.heavy 503.313 / 760.469 8317.0 21.66550064086914 50 20 10 10 10 18.507556217664856 5.403198500326763 0.0 3 0.9968214279792408 21.88422837237012 8317.0 66.76974430789289 0.0 - - - - - - - 250.0 16 1 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1275 162 C20140704_OR005_03 C20140704_OR005_03 TB450628.[MT7]-TELVQK[MT7].2b4_1.heavy 503.313 / 587.352 7485.0 21.66550064086914 50 20 10 10 10 18.507556217664856 5.403198500326763 0.0 3 0.9968214279792408 21.88422837237012 7485.0 62.611961358949316 0.0 - - - - - - - 194.16666666666666 14 6 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1277 162 C20140704_OR005_03 C20140704_OR005_03 TB450628.[MT7]-TELVQK[MT7].2y3_1.heavy 503.313 / 518.342 13972.0 21.66550064086914 50 20 10 10 10 18.507556217664856 5.403198500326763 0.0 3 0.9968214279792408 21.88422837237012 13972.0 64.92132132132133 0.0 - - - - - - - 287.45454545454544 27 11 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1279 163 C20140704_OR005_03 C20140704_OR005_03 TB427075.[MT7]-QRVLETAAK[MT7].2b8_1.heavy 652.4 / 1013.59 988.0 19.65019989013672 45 17 8 10 10 4.216877152838833 23.714231260609345 0.0 3 0.97468710665802 7.740536978802892 988.0 9.1 0.0 - - - - - - - 0.0 1 0 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1281 163 C20140704_OR005_03 C20140704_OR005_03 TB427075.[MT7]-QRVLETAAK[MT7].2y4_1.heavy 652.4 / 534.337 836.0 19.65019989013672 45 17 8 10 10 4.216877152838833 23.714231260609345 0.0 3 0.97468710665802 7.740536978802892 836.0 3.192 1.0 - - - - - - - 0.0 1 0 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1283 163 C20140704_OR005_03 C20140704_OR005_03 TB427075.[MT7]-QRVLETAAK[MT7].2y8_1.heavy 652.4 / 1031.63 1671.0 19.65019989013672 45 17 8 10 10 4.216877152838833 23.714231260609345 0.0 3 0.97468710665802 7.740536978802892 1671.0 24.185526315789474 0.0 - - - - - - - 114.0 3 4 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1285 163 C20140704_OR005_03 C20140704_OR005_03 TB427075.[MT7]-QRVLETAAK[MT7].2b5_1.heavy 652.4 / 770.464 532.0 19.65019989013672 45 17 8 10 10 4.216877152838833 23.714231260609345 0.0 3 0.97468710665802 7.740536978802892 532.0 1.6227272727272728 4.0 - - - - - - - 133.0 4 4 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1287 164 C20140704_OR005_03 C20140704_OR005_03 TB427654.[MT7]-LALQTSDWIRVDPWESEQAQWMETVK[MT7].4y4_1.heavy 859.438 / 620.374 9829.0 47.81737518310547 43 17 10 6 10 4.76246079847835 20.99754816500556 0.03289794921875 3 0.9768822823692874 8.101205810688514 9829.0 78.18522727272727 0.0 - - - - - - - 216.35 19 20 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1289 164 C20140704_OR005_03 C20140704_OR005_03 TB427654.[MT7]-LALQTSDWIRVDPWESEQAQWMETVK[MT7].4y5_1.heavy 859.438 / 751.414 9315.0 47.81737518310547 43 17 10 6 10 4.76246079847835 20.99754816500556 0.03289794921875 3 0.9768822823692874 8.101205810688514 9315.0 28.177751196172245 0.0 - - - - - - - 205.3 18 10 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1291 164 C20140704_OR005_03 C20140704_OR005_03 TB427654.[MT7]-LALQTSDWIRVDPWESEQAQWMETVK[MT7].4b7_1.heavy 859.438 / 873.48 2787.0 47.81737518310547 43 17 10 6 10 4.76246079847835 20.99754816500556 0.03289794921875 3 0.9768822823692874 8.101205810688514 2787.0 7.609556313993174 0.0 - - - - - - - 198.52941176470588 5 17 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1293 164 C20140704_OR005_03 C20140704_OR005_03 TB427654.[MT7]-LALQTSDWIRVDPWESEQAQWMETVK[MT7].4b12_2.heavy 859.438 / 771.924 6528.0 47.81737518310547 43 17 10 6 10 4.76246079847835 20.99754816500556 0.03289794921875 3 0.9768822823692874 8.101205810688514 6528.0 16.942420487401897 0.0 - - - - - - - 196.9375 13 16 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1295 165 C20140704_OR005_03 C20140704_OR005_03 TB427653.[MT7]-LALQTSDWIRVDPWESEQAQWMETVK[MT7].3b3_1.heavy 1145.58 / 442.315 1538.0 47.77615165710449 40 14 10 6 10 1.5529611324374115 45.2068439443796 0.033100128173828125 3 0.9370852991792958 4.894210164838434 1538.0 2.758206627680312 1.0 - - - - - - - 182.92857142857142 3 14 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1297 165 C20140704_OR005_03 C20140704_OR005_03 TB427653.[MT7]-LALQTSDWIRVDPWESEQAQWMETVK[MT7].3y5_1.heavy 1145.58 / 751.414 586.0 47.77615165710449 40 14 10 6 10 1.5529611324374115 45.2068439443796 0.033100128173828125 3 0.9370852991792958 4.894210164838434 586.0 3.2109589041095887 1.0 - - - - - - - 0.0 1 0 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1299 165 C20140704_OR005_03 C20140704_OR005_03 TB427653.[MT7]-LALQTSDWIRVDPWESEQAQWMETVK[MT7].3b7_1.heavy 1145.58 / 873.48 879.0 47.77615165710449 40 14 10 6 10 1.5529611324374115 45.2068439443796 0.033100128173828125 3 0.9370852991792958 4.894210164838434 879.0 13.000269291977409 1.0 - - - - - - - 0.0 1 0 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1301 165 C20140704_OR005_03 C20140704_OR005_03 TB427653.[MT7]-LALQTSDWIRVDPWESEQAQWMETVK[MT7].3b12_2.heavy 1145.58 / 771.924 1757.0 47.77615165710449 40 14 10 6 10 1.5529611324374115 45.2068439443796 0.033100128173828125 3 0.9370852991792958 4.894210164838434 1757.0 6.896258539520725 1.0 - - - - - - - 105.55555555555556 5 9 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1303 166 C20140704_OR005_03 C20140704_OR005_03 TB450622.[MT7]-TAVAPIER.2y4_1.heavy 500.799 / 514.298 16360.0 22.333099365234375 37 17 0 10 10 3.0119126862908434 28.94944813060312 0.0 3 0.9788953280659282 8.480203825016723 16360.0 87.44137931034483 0.0 - - - - - - - 203.0 32 12 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1305 166 C20140704_OR005_03 C20140704_OR005_03 TB450622.[MT7]-TAVAPIER.2y5_1.heavy 500.799 / 585.336 21494.0 22.333099365234375 37 17 0 10 10 3.0119126862908434 28.94944813060312 0.0 3 0.9788953280659282 8.480203825016723 21494.0 133.8227969348659 0.0 - - - - - - - 200.1 42 10 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1307 166 C20140704_OR005_03 C20140704_OR005_03 TB450622.[MT7]-TAVAPIER.2y6_1.heavy 500.799 / 684.404 9659.0 22.333099365234375 37 17 0 10 10 3.0119126862908434 28.94944813060312 0.0 3 0.9788953280659282 8.480203825016723 9659.0 151.54637931034483 0.0 - - - - - - - 130.5 19 8 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1309 166 C20140704_OR005_03 C20140704_OR005_03 TB450622.[MT7]-TAVAPIER.2y7_1.heavy 500.799 / 755.441 N/A 22.333099365234375 37 17 0 10 10 3.0119126862908434 28.94944813060312 0.0 3 0.9788953280659282 8.480203825016723 19753.0 51.16954238686721 1.0 - - - - - - - 186.42857142857142 469 7 SLC25A4;SLC25A5;SLC25A6;SLC25A31 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 1311 167 C20140704_OR005_03 C20140704_OR005_03 TB427073.[MT7]-VLVTGFPASLR.3b5_1.heavy 435.267 / 614.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1313 167 C20140704_OR005_03 C20140704_OR005_03 TB427073.[MT7]-VLVTGFPASLR.3b3_1.heavy 435.267 / 456.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1315 167 C20140704_OR005_03 C20140704_OR005_03 TB427073.[MT7]-VLVTGFPASLR.3y4_1.heavy 435.267 / 446.272 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1317 167 C20140704_OR005_03 C20140704_OR005_03 TB427073.[MT7]-VLVTGFPASLR.3y5_1.heavy 435.267 / 543.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1319 168 C20140704_OR005_03 C20140704_OR005_03 TB412862.[MT7]-TFQTPNLWK[MT7].3b6_1.heavy 474.938 / 833.427 801.0 36.86309814453125 48 18 10 10 10 9.116452103294499 10.969179552192465 0.0 3 0.9828559998676967 9.412042240580831 801.0 5.7297910447761184 1.0 - - - - - - - 0.0 1 0 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1321 168 C20140704_OR005_03 C20140704_OR005_03 TB412862.[MT7]-TFQTPNLWK[MT7].3y3_1.heavy 474.938 / 590.378 3205.0 36.86309814453125 48 18 10 10 10 9.116452103294499 10.969179552192465 0.0 3 0.9828559998676967 9.412042240580831 3205.0 5.650380266509601 1.0 - - - - - - - 134.0 7 1 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1323 168 C20140704_OR005_03 C20140704_OR005_03 TB412862.[MT7]-TFQTPNLWK[MT7].3b4_1.heavy 474.938 / 622.332 4674.0 36.86309814453125 48 18 10 10 10 9.116452103294499 10.969179552192465 0.0 3 0.9828559998676967 9.412042240580831 4674.0 32.67230519891803 1.0 - - - - - - - 134.0 9 1 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1325 168 C20140704_OR005_03 C20140704_OR005_03 TB412862.[MT7]-TFQTPNLWK[MT7].3b3_1.heavy 474.938 / 521.284 7345.0 36.86309814453125 48 18 10 10 10 9.116452103294499 10.969179552192465 0.0 3 0.9828559998676967 9.412042240580831 7345.0 13.540926966292135 1.0 - - - - - - - 245.16666666666666 14 6 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1327 169 C20140704_OR005_03 C20140704_OR005_03 TB412704.[MT7]-FLDDC[CAM]C[CAM]K[MT7].2y4_1.heavy 623.296 / 726.303 5408.0 27.217100143432617 48 18 10 10 10 5.161624656799735 19.3737450219794 0.0 3 0.9858997317914254 10.380948891379637 5408.0 34.85799900249376 0.0 - - - - - - - 629.5714285714286 10 7 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1329 169 C20140704_OR005_03 C20140704_OR005_03 TB412704.[MT7]-FLDDC[CAM]C[CAM]K[MT7].2y5_1.heavy 623.296 / 841.33 4507.0 27.217100143432617 48 18 10 10 10 5.161624656799735 19.3737450219794 0.0 3 0.9858997317914254 10.380948891379637 4507.0 46.674131954350926 0.0 - - - - - - - 150.0 9 6 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1331 169 C20140704_OR005_03 C20140704_OR005_03 TB412704.[MT7]-FLDDC[CAM]C[CAM]K[MT7].2y3_1.heavy 623.296 / 611.276 7011.0 27.217100143432617 48 18 10 10 10 5.161624656799735 19.3737450219794 0.0 3 0.9858997317914254 10.380948891379637 7011.0 18.560445100582246 0.0 - - - - - - - 230.3 14 10 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1333 169 C20140704_OR005_03 C20140704_OR005_03 TB412704.[MT7]-FLDDC[CAM]C[CAM]K[MT7].2y6_1.heavy 623.296 / 954.414 8012.0 27.217100143432617 48 18 10 10 10 5.161624656799735 19.3737450219794 0.0 3 0.9858997317914254 10.380948891379637 8012.0 26.172533333333334 0.0 - - - - - - - 244.66666666666666 16 9 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1335 170 C20140704_OR005_03 C20140704_OR005_03 TB450938.[MT7]-GHTQQDPEVPK[MT7].2b8_2.heavy 762.406 / 519.242 54.0 18.248674869537354 25 3 10 6 6 5.9879928804626985 16.700086656127237 0.03949928283691406 5 0.5341770839143474 1.7327455077340628 54.0 1.93 11.0 - - - - - - - 0.0 1 0 IFI35 interferon-induced protein 35 1337 170 C20140704_OR005_03 C20140704_OR005_03 TB450938.[MT7]-GHTQQDPEVPK[MT7].2y5_1.heavy 762.406 / 713.431 1196.0 18.248674869537354 25 3 10 6 6 5.9879928804626985 16.700086656127237 0.03949928283691406 5 0.5341770839143474 1.7327455077340628 1196.0 14.593394495412845 0.0 - - - - - - - 122.375 2 8 IFI35 interferon-induced protein 35 1339 170 C20140704_OR005_03 C20140704_OR005_03 TB450938.[MT7]-GHTQQDPEVPK[MT7].2b4_1.heavy 762.406 / 568.296 272.0 18.248674869537354 25 3 10 6 6 5.9879928804626985 16.700086656127237 0.03949928283691406 5 0.5341770839143474 1.7327455077340628 272.0 4.533333333333333 6.0 - - - - - - - 0.0 0 0 IFI35 interferon-induced protein 35 1341 170 C20140704_OR005_03 C20140704_OR005_03 TB450938.[MT7]-GHTQQDPEVPK[MT7].2b6_1.heavy 762.406 / 811.381 2066.0 18.248674869537354 25 3 10 6 6 5.9879928804626985 16.700086656127237 0.03949928283691406 5 0.5341770839143474 1.7327455077340628 2066.0 39.750245098039215 0.0 - - - - - - - 130.4 4 5 IFI35 interferon-induced protein 35 1343 171 C20140704_OR005_03 C20140704_OR005_03 TB450939.[MT7]-FFDSFGNLSSPSAILGNPK[MT7].3b4_1.heavy 762.738 / 641.305 16767.0 45.5172004699707 41 11 10 10 10 0.9070259682129443 66.99492203518943 0.0 3 0.8797362522887274 3.522437014010697 16767.0 57.871836435295414 0.0 - - - - - - - 212.0 33 7 HBE1 hemoglobin, epsilon 1 1345 171 C20140704_OR005_03 C20140704_OR005_03 TB450939.[MT7]-FFDSFGNLSSPSAILGNPK[MT7].3y4_1.heavy 762.738 / 559.332 66697.0 45.5172004699707 41 11 10 10 10 0.9070259682129443 66.99492203518943 0.0 3 0.8797362522887274 3.522437014010697 66697.0 115.21003303447955 0.0 - - - - - - - 393.75 133 4 HBE1 hemoglobin, epsilon 1 1347 171 C20140704_OR005_03 C20140704_OR005_03 TB450939.[MT7]-FFDSFGNLSSPSAILGNPK[MT7].3b3_1.heavy 762.738 / 554.273 23993.0 45.5172004699707 41 11 10 10 10 0.9070259682129443 66.99492203518943 0.0 3 0.8797362522887274 3.522437014010697 23993.0 36.60406644480721 0.0 - - - - - - - 241.0 47 5 HBE1 hemoglobin, epsilon 1 1349 171 C20140704_OR005_03 C20140704_OR005_03 TB450939.[MT7]-FFDSFGNLSSPSAILGNPK[MT7].3b7_1.heavy 762.738 / 959.438 42149.0 45.5172004699707 41 11 10 10 10 0.9070259682129443 66.99492203518943 0.0 3 0.8797362522887274 3.522437014010697 42149.0 56.37544865484131 0.0 - - - - - - - 278.0 84 5 HBE1 hemoglobin, epsilon 1 1351 172 C20140704_OR005_03 C20140704_OR005_03 TB412839.[MT7]-LHVDPENFK[MT7].3y3_1.heavy 462.926 / 552.326 9016.0 29.752549648284912 40 18 10 6 6 4.53175488811707 22.066506787958623 0.03899955749511719 6 0.9819816353668648 9.180163429909646 9016.0 23.574303030303028 0.0 - - - - - - - 264.0 18 5 HBE1;HBG1;HBG2 hemoglobin, epsilon 1;hemoglobin, gamma A;hemoglobin, gamma G 1353 172 C20140704_OR005_03 C20140704_OR005_03 TB412839.[MT7]-LHVDPENFK[MT7].3b4_1.heavy 462.926 / 609.348 13525.0 29.752549648284912 40 18 10 6 6 4.53175488811707 22.066506787958623 0.03899955749511719 6 0.9819816353668648 9.180163429909646 13525.0 37.9519696969697 0.0 - - - - - - - 275.0 27 8 HBE1;HBG1;HBG2 hemoglobin, epsilon 1;hemoglobin, gamma A;hemoglobin, gamma G 1355 172 C20140704_OR005_03 C20140704_OR005_03 TB412839.[MT7]-LHVDPENFK[MT7].3y4_1.heavy 462.926 / 681.369 1759.0 29.752549648284912 40 18 10 6 6 4.53175488811707 22.066506787958623 0.03899955749511719 6 0.9819816353668648 9.180163429909646 1759.0 14.711636363636364 3.0 - - - - - - - 183.33333333333334 5 6 HBE1;HBG1;HBG2 hemoglobin, epsilon 1;hemoglobin, gamma A;hemoglobin, gamma G 1357 172 C20140704_OR005_03 C20140704_OR005_03 TB412839.[MT7]-LHVDPENFK[MT7].3y5_1.heavy 462.926 / 778.422 1210.0 29.752549648284912 40 18 10 6 6 4.53175488811707 22.066506787958623 0.03899955749511719 6 0.9819816353668648 9.180163429909646 1210.0 1.2571428571428571 0.0 - - - - - - - 247.5 2 4 HBE1;HBG1;HBG2 hemoglobin, epsilon 1;hemoglobin, gamma A;hemoglobin, gamma G 1359 173 C20140704_OR005_03 C20140704_OR005_03 TB427461.[MT7]-RVQLILDDLGVDAAEGR.3y6_1.heavy 662.036 / 618.284 46651.0 41.0718994140625 44 14 10 10 10 2.2645923782155184 30.75591795715379 0.0 3 0.9489148055602276 5.436863707285463 46651.0 117.55021420077689 0.0 - - - - - - - 652.5454545454545 93 11 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1361 173 C20140704_OR005_03 C20140704_OR005_03 TB427461.[MT7]-RVQLILDDLGVDAAEGR.3y8_1.heavy 662.036 / 774.374 36090.0 41.0718994140625 44 14 10 10 10 2.2645923782155184 30.75591795715379 0.0 3 0.9489148055602276 5.436863707285463 36090.0 132.86878476679505 0.0 - - - - - - - 265.0833333333333 72 12 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1363 173 C20140704_OR005_03 C20140704_OR005_03 TB427461.