Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140704_OR005_04 C20140704_OR005_04 TB413350.[MT7]-YK[MT7]PVTNQVEC[CAM]HPYLTQEK[MT7].4y5_1.heavy 667.355 / 762.448 17654.0 26.783899307250977 47 17 10 10 10 3.091231828168967 25.815536553349975 0.0 3 0.9767194806142473 8.072719598393292 17654.0 220.85803478260868 0.0 - - - - - - - 266.0 35 9 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 3 1 C20140704_OR005_04 C20140704_OR005_04 TB413350.[MT7]-YK[MT7]PVTNQVEC[CAM]HPYLTQEK[MT7].4y4_1.heavy 667.355 / 649.364 36804.0 26.783899307250977 47 17 10 10 10 3.091231828168967 25.815536553349975 0.0 3 0.9767194806142473 8.072719598393292 36804.0 43.533455143218745 0.0 - - - - - - - 1724.2857142857142 73 7 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 5 1 C20140704_OR005_04 C20140704_OR005_04 TB413350.[MT7]-YK[MT7]PVTNQVEC[CAM]HPYLTQEK[MT7].4b7_2.heavy 667.355 / 560.324 32714.0 26.783899307250977 47 17 10 10 10 3.091231828168967 25.815536553349975 0.0 3 0.9767194806142473 8.072719598393292 32714.0 238.76970000504195 0.0 - - - - - - - 232.55555555555554 65 9 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 7 1 C20140704_OR005_04 C20140704_OR005_04 TB413350.[MT7]-YK[MT7]PVTNQVEC[CAM]HPYLTQEK[MT7].4y7_1.heavy 667.355 / 1022.56 22242.0 26.783899307250977 47 17 10 10 10 3.091231828168967 25.815536553349975 0.0 3 0.9767194806142473 8.072719598393292 22242.0 71.14330135510696 0.0 - - - - - - - 182.83333333333334 44 6 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 9 2 C20140704_OR005_04 C20140704_OR005_04 TB427509.[MT7]-YQLGSTSYLPDK[MT7]LPK[MT7].4b4_1.heavy 536.31 / 606.337 14891.0 34.340200424194336 42 18 10 6 8 5.3593005045410065 18.659151490995637 0.039997100830078125 4 0.9860789858719098 10.447727183395136 14891.0 73.1098690615201 0.0 - - - - - - - 239.8125 29 16 PLAGL2 pleiomorphic adenoma gene-like 2 11 2 C20140704_OR005_04 C20140704_OR005_04 TB427509.[MT7]-YQLGSTSYLPDK[MT7]LPK[MT7].4y6_1.heavy 536.31 / 985.628 2933.0 34.340200424194336 42 18 10 6 8 5.3593005045410065 18.659151490995637 0.039997100830078125 4 0.9860789858719098 10.447727183395136 2933.0 25.436637168141594 1.0 - - - - - - - 205.1818181818182 5 11 PLAGL2 pleiomorphic adenoma gene-like 2 13 2 C20140704_OR005_04 C20140704_OR005_04 TB427509.[MT7]-YQLGSTSYLPDK[MT7]LPK[MT7].4y3_1.heavy 536.31 / 501.352 3723.0 34.340200424194336 42 18 10 6 8 5.3593005045410065 18.659151490995637 0.039997100830078125 4 0.9860789858719098 10.447727183395136 3723.0 2.385562372188139 2.0 - - - - - - - 761.625 9 8 PLAGL2 pleiomorphic adenoma gene-like 2 15 2 C20140704_OR005_04 C20140704_OR005_04 TB427509.[MT7]-YQLGSTSYLPDK[MT7]LPK[MT7].4b3_1.heavy 536.31 / 549.315 13537.0 34.340200424194336 42 18 10 6 8 5.3593005045410065 18.659151490995637 0.039997100830078125 4 0.9860789858719098 10.447727183395136 13537.0 70.87097927635264 0.0 - - - - - - - 290.0 27 7 PLAGL2 pleiomorphic adenoma gene-like 2 17 3 C20140704_OR005_04 C20140704_OR005_04 TB413000.[MT7]-SWLFQHIGHPYPTEDEK[MT7].3y6_1.heavy 791.402 / 862.427 5619.0 35.608299255371094 44 14 10 10 10 1.1784850258333601 49.98719671597772 0.0 3 0.9346805622884813 4.802289435734112 5619.0 33.692101553856986 0.0 - - - - - - - 293.2 11 5 PKNOX1 PBX/knotted 1 homeobox 1 19 3 C20140704_OR005_04 C20140704_OR005_04 TB413000.[MT7]-SWLFQHIGHPYPTEDEK[MT7].3b4_1.heavy 791.402 / 678.373 2321.0 35.608299255371094 44 14 10 10 10 1.1784850258333601 49.98719671597772 0.0 3 0.9346805622884813 4.802289435734112 2321.0 4.450910309051407 0.0 - - - - - - - 763.5 4 8 PKNOX1 PBX/knotted 1 homeobox 1 21 3 C20140704_OR005_04 C20140704_OR005_04 TB413000.[MT7]-SWLFQHIGHPYPTEDEK[MT7].3b3_1.heavy 791.402 / 531.305 2443.0 35.608299255371094 44 14 10 10 10 1.1784850258333601 49.98719671597772 0.0 3 0.9346805622884813 4.802289435734112 2443.0 2.8157075306919706 1.0 - - - - - - - 331.42857142857144 5 7 PKNOX1 PBX/knotted 1 homeobox 1 23 3 C20140704_OR005_04 C20140704_OR005_04 TB413000.[MT7]-SWLFQHIGHPYPTEDEK[MT7].3y8_1.heavy 791.402 / 1122.54 6230.0 35.608299255371094 44 14 10 10 10 1.1784850258333601 49.98719671597772 0.0 3 0.9346805622884813 4.802289435734112 6230.0 71.23647540983606 0.0 - - - - - - - 244.0 12 6 PKNOX1 PBX/knotted 1 homeobox 1 25 4 C20140704_OR005_04 C20140704_OR005_04 TB450802.[MT7]-QEEEVGWK[MT7].2b3_1.heavy 646.84 / 531.253 1645.0 26.34830093383789 48 18 10 10 10 4.89337708775678 20.435784573030315 0.0 3 0.9874706622582402 11.013968106822865 1645.0 11.371135352566663 1.0 - - - - - - - 264.1818181818182 3 11 PLAGL2 pleiomorphic adenoma gene-like 2 27 4 C20140704_OR005_04 C20140704_OR005_04 TB450802.[MT7]-QEEEVGWK[MT7].2y4_1.heavy 646.84 / 633.384 3097.0 26.34830093383789 48 18 10 10 10 4.89337708775678 20.435784573030315 0.0 3 0.9874706622582402 11.013968106822865 3097.0 35.367233558478496 0.0 - - - - - - - 181.625 6 8 PLAGL2 pleiomorphic adenoma gene-like 2 29 4 C20140704_OR005_04 C20140704_OR005_04 TB450802.[MT7]-QEEEVGWK[MT7].2