[MT7]-RVQLILDDLGVDAAEGR.3b8_1.heavy 662.036 / 1097.64 22556.0 41.0718994140625 44 14 10 10 10 2.2645923782155184 30.75591795715379 0.0 3 0.9489148055602276 5.436863707285463 22556.0 74.25783526676004 0.0 - - - - - - - 273.55555555555554 45 9 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1365 173 C20140704_OR005_03 C20140704_OR005_03 TB427461.[MT7]-RVQLILDDLGVDAAEGR.3y5_1.heavy 662.036 / 503.257 28298.0 41.0718994140625 44 14 10 10 10 2.2645923782155184 30.75591795715379 0.0 3 0.9489148055602276 5.436863707285463 28298.0 92.43771159606332 0.0 - - - - - - - 643.3636363636364 56 11 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1367 174 C20140704_OR005_03 C20140704_OR005_03 TB450834.[MT7]-DTVGIWGEGK[MT7].2y4_1.heavy 675.369 / 534.3 2706.0 32.0162665049235 39 17 10 2 10 2.4738069543627086 32.1748744004595 0.08169746398925781 3 0.9765399930364427 8.04165764188325 2706.0 3.158510638297872 1.0 - - - - - - - 250.55555555555554 5 9 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1369 174 C20140704_OR005_03 C20140704_OR005_03 TB450834.[MT7]-DTVGIWGEGK[MT7].2y5_1.heavy 675.369 / 720.38 N/A 32.0162665049235 39 17 10 2 10 2.4738069543627086 32.1748744004595 0.08169746398925781 3 0.9765399930364427 8.04165764188325 4059.0 13.222417423674194 0.0 - - - - - - - 286.8181818181818 8 11 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1371 174 C20140704_OR005_03 C20140704_OR005_03 TB450834.[MT7]-DTVGIWGEGK[MT7].2b4_1.heavy 675.369 / 517.274 5186.0 32.0162665049235 39 17 10 2 10 2.4738069543627086 32.1748744004595 0.08169746398925781 3 0.9765399930364427 8.04165764188325 5186.0 29.026268144863266 0.0 - - - - - - - 313.1111111111111 10 9 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1373 174 C20140704_OR005_03 C20140704_OR005_03 TB450834.[MT7]-DTVGIWGEGK[MT7].2y7_1.heavy 675.369 / 890.485 4284.0 32.0162665049235 39 17 10 2 10 2.4738069543627086 32.1748744004595 0.08169746398925781 3 0.9765399930364427 8.04165764188325 4284.0 17.36414201183432 1.0 - - - - - - - 338.1666666666667 8 6 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1375 175 C20140704_OR005_03 C20140704_OR005_03 TB450930.[MT7]-VYGALMWSLGK[MT7].3b6_1.heavy 504.954 / 779.424 1989.0 43.8578987121582 43 13 10 10 10 1.3157688552807196 50.6674606250984 0.0 3 0.9288296662510035 4.598358694103354 1989.0 20.73145851128737 0.0 - - - - - - - 248.5 3 4 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 1377 175 C20140704_OR005_03 C20140704_OR005_03 TB450930.[MT7]-VYGALMWSLGK[MT7].3b4_1.heavy 504.954 / 535.3 8751.0 43.8578987121582 43 13 10 10 10 1.3157688552807196 50.6674606250984 0.0 3 0.9288296662510035 4.598358694103354 8751.0 29.580845070422534 0.0 - - - - - - - 265.0 17 9 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 1379 175 C20140704_OR005_03 C20140704_OR005_03 TB450930.[MT7]-VYGALMWSLGK[MT7].3b5_1.heavy 504.954 / 648.384 9646.0 43.8578987121582 43 13 10 10 10 1.3157688552807196 50.6674606250984 0.0 3 0.9288296662510035 4.598358694103354 9646.0 60.853959731543625 0.0 - - - - - - - 227.14285714285714 19 7 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 1381 175 C20140704_OR005_03 C20140704_OR005_03 TB450930.[MT7]-VYGALMWSLGK[MT7].3y4_1.heavy 504.954 / 548.352 9845.0 43.8578987121582 43 13 10 10 10 1.3157688552807196 50.6674606250984 0.0 3 0.9288296662510035 4.598358694103354 9845.0 91.52386934673368 0.0 - - - - - - - 198.75 19 4 EHD1;EHD4;EHD3 EH-domain containing 1;EH-domain containing 4;EH-domain containing 3 1383 176 C20140704_OR005_03 C20140704_OR005_03 TB427383.[MT7]-ERAGGADAVQTVTGGLR.4b8_1.heavy 451.246 / 872.434 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD4 EH-domain containing 4 1385 176 C20140704_OR005_03 C20140704_OR005_03 TB427383.[MT7]-ERAGGADAVQTVTGGLR.4y5_1.heavy 451.246 / 503.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD4 EH-domain containing 4 1387 176 C20140704_OR005_03 C20140704_OR005_03 TB427383.[MT7]-ERAGGADAVQTVTGGLR.4b7_1.heavy 451.246 / 801.397 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD4 EH-domain containing 4 1389 176 C20140704_OR005_03 C20140704_OR005_03 TB427383.[MT7]-ERAGGADAVQTVTGGLR.4b9_2.heavy 451.246 / 486.255 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD4 EH-domain containing 4 1391 177 C20140704_OR005_03 C20140704_OR005_03 TB427384.[MT7]-FIAMGYVDDTQFVR.2y5_1.heavy 903.454 / 650.362 1500.0 42.31159973144531 27 14 2 5 6 1.901214164427898 41.985664495195735 0.04119873046875 5 0.9395353530203278 4.99342636991104 1500.0 11.170212765957448 0.0 - - - - - - - 164.375 3 8 HLA-G major histocompatibility complex, class I, G 1393 177 C20140704_OR005_03 C20140704_OR005_03 TB427384.[MT7]-FIAMGYVDDTQFVR.2y6_1.heavy 903.454 / 765.389 1500.0 42.31159973144531 27 14 2 5 6 1.901214164427898 41.985664495195735 0.04119873046875 5 0.9395353530203278 4.99342636991104 1500.0 3.1982942430703623 2.0 - - - - - - - 226.75 10 12 HLA-G major histocompatibility complex, class I, G 1395 177 C20140704_OR005_03 C20140704_OR005_03 TB427384.[MT7]-FIAMGYVDDTQFVR.2y10_1.heavy 903.454 / 1199.57 2157.0 42.31159973144531 27 14 2 5 6 1.901214164427898 41.985664495195735 0.04119873046875 5 0.9395353530203278 4.99342636991104 2157.0 6.529972012558371 0.0 - - - - - - - 243.93333333333334 4 15 HLA-G major histocompatibility complex, class I, G 1397 177 C20140704_OR005_03 C20140704_OR005_03 TB427384.[MT7]-FIAMGYVDDTQFVR.2y7_1.heavy 903.454 / 880.416 1500.0 42.31159973144531 27 14 2 5 6 1.901214164427898 41.985664495195735 0.04119873046875 5 0.9395353530203278 4.99342636991104 1500.0 7.99008101764216 0.0 - - - - - - - 206.5 3 10 HLA-G major histocompatibility complex, class I, G 1399 178 C20140704_OR005_03 C20140704_OR005_03 TB412708.[MT7]-AAVTSLWSK[MT7].3b6_1.heavy 417.583 / 687.416 1215.0 33.90999984741211 48 18 10 10 10 5.968613566898648 16.754309669935793 0.0 3 0.9819075357914726 9.161288035063452 1215.0 1.7249999999999999 3.0 - - - - - - - 0.0 2 0 HBE1 hemoglobin, epsilon 1 1401 178 C20140704_OR005_03 C20140704_OR005_03 TB412708.[MT7]-AAVTSLWSK[MT7].3y3_1.heavy 417.583 / 564.326 12417.0 33.90999984741211 48 18 10 10 10 5.968613566898648 16.754309669935793 0.0 3 0.9819075357914726 9.161288035063452 12417.0 51.35425925925926 0.0 - - - - - - - 540.0 24 2 HBE1 hemoglobin, epsilon 1 1403 178 C20140704_OR005_03 C20140704_OR005_03 TB412708.[MT7]-AAVTSLWSK[MT7].3b4_1.heavy 417.583 / 487.3 4184.0 33.90999984741211 48 18 10 10 10 5.968613566898648 16.754309669935793 0.0 3 0.9819075357914726 9.161288035063452 4184.0 15.0313787052472 3.0 - - - - - - - 270.0 10 5 HBE1 hemoglobin, epsilon 1 1405 178 C20140704_OR005_03 C20140704_OR005_03 TB412708.[MT7]-AAVTSLWSK[MT7].3b5_1.heavy 417.583 / 574.332 8503.0 33.90999984741211 48 18 10 10 10 5.968613566898648 16.754309669935793 0.0 3 0.9819075357914726 9.161288035063452 8503.0 50.49312345679012 0.0 - - - - - - - 297.0 17 5 HBE1 hemoglobin, epsilon 1 1407 179 C20140704_OR005_03 C20140704_OR005_03 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 111604.0 40.386034647623696 23 -3 10 6 10 null 0.0 0.03620147705078125 3 0.0 0.0 111604.0 442.90038976722013 0.0 - - - - - - - 255.75 223 4 1409 179 C20140704_OR005_03 C20140704_OR005_03 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 189215.0 40.386034647623696 23 -3 10 6 10 null 0.0 0.03620147705078125 3 0.0 0.0 189215.0 912.3803704951163 0.0 - - - - - - - 731.4285714285714 378 7 1411 179 C20140704_OR005_03 C20140704_OR005_03 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 234778.0 40.386034647623696 23 -3 10 6 10 null 0.0 0.03620147705078125 3 0.0 0.0 234778.0 420.58403932658007 0.0 - - - - - - - 410.0 469 1 1413 180 C20140704_OR005_03 C20140704_OR005_03 TB451116.[MT7]-LLGNVMVIILATHFGK[MT7].3b6_1.heavy 672.076 / 772.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBE1 hemoglobin, epsilon 1 1415 180 C20140704_OR005_03 C20140704_OR005_03 TB451116.[MT7]-LLGNVMVIILATHFGK[MT7].3b4_1.heavy 672.076 / 542.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBE1 hemoglobin, epsilon 1 1417 180 C20140704_OR005_03 C20140704_OR005_03 TB451116.[MT7]-LLGNVMVIILATHFGK[MT7].3y4_1.heavy 672.076 / 632.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBE1 hemoglobin, epsilon 1 1419 180 C20140704_OR005_03 C20140704_OR005_03 TB451116.[MT7]-LLGNVMVIILATHFGK[MT7].3b7_1.heavy 672.076 / 871.519 N/A N/A - - - - - - - - - 0.0 - - - - - - - HBE1 hemoglobin, epsilon 1 1421 181 C20140704_OR005_03 C20140704_OR005_03 TB426905.[MT7]-VVFDSAQR.2y5_1.heavy 533.294 / 576.274 5490.0 26.342575550079346 44 18 10 6 10 5.312465592145811 18.82365132827298 0.03970146179199219 3 0.9899657531155932 12.309946266001738 5490.0 62.177320367278796 0.0 - - - - - - - 242.57142857142858 10 7 APEH N-acylaminoacyl-peptide hydrolase 1423 181 C20140704_OR005_03 C20140704_OR005_03 TB426905.[MT7]-VVFDSAQR.2b4_1.heavy 533.294 / 605.341 9183.0 26.342575550079346 44 18 10 6 10 5.312465592145811 18.82365132827298 0.03970146179199219 3 0.9899657531155932 12.309946266001738 9183.0 118.4607 0.0 - - - - - - - 199.6153846153846 18 13 APEH N-acylaminoacyl-peptide hydrolase 1425 181 C20140704_OR005_03 C20140704_OR005_03 TB426905.[MT7]-VVFDSAQR.2y6_1.heavy 533.294 / 723.342 12777.0 26.342575550079346 44 18 10 6 10 5.312465592145811 18.82365132827298 0.03970146179199219 3 0.9899657531155932 12.309946266001738 12777.0 53.25851725499251 0.0 - - - - - - - 263.0 25 11 APEH N-acylaminoacyl-peptide hydrolase 1427 181 C20140704_OR005_03 C20140704_OR005_03 TB426905.[MT7]-VVFDSAQR.2y7_1.heavy 533.294 / 822.41 19364.0 26.342575550079346 44 18 10 6 10 5.312465592145811 18.82365132827298 0.03970146179199219 3 0.9899657531155932 12.309946266001738 19364.0 148.65593846153845 0.0 - - - - - - - 288.3333333333333 38 9 APEH N-acylaminoacyl-peptide hydrolase 1429 182 C20140704_OR005_03 C20140704_OR005_03 TB427182.[MT7]-DK[MT7]VPFSVPK[MT7].3b6_2.heavy 483.633 / 481.781 21571.0 29.130699157714844 43 13 10 10 10 0.9695994288877798 67.6016455997908 0.0 3 0.9092258317446205 4.064806923611932 21571.0 214.78647094801224 0.0 - - - - - - - 196.2 43 5 IFI35 interferon-induced protein 35 1431 182 C20140704_OR005_03 C20140704_OR005_03 TB427182.[MT7]-DK[MT7]VPFSVPK[MT7].3y3_1.heavy 483.633 / 487.336 8280.0 29.130699157714844 43 13 10 10 10 0.9695994288877798 67.6016455997908 0.0 3 0.9092258317446205 4.064806923611932 8280.0 34.74824988502421 1.0 - - - - - - - 204.375 16 8 IFI35 interferon-induced protein 35 1433 182 C20140704_OR005_03 C20140704_OR005_03 TB427182.[MT7]-DK[MT7]VPFSVPK[MT7].3b3_2.heavy 483.633 / 316.204 34317.0 29.130699157714844 43 13 10 10 10 0.9695994288877798 67.6016455997908 0.0 3 0.9092258317446205 4.064806923611932 34317.0 224.5822018348624 0.0 - - - - - - - 218.0 68 10 IFI35 interferon-induced protein 35 1435 182 C20140704_OR005_03 C20140704_OR005_03 TB427182.[MT7]-DK[MT7]VPFSVPK[MT7].3b3_1.heavy 483.633 / 631.402 12310.0 29.130699157714844 43 13 10 10 10 0.9695994288877798 67.6016455997908 0.0 3 0.9092258317446205 4.064806923611932 12310.0 66.4062385321101 0.0 - - - - - - - 242.22222222222223 24 9 IFI35 interferon-induced protein 35 1437 183 C20140704_OR005_03 C20140704_OR005_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 147175.0 35.422298431396484 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 147175.0 499.4825820652021 0.0 - - - - - - - 413.8 294 5 1439 183 C20140704_OR005_03 C20140704_OR005_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 34207.0 35.422298431396484 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 34207.0 110.1183218878638 1.0 - - - - - - - 330.42857142857144 91 7 1441 183 C20140704_OR005_03 C20140704_OR005_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 31894.0 35.422298431396484 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 31894.0 121.98362739726028 0.0 - - - - - - - 267.6 63 10 1443 184 C20140704_OR005_03 C20140704_OR005_03 TB427043.[MT7]-SSVAVNNC[CAM]IR.3b4_1.heavy 421.891 / 489.279 189128.0 23.556034088134766 43 17 10 6 10 2.843042863888239 35.17358154186839 0.03800010681152344 3 0.9784422795506266 8.390303097711184 189128.0 493.5286192474763 0.0 - - - - - - - 186.93333333333334 378 15 APBB1;APBB2 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);amyloid beta (A4) precursor protein-binding, family B, member 2 1445 184 C20140704_OR005_03 C20140704_OR005_03 TB427043.[MT7]-SSVAVNNC[CAM]IR.3b3_1.heavy 421.891 / 418.242 233871.0 23.556034088134766 43 17 10 6 10 2.843042863888239 35.17358154186839 0.03800010681152344 3 0.9784422795506266 8.390303097711184 233871.0 655.4985707971178 0.0 - - - - - - - 246.9090909090909 467 11 APBB1;APBB2 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);amyloid beta (A4) precursor protein-binding, family B, member 2 1447 184 C20140704_OR005_03 C20140704_OR005_03 TB427043.[MT7]-SSVAVNNC[CAM]IR.3y4_1.heavy 421.891 / 562.277 8231.0 23.556034088134766 43 17 10 6 10 2.843042863888239 35.17358154186839 0.03800010681152344 3 0.9784422795506266 8.390303097711184 8231.0 29.418783269961974 1.0 - - - - - - - 197.16666666666666 16 12 APBB1;APBB2 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);amyloid beta (A4) precursor protein-binding, family B, member 2 1449 184 C20140704_OR005_03 C20140704_OR005_03 TB427043.[MT7]-SSVAVNNC[CAM]IR.3y5_1.heavy 421.891 / 676.32 N/A 23.556034088134766 43 17 10 6 10 2.843042863888239 35.17358154186839 0.03800010681152344 3 0.9784422795506266 8.390303097711184 0.0 0.0 24.0 - - - - - - - 175.33333333333334 8 9 APBB1;APBB2 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);amyloid beta (A4) precursor protein-binding, family B, member 2 1451 185 C20140704_OR005_03 C20140704_OR005_03 TB427666.[MT7]-VLQPPPEQENVQYAGLDFEAILLQPGSPPDK[MT7].3y7_1.heavy 1226.65 / 841.454 3765.0 48.709699630737305 44 18 10 6 10 3.159677633615868 31.64879826223352 0.031398773193359375 3 0.9843882136171561 9.864371871937111 3765.0 4.8896103896103895 1.0 - - - - - - - 261.27272727272725 7 11 APEH N-acylaminoacyl-peptide hydrolase 1453 185 C20140704_OR005_03 C20140704_OR005_03 TB427666.[MT7]-VLQPPPEQENVQYAGLDFEAILLQPGSPPDK[MT7].3y3_1.heavy 1226.65 / 503.295 1506.0 48.709699630737305 44 18 10 6 10 3.159677633615868 31.64879826223352 0.031398773193359375 3 0.9843882136171561 9.864371871937111 1506.0 0.0 1.0 - - - - - - - 171.0 3 14 APEH N-acylaminoacyl-peptide hydrolase 1455 185 C20140704_OR005_03 C20140704_OR005_03 TB427666.[MT7]-VLQPPPEQENVQYAGLDFEAILLQPGSPPDK[MT7].3y7_2.heavy 1226.65 / 421.23 1164.0 48.709699630737305 44 18 10 6 10 3.159677633615868 31.64879826223352 0.031398773193359375 3 0.9843882136171561 9.864371871937111 1164.0 5.790228235713014 0.0 - - - - - - - 188.0625 2 16 APEH N-acylaminoacyl-peptide hydrolase 1457 185 C20140704_OR005_03 C20140704_OR005_03 TB427666.[MT7]-VLQPPPEQENVQYAGLDFEAILLQPGSPPDK[MT7].3y5_1.heavy 1226.65 / 687.379 821.0 48.709699630737305 44 18 10 6 10 3.159677633615868 31.64879826223352 0.031398773193359375 3 0.9843882136171561 9.864371871937111 821.0 0.0 1.0 - - - - - - - 0.0 1 0 APEH N-acylaminoacyl-peptide hydrolase 1459 186 C20140704_OR005_03 C20140704_OR005_03 TB427665.[MT7]-VLQPPPEQENVQYAGLDFEAILLQPGSPPDK[MT7].4b11_2.heavy 920.238 / 688.37 4236.0 48.67824935913086 40 14 10 6 10 1.3809252174956657 46.72861595624333 0.03150177001953125 3 0.9492625881912674 5.455626666098963 4236.0 6.043418490875977 1.0 - - - - - - - 243.4375 8 16 APEH N-acylaminoacyl-peptide hydrolase 1461 186 C20140704_OR005_03 C20140704_OR005_03 TB427665.[MT7]-VLQPPPEQENVQYAGLDFEAILLQPGSPPDK[MT7].4y7_1.heavy 920.238 / 841.454 17902.0 48.67824935913086 40 14 10 6 10 1.3809252174956657 46.72861595624333 0.03150177001953125 3 0.9492625881912674 5.455626666098963 17902.0 17.49380817973065 0.0 - - - - - - - 698.5555555555555 35 9 APEH N-acylaminoacyl-peptide hydrolase 1463 186 C20140704_OR005_03 C20140704_OR005_03 TB427665.[MT7]-VLQPPPEQENVQYAGLDFEAILLQPGSPPDK[MT7].4y7_2.heavy 920.238 / 421.23 6150.0 48.67824935913086 40 14 10 6 10 1.3809252174956657 46.72861595624333 0.03150177001953125 3 0.9492625881912674 5.455626666098963 6150.0 4.049012435991221 1.0 - - - - - - - 247.625 12 16 APEH N-acylaminoacyl-peptide hydrolase 1465 186 C20140704_OR005_03 C20140704_OR005_03 TB427665.[MT7]-VLQPPPEQENVQYAGLDFEAILLQPGSPPDK[MT7].4y3_1.heavy 920.238 / 503.295 5603.0 48.67824935913086 40 14 10 6 10 1.3809252174956657 46.72861595624333 0.03150177001953125 3 0.9492625881912674 5.455626666098963 5603.0 18.71481038792911 0.0 - - - - - - - 189.15384615384616 11 13 APEH N-acylaminoacyl-peptide hydrolase 1467 187 C20140704_OR005_03 C20140704_OR005_03 TB450843.[MT7]-DYLALNEDLR.2y8_1.heavy 683.36 / 943.521 23614.0 36.205101013183594 50 20 10 10 10 15.972850592708348 6.260623263179478 0.0 3 0.9934318612366126 15.2195991558843 23614.0 106.39274725274724 0.0 - - - - - - - 285.09090909090907 47 11 HLA-G major histocompatibility complex, class I, G 1469 187 C20140704_OR005_03 C20140704_OR005_03 TB450843.[MT7]-DYLALNEDLR.2y9_1.heavy 683.36 / 1106.58 28119.0 36.205101013183594 50 20 10 10 10 15.972850592708348 6.260623263179478 0.0 3 0.9934318612366126 15.2195991558843 28119.0 70.33524429967426 0.0 - - - - - - - 245.3 56 10 HLA-G major histocompatibility complex, class I, G 1471 187 C20140704_OR005_03 C20140704_OR005_03 TB450843.[MT7]-DYLALNEDLR.2b4_1.heavy 683.36 / 607.321 32896.0 36.205101013183594 50 20 10 10 10 15.972850592708348 6.260623263179478 0.0 3 0.9934318612366126 15.2195991558843 32896.0 187.2700631397942 0.0 - - - - - - - 227.16666666666666 65 6 HLA-G major histocompatibility complex, class I, G 1473 187 C20140704_OR005_03 C20140704_OR005_03 TB450843.[MT7]-DYLALNEDLR.2y6_1.heavy 683.36 / 759.399 12831.0 36.205101013183594 50 20 10 10 10 15.972850592708348 6.260623263179478 0.0 3 0.9934318612366126 15.2195991558843 12831.0 107.2360294117647 0.0 - - - - - - - 272.75 25 4 HLA-G major histocompatibility complex, class I, G 1475 188 C20140704_OR005_03 C20140704_OR005_03 TB450844.[MT7]-QFLEVWEK[MT7].2y4_1.heavy 683.884 / 705.405 8911.0 39.141249656677246 44 18 10 6 10 3.3059185024701017 30.248779552575918 0.036998748779296875 3 0.9812068592384042 8.988354329539643 8911.0 25.19276717557252 0.0 - - - - - - - 196.5 17 6 APEH N-acylaminoacyl-peptide hydrolase 1477 188 C20140704_OR005_03 C20140704_OR005_03 TB450844.[MT7]-QFLEVWEK[MT7].2b4_1.heavy 683.884 / 662.363 12974.0 39.141249656677246 44 18 10 6 10 3.3059185024701017 30.248779552575918 0.036998748779296875 3 0.9812068592384042 8.988354329539643 12974.0 46.382875318066155 0.0 - - - - - - - 262.0 25 11 APEH N-acylaminoacyl-peptide hydrolase 1479 188 C20140704_OR005_03 C20140704_OR005_03 TB450844.[MT7]-QFLEVWEK[MT7].2y3_1.heavy 683.884 / 606.337 13236.0 39.141249656677246 44 18 10 6 10 3.3059185024701017 30.248779552575918 0.036998748779296875 3 0.9812068592384042 8.988354329539643 13236.0 34.62802544529262 0.0 - - - - - - - 262.0 26 5 APEH N-acylaminoacyl-peptide hydrolase 1481 188 C20140704_OR005_03 C20140704_OR005_03 TB450844.[MT7]-QFLEVWEK[MT7].2y7_1.heavy 683.884 / 1094.6 12056.0 39.141249656677246 44 18 10 6 10 3.3059185024701017 30.248779552575918 0.036998748779296875 3 0.9812068592384042 8.988354329539643 12056.0 28.184351145038164 0.0 - - - - - - - 283.8333333333333 24 6 APEH N-acylaminoacyl-peptide hydrolase 1483 189 C20140704_OR005_03 C20140704_OR005_03 TB427476.[MT7]-LSHSDTFIPLLTEEK[MT7].4y4_1.heavy 505.282 / 650.348 4634.0 39.456600189208984 39 13 10 6 10 1.1151592798729486 59.21803927849167 0.037200927734375 3 0.9030383461415346 3.9308738041021436 4634.0 39.178363636363635 1.0 - - - - - - - 193.0 9 12 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1485 189 C20140704_OR005_03 C20140704_OR005_03 TB427476.[MT7]-LSHSDTFIPLLTEEK[MT7].4b7_1.heavy 505.282 / 932.459 1545.0 39.456600189208984 39 13 10 6 10 1.1151592798729486 59.21803927849167 0.037200927734375 3 0.9030383461415346 3.9308738041021436 1545.0 2.753251017995534 0.0 - - - - - - - 189.0 3 7 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1487 189 C20140704_OR005_03 C20140704_OR005_03 TB427476.[MT7]-LSHSDTFIPLLTEEK[MT7].4b5_1.heavy 505.282 / 684.343 1214.0 39.456600189208984 39 13 10 6 10 1.1151592798729486 59.21803927849167 0.037200927734375 3 0.9030383461415346 3.9308738041021436 1214.0 -0.5 1.0 - - - - - - - 232.77777777777777 2 9 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1489 189 C20140704_OR005_03 C20140704_OR005_03 TB427476.[MT7]-LSHSDTFIPLLTEEK[MT7].4y3_1.heavy 505.282 / 549.3 4082.0 39.456600189208984 39 13 10 6 10 1.1151592798729486 59.21803927849167 0.037200927734375 3 0.9030383461415346 3.9308738041021436 4082.0 17.688220054861322 0.0 - - - - - - - 208.33333333333334 8 9 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1491 190 C20140704_OR005_03 C20140704_OR005_03 TB427393.[MT7]-EPVQNEISATYIRR.3y7_1.heavy 607.331 / 866.484 2952.0 29.05030059814453 44 14 10 10 10 2.30111219192766 36.787980360277345 0.0 3 0.9490535774886925 5.444327515974328 2952.0 5.471760062419439 1.0 - - - - - - - 140.16666666666666 8 6 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1493 190 C20140704_OR005_03 C20140704_OR005_03 TB427393.[MT7]-EPVQNEISATYIRR.3b6_1.heavy 607.331 / 841.417 6327.0 29.05030059814453 44 14 10 10 10 2.30111219192766 36.787980360277345 0.0 3 0.9490535774886925 5.444327515974328 6327.0 53.07483412322276 0.0 - - - - - - - 163.77777777777777 12 9 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1495 190 C20140704_OR005_03 C20140704_OR005_03 TB427393.[MT7]-EPVQNEISATYIRR.3b4_1.heavy 607.331 / 598.332 5799.0 29.05030059814453 44 14 10 10 10 2.30111219192766 36.787980360277345 0.0 3 0.9490535774886925 5.444327515974328 5799.0 5.519885944990457 1.0 - - - - - - - 769.9 11 10 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1497 190 C20140704_OR005_03 C20140704_OR005_03 TB427393.[MT7]-EPVQNEISATYIRR.3y13_2.heavy 607.331 / 773.92 55359.0 29.05030059814453 44 14 10 10 10 2.30111219192766 36.787980360277345 0.0 3 0.9490535774886925 5.444327515974328 55359.0 375.18184834123224 0.0 - - - - - - - 218.76923076923077 110 13 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1499 191 C20140704_OR005_03 C20140704_OR005_03 TB450940.[MT7]-TPLLLMLGQEDR.2y8_1.heavy 765.428 / 961.477 13189.0 45.896751403808594 39 16 10 5 8 1.8141552367941305 43.79617391922466 0.0410003662109375 4 0.965256867556892 6.601800576513244 13189.0 55.074945054945054 0.0 - - - - - - - 282.1 26 10 APEH N-acylaminoacyl-peptide hydrolase 1501 191 C20140704_OR005_03 C20140704_OR005_03 TB450940.[MT7]-TPLLLMLGQEDR.2b4_1.heavy 765.428 / 569.378 8823.0 45.896751403808594 39 16 10 5 8 1.8141552367941305 43.79617391922466 0.0410003662109375 4 0.965256867556892 6.601800576513244 8823.0 46.522741758241764 0.0 - - - - - - - 286.0 17 7 APEH N-acylaminoacyl-peptide hydrolase 1503 191 C20140704_OR005_03 C20140704_OR005_03 TB450940.[MT7]-TPLLLMLGQEDR.2y9_1.heavy 765.428 / 1074.56 7186.0 45.896751403808594 39 16 10 5 8 1.8141552367941305 43.79617391922466 0.0410003662109375 4 0.965256867556892 6.601800576513244 7186.0 1.7084963901028207 1.0 - - - - - - - 257.8333333333333 16 12 APEH N-acylaminoacyl-peptide hydrolase 1505 191 C20140704_OR005_03 C20140704_OR005_03 TB450940.[MT7]-TPLLLMLGQEDR.2y7_1.heavy 765.428 / 848.393 6822.0 45.896751403808594 39 16 10 5 8 1.8141552367941305 43.79617391922466 0.0410003662109375 4 0.965256867556892 6.601800576513244 6822.0 12.057120537837866 1.0 - - - - - - - 151.66666666666666 14 6 APEH N-acylaminoacyl-peptide hydrolase 1507 192 C20140704_OR005_03 C20140704_OR005_03 TB427258.[MT7]-GIIDC[CAM]VVRIPK[MT7].3b4_1.heavy 519.984 / 543.326 28203.0 35.51810073852539 43 13 10 10 10 2.092426929783293 36.95673223888806 0.0 3 0.9184481551670854 4.291892823062193 28203.0 142.62668517970403 0.0 - - - - - - - 229.33333333333334 56 3 SLC25A4;SLC25A5 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 1509 192 C20140704_OR005_03 C20140704_OR005_03 TB427258.[MT7]-GIIDC[CAM]VVRIPK[MT7].3b5_1.heavy 519.984 / 703.357 7567.0 35.51810073852539 43 13 10 10 10 2.092426929783293 36.95673223888806 0.0 3 0.9184481551670854 4.291892823062193 7567.0 34.120290909090905 0.0 - - - - - - - 247.8 15 5 SLC25A4;SLC25A5 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 1511 192 C20140704_OR005_03 C20140704_OR005_03 TB427258.[MT7]-GIIDC[CAM]VVRIPK[MT7].3y7_2.heavy 519.984 / 508.314 44299.0 35.51810073852539 43 13 10 10 10 2.092426929783293 36.95673223888806 0.0 3 0.9184481551670854 4.291892823062193 44299.0 361.6277272918773 0.0 - - - - - - - 275.3333333333333 88 3 SLC25A4;SLC25A5 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 1513 192 C20140704_OR005_03 C20140704_OR005_03 TB427258.[MT7]-GIIDC[CAM]VVRIPK[MT7].3y9_2.heavy 519.984 / 622.369 12932.0 35.51810073852539 43 13 10 10 10 2.092426929783293 36.95673223888806 0.0 3 0.9184481551670854 4.291892823062193 12932.0 75.20542971604667 0.0 - - - - - - - 223.75 25 8 SLC25A4;SLC25A5 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 1515 193 C20140704_OR005_03 C20140704_OR005_03 TB427471.[MT7]-LLGNVMVIILATHFGK[MT7].2b4_1.heavy 1007.61 / 542.342 1596.0 53.94005012512207 43 17 10 6 10 4.201180205233558 23.802835183176978 0.033901214599609375 3 0.9766505471958264 8.060747743375634 1596.0 21.94349547511312 0.0 - - - - - - - 151.8 3 10 HBE1 hemoglobin, epsilon 1 1517 193 C20140704_OR005_03 C20140704_OR005_03 TB427471.[MT7]-LLGNVMVIILATHFGK[MT7].2b6_1.heavy 1007.61 / 772.451 1245.0 53.94005012512207 43 17 10 6 10 4.201180205233558 23.802835183176978 0.033901214599609375 3 0.9766505471958264 8.060747743375634 1245.0 15.515554298642535 0.0 - - - - - - - 122.84615384615384 2 13 HBE1 hemoglobin, epsilon 1 1519 193 C20140704_OR005_03 C20140704_OR005_03 TB427471.[MT7]-LLGNVMVIILATHFGK[MT7].2y10_1.heavy 1007.61 / 1242.77 545.0 53.94005012512207 43 17 10 6 10 4.201180205233558 23.802835183176978 0.033901214599609375 3 0.9766505471958264 8.060747743375634 545.0 4.611538461538462 6.0 - - - - - - - 0.0 1 0 HBE1 hemoglobin, epsilon 1 1521 193 C20140704_OR005_03 C20140704_OR005_03 TB427471.[MT7]-LLGNVMVIILATHFGK[MT7].2b7_1.heavy 1007.61 / 871.519 1596.0 53.94005012512207 43 17 10 6 10 4.201180205233558 23.802835183176978 0.033901214599609375 3 0.9766505471958264 8.060747743375634 1596.0 34.562461538461534 0.0 - - - - - - - 155.76923076923077 3 13 HBE1 hemoglobin, epsilon 1 1523 194 C20140704_OR005_03 C20140704_OR005_03 TB412987.[MT7]-GIIDC[CAM]VVRIPK[MT7].2y8_1.heavy 779.473 / 1130.65 2339.0 35.50612545013428 42 17 10 5 10 2.899848789143366 27.478140396324505 0.047901153564453125 3 0.9705779941247894 7.177209482220763 2339.0 19.845444268774703 0.0 - - - - - - - 206.75 4 4 SLC25A4;SLC25A5 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 1525 194 C20140704_OR005_03 C20140704_OR005_03 TB412987.[MT7]-GIIDC[CAM]VVRIPK[MT7].2y9_1.heavy 779.473 / 1243.73 1513.0 35.50612545013428 42 17 10 5 10 2.899848789143366 27.478140396324505 0.047901153564453125 3 0.9705779941247894 7.177209482220763 1513.0 5.666552854122621 0.0 - - - - - - - 225.36363636363637 3 11 SLC25A4;SLC25A5 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 1527 194 C20140704_OR005_03 C20140704_OR005_03 TB412987.[MT7]-GIIDC[CAM]VVRIPK[MT7].2b4_1.heavy 779.473 / 543.326 3027.0 35.50612545013428 42 17 10 5 10 2.899848789143366 27.478140396324505 0.047901153564453125 3 0.9705779941247894 7.177209482220763 3027.0 30.744588932806323 0.0 - - - - - - - 236.0 6 7 SLC25A4;SLC25A5 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 1529 194 C20140704_OR005_03 C20140704_OR005_03 TB412987.[MT7]-GIIDC[CAM]VVRIPK[MT7].2y7_1.heavy 779.473 / 1015.62 3990.0 35.50612545013428 42 17 10 5 10 2.899848789143366 27.478140396324505 0.047901153564453125 3 0.9705779941247894 7.177209482220763 3990.0 23.68705701078582 0.0 - - - - - - - 275.5 7 2 SLC25A4;SLC25A5 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 1531 195 C20140704_OR005_03 C20140704_OR005_03 TB427195.[MT7]-LFEAEAQDLFR.2b3_1.heavy 741.889 / 534.304 15482.0 43.89580154418945 41 11 10 10 10 3.235324440425949 25.545686644175476 0.0 3 0.8597983441921957 3.2566870435983724 15482.0 57.49467561521253 0.0 - - - - - - - 298.0 30 12 EHD4 EH-domain containing 4 1533 195 C20140704_OR005_03 C20140704_OR005_03 TB427195.[MT7]-LFEAEAQDLFR.2y8_1.heavy 741.889 / 949.474 14498.0 43.89580154418945 41 11 10 10 10 3.235324440425949 25.545686644175476 0.0 3 0.8597983441921957 3.2566870435983724 14498.0 304.6208988764045 0.0 - - - - - - - 127.57142857142857 28 7 EHD4 EH-domain containing 4 1535 195 C20140704_OR005_03 C20140704_OR005_03 TB427195.[MT7]-LFEAEAQDLFR.2y6_1.heavy 741.889 / 749.394 9755.0 43.89580154418945 41 11 10 10 10 3.235324440425949 25.545686644175476 0.0 3 0.8597983441921957 3.2566870435983724 9755.0 82.8987920036688 0.0 - - - - - - - 187.6 19 10 EHD4 EH-domain containing 4 1537 195 C20140704_OR005_03 C20140704_OR005_03 TB427195.[MT7]-LFEAEAQDLFR.2y10_1.heavy 741.889 / 1225.58 7249.0 43.89580154418945 41 11 10 10 10 3.235324440425949 25.545686644175476 0.0 3 0.8597983441921957 3.2566870435983724 7249.0 39.32913428666722 0.0 - - - - - - - 216.0 14 12 EHD4 EH-domain containing 4 1539 196 C20140704_OR005_03 C20140704_OR005_03 TB450648.[MT7]-VPFSVPK[MT7].2y6_1.heavy 531.333 / 818.489 13937.0 32.689674377441406 34 20 10 2 2 4.887891108571732 20.458720904120252 0.0868988037109375 15 0.9923837519513463 14.132396154502615 13937.0 49.737663837347014 0.0 - - - - - - - 277.6666666666667 27 9 IFI35 interferon-induced protein 35 1541 196 C20140704_OR005_03 C20140704_OR005_03 TB450648.[MT7]-VPFSVPK[MT7].2y4_1.heavy 531.333 / 574.368 3812.0 32.689674377441406 34 20 10 2 2 4.887891108571732 20.458720904120252 0.0868988037109375 15 0.9923837519513463 14.132396154502615 3812.0 5.142015725567965 1.0 - - - - - - - 738.8 7 10 IFI35 interferon-induced protein 35 1543 196 C20140704_OR005_03 C20140704_OR005_03 TB450648.[MT7]-VPFSVPK[MT7].2y5_1.heavy 531.333 / 721.437 715.0 32.689674377441406 34 20 10 2 2 4.887891108571732 20.458720904120252 0.0868988037109375 15 0.9923837519513463 14.132396154502615 715.0 1.962442407693556 6.0 - - - - - - - 285.6 4 15 IFI35 interferon-induced protein 35 1545 196 C20140704_OR005_03 C20140704_OR005_03 TB450648.[MT7]-VPFSVPK[MT7].2y3_1.heavy 531.333 / 487.336 1787.0 32.689674377441406 34 20 10 2 2 4.887891108571732 20.458720904120252 0.0868988037109375 15 0.9923837519513463 14.132396154502615 1787.0 0.9375655823714586 21.0 - - - - - - - 333.2 10 10 IFI35 interferon-induced protein 35 1547 197 C20140704_OR005_03 C20140704_OR005_03 TB427194.[MT7]-GYEQYAYDGK[MT7].2y4_1.heavy 741.361 / 626.327 2575.0 26.392200469970703 44 16 10 10 8 17.330032692966448 5.770329564385987 0.0 4 0.9648993099012046 6.567891218819955 2575.0 31.96525579683474 1.0 - - - - - - - 254.33333333333334 7 9 HLA-G major histocompatibility complex, class I, G 1549 197 C20140704_OR005_03 C20140704_OR005_03 TB427194.[MT7]-GYEQYAYDGK[MT7].2y5_1.heavy 741.361 / 697.364 2480.0 26.392200469970703 44 16 10 10 8 17.330032692966448 5.770329564385987 0.0 4 0.9648993099012046 6.567891218819955 2480.0 11.793006993006992 0.0 - - - - - - - 254.33333333333334 4 15 HLA-G major histocompatibility complex, class I, G 1551 197 C20140704_OR005_03 C20140704_OR005_03 TB427194.[MT7]-GYEQYAYDGK[MT7].2b4_1.heavy 741.361 / 622.295 2385.0 26.392200469970703 44 16 10 10 8 17.330032692966448 5.770329564385987 0.0 4 0.9648993099012046 6.567891218819955 2385.0 29.90791755612808 0.0 - - - - - - - 190.66666666666666 4 6 HLA-G major histocompatibility complex, class I, G 1553 197 C20140704_OR005_03 C20140704_OR005_03 TB427194.[MT7]-GYEQYAYDGK[MT7].2b5_1.heavy 741.361 / 785.359 3339.0 26.392200469970703 44 16 10 10 8 17.330032692966448 5.770329564385987 0.0 4 0.9648993099012046 6.567891218819955 3339.0 67.48294736842107 0.0 - - - - - - - 214.5 6 4 HLA-G major histocompatibility complex, class I, G 1555 198 C20140704_OR005_03 C20140704_OR005_03 TB451106.[MT7]-RVQLILDDLGVDAAEGR.2b8_1.heavy 992.551 / 1097.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNF1 potassium voltage-gated channel, subfamily F, member 1 1557 198 C20140704_OR005_03 C20140704_OR005_03 TB451106.[MT7]-RVQLILDDLGVDAAEGR.2y5_1.heavy 992.551 / 503.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNF1 potassium voltage-gated channel, subfamily F, member 1 1559 198 C20140704_OR005_03 C20140704_OR005_03 TB451106.[MT7]-RVQLILDDLGVDAAEGR.2y9_1.heavy 992.551 / 887.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNF1 potassium voltage-gated channel, subfamily F, member 1 1561 198 C20140704_OR005_03 C20140704_OR005_03 TB451106.[MT7]-RVQLILDDLGVDAAEGR.2y10_1.heavy 992.551 / 1002.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNF1 potassium voltage-gated channel, subfamily F, member 1 1563 199 C20140704_OR005_03 C20140704_OR005_03 TB427199.[MT7]-LWDLQQLRK[MT7].2b3_1.heavy 744.45 / 559.3 1650.0 35.90789985656738 22 9 2 5 6 0.7640237239967917 75.01179507647296 0.046001434326171875 5 0.802897517423584 2.732814818220391 1650.0 14.925244490114094 3.0 - - - - - - - 251.66666666666666 7 6 IFI35 interferon-induced protein 35 1565 199 C20140704_OR005_03 C20140704_OR005_03 TB427199.[MT7]-LWDLQQLRK[MT7].2y8_1.heavy 744.45 / 1230.71 550.0 35.90789985656738 22 9 2 5 6 0.7640237239967917 75.01179507647296 0.046001434326171875 5 0.802897517423584 2.732814818220391 550.0 4.414655914321232 4.0 - - - - - - - 0.0 1 0 IFI35 interferon-induced protein 35 1567 199 C20140704_OR005_03 C20140704_OR005_03 TB427199.[MT7]-LWDLQQLRK[MT7].2y6_1.heavy 744.45 / 929.601 825.0 35.90789985656738 22 9 2 5 6 0.7640237239967917 75.01179507647296 0.046001434326171875 5 0.802897517423584 2.732814818220391 825.0 3.327305825242718 1.0 - - - - - - - 0.0 1 0 IFI35 interferon-induced protein 35 1569 199 C20140704_OR005_03 C20140704_OR005_03 TB427199.[MT7]-LWDLQQLRK[MT7].2y7_1.heavy 744.45 / 1044.63 1925.0 35.90789985656738 22 9 2 5 6 0.7640237239967917 75.01179507647296 0.046001434326171875 5 0.802897517423584 2.732814818220391 1925.0 9.66 2.0 - - - - - - - 333.57142857142856 5 7 IFI35 interferon-induced protein 35 1571 200 C20140704_OR005_03 C20140704_OR005_03 TB427057.[MT7]-GIC[CAM]PIC[CAM]FK[MT7].2y4_1.heavy 641.848 / 711.398 1786.0 34.37770080566406 37 11 10 10 6 0.6542224228265759 83.50290540807426 0.0 6 0.8625753336952351 3.2902294304175093 1786.0 15.039212281199063 1.0 - - - - - - - 205.83333333333334 3 6 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1573 200 C20140704_OR005_03 C20140704_OR005_03 TB427057.[MT7]-GIC[CAM]PIC[CAM]FK[MT7].2y5_1.heavy 641.848 / 808.451 16209.0 34.37770080566406 37 11 10 10 6 0.6542224228265759 83.50290540807426 0.0 6 0.8625753336952351 3.2902294304175093 16209.0 77.22922508932116 0.0 - - - - - - - 198.22222222222223 32 9 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1575 200 C20140704_OR005_03 C20140704_OR005_03 TB427057.[MT7]-GIC[CAM]PIC[CAM]FK[MT7].2y3_1.heavy 641.848 / 598.314 3159.0 34.37770080566406 37 11 10 10 6 0.6542224228265759 83.50290540807426 0.0 6 0.8625753336952351 3.2902294304175093 3159.0 -0.32064679608686797 5.0 - - - - - - - 274.6666666666667 10 6 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1577 200 C20140704_OR005_03 C20140704_OR005_03 TB427057.[MT7]-GIC[CAM]PIC[CAM]FK[MT7].2y6_1.heavy 641.848 / 968.481 8517.0 34.37770080566406 37 11 10 10 6 0.6542224228265759 83.50290540807426 0.0 6 0.8625753336952351 3.2902294304175093 8517.0 49.37078631950574 0.0 - - - - - - - 274.6 17 5 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1579 201 C20140704_OR005_03 C20140704_OR005_03 TB427674.[MT7]-FHVQYLGMLPVDK[MT7]PVGMDILNSAIENLMTSSNK[MT7].4y5_1.heavy 1024.29 / 680.37 2197.0 52.97879886627197 39 13 10 6 10 1.646362527898619 48.02175903963165 0.035602569580078125 3 0.9100353009331285 4.083337706748809 2197.0 -0.9218181818181819 0.0 - - - - - - - 198.0 4 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1581 201 C20140704_OR005_03 C20140704_OR005_03 TB427674.[MT7]-FHVQYLGMLPVDK[MT7]PVGMDILNSAIENLMTSSNK[MT7].4b4_1.heavy 1024.29 / 656.364 1242.0 52.97879886627197 39 13 10 6 10 1.646362527898619 48.02175903963165 0.035602569580078125 3 0.9100353009331285 4.083337706748809 1242.0 -1.2937499999999993 0.0 - - - - - - - 131.625 2 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1583 201 C20140704_OR005_03 C20140704_OR005_03 TB427674.[MT7]-FHVQYLGMLPVDK[MT7]PVGMDILNSAIENLMTSSNK[MT7].4b5_1.heavy 1024.29 / 819.427 812.0 52.97879886627197 39 13 10 6 10 1.646362527898619 48.02175903963165 0.035602569580078125 3 0.9100353009331285 4.083337706748809 812.0 -1.0150000000000006 0.0 - - - - - - - 0.0 1 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1585 201 C20140704_OR005_03 C20140704_OR005_03 TB427674.[MT7]-FHVQYLGMLPVDK[MT7]PVGMDILNSAIENLMTSSNK[MT7].4b9_1.heavy 1024.29 / 1233.66 907.0 52.97879886627197 39 13 10 6 10 1.646362527898619 48.02175903963165 0.035602569580078125 3 0.9100353009331285 4.083337706748809 907.0 -1.1337500000000027 0.0 - - - - - - - 0.0 1 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1587 202 C20140704_OR005_03 C20140704_OR005_03 TB450992.[MT7]-SWTAADTAAQISK[MT7].3b6_1.heavy 546.629 / 776.37 29140.0 30.26689910888672 47 17 10 10 10 3.771074929865488 26.51763803684668 0.0 3 0.9760069091961747 7.951463815936843 29140.0 337.33008833271987 0.0 - - - - - - - 240.1 58 10 HLA-G major histocompatibility complex, class I, G 1589 202 C20140704_OR005_03 C20140704_OR005_03 TB450992.[MT7]-SWTAADTAAQISK[MT7].3b4_1.heavy 546.629 / 590.305 51177.0 30.26689910888672 47 17 10 10 10 3.771074929865488 26.51763803684668 0.0 3 0.9760069091961747 7.951463815936843 51177.0 200.10050541703106 0.0 - - - - - - - 701.2857142857143 102 7 HLA-G major histocompatibility complex, class I, G 1591 202 C20140704_OR005_03 C20140704_OR005_03 TB450992.[MT7]-SWTAADTAAQISK[MT7].3b5_1.heavy 546.629 / 661.343 24753.0 30.26689910888672 47 17 10 10 10 3.771074929865488 26.51763803684668 0.0 3 0.9760069091961747 7.951463815936843 24753.0 68.10035885167464 0.0 - - - - - - - 218.1818181818182 49 11 HLA-G major histocompatibility complex, class I, G 1593 202 C20140704_OR005_03 C20140704_OR005_03 TB450992.[MT7]-SWTAADTAAQISK[MT7].3b3_1.heavy 546.629 / 519.268 13891.0 30.26689910888672 47 17 10 10 10 3.771074929865488 26.51763803684668 0.0 3 0.9760069091961747 7.951463815936843 13891.0 30.65509548105433 1.0 - - - - - - - 269.75 30 12 HLA-G major histocompatibility complex, class I, G 1595 203 C20140704_OR005_03 C20140704_OR005_03 TB450994.[MT7]-RLFEAEAQDLFR.3y6_1.heavy 546.962 / 749.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD4 EH-domain containing 4 1597 203 C20140704_OR005_03 C20140704_OR005_03 TB450994.[MT7]-RLFEAEAQDLFR.3b4_1.heavy 546.962 / 690.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD4 EH-domain containing 4 1599 203 C20140704_OR005_03 C20140704_OR005_03 TB450994.[MT7]-RLFEAEAQDLFR.3b5_1.heavy 546.962 / 761.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD4 EH-domain containing 4 1601 203 C20140704_OR005_03 C20140704_OR005_03 TB450994.[MT7]-RLFEAEAQDLFR.3y4_1.heavy 546.962 / 550.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - EHD4 EH-domain containing 4 1603 204 C20140704_OR005_03 C20140704_OR005_03 TB451173.[MT7]-DMYLILENDMLSLVDPMDR.4y4_1.heavy 607.549 / 518.239 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1605 204 C20140704_OR005_03 C20140704_OR005_03 TB451173.[MT7]-DMYLILENDMLSLVDPMDR.4b4_1.heavy 607.549 / 667.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1607 204 C20140704_OR005_03 C20140704_OR005_03 TB451173.[MT7]-DMYLILENDMLSLVDPMDR.4b5_1.heavy 607.549 / 780.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1609 204 C20140704_OR005_03 C20140704_OR005_03 TB451173.[MT7]-DMYLILENDMLSLVDPMDR.4b3_1.heavy 607.549 / 554.24 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1611 205 C20140704_OR005_03 C20140704_OR005_03 TB451174.[MT7]-DMYLILENDMLSLVDPMDR.2b3_1.heavy 1214.09 / 554.24 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1613 205 C20140704_OR005_03 C20140704_OR005_03 TB451174.[MT7]-DMYLILENDMLSLVDPMDR.2y4_1.heavy 1214.09 / 518.239 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1615 205 C20140704_OR005_03 C20140704_OR005_03 TB451174.[MT7]-DMYLILENDMLSLVDPMDR.2b4_1.heavy 1214.09 / 667.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1617 205 C20140704_OR005_03 C20140704_OR005_03 TB451174.[MT7]-DMYLILENDMLSLVDPMDR.2b5_1.heavy 1214.09 / 780.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1619 206 C20140704_OR005_03 C20140704_OR005_03 TB427542.[MT7]-IHC[CAM]PLLAGSALITFDDPK[MT7].3y6_1.heavy 752.748 / 866.438 3233.0 42.022873878479004 32 9 9 6 8 0.845510354830011 73.39754392262321 0.039699554443359375 4 0.8173249200168926 2.8423543005465977 3233.0 15.93787425619263 1.0 - - - - - - - 161.5 6 10 IFI35 interferon-induced protein 35 1621 206 C20140704_OR005_03 C20140704_OR005_03 TB427542.[MT7]-IHC[CAM]PLLAGSALITFDDPK[MT7].3b6_1.heavy 752.748 / 878.504 1141.0 42.022873878479004 32 9 9 6 8 0.845510354830011 73.39754392262321 0.039699554443359375 4 0.8173249200168926 2.8423543005465977 1141.0 -0.13329439252336445 2.0 - - - - - - - 215.9090909090909 3 11 IFI35 interferon-induced protein 35 1623 206 C20140704_OR005_03 C20140704_OR005_03 TB427542.[MT7]-IHC[CAM]PLLAGSALITFDDPK[MT7].3b3_1.heavy 752.748 / 555.283 4470.0 42.022873878479004 32 9 9 6 8 0.845510354830011 73.39754392262321 0.039699554443359375 4 0.8173249200168926 2.8423543005465977 4470.0 9.636193475028428 0.0 - - - - - - - 218.5 8 10 IFI35 interferon-induced protein 35 1625 206 C20140704_OR005_03 C20140704_OR005_03 TB427542.[MT7]-IHC[CAM]PLLAGSALITFDDPK[MT7].3b8_2.heavy 752.748 / 503.785 5040.0 42.022873878479004 32 9 9 6 8 0.845510354830011 73.39754392262321 0.039699554443359375 4 0.8173249200168926 2.8423543005465977 5040.0 53.6377247977229 1.0 - - - - - - - 164.0909090909091 11 11 IFI35 interferon-induced protein 35 1627 207 C20140704_OR005_03 C20140704_OR005_03 TB451089.[MT7]-GC[CAM]LVSLSY[MT7]HLDTK[MT7].3y3_1.heavy 642.356 / 507.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1629 207 C20140704_OR005_03 C20140704_OR005_03 TB451089.[MT7]-GC[CAM]LVSLSY[MT7]HLDTK[MT7].3b4_1.heavy 642.356 / 574.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1631 207 C20140704_OR005_03 C20140704_OR005_03 TB451089.[MT7]-GC[CAM]LVSLSY[MT7]HLDTK[MT7].3y4_1.heavy 642.356 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1633 207 C20140704_OR005_03 C20140704_OR005_03 TB451089.[MT7]-GC[CAM]LVSLSY[MT7]HLDTK[MT7].3y5_1.heavy 642.356 / 757.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM73;TRIM74 tripartite motif-containing 73;tripartite motif-containing 74 1635 208 C20140704_OR005_03 C20140704_OR005_03 TB427544.[MT7]-FFDSFGNLSSPSAILGNPK[MT7].2y4_1.heavy 1143.6 / 559.332 6966.0 45.5172004699707 43 13 10 10 10 1.3548063928221736 52.28251281826219 0.0 3 0.9085203842646822 4.048857363926773 6966.0 55.147499999999994 0.0 - - - - - - - 246.15384615384616 13 13 HBE1 hemoglobin, epsilon 1 1637 208 C20140704_OR005_03 C20140704_OR005_03 TB427544.[MT7]-FFDSFGNLSSPSAILGNPK[MT7].2b3_1.heavy 1143.6 / 554.273 7927.0 45.5172004699707 43 13 10 10 10 1.3548063928221736 52.28251281826219 0.0 3 0.9085203842646822 4.048857363926773 7927.0 100.60038629684055 0.0 - - - - - - - 181.8181818181818 15 11 HBE1 hemoglobin, epsilon 1 1639 208 C20140704_OR005_03 C20140704_OR005_03 TB427544.[MT7]-FFDSFGNLSSPSAILGNPK[MT7].2b7_1.heavy 1143.6 / 959.438 8728.0 45.5172004699707 43 13 10 10 10 1.3548063928221736 52.28251281826219 0.0 3 0.9085203842646822 4.048857363926773 8728.0 58.39775900073475 0.0 - - - - - - - 165.71428571428572 17 14 HBE1 hemoglobin, epsilon 1 1641 208 C20140704_OR005_03 C20140704_OR005_03 TB427544.[MT7]-FFDSFGNLSSPSAILGNPK[MT7].2y11_1.heavy 1143.6 / 1214.69 1441.0 45.5172004699707 43 13 10 10 10 1.3548063928221736 52.28251281826219 0.0 3 0.9085203842646822 4.048857363926773 1441.0 -0.2921100727925548 2.0 - - - - - - - 208.0 4 10 HBE1 hemoglobin, epsilon 1 1643 209 C20140704_OR005_03 C20140704_OR005_03 TB427541.[MT7]-LC[CAM]QIGQFTVPLGGQQVPLR.3b4_1.heavy 752.42 / 659.367 2893.0 42.3218994140625 44 14 10 10 10 1.8013001312303754 43.756797037339844 0.0 3 0.936984623348258 4.890257010943767 2893.0 15.540574229691876 0.0 - - - - - - - 229.84615384615384 5 13 IFI35 interferon-induced protein 35 1645 209 C20140704_OR005_03 C20140704_OR005_03 TB427541.[MT7]-LC[CAM]QIGQFTVPLGGQQVPLR.3b3_1.heavy 752.42 / 546.283 1960.0 42.3218994140625 44 14 10 10 10 1.8013001312303754 43.756797037339844 0.0 3 0.936984623348258 4.890257010943767 1960.0 5.205632173619669 0.0 - - - - - - - 261.4 3 10 IFI35 interferon-induced protein 35 1647 209 C20140704_OR005_03 C20140704_OR005_03 TB427541.[MT7]-LC[CAM]QIGQFTVPLGGQQVPLR.3y8_1.heavy 752.42 / 854.484 1306.0 42.3218994140625 44 14 10 10 10 1.8013001312303754 43.756797037339844 0.0 3 0.936984623348258 4.890257010943767 1306.0 2.484710920770878 2.0 - - - - - - - 280.0 2 8 IFI35 interferon-induced protein 35 1649 209 C20140704_OR005_03 C20140704_OR005_03 TB427541.[MT7]-LC[CAM]QIGQFTVPLGGQQVPLR.3y10_1.heavy 752.42 / 1064.62 7465.0 42.3218994140625 44 14 10 10 10 1.8013001312303754 43.756797037339844 0.0 3 0.936984623348258 4.890257010943767 7465.0 30.676261011106856 0.0 - - - - - - - 225.5 14 12 IFI35 interferon-induced protein 35 1651 210 C20140704_OR005_03 C20140704_OR005_03 TB427540.[MT7]-VDPWESEQAQWMETVK[MT7].2y8_1.heavy 1126.05 / 1136.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1653 210 C20140704_OR005_03 C20140704_OR005_03 TB427540.[MT7]-VDPWESEQAQWMETVK[MT7].2y5_1.heavy 1126.05 / 751.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1655 210 C20140704_OR005_03 C20140704_OR005_03 TB427540.[MT7]-VDPWESEQAQWMETVK[MT7].2y6_1.heavy 1126.05 / 937.493 N/A N/A - - - - - - - - - 0.0 - - - - - - - NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1657 210 C20140704_OR005_03 C20140704_OR005_03 TB427540.[MT7]-VDPWESEQAQWMETVK[MT7].2b5_1.heavy 1126.05 / 771.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1659 211 C20140704_OR005_03 C20140704_OR005_03 TB451080.[MT7]-AMQEQLENYDFTK[MT7].2b4_1.heavy 952.969 / 604.288 1939.0 34.144100189208984 42 12 10 10 10 0.825442358798375 69.64932729648827 0.0 3 0.8983284278268178 3.8371820810721324 1939.0 -0.8012396694214878 0.0 - - - - - - - 242.33333333333334 3 3 EHD4 EH-domain containing 4 1661 211 C20140704_OR005_03 C20140704_OR005_03 TB451080.[MT7]-AMQEQLENYDFTK[MT7].2y3_1.heavy 952.969 / 539.331 2424.0 34.144100189208984 42 12 10 10 10 0.825442358798375 69.64932729648827 0.0 3 0.8983284278268178 3.8371820810721324 2424.0 -2.003305785123967 0.0 - - - - - - - 121.0 4 1 EHD4 EH-domain containing 4 1663 211 C20140704_OR005_03 C20140704_OR005_03 TB451080.[MT7]-AMQEQLENYDFTK[MT7].2b5_1.heavy 952.969 / 732.347 2908.0 34.144100189208984 42 12 10 10 10 0.825442358798375 69.64932729648827 0.0 3 0.8983284278268178 3.8371820810721324 2908.0 34.72776859504132 0.0 - - - - - - - 212.0 5 4 EHD4 EH-domain containing 4 1665 211 C20140704_OR005_03 C20140704_OR005_03 TB451080.[MT7]-AMQEQLENYDFTK[MT7].2y7_1.heavy 952.969 / 1060.51 3151.0 34.144100189208984 42 12 10 10 10 0.825442358798375 69.64932729648827 0.0 3 0.8983284278268178 3.8371820810721324 3151.0 3.4540336394382143 1.0 - - - - - - - 181.5 6 2 EHD4 EH-domain containing 4 1667 212 C20140704_OR005_03 C20140704_OR005_03 TB412898.[MT7]-EHTINMEEC[CAM]R.2y8_1.heavy 731.83 / 1052.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1669 212 C20140704_OR005_03 C20140704_OR005_03 TB412898.[MT7]-EHTINMEEC[CAM]R.2y9_1.heavy 731.83 / 1189.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1671 212 C20140704_OR005_03 C20140704_OR005_03 TB412898.[MT7]-EHTINMEEC[CAM]R.2y6_1.heavy 731.83 / 838.318 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1673 212 C20140704_OR005_03 C20140704_OR005_03 TB412898.[MT7]-EHTINMEEC[CAM]R.2y7_1.heavy 731.83 / 951.402 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1675 213 C20140704_OR005_03 C20140704_OR005_03 TB412897.[MT7]-RVLVTGFPASLR.3y7_1.heavy 487.3 / 747.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1677 213 C20140704_OR005_03 C20140704_OR005_03 TB412897.[MT7]-RVLVTGFPASLR.3b6_1.heavy 487.3 / 770.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1679 213 C20140704_OR005_03 C20140704_OR005_03 TB412897.[MT7]-RVLVTGFPASLR.3b4_1.heavy 487.3 / 612.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1681 213 C20140704_OR005_03 C20140704_OR005_03 TB412897.[MT7]-RVLVTGFPASLR.3b3_1.heavy 487.3 / 513.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1683 214 C20140704_OR005_03 C20140704_OR005_03 TB427021.[MT7]-K[MT7]PDQAIK[MT7].3y6_1.heavy 411.263 / 815.474 559.0 17.686275005340576 37 11 10 6 10 2.642210307657817 37.84710085725342 0.03569984436035156 3 0.8713001381514348 3.4025268034575973 559.0 2.3291666666666666 0.0 - - - - - - - 0.0 1 0 APEH N-acylaminoacyl-peptide hydrolase 1685 214 C20140704_OR005_03 C20140704_OR005_03 TB427021.[MT7]-K[MT7]PDQAIK[MT7].3y3_1.heavy 411.263 / 475.336 12300.0 17.686275005340576 37 11 10 6 10 2.642210307657817 37.84710085725342 0.03569984436035156 3 0.8713001381514348 3.4025268034575973 12300.0 39.596543702226654 0.0 - - - - - - - 243.47058823529412 24 17 APEH N-acylaminoacyl-peptide hydrolase 1687 214 C20140704_OR005_03 C20140704_OR005_03 TB427021.[MT7]-K[MT7]PDQAIK[MT7].3y4_1.heavy 411.263 / 603.395 9113.0 17.686275005340576 37 11 10 6 10 2.642210307657817 37.84710085725342 0.03569984436035156 3 0.8713001381514348 3.4025268034575973 9113.0 85.43437499999999 0.0 - - - - - - - 122.18181818181819 18 11 APEH N-acylaminoacyl-peptide hydrolase 1689 214 C20140704_OR005_03 C20140704_OR005_03 TB427021.[MT7]-K[MT7]PDQAIK[MT7].3y5_1.heavy 411.263 / 718.422 2236.0 17.686275005340576 37 11 10 6 10 2.642210307657817 37.84710085725342 0.03569984436035156 3 0.8713001381514348 3.4025268034575973 2236.0 56.29928571428571 0.0 - - - - - - - 151.85714285714286 4 7 APEH N-acylaminoacyl-peptide hydrolase 1691 215 C20140704_OR005_03 C20140704_OR005_03 TB426826.[MT7]-VGHDPK[MT7].2b3_1.heavy 470.776 / 438.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1693 215 C20140704_OR005_03 C20140704_OR005_03 TB426826.[MT7]-VGHDPK[MT7].2y5_1.heavy 470.776 / 697.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1695 215 C20140704_OR005_03 C20140704_OR005_03 TB426826.[MT7]-VGHDPK[MT7].2b4_1.heavy 470.776 / 553.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1697 215 C20140704_OR005_03 C20140704_OR005_03 TB426826.[MT7]-VGHDPK[MT7].2y3_1.heavy 470.776 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1699 216 C20140704_OR005_03 C20140704_OR005_03 TB412574.[MT7]-GMLPDPK[MT7].2y4_1.heavy 523.301 / 600.347 3088.0 26.817050457000732 34 11 10 5 8 1.919051342915057 37.80199278012279 0.04099845886230469 4 0.8787525663220243 3.5078181031402944 3088.0 5.87229185869904 1.0 - - - - - - - 208.45454545454547 7 11 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1701 216 C20140704_OR005_03 C20140704_OR005_03 TB412574.[MT7]-GMLPDPK[MT7].2b3_1.heavy 523.301 / 446.255 14942.0 26.817050457000732 34 11 10 5 8 1.919051342915057 37.80199278012279 0.04099845886230469 4 0.8787525663220243 3.5078181031402944 14942.0 57.00763052208835 0.0 - - - - - - - 273.9166666666667 29 12 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1703 216 C20140704_OR005_03 C20140704_OR005_03 TB412574.[MT7]-GMLPDPK[MT7].2b5_1.heavy 523.301 / 658.335 27395.0 26.817050457000732 34 11 10 5 8 1.919051342915057 37.80199278012279 0.04099845886230469 4 0.8787525663220243 3.5078181031402944 27395.0 169.88877818071705 0.0 - - - - - - - 199.375 54 8 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1705 216 C20140704_OR005_03 C20140704_OR005_03 TB412574.[MT7]-GMLPDPK[MT7].2b4_1.heavy 523.301 / 543.308 996.0 26.817050457000732 34 11 10 5 8 1.919051342915057 37.80199278012279 0.04099845886230469 4 0.8787525663220243 3.5078181031402944 996.0 0.48693276171537025 3.0 - - - - - - - 249.0 2 10 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1707 217 C20140704_OR005_03 C20140704_OR005_03 TB413253.[MT7]-GMGGAFVLVLYDEIK[MT7]K[MT7].4b7_1.heavy 543.817 / 764.388 1650.0 48.07929992675781 34 14 4 10 6 1.0842640408004076 59.660585370528324 0.0 5 0.9430913871584925 5.148633129191326 1650.0 21.413759689922482 0.0 - - - - - - - 174.42857142857142 3 7 SLC25A4;SLC25A5 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 1709 217 C20140704_OR005_03 C20140704_OR005_03 TB413253.[MT7]-GMGGAFVLVLYDEIK[MT7]K[MT7].4y6_2.heavy 543.817 / 542.318 2583.0 48.07929992675781 34 14 4 10 6 1.0842640408004076 59.660585370528324 0.0 5 0.9430913871584925 5.148633129191326 2583.0 12.251555354019564 2.0 - - - - - - - 133.42857142857142 14 7 SLC25A4;SLC25A5 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 1711 217 C20140704_OR005_03 C20140704_OR005_03 TB413253.[MT7]-GMGGAFVLVLYDEIK[MT7]K[MT7].4b5_1.heavy 543.817 / 518.251 3875.0 48.07929992675781 34 14 4 10 6 1.0842640408004076 59.660585370528324 0.0 5 0.9430913871584925 5.148633129191326 3875.0 36.835029069767444 0.0 - - - - - - - 143.8 7 10 SLC25A4;SLC25A5 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 1713 217 C20140704_OR005_03 C20140704_OR005_03 TB413253.[MT7]-GMGGAFVLVLYDEIK[MT7]K[MT7].4b6_1.heavy 543.817 / 665.32 1794.0 48.07929992675781 34 14 4 10 6 1.0842640408004076 59.660585370528324 0.0 5 0.9430913871584925 5.148633129191326 1794.0 17.29883227176221 1.0 - - - - - - - 215.4 5 5 SLC25A4;SLC25A5 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 1715 218 C20140704_OR005_03 C20140704_OR005_03 TB413105.[MT7]-ERSPLAFIPFSAGPR.3y7_1.heavy 597.001 / 731.383 8782.0 41.140899658203125 41 20 10 3 8 4.149090349796629 19.381587640456758 0.07900238037109375 4 0.9908831303293062 12.915433664194879 8782.0 50.77632725450901 1.0 - - - - - - - 245.0909090909091 17 11 CYP4F3;CYP4F11;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 2 1717 218 C20140704_OR005_03 C20140704_OR005_03 TB413105.[MT7]-ERSPLAFIPFSAGPR.3y6_1.heavy 597.001 / 634.331 2894.0 41.140899658203125 41 20 10 3 8 4.149090349796629 19.381587640456758 0.07900238037109375 4 0.9908831303293062 12.915433664194879 2894.0 5.594953827540632 0.0 - - - - - - - 278.07142857142856 5 14 CYP4F3;CYP4F11;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 2 1719 218 C20140704_OR005_03 C20140704_OR005_03 TB413105.[MT7]-ERSPLAFIPFSAGPR.3b6_1.heavy 597.001 / 798.459 2994.0 41.140899658203125 41 20 10 3 8 4.149090349796629 19.381587640456758 0.07900238037109375 4 0.9908831303293062 12.915433664194879 2994.0 6.391374045801527 1.0 - - - - - - - 233.0 5 9 CYP4F3;CYP4F11;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 2 1721 218 C20140704_OR005_03 C20140704_OR005_03 TB413105.[MT7]-ERSPLAFIPFSAGPR.3b7_1.heavy 597.001 / 945.527 3094.0 41.140899658203125 41 20 10 3 8 4.149090349796629 19.381587640456758 0.07900238037109375 4 0.9908831303293062 12.915433664194879 3094.0 0.0 2.0 - - - - - - - 242.57142857142858 10 7 CYP4F3;CYP4F11;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 2 1723 219 C20140704_OR005_03 C20140704_OR005_03 TB426928.[MT7]-QGMEYYR.2b4_1.heavy 545.759 / 590.273 1896.0 23.712550163269043 41 17 10 6 8 2.585100332877707 30.722350011162398 0.037799835205078125 4 0.9724779114501846 7.421993231476605 1896.0 1.469767441860465 2.0 - - - - - - - 251.71428571428572 4 14 APEH N-acylaminoacyl-peptide hydrolase 1725 219 C20140704_OR005_03 C20140704_OR005_03 TB426928.[MT7]-QGMEYYR.2y3_1.heavy 545.759 / 501.246 3070.0 23.712550163269043 41 17 10 6 8 2.585100332877707 30.722350011162398 0.037799835205078125 4 0.9724779114501846 7.421993231476605 3070.0 7.653739612188365 0.0 - - - - - - - 722.25 6 8 APEH N-acylaminoacyl-peptide hydrolase 1727 219 C20140704_OR005_03 C20140704_OR005_03 TB426928.[MT7]-QGMEYYR.2y6_1.heavy 545.759 / 818.35 3702.0 23.712550163269043 41 17 10 6 8 2.585100332877707 30.722350011162398 0.037799835205078125 4 0.9724779114501846 7.421993231476605 3702.0 9.549502349310984 0.0 - - - - - - - 203.08333333333334 7 12 APEH N-acylaminoacyl-peptide hydrolase 1729 219 C20140704_OR005_03 C20140704_OR005_03 TB426928.[MT7]-QGMEYYR.2b5_1.heavy 545.759 / 753.336 993.0 23.712550163269043 41 17 10 6 8 2.585100332877707 30.722350011162398 0.037799835205078125 4 0.9724779114501846 7.421993231476605 993.0 5.312886477701342 1.0 - - - - - - - 0.0 1 0 APEH N-acylaminoacyl-peptide hydrolase 1731 220 C20140704_OR005_03 C20140704_OR005_03 TB413102.[MT7]-AYLEGTC[CAM]VEWLHR.3b4_1.heavy 593.299 / 621.336 8805.0 36.06919860839844 47 17 10 10 10 3.39040847738747 29.494971082970068 0.0 3 0.9736241781303419 7.582285735660209 8805.0 50.58872727272727 0.0 - - - - - - - 216.28571428571428 17 7 HLA-G major histocompatibility complex, class I, G 1733 220 C20140704_OR005_03 C20140704_OR005_03 TB413102.[MT7]-AYLEGTC[CAM]VEWLHR.3b5_1.heavy 593.299 / 678.358 6053.0 36.06919860839844 47 17 10 10 10 3.39040847738747 29.494971082970068 0.0 3 0.9736241781303419 7.582285735660209 6053.0 13.457693670089258 1.0 - - - - - - - 298.3333333333333 14 6 HLA-G major histocompatibility complex, class I, G 1735 220 C20140704_OR005_03 C20140704_OR005_03 TB413102.[MT7]-AYLEGTC[CAM]VEWLHR.3y4_1.heavy 593.299 / 611.341 20223.0 36.06919860839844 47 17 10 10 10 3.39040847738747 29.494971082970068 0.0 3 0.9736241781303419 7.582285735660209 20223.0 37.51006267029973 0.0 - - - - - - - 275.25 40 4 HLA-G major histocompatibility complex, class I, G 1737 220 C20140704_OR005_03 C20140704_OR005_03 TB413102.[MT7]-AYLEGTC[CAM]VEWLHR.3y5_1.heavy 593.299 / 740.384 19260.0 36.06919860839844 47 17 10 10 10 3.39040847738747 29.494971082970068 0.0 3 0.9736241781303419 7.582285735660209 19260.0 95.36957505285412 0.0 - - - - - - - 321.0 38 6 HLA-G major histocompatibility complex, class I, G 1739 221 C20140704_OR005_03 C20140704_OR005_03 TB412996.[MT7]-EFHGLGDC[CAM]IIK[MT7].3b4_1.heavy 526.285 / 615.301 5588.0 32.474098205566406 46 18 10 10 8 14.265766898726529 7.009787886617351 0.0 4 0.9897554742828611 12.182740152668684 5588.0 53.68000000000001 1.0 - - - - - - - 152.4 13 5 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 1741 221 C20140704_OR005_03 C20140704_OR005_03 TB412996.[MT7]-EFHGLGDC[CAM]IIK[MT7].3b3_2.heavy 526.285 / 279.643 6604.0 32.474098205566406 46 18 10 10 8 14.265766898726529 7.009787886617351 0.0 4 0.9897554742828611 12.182740152668684 6604.0 22.966666666666665 0.0 - - - - - - - 211.66666666666666 13 3 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 1743 221 C20140704_OR005_03 C20140704_OR005_03 TB412996.[MT7]-EFHGLGDC[CAM]IIK[MT7].3b3_1.heavy 526.285 / 558.279 3175.0 32.474098205566406 46 18 10 10 8 14.265766898726529 7.009787886617351 0.0 4 0.9897554742828611 12.182740152668684 3175.0 10.166666666666668 1.0 - - - - - - - 254.0 6 11 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 1745 221 C20140704_OR005_03 C20140704_OR005_03 TB412996.[MT7]-EFHGLGDC[CAM]IIK[MT7].3y4_1.heavy 526.285 / 677.414 2921.0 32.474098205566406 46 18 10 10 8 14.265766898726529 7.009787886617351 0.0 4 0.9897554742828611 12.182740152668684 2921.0 13.915 0.0 - - - - - - - 243.41666666666666 5 12 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 1747 222 C20140704_OR005_03 C20140704_OR005_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 155932.0 43.93370056152344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 155932.0 125.52778317152104 1.0 - - - - - - - 706.375 311 8 1749 222 C20140704_OR005_03 C20140704_OR005_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 265596.0 43.93370056152344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 265596.0 541.2104361604689 0.0 - - - - - - - 294.3333333333333 531 6 1751 222 C20140704_OR005_03 C20140704_OR005_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 258444.0 43.93370056152344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 258444.0 1032.0323120912706 0.0 - - - - - - - 202.0 516 7 1753 223 C20140704_OR005_03 C20140704_OR005_03 TB427556.[MT7]-LSEEELLDK[MT7]LEIFFGK[MT7].4y4_1.heavy 586.336 / 642.373 5634.0 52.37300109863281 40 10 10 10 10 0.8234259747831636 74.38791911719034 0.0 3 0.8428705502498872 3.071677189383226 5634.0 18.801646213302597 0.0 - - - - - - - 228.66666666666666 11 9 IFI35 interferon-induced protein 35 1755 223 C20140704_OR005_03 C20140704_OR005_03 TB427556.[MT7]-LSEEELLDK[MT7]LEIFFGK[MT7].4b11_2.heavy 586.336 / 794.44 8329.0 52.37300109863281 40 10 10 10 10 0.8234259747831636 74.38791911719034 0.0 3 0.8428705502498872 3.071677189383226 8329.0 158.93091836734695 0.0 - - - - - - - 136.11111111111111 16 9 IFI35 interferon-induced protein 35 1757 223 C20140704_OR005_03 C20140704_OR005_03 TB427556.[MT7]-LSEEELLDK[MT7]LEIFFGK[MT7].4b4_1.heavy 586.336 / 603.311 4311.0 52.37300109863281 40 10 10 10 10 0.8234259747831636 74.38791911719034 0.0 3 0.8428705502498872 3.071677189383226 4311.0 29.033265306122445 0.0 - - - - - - - 156.8 8 15 IFI35 interferon-induced protein 35 1759 223 C20140704_OR005_03 C20140704_OR005_03 TB427556.[MT7]-LSEEELLDK[MT7]LEIFFGK[MT7].4b5_1.heavy 586.336 / 732.353 4752.0 52.37300109863281 40 10 10 10 10 0.8234259747831636 74.38791911719034 0.0 3 0.8428705502498872 3.071677189383226 4752.0 137.71102040816328 0.0 - - - - - - - 114.33333333333333 9 9 IFI35 interferon-induced protein 35 1761 224 C20140704_OR005_03 C20140704_OR005_03 TB427555.[MT7]-GDQFVFYEDWGENMVSK[MT7].3y7_1.heavy 780.368 / 908.463 6319.0 44.17680072784424 44 18 10 6 10 5.7587578899029905 17.364855740043026 0.033199310302734375 3 0.986098066921918 10.454911430139854 6319.0 29.35245064268824 0.0 - - - - - - - 196.8181818181818 12 11 APEH N-acylaminoacyl-peptide hydrolase 1763 224 C20140704_OR005_03 C20140704_OR005_03 TB427555.[MT7]-GDQFVFYEDWGENMVSK[MT7].3b6_1.heavy 780.368 / 838.422 8485.0 44.17680072784424 44 18 10 6 10 5.7587578899029905 17.364855740043026 0.033199310302734375 3 0.986098066921918 10.454911430139854 8485.0 130.81171884591774 0.0 - - - - - - - 219.35714285714286 16 14 APEH N-acylaminoacyl-peptide hydrolase 1765 224 C20140704_OR005_03 C20140704_OR005_03 TB427555.[MT7]-GDQFVFYEDWGENMVSK[MT7].3b4_1.heavy 780.368 / 592.285 15074.0 44.17680072784424 44 18 10 6 10 5.7587578899029905 17.364855740043026 0.033199310302734375 3 0.986098066921918 10.454911430139854 15074.0 83.8899710148872 0.0 - - - - - - - 234.7 30 10 APEH N-acylaminoacyl-peptide hydrolase 1767 224 C20140704_OR005_03 C20140704_OR005_03 TB427555.[MT7]-GDQFVFYEDWGENMVSK[MT7].3b5_1.heavy 780.368 / 691.353 12366.0 44.17680072784424 44 18 10 6 10 5.7587578899029905 17.364855740043026 0.033199310302734375 3 0.986098066921918 10.454911430139854 12366.0 39.6989667896679 0.0 - - - - - - - 237.125 24 16 APEH N-acylaminoacyl-peptide hydrolase 1769 225 C20140704_OR005_03 C20140704_OR005_03 TB451166.[MT7]-MLTPAFHFNILK[MT7]PYMK[MT7].4y4_1.heavy 596.59 / 682.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP4F3;CYP4F11;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 2 1771 225 C20140704_OR005_03 C20140704_OR005_03 TB451166.[MT7]-MLTPAFHFNILK[MT7]PYMK[MT7].4b5_1.heavy 596.59 / 658.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP4F3;CYP4F11;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 2 1773 225 C20140704_OR005_03 C20140704_OR005_03 TB451166.[MT7]-MLTPAFHFNILK[MT7]PYMK[MT7].4y3_1.heavy 596.59 / 585.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP4F3;CYP4F11;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 2 1775 225 C20140704_OR005_03 C20140704_OR005_03 TB451166.[MT7]-MLTPAFHFNILK[MT7]PYMK[MT7].4b6_1.heavy 596.59 / 805.44 N/A N/A - - - - - - - - - 0.0 - - - - - - - CYP4F3;CYP4F11;CYP4F2 cytochrome P450, family 4, subfamily F, polypeptide 3;cytochrome P450, family 4, subfamily F, polypeptide 11;cytochrome P450, family 4, subfamily F, polypeptide 2 1777 226 C20140704_OR005_03 C20140704_OR005_03 TB451090.[MT7]-QVLYGDLLSQYPETR.2y4_1.heavy 963.508 / 502.262 7037.0 39.570199966430664 38 12 10 6 10 1.0297580936293942 55.91206260462407 0.03839874267578125 3 0.8957341027040437 3.7882919413317873 7037.0 38.469849609375004 0.0 - - - - - - - 192.0 14 4 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1779 226 C20140704_OR005_03 C20140704_OR005_03 TB451090.[MT7]-QVLYGDLLSQYPETR.2b4_1.heavy 963.508 / 648.384 5118.0 39.570199966430664 38 12 10 6 10 1.0297580936293942 55.91206260462407 0.03839874267578125 3 0.8957341027040437 3.7882919413317873 5118.0 25.59 0.0 - - - - - - - 160.0 10 4 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1781 226 C20140704_OR005_03 C20140704_OR005_03 TB451090.[MT7]-QVLYGDLLSQYPETR.2y9_1.heavy 963.508 / 1106.58 4478.0 39.570199966430664 38 12 10 6 10 1.0297580936293942 55.91206260462407 0.03839874267578125 3 0.8957341027040437 3.7882919413317873 4478.0 -2.4489062500000003 0.0 - - - - - - - 182.85714285714286 8 7 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1783 226 C20140704_OR005_03 C20140704_OR005_03 TB451090.[MT7]-QVLYGDLLSQYPETR.2b6_1.heavy 963.508 / 820.432 3582.0 39.570199966430664 38 12 10 6 10 1.0297580936293942 55.91206260462407 0.03839874267578125 3 0.8957341027040437 3.7882919413317873 3582.0 28.474101562499996 0.0 - - - - - - - 170.66666666666666 7 6 KCNF1 potassium voltage-gated channel, subfamily F, member 1 1785 227 C20140704_OR005_03 C20140704_OR005_03 TB412688.[MT7]-TRLAADVGK[MT7].3b6_1.heavy 406.918 / 772.443 1792.0 21.443599700927734 34 10 10 6 8 0.8095030320387737 81.27946457339573 0.039798736572265625 4 0.831461785848168 2.962892105401299 1792.0 5.255131964809384 2.0 - - - - - - - 170.5 5 2 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1787 227 C20140704_OR005_03 C20140704_OR005_03 TB412688.[MT7]-TRLAADVGK[MT7].3y3_1.heavy 406.918 / 447.305 13997.0 21.443599700927734 34 10 10 6 8 0.8095030320387737 81.27946457339573 0.039798736572265625 4 0.831461785848168 2.962892105401299 13997.0 54.407452904797694 0.0 - - - - - - - 312.6666666666667 27 3 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1789 227 C20140704_OR005_03 C20140704_OR005_03 TB412688.[MT7]-TRLAADVGK[MT7].3b4_1.heavy 406.918 / 586.379 1110.0 21.443599700927734 34 10 10 6 8 0.8095030320387737 81.27946457339573 0.039798736572265625 4 0.831461785848168 2.962892105401299 1110.0 17.134604779411763 3.0 - - - - - - - 227.66666666666666 11 6 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1791 227 C20140704_OR005_03 C20140704_OR005_03 TB412688.[MT7]-TRLAADVGK[MT7].3y4_1.heavy 406.918 / 562.332 3499.0 21.443599700927734 34 10 10 6 8 0.8095030320387737 81.27946457339573 0.039798736572265625 4 0.831461785848168 2.962892105401299 3499.0 30.354069523760522 0.0 - - - - - - - 170.66666666666666 6 6 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1793 228 C20140704_OR005_03 C20140704_OR005_03 TB427035.[MT7]-AAVTSLWSK[MT7].2y8_1.heavy 625.871 / 1035.6 22747.0 33.90999984741211 46 16 10 10 10 2.327221204047494 37.733480319006965 0.0 3 0.9622477776852788 6.33162600672986 22747.0 120.79155109489051 0.0 - - - - - - - 216.91666666666666 45 12 HBE1 hemoglobin, epsilon 1 1795 228 C20140704_OR005_03 C20140704_OR005_03 TB427035.[MT7]-AAVTSLWSK[MT7].2y5_1.heavy 625.871 / 764.442 11785.0 33.90999984741211 46 16 10 10 10 2.327221204047494 37.733480319006965 0.0 3 0.9622477776852788 6.33162600672986 11785.0 53.333576642335764 0.0 - - - - - - - 328.8 23 5 HBE1 hemoglobin, epsilon 1 1797 228 C20140704_OR005_03 C20140704_OR005_03 TB427035.[MT7]-AAVTSLWSK[MT7].2y3_1.heavy 625.871 / 564.326 25488.0 33.90999984741211 46 16 10 10 10 2.327221204047494 37.733480319006965 0.0 3 0.9622477776852788 6.33162600672986 25488.0 47.90627737226278 0.0 - - - - - - - 308.25 50 4 HBE1 hemoglobin, epsilon 1 1799 228 C20140704_OR005_03 C20140704_OR005_03 TB427035.[MT7]-AAVTSLWSK[MT7].2y6_1.heavy 625.871 / 865.49 33983.0 33.90999984741211 46 16 10 10 10 2.327221204047494 37.733480319006965 0.0 3 0.9622477776852788 6.33162600672986 33983.0 121.13161800486617 0.0 - - - - - - - 304.44444444444446 67 9 HBE1 hemoglobin, epsilon 1 1801 229 C20140704_OR005_03 C20140704_OR005_03 TB427033.[MT7]-AESFFQTK[MT7].2y4_1.heavy 623.34 / 667.39 15396.0 31.1112003326416 46 16 10 10 10 2.2212905802364595 31.53611498144479 0.0 3 0.9649299696242364 6.570778564877717 15396.0 56.26614370064102 0.0 - - - - - - - 253.57142857142858 30 7 APEH N-acylaminoacyl-peptide hydrolase 1803 229 C20140704_OR005_03 C20140704_OR005_03 TB427033.[MT7]-AESFFQTK[MT7].2b4_1.heavy 623.34 / 579.289 9593.0 31.1112003326416 46 16 10 10 10 2.2212905802364595 31.53611498144479 0.0 3 0.9649299696242364 6.570778564877717 9593.0 23.64473756984833 0.0 - - - - - - - 300.61538461538464 19 13 APEH N-acylaminoacyl-peptide hydrolase 1805 229 C20140704_OR005_03 C20140704_OR005_03 TB427033.[MT7]-AESFFQTK[MT7].2y6_1.heavy 623.34 / 901.49 16936.0 31.1112003326416 46 16 10 10 10 2.2212905802364595 31.53611498144479 0.0 3 0.9649299696242364 6.570778564877717 16936.0 85.75189873417723 0.0 - - - - - - - 260.4 33 5 APEH N-acylaminoacyl-peptide hydrolase 1807 229 C20140704_OR005_03 C20140704_OR005_03 TB427033.[MT7]-AESFFQTK[MT7].2y7_1.heavy 623.34 / 1030.53 16344.0 31.1112003326416 46 16 10 10 10 2.2212905802364595 31.53611498144479 0.0 3 0.9649299696242364 6.570778564877717 16344.0 69.02030308432876 0.0 - - - - - - - 287.42857142857144 32 7 APEH N-acylaminoacyl-peptide hydrolase 1809 230 C20140704_OR005_03 C20140704_OR005_03 TB412582.[MT7]-FGLVC[CAM]VGR.2y5_1.heavy 526.296 / 590.308 8757.0 34.09590148925781 48 18 10 10 10 3.5439280689282087 28.217277003097593 0.0 3 0.982619517677316 9.347606523564664 8757.0 35.81986676773532 0.0 - - - - - - - 290.625 17 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1811 230 C20140704_OR005_03 C20140704_OR005_03 TB412582.[MT7]-FGLVC[CAM]VGR.2b4_1.heavy 526.296 / 561.352 4789.0 34.09590148925781 48 18 10 10 10 3.5439280689282087 28.217277003097593 0.0 3 0.982619517677316 9.347606523564664 4789.0 9.095907684137273 0.0 - - - - - - - 684.0 9 7 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1813 230 C20140704_OR005_03 C20140704_OR005_03 TB412582.[MT7]-FGLVC[CAM]VGR.2y6_1.heavy 526.296 / 703.392 3557.0 34.09590148925781 48 18 10 10 10 3.5439280689282087 28.217277003097593 0.0 3 0.982619517677316 9.347606523564664 3557.0 26.399918205499795 0.0 - - - - - - - 328.2 7 5 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1815 230 C20140704_OR005_03 C20140704_OR005_03 TB412582.[MT7]-FGLVC[CAM]VGR.2y7_1.heavy 526.296 / 760.413 15598.0 34.09590148925781 48 18 10 10 10 3.5439280689282087 28.217277003097593 0.0 3 0.982619517677316 9.347606523564664 15598.0 105.88423357664234 0.0 - - - - - - - 239.625 31 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1817 231 C20140704_OR005_03 C20140704_OR005_03 TB413113.[MT7]-QYLVFHDGDSVVFAGPAGNSVETR.3b4_1.heavy 903.784 / 648.384 2218.0 37.834951400756836 38 13 10 5 10 2.070960196407813 38.35240195161623 0.041500091552734375 3 0.9229675740825933 4.417712569640059 2218.0 26.32747967479675 0.0 - - - - - - - 211.0 4 7 APEH N-acylaminoacyl-peptide hydrolase 1819 231 C20140704_OR005_03 C20140704_OR005_03 TB413113.[MT7]-QYLVFHDGDSVVFAGPAGNSVETR.3b3_1.heavy 903.784 / 549.315 1355.0 37.834951400756836 38 13 10 5 10 2.070960196407813 38.35240195161623 0.041500091552734375 3 0.9229675740825933 4.417712569640059 1355.0 6.387284869601943 1.0 - - - - - - - 270.9 3 10 APEH N-acylaminoacyl-peptide hydrolase 1821 231 C20140704_OR005_03 C20140704_OR005_03 TB413113.[MT7]-QYLVFHDGDSVVFAGPAGNSVETR.3y10_1.heavy 903.784 / 987.485 4805.0 37.834951400756836 38 13 10 5 10 2.070960196407813 38.35240195161623 0.041500091552734375 3 0.9229675740825933 4.417712569640059 4805.0 15.399391480730223 0.0 - - - - - - - 262.6666666666667 9 15 APEH N-acylaminoacyl-peptide hydrolase 1823 231 C20140704_OR005_03 C20140704_OR005_03 TB413113.[MT7]-QYLVFHDGDSVVFAGPAGNSVETR.3y9_1.heavy 903.784 / 930.464 3573.0 37.834951400756836 38 13 10 5 10 2.070960196407813 38.35240195161623 0.041500091552734375 3 0.9229675740825933 4.417712569640059 3573.0 38.62828319050758 0.0 - - - - - - - 279.90909090909093 7 11 APEH N-acylaminoacyl-peptide hydrolase 1825 232 C20140704_OR005_03 C20140704_OR005_03 TB427130.[MT7]-GAAQREFHGLGDC[CAM]IIK[MT7].3b9_2.heavy 687.37 / 549.782 1649.0 30.246649742126465 30 13 4 5 8 1.7902141483325467 39.411820864100996 0.04049873352050781 4 0.9264200021290458 4.521503450439314 1649.0 16.739848484848483 0.0 - - - - - - - 178.75 3 8 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 1827 232 C20140704_OR005_03 C20140704_OR005_03 TB427130.[MT7]-GAAQREFHGLGDC[CAM]IIK[MT7].3y4_1.heavy 687.37 / 677.414 1869.0 30.246649742126465 30 13 4 5 8 1.7902141483325467 39.411820864100996 0.04049873352050781 4 0.9264200021290458 4.521503450439314 1869.0 4.530909090909091 1.0 - - - - - - - 244.44444444444446 7 9 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 1829 232 C20140704_OR005_03 C20140704_OR005_03 TB427130.[MT7]-GAAQREFHGLGDC[CAM]IIK[MT7].3y8_1.heavy 687.37 / 1019.57 770.0 30.246649742126465 30 13 4 5 8 1.7902141483325467 39.411820864100996 0.04049873352050781 4 0.9264200021290458 4.521503450439314 770.0 6.545 3.0 - - - - - - - 0.0 1 0 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 1831 232 C20140704_OR005_03 C20140704_OR005_03 TB427130.[MT7]-GAAQREFHGLGDC[CAM]IIK[MT7].3b12_2.heavy 687.37 / 692.348 2089.0 30.246649742126465 30 13 4 5 8 1.7902141483325467 39.411820864100996 0.04049873352050781 4 0.9264200021290458 4.521503450439314 2089.0 4.557818181818182 1.0 - - - - - - - 220.0 4 9 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 1833 233 C20140704_OR005_03 C20140704_OR005_03 TB413111.[MT7]-AHAQTDRMNLQTLR.3y7_1.heavy 600.32 / 875.477 842.0 24.66615056991577 37 14 10 3 10 20.64200536142984 4.8444905545297825 0.07449913024902344 3 0.9357972806742255 4.8443358039698285 842.0 5.770212765957447 1.0 - - - - - - - 0.0 1 0 HLA-G major histocompatibility complex, class I, G 1835 233 C20140704_OR005_03 C20140704_OR005_03 TB413111.[MT7]-AHAQTDRMNLQTLR.3y12_2.heavy 600.32 / 723.878 4119.0 24.66615056991577 37 14 10 3 10 20.64200536142984 4.8444905545297825 0.07449913024902344 3 0.9357972806742255 4.8443358039698285 4119.0 87.20010638297873 0.0 - - - - - - - 187.5 8 2 HLA-G major histocompatibility complex, class I, G 1837 233 C20140704_OR005_03 C20140704_OR005_03 TB413111.[MT7]-AHAQTDRMNLQTLR.3y8_2.heavy 600.32 / 516.293 4493.0 24.66615056991577 37 14 10 3 10 20.64200536142984 4.8444905545297825 0.07449913024902344 3 0.9357972806742255 4.8443358039698285 4493.0 4.120082682723056 0.0 - - - - - - - 255.86666666666667 8 15 HLA-G major histocompatibility complex, class I, G 1839 233 C20140704_OR005_03 C20140704_OR005_03 TB413111.[MT7]-AHAQTDRMNLQTLR.3y13_2.heavy 600.32 / 792.407 7114.0 24.66615056991577 37 14 10 3 10 20.64200536142984 4.8444905545297825 0.07449913024902344 3 0.9357972806742255 4.8443358039698285 7114.0 47.40590785392125 0.0 - - - - - - - 112.6 14 5 HLA-G major histocompatibility complex, class I, G 1841 234 C20140704_OR005_03 C20140704_OR005_03 TB451152.[MT7]-IHC[CAM]PLLAGSALITFDDPK[MT7].4y4_1.heavy 564.813 / 618.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1843 234 C20140704_OR005_03 C20140704_OR005_03 TB451152.[MT7]-IHC[CAM]PLLAGSALITFDDPK[MT7].4b7_1.heavy 564.813 / 949.541 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1845 234 C20140704_OR005_03 C20140704_OR005_03 TB451152.[MT7]-IHC[CAM]PLLAGSALITFDDPK[MT7].4b6_1.heavy 564.813 / 878.504 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1847 234 C20140704_OR005_03 C20140704_OR005_03 TB451152.[MT7]-IHC[CAM]PLLAGSALITFDDPK[MT7].4b3_1.heavy 564.813 / 555.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFI35 interferon-induced protein 35 1849 235 C20140704_OR005_03 C20140704_OR005_03 TB451060.[MT7]-NDIRDTVGIWGEGK[MT7].4b8_1.heavy 462.752 / 1015.53 116.0 33.225149154663086 26 3 10 5 8 0.39629557829151596 101.14155566171141 0.043498992919921875 4 0.5494266507632364 1.764530084423681 116.0 0.0 4.0 - - - - - - - 0.0 0 0 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1851 235 C20140704_OR005_03 C20140704_OR005_03 TB451060.[MT7]-NDIRDTVGIWGEGK[MT7].4y4_1.heavy 462.752 / 534.3 1737.0 33.225149154663086 26 3 10 5 8 0.39629557829151596 101.14155566171141 0.043498992919921875 4 0.5494266507632364 1.764530084423681 1737.0 11.979310344827585 2.0 - - - - - - - 248.14285714285714 3 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1853 235 C20140704_OR005_03 C20140704_OR005_03 TB451060.[MT7]-NDIRDTVGIWGEGK[MT7].4b8_2.heavy 462.752 / 508.268 8918.0 33.225149154663086 26 3 10 5 8 0.39629557829151596 101.14155566171141 0.043498992919921875 4 0.5494266507632364 1.764530084423681 8918.0 44.97550432276657 0.0 - - - - - - - 303.875 17 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1855 235 C20140704_OR005_03 C20140704_OR005_03 TB451060.[MT7]-NDIRDTVGIWGEGK[MT7].4y3_1.heavy 462.752 / 477.279 4864.0 33.225149154663086 26 3 10 5 8 0.39629557829151596 101.14155566171141 0.043498992919921875 4 0.5494266507632364 1.764530084423681 4864.0 18.075342242361245 1.0 - - - - - - - 347.5 11 6 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1857 236 C20140704_OR005_03 C20140704_OR005_03 TB451151.[MT7]-VDPWESEQAQWMETVK[MT7].4y5_1.heavy 563.529 / 751.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1859 236 C20140704_OR005_03 C20140704_OR005_03 TB451151.[MT7]-VDPWESEQAQWMETVK[MT7].4y4_1.heavy 563.529 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1861 236 C20140704_OR005_03 C20140704_OR005_03 TB451151.[MT7]-VDPWESEQAQWMETVK[MT7].4b4_1.heavy 563.529 / 642.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1863 236 C20140704_OR005_03 C20140704_OR005_03 TB451151.[MT7]-VDPWESEQAQWMETVK[MT7].4b5_1.heavy 563.529 / 771.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1865 237 C20140704_OR005_03 C20140704_OR005_03 TB450871.[MT7]-TFQTPNLWK[MT7].2b3_1.heavy 711.903 / 521.284 5221.0 36.816200256347656 45 15 10 10 10 2.356681320971788 36.271122448251894 0.0 3 0.9587531366830789 6.055677158416674 5221.0 -0.29907880111522356 2.0 - - - - - - - 255.0 14 7 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1867 237 C20140704_OR005_03 C20140704_OR005_03 TB450871.[MT7]-TFQTPNLWK[MT7].2y5_1.heavy 711.903 / 801.474 12366.0 36.816200256347656 45 15 10 10 10 2.356681320971788 36.271122448251894 0.0 3 0.9587531366830789 6.055677158416674 12366.0 33.95683500283501 0.0 - - - - - - - 773.0 24 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1869 237 C20140704_OR005_03 C20140704_OR005_03 TB450871.[MT7]-TFQTPNLWK[MT7].2b4_1.heavy 711.903 / 622.332 7969.0 36.816200256347656 45 15 10 10 10 2.356681320971788 36.271122448251894 0.0 3 0.9587531366830789 6.055677158416674 7969.0 28.812915036510148 0.0 - - - - - - - 257.375 15 8 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1871 237 C20140704_OR005_03 C20140704_OR005_03 TB450871.[MT7]-TFQTPNLWK[MT7].2y6_1.heavy 711.903 / 902.522 7282.0 36.816200256347656 45 15 10 10 10 2.356681320971788 36.271122448251894 0.0 3 0.9587531366830789 6.055677158416674 7282.0 35.54371470160116 0.0 - - - - - - - 244.11111111111111 14 9 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1873 238 C20140704_OR005_03 C20140704_OR005_03 TB412497.[MT7]-SLVSNLR.2y4_1.heavy 466.786 / 489.278 14556.0 27.90019989013672 35 9 10 6 10 0.6696791028632182 88.18107174043783 0.0391998291015625 3 0.8138259423134552 2.8146369021227833 14556.0 156.75692307692304 0.0 - - - - - - - 208.0 32 7 IFI35 interferon-induced protein 35 1875 238 C20140704_OR005_03 C20140704_OR005_03 TB412497.[MT7]-SLVSNLR.2y5_1.heavy 466.786 / 588.346 12477.0 27.90019989013672 35 9 10 6 10 0.6696791028632182 88.18107174043783 0.0391998291015625 3 0.8138259423134552 2.8146369021227833 12477.0 169.75918269230766 0.0 - - - - - - - 252.57142857142858 24 7 IFI35 interferon-induced protein 35 1877 238 C20140704_OR005_03 C20140704_OR005_03 TB412497.[MT7]-SLVSNLR.2y6_1.heavy 466.786 / 701.43 4991.0 27.90019989013672 35 9 10 6 10 0.6696791028632182 88.18107174043783 0.0391998291015625 3 0.8138259423134552 2.8146369021227833 4991.0 88.78221153846154 0.0 - - - - - - - 237.71428571428572 15 7 IFI35 interferon-induced protein 35 1879 238 C20140704_OR005_03 C20140704_OR005_03 TB412497.[MT7]-SLVSNLR.2b5_1.heavy 466.786 / 645.369 4887.0 27.90019989013672 35 9 10 6 10 0.6696791028632182 88.18107174043783 0.0391998291015625 3 0.8138259423134552 2.8146369021227833 4887.0 21.145673076923078 0.0 - - - - - - - 226.9090909090909 9 11 IFI35 interferon-induced protein 35 1881 239 C20140704_OR005_03 C20140704_OR005_03 TB427281.[MT7]-AIATSLHEIC[CAM]SK[MT7].4b8_2.heavy 405.227 / 484.27 4120.0 29.62299919128418 42 12 10 10 10 1.0479411048508733 58.04174640553512 0.0 3 0.8989632067488916 3.849428567375705 4120.0 15.189759805411978 0.0 - - - - - - - 175.875 8 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1883 239 C20140704_OR005_03 C20140704_OR005_03 TB427281.[MT7]-AIATSLHEIC[CAM]SK[MT7].4b7_2.heavy 405.227 / 419.749 N/A 29.62299919128418 42 12 10 10 10 1.0479411048508733 58.04174640553512 0.0 3 0.8989632067488916 3.849428567375705 1518.0 1.2590414406448214 2.0 - - - - - - - 198.66666666666666 4 6 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1885 239 C20140704_OR005_03 C20140704_OR005_03 TB427281.[MT7]-AIATSLHEIC[CAM]SK[MT7].4b5_1.heavy 405.227 / 588.347 1626.0 29.62299919128418 42 12 10 10 10 1.0479411048508733 58.04174640553512 0.0 3 0.8989632067488916 3.849428567375705 1626.0 16.721539162112933 0.0 - - - - - - - 289.0 3 6 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1887 239 C20140704_OR005_03 C20140704_OR005_03 TB427281.[MT7]-AIATSLHEIC[CAM]SK[MT7].4y3_1.heavy 405.227 / 538.278 1301.0 29.62299919128418 42 12 10 10 10 1.0479411048508733 58.04174640553512 0.0 3 0.8989632067488916 3.849428567375705 1301.0 17.381084656084653 0.0 - - - - - - - 195.2 2 5 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1889 240 C20140704_OR005_03 C20140704_OR005_03 TB413378.[MT7]-SRQDLFAVDTQVGTVTSLTAGGSGGSWK[MT7].4b7_1.heavy 779.158 / 962.518 1467.0 39.400275230407715 39 13 10 6 10 2.8573588877302156 30.821870121836188 0.037899017333984375 3 0.925541566778807 4.494414506252037 1467.0 5.842035398230088 0.0 - - - - - - - 225.66666666666666 2 9 APEH N-acylaminoacyl-peptide hydrolase 1891 240 C20140704_OR005_03 C20140704_OR005_03 TB413378.[MT7]-SRQDLFAVDTQVGTVTSLTAGGSGGSWK[MT7].4b4_1.heavy 779.158 / 631.328 564.0 39.400275230407715 39 13 10 6 10 2.8573588877302156 30.821870121836188 0.037899017333984375 3 0.925541566778807 4.494414506252037 564.0 0.14253164556962028 17.0 - - - - - - - 253.875 2 16 APEH N-acylaminoacyl-peptide hydrolase 1893 240 C20140704_OR005_03 C20140704_OR005_03 TB413378.[MT7]-SRQDLFAVDTQVGTVTSLTAGGSGGSWK[MT7].4b9_1.heavy 779.158 / 1176.61 1128.0 39.400275230407715 39 13 10 6 10 2.8573588877302156 30.821870121836188 0.037899017333984375 3 0.925541566778807 4.494414506252037 1128.0 18.46725663716814 1.0 - - - - - - - 184.8181818181818 2 11 APEH N-acylaminoacyl-peptide hydrolase 1895 240 C20140704_OR005_03 C20140704_OR005_03 TB413378.[MT7]-SRQDLFAVDTQVGTVTSLTAGGSGGSWK[MT7].4b9_2.heavy 779.158 / 588.81 2369.0 39.400275230407715 39 13 10 6 10 2.8573588877302156 30.821870121836188 0.037899017333984375 3 0.925541566778807 4.494414506252037 2369.0 24.591803269038323 0.0 - - - - - - - 225.75 4 8 APEH N-acylaminoacyl-peptide hydrolase 1897 241 C20140704_OR005_03 C20140704_OR005_03 TB427007.[MT7]-EPAAPVSIQR.2y9_1.heavy 606.347 / 938.542 N/A 25.190566380818684 43 20 10 3 10 14.49593889054857 6.898483827439458 0.06960105895996094 3 0.9988418387771953 36.26067928515217 7343.0 36.854540164511015 0.0 - - - - - - - 233.0 14 9 LASP1 LIM and SH3 protein 1 1899 241 C20140704_OR005_03 C20140704_OR005_03 TB427007.[MT7]-EPAAPVSIQR.2y6_1.heavy 606.347 / 699.415 2575.0 25.190566380818684 43 20 10 3 10 14.49593889054857 6.898483827439458 0.06960105895996094 3 0.9988418387771953 36.26067928515217 2575.0 3.6013986013986017 0.0 - - - - - - - 251.27272727272728 5 11 LASP1 LIM and SH3 protein 1 1901 241 C20140704_OR005_03 C20140704_OR005_03 TB427007.[MT7]-EPAAPVSIQR.2b7_1.heavy 606.347 / 796.432 1812.0 25.190566380818684 43 20 10 3 10 14.49593889054857 6.898483827439458 0.06960105895996094 3 0.9988418387771953 36.26067928515217 1812.0 8.917696335078533 1.0 - - - - - - - 294.0 3 12 LASP1 LIM and SH3 protein 1 1903 241 C20140704_OR005_03 C20140704_OR005_03 TB427007.[MT7]-EPAAPVSIQR.2y7_1.heavy 606.347 / 770.452 1049.0 25.190566380818684 43 20 10 3 10 14.49593889054857 6.898483827439458 0.06960105895996094 3 0.9988418387771953 36.26067928515217 1049.0 7.729473684210526 0.0 - - - - - - - 171.6 2 15 LASP1 LIM and SH3 protein 1 1905 242 C20140704_OR005_03 C20140704_OR005_03 TB413279.[MT7]-LAELINC[CAM]LAGGYDTIFSLC[CAM]DDYDPGK[MT7]R.3b9_1.heavy 1122.22 / 1142.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNF1 potassium voltage-gated channel, subfamily F, member 1 1907 242 C20140704_OR005_03 C20140704_OR005_03 TB413279.[MT7]-LAELINC[CAM]LAGGYDTIFSLC[CAM]DDYDPGK[MT7]R.3y6_1.heavy 1122.22 / 879.481 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNF1 potassium voltage-gated channel, subfamily F, member 1 1909 242 C20140704_OR005_03 C20140704_OR005_03 TB413279.[MT7]-LAELINC[CAM]LAGGYDTIFSLC[CAM]DDYDPGK[MT7]R.3b4_1.heavy 1122.22 / 571.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNF1 potassium voltage-gated channel, subfamily F, member 1 1911 242 C20140704_OR005_03 C20140704_OR005_03 TB413279.[MT7]-LAELINC[CAM]LAGGYDTIFSLC[CAM]DDYDPGK[MT7]R.3y4_1.heavy 1122.22 / 601.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNF1 potassium voltage-gated channel, subfamily F, member 1 1913 243 C20140704_OR005_03 C20140704_OR005_03 TB413370.[MT7]-EQSVLWVSLEEAEPIPDIHWGIR.4y8_1.heavy 712.625 / 993.526 4427.0 49.42789840698242 46 16 10 10 10 7.671637677735474 13.035026444251752 0.0 3 0.9654827443653907 6.623492331120178 4427.0 33.642997512437816 0.0 - - - - - - - 159.76923076923077 8 13 APEH N-acylaminoacyl-peptide hydrolase 1915 243 C20140704_OR005_03 C20140704_OR005_03 TB413370.[MT7]-EQSVLWVSLEEAEPIPDIHWGIR.4b4_1.heavy 712.625 / 588.311 2482.0 49.42789840698242 46 16 10 10 10 7.671637677735474 13.035026444251752 0.0 3 0.9654827443653907 6.623492331120178 2482.0 17.77707587250039 0.0 - - - - - - - 206.15384615384616 4 13 APEH N-acylaminoacyl-peptide hydrolase 1917 243 C20140704_OR005_03 C20140704_OR005_03 TB413370.[MT7]-EQSVLWVSLEEAEPIPDIHWGIR.4b5_1.heavy 712.625 / 701.395 5366.0 49.42789840698242 46 16 10 10 10 7.671637677735474 13.035026444251752 0.0 3 0.9654827443653907 6.623492331120178 5366.0 13.152594790025029 0.0 - - - - - - - 201.0 10 13 APEH N-acylaminoacyl-peptide hydrolase 1919 243 C20140704_OR005_03 C20140704_OR005_03 TB413370.[MT7]-EQSVLWVSLEEAEPIPDIHWGIR.4y6_1.heavy 712.625 / 781.447 1006.0 49.42789840698242 46 16 10 10 10 7.671637677735474 13.035026444251752 0.0 3 0.9654827443653907 6.623492331120178 1006.0 -0.3128055912138068 2.0 - - - - - - - 167.5 2 10 APEH N-acylaminoacyl-peptide hydrolase 1921 244 C20140704_OR005_03 C20140704_OR005_03 TB450982.[MT7]-AIATSLHEIC[CAM]SK[MT7].3y3_1.heavy 539.967 / 538.278 70633.0 29.62299919128418 48 18 10 10 10 5.576335340624979 17.93292438341635 0.0 3 0.9856987658415562 10.307578943547874 70633.0 -4.639277504105088 0.0 - - - - - - - 231.71428571428572 141 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1923 244 C20140704_OR005_03 C20140704_OR005_03 TB450982.[MT7]-AIATSLHEIC[CAM]SK[MT7].3b5_1.heavy 539.967 / 588.347 19384.0 29.62299919128418 48 18 10 10 10 5.576335340624979 17.93292438341635 0.0 3 0.9856987658415562 10.307578943547874 19384.0 40.20345336386133 0.0 - - - - - - - 202.77777777777777 38 9 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1925 244 C20140704_OR005_03 C20140704_OR005_03 TB450982.[MT7]-AIATSLHEIC[CAM]SK[MT7].3y4_1.heavy 539.967 / 651.362 41812.0 29.62299919128418 48 18 10 10 10 5.576335340624979 17.93292438341635 0.0 3 0.9856987658415562 10.307578943547874 41812.0 232.3089419927808 0.0 - - - - - - - 168.88888888888889 83 9 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1927 244 C20140704_OR005_03 C20140704_OR005_03 TB450982.[MT7]-AIATSLHEIC[CAM]SK[MT7].3y5_1.heavy 539.967 / 780.404 37854.0 29.62299919128418 48 18 10 10 10 5.576335340624979 17.93292438341635 0.0 3 0.9856987658415562 10.307578943547874 37854.0 132.25656315789473 0.0 - - - - - - - 212.8 75 10 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1929 245 C20140704_OR005_03 C20140704_OR005_03 TB427296.[MT7]-SWTAADTAAQISK[MT7].2y5_1.heavy 819.44 / 690.427 1559.0 30.26689910888672 46 16 10 10 10 4.48119689055278 17.86434173356486 0.0 3 0.9654864753561537 6.623852414664294 1559.0 1.9530956046319459 1.0 - - - - - - - 222.7 4 10 HLA-G major histocompatibility complex, class I, G 1931 245 C20140704_OR005_03 C20140704_OR005_03 TB427296.[MT7]-SWTAADTAAQISK[MT7].2b4_1.heavy 819.44 / 590.305 3007.0 30.26689910888672 46 16 10 10 10 4.48119689055278 17.86434173356486 0.0 3 0.9654864753561537 6.623852414664294 3007.0 30.736598846037044 0.0 - - - - - - - 284.44444444444446 6 9 HLA-G major histocompatibility complex, class I, G 1933 245 C20140704_OR005_03 C20140704_OR005_03 TB427296.[MT7]-SWTAADTAAQISK[MT7].2b6_1.heavy 819.44 / 776.37 3229.0 30.26689910888672 46 16 10 10 10 4.48119689055278 17.86434173356486 0.0 3 0.9654864753561537 6.623852414664294 3229.0 19.70752395828085 0.0 - - - - - - - 222.66666666666666 6 6 HLA-G major histocompatibility complex, class I, G 1935 245 C20140704_OR005_03 C20140704_OR005_03 TB427296.[MT7]-SWTAADTAAQISK[MT7].2y7_1.heavy 819.44 / 862.511 4009.0 30.26689910888672 46 16 10 10 10 4.48119689055278 17.86434173356486 0.0 3 0.9654864753561537 6.623852414664294 4009.0 65.73315315315315 0.0 - - - - - - - 167.0 8 6 HLA-G major histocompatibility complex, class I, G 1937 246 C20140704_OR005_03 C20140704_OR005_03 TB427434.[MT7]-AM[OXI]QEQLENYDFTK[MT7].3y3_1.heavy 640.98 / 539.331 24148.0 33.32312488555908 24 5 10 5 4 0.4576324882090369 105.50160541263772 0.043498992919921875 9 0.6736234834470667 2.0985190392109305 24148.0 74.64164895920067 0.0 - - - - - - - 266.6666666666667 48 6 EHD4 EH-domain containing 4 1939 246 C20140704_OR005_03 C20140704_OR005_03 TB427434.[MT7]-AM[OXI]QEQLENYDFTK[MT7].3b4_1.heavy 640.98 / 620.283 1468.0 33.32312488555908 24 5 10 5 4 0.4576324882090369 105.50160541263772 0.043498992919921875 9 0.6736234834470667 2.0985190392109305 1468.0 1.100656044985942 18.0 - - - - - - - 743.2857142857143 13 7 EHD4 EH-domain containing 4 1941 246 C20140704_OR005_03 C20140704_OR005_03 TB427434.[MT7]-AM[OXI]QEQLENYDFTK[MT7].3b5_1.heavy 640.98 / 748.342 934.0 33.32312488555908 24 5 10 5 4 0.4576324882090369 105.50160541263772 0.043498992919921875 9 0.6736234834470667 2.0985190392109305 934.0 2.536771670344603 18.0 - - - - - - - 240.2 21 5 EHD4 EH-domain containing 4 1943 246 C20140704_OR005_03 C20140704_OR005_03 TB427434.[MT7]-AM[OXI]QEQLENYDFTK[MT7].3y4_1.heavy 640.98 / 654.358 8805.0 33.32312488555908 24 5 10 5 4 0.4576324882090369 105.50160541263772 0.043498992919921875 9 0.6736234834470667 2.0985190392109305 8805.0 19.472220941028784 0.0 - - - - - - - 233.25 17 8 EHD4 EH-domain containing 4 1945 247 C20140704_OR005_03 C20140704_OR005_03 TB427293.[MT7]-LIEAVDNMLSNK[MT7].3b6_1.heavy 545.639 / 785.453 17835.0 45.01169967651367 46 16 10 10 10 1.5065753724478606 39.61633691547579 0.0 3 0.9601887515405655 6.164644274525316 17835.0 270.4018772977941 0.0 - - - - - - - 204.8 35 5 EHD4 EH-domain containing 4 1947 247 C20140704_OR005_03 C20140704_OR005_03 TB427293.[MT7]-LIEAVDNMLSNK[MT7].3b4_1.heavy 545.639 / 571.357 22784.0 45.01169967651367 46 16 10 10 10 1.5065753724478606 39.61633691547579 0.0 3 0.9601887515405655 6.164644274525316 22784.0 279.41693566372237 0.0 - - - - - - - 187.7 45 10 EHD4 EH-domain containing 4 1949 247 C20140704_OR005_03 C20140704_OR005_03 TB427293.[MT7]-LIEAVDNMLSNK[MT7].3y4_1.heavy 545.639 / 605.374 23382.0 45.01169967651367 46 16 10 10 10 1.5065753724478606 39.61633691547579 0.0 3 0.9601887515405655 6.164644274525316 23382.0 298.58299868445783 0.0 - - - - - - - 294.90909090909093 46 11 EHD4 EH-domain containing 4 1951 247 C20140704_OR005_03 C20140704_OR005_03 TB427293.[MT7]-LIEAVDNMLSNK[MT7].3b3_1.heavy 545.639 / 500.32 16726.0 45.01169967651367 46 16 10 10 10 1.5065753724478606 39.61633691547579 0.0 3 0.9601887515405655 6.164644274525316 16726.0 84.39906034737339 0.0 - - - - - - - 246.66666666666666 33 9 EHD4 EH-domain containing 4 1953 248 C20140704_OR005_03 C20140704_OR005_03 TB450988.[MT7]-ALFSTPAAVPELK[MT7].3y3_1.heavy 544.659 / 533.341 41239.0 38.99984931945801 44 18 10 6 10 4.9429361768887174 20.23089039012112 0.037700653076171875 3 0.9817884302938646 9.131189780280584 41239.0 50.67540778671531 0.0 - - - - - - - 233.4 82 5 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1955 248 C20140704_OR005_03 C20140704_OR005_03 TB450988.[MT7]-ALFSTPAAVPELK[MT7].3b5_1.heavy 544.659 / 664.379 41757.0 38.99984931945801 44 18 10 6 10 4.9429361768887174 20.23089039012112 0.037700653076171875 3 0.9817884302938646 9.131189780280584 41757.0 118.3085129402846 0.0 - - - - - - - 648.5714285714286 83 7 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1957 248 C20140704_OR005_03 C20140704_OR005_03 TB450988.[MT7]-ALFSTPAAVPELK[MT7].3y4_1.heavy 544.659 / 630.394 178960.0 38.99984931945801 44 18 10 6 10 4.9429361768887174 20.23089039012112 0.037700653076171875 3 0.9817884302938646 9.131189780280584 178960.0 562.9965603221541 0.0 - - - - - - - 333.42857142857144 357 7 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1959 248 C20140704_OR005_03 C20140704_OR005_03 TB450988.[MT7]-ALFSTPAAVPELK[MT7].3b7_1.heavy 544.659 / 832.469 25677.0 38.99984931945801 44 18 10 6 10 4.9429361768887174 20.23089039012112 0.037700653076171875 3 0.9817884302938646 9.131189780280584 25677.0 134.99885617760617 0.0 - - - - - - - 345.6666666666667 51 3 NMNAT3 nicotinamide nucleotide adenylyltransferase 3 1961 249 C20140704_OR005_03 C20140704_OR005_03 TB413366.[MT7]-LLTIDQDLMVAQFSTPSLPPTLK[MT7].3y4_1.heavy 939.529 / 602.399 5451.0 49.44794845581055 43 18 10 5 10 2.2593752013489232 34.5993084273852 0.04010009765625 3 0.9818611365735942 9.149527629125988 5451.0 40.285041394066766 0.0 - - - - - - - 779.875 10 8 APEH N-acylaminoacyl-peptide hydrolase 1963 249 C20140704_OR005_03 C20140704_OR005_03 TB413366.[MT7]-LLTIDQDLMVAQFSTPSLPPTLK[MT7].3b8_1.heavy 939.529 / 1056.61 11886.0 49.44794845581055 43 18 10 5 10 2.2593752013489232 34.5993084273852 0.04010009765625 3 0.9818611365735942 9.149527629125988 11886.0 23.579105056406124 0.0 - - - - - - - 1259.6363636363637 23 11 APEH N-acylaminoacyl-peptide hydrolase 1965 249 C20140704_OR005_03 C20140704_OR005_03 TB413366.[MT7]-LLTIDQDLMVAQFSTPSLPPTLK[MT7].3b7_1.heavy 939.529 / 943.522 8406.0 49.44794845581055 43 18 10 5 10 2.2593752013489232 34.5993084273852 0.04010009765625 3 0.9818611365735942 9.149527629125988 8406.0 11.337962498164218 0.0 - - - - - - - 460.0 16 1 APEH N-acylaminoacyl-peptide hydrolase 1967 249 C20140704_OR005_03 C20140704_OR005_03 TB413366.[MT7]-LLTIDQDLMVAQFSTPSLPPTLK[MT7].3y5_1.heavy 939.529 / 699.452 21408.0 49.44794845581055 43 18 10 5 10 2.2593752013489232 34.5993084273852 0.04010009765625 3 0.9818611365735942 9.149527629125988 21408.0 156.14664939215697 0.0 - - - - - - - 919.0 42 1 APEH N-acylaminoacyl-peptide hydrolase 1969 250 C20140704_OR005_03 C20140704_OR005_03 TB450600.[MT7]-LLLQVQHASK[MT7].3b6_1.heavy 475.632 / 839.547 2287.0 29.63297462463379 44 18 10 6 10 7.240795994847086 13.810636298987712 0.0399017333984375 3 0.9869474150018375 10.790475461486404 2287.0 -0.7996503496503498 0.0 - - - - - - - 104.0 4 2 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1971 250 C20140704_OR005_03 C20140704_OR005_03 TB450600.[MT7]-LLLQVQHASK[MT7].3b4_1.heavy 475.632 / 612.42 36702.0 29.63297462463379 44 18 10 6 10 7.240795994847086 13.810636298987712 0.0399017333984375 3 0.9869474150018375 10.790475461486404 36702.0 205.56649038461535 0.0 - - - - - - - 184.88888888888889 73 9 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1973 250 C20140704_OR005_03 C20140704_OR005_03 TB450600.[MT7]-LLLQVQHASK[MT7].3b5_1.heavy 475.632 / 711.489 8734.0 29.63297462463379 44 18 10 6 10 7.240795994847086 13.810636298987712 0.0399017333984375 3 0.9869474150018375 10.790475461486404 8734.0 29.758479349941297 0.0 - - - - - - - 182.0 17 4 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1975 250 C20140704_OR005_03 C20140704_OR005_03 TB450600.[MT7]-LLLQVQHASK[MT7].3b3_1.heavy 475.632 / 484.362 25473.0 29.63297462463379 44 18 10 6 10 7.240795994847086 13.810636298987712 0.0399017333984375 3 0.9869474150018375 10.790475461486404 25473.0 142.91822596153847 0.0 - - - - - - - 193.14285714285714 50 7 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1977 251 C20140704_OR005_03 C20140704_OR005_03 TB450605.[MT7]-LAADVGK[MT7].2y4_1.heavy 481.3 / 562.332 3733.0 23.617299556732178 42 16 10 6 10 2.654265403213863 29.39341556539467 0.03880119323730469 3 0.9632643158163814 6.419182880762148 3733.0 33.555056179775285 0.0 - - - - - - - 227.33333333333334 7 9 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1979 251 C20140704_OR005_03 C20140704_OR005_03 TB450605.[MT7]-LAADVGK[MT7].2y5_1.heavy 481.3 / 633.369 3644.0 23.617299556732178 42 16 10 6 10 2.654265403213863 29.39341556539467 0.03880119323730469 3 0.9632643158163814 6.419182880762148 3644.0 20.4885089583966 0.0 - - - - - - - 186.0 7 11 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1981 251 C20140704_OR005_03 C20140704_OR005_03 TB450605.[MT7]-LAADVGK[MT7].2b4_1.heavy 481.3 / 515.295 9956.0 23.617299556732178 42 16 10 6 10 2.654265403213863 29.39341556539467 0.03880119323730469 3 0.9632643158163814 6.419182880762148 9956.0 100.67865168539325 0.0 - - - - - - - 160.2 19 10 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1983 251 C20140704_OR005_03 C20140704_OR005_03 TB450605.[MT7]-LAADVGK[MT7].2y6_1.heavy 481.3 / 704.406 8000.0 23.617299556732178 42 16 10 6 10 2.654265403213863 29.39341556539467 0.03880119323730469 3 0.9632643158163814 6.419182880762148 8000.0 40.46911342060698 0.0 - - - - - - - 200.125 16 8 SLC25A4;SLC25A5;SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5;solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 1985 252 C20140704_OR005_03 C20140704_OR005_03 TB412560.[MT7]-MNLQTLR.2b3_1.heavy 510.293 / 503.277 6561.0 30.02389907836914 38 18 0 10 10 5.414965490047522 18.4673383761717 0.0 3 0.9888809620838305 11.692988698549499 6561.0 13.766793457203983 1.0 - - - - - - - 222.4 13 10 HLA-G major histocompatibility complex, class I, G 1987 252 C20140704_OR005_03 C20140704_OR005_03 TB412560.[MT7]-MNLQTLR.2y5_1.heavy 510.293 / 630.393 4003.0 30.02389907836914 38 18 0 10 10 5.414965490047522 18.4673383761717 0.0 3 0.9888809620838305 11.692988698549499 4003.0 12.863573033707866 1.0 - - - - - - - 319.75 127 8 HLA-G major histocompatibility complex, class I, G 1989 252 C20140704_OR005_03 C20140704_OR005_03 TB412560.[MT7]-MNLQTLR.2b4_1.heavy 510.293 / 631.335 4448.0 30.02389907836914 38 18 0 10 10 5.414965490047522 18.4673383761717 0.0 3 0.9888809620838305 11.692988698549499 4448.0 13.286211119735924 1.0 - - - - - - - 155.4 8 5 HLA-G major histocompatibility complex, class I, G 1991 252 C20140704_OR005_03 C20140704_OR005_03 TB412560.[MT7]-MNLQTLR.2y6_1.heavy 510.293 / 744.436 12121.0 30.02389907836914 38 18 0 10 10 5.414965490047522 18.4673383761717 0.0 3 0.9888809620838305 11.692988698549499 12121.0 104.83027027027026 0.0 - - - - - - - 238.0 24 7 HLA-G major histocompatibility complex, class I, G 1993 253 C20140704_OR005_03 C20140704_OR005_03 TB427155.[MT7]-NEEEVLVEC[CAM]R.2y8_1.heavy 710.847 / 1033.5 4555.0 28.195874214172363 31 13 4 6 8 1.2612475541855706 55.64388372129611 0.038700103759765625 4 0.9228553312206857 4.414455092496748 4555.0 84.31129807692307 1.0 - - - - - - - 129.75 16 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1995 253 C20140704_OR005_03 C20140704_OR005_03 TB427155.[MT7]-NEEEVLVEC[CAM]R.2b4_1.heavy 710.847 / 646.28 3313.0 28.195874214172363 31 13 4 6 8 1.2612475541855706 55.64388372129611 0.038700103759765625 4 0.9228553312206857 4.414455092496748 3313.0 19.145586001211612 0.0 - - - - - - - 192.42857142857142 6 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1997 253 C20140704_OR005_03 C20140704_OR005_03 TB427155.[MT7]-NEEEVLVEC[CAM]R.2y6_1.heavy 710.847 / 775.413 2692.0 28.195874214172363 31 13 4 6 8 1.2612475541855706 55.64388372129611 0.038700103759765625 4 0.9228553312206857 4.414455092496748 2692.0 41.41538461538461 0.0 - - - - - - - 104.0 5 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 1999 253 C20140704_OR005_03 C20140704_OR005_03 TB427155.[MT7]-NEEEVLVEC[CAM]R.2b5_1.heavy 710.847 / 745.349 3002.0 28.195874214172363 31 13 4 6 8 1.2612475541855706 55.64388372129611 0.038700103759765625 4 0.9228553312206857 4.414455092496748 3002.0 9.598506375001552 0.0 - - - - - - - 190.16666666666666 6 6 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 2001 254 C20140704_OR005_03 C20140704_OR005_03 TB427156.[MT7]-NEEEVLVEC[CAM]R.3b4_1.heavy 474.233 / 646.28 5681.0 28.186199188232422 44 14 10 10 10 1.792940167494378 44.16144082551483 0.0 3 0.9348275988235396 4.807764003922733 5681.0 40.272508960573475 0.0 - - - - - - - 172.16666666666666 11 6 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 2003 254 C20140704_OR005_03 C20140704_OR005_03 TB427156.[MT7]-NEEEVLVEC[CAM]R.3b5_1.heavy 474.233 / 745.349 3306.0 28.186199188232422 44 14 10 10 10 1.792940167494378 44.16144082551483 0.0 3 0.9348275988235396 4.807764003922733 3306.0 26.99101449275362 0.0 - - - - - - - 167.875 6 8 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 2005 254 C20140704_OR005_03 C20140704_OR005_03 TB427156.[MT7]-NEEEVLVEC[CAM]R.3y4_1.heavy 474.233 / 563.261 9710.0 28.186199188232422 44 14 10 10 10 1.792940167494378 44.16144082551483 0.0 3 0.9348275988235396 4.807764003922733 9710.0 136.95376389475166 0.0 - - - - - - - 162.28571428571428 19 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 2007 254 C20140704_OR005_03 C20140704_OR005_03 TB427156.[MT7]-NEEEVLVEC[CAM]R.3y5_1.heavy 474.233 / 676.345 4442.0 28.186199188232422 44 14 10 10 10 1.792940167494378 44.16144082551483 0.0 3 0.9348275988235396 4.807764003922733 4442.0 69.00194174757281 0.0 - - - - - - - 236.0 8 7 APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 2009 255 C20140704_OR005_03 C20140704_OR005_03 TB450607.[MT7]-QISAEK[MT7].2y4_1.heavy 482.289 / 578.327 9311.0 18.145400047302246 46 20 10 6 10 10.515085096600421 9.510146525807052 0.03740119934082031 3 0.9943613587121054 16.427476542359795 9311.0 173.22090834680043 0.0 - - - - - - - 202.0909090909091 18 11 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 2011 255 C20140704_OR005_03 C20140704_OR005_03 TB450607.[MT7]-QISAEK[MT7].2y5_1.heavy 482.289 / 691.411 8200.0 18.145400047302246 46 20 10 6 10 10.515085096600421 9.510146525807052 0.03740119934082031 3 0.9943613587121054 16.427476542359795 8200.0 29.786282388451273 0.0 - - - - - - - 167.07692307692307 16 13 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 2013 255 C20140704_OR005_03 C20140704_OR005_03 TB450607.[MT7]-QISAEK[MT7].2y3_1.heavy 482.289 / 491.295 3756.0 18.145400047302246 46 20 10 6 10 10.515085096600421 9.510146525807052 0.03740119934082031 3 0.9943613587121054 16.427476542359795 3756.0 36.201275849442055 0.0 - - - - - - - 198.625 7 8 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 2015 255 C20140704_OR005_03 C20140704_OR005_03 TB450607.[MT7]-QISAEK[MT7].2b5_1.heavy 482.289 / 673.364 2328.0 18.145400047302246 46 20 10 6 10 10.515085096600421 9.510146525807052 0.03740119934082031 3 0.9943613587121054 16.427476542359795 2328.0 9.506415094339623 0.0 - - - - - - - 176.58333333333334 4 12 SLC25A4 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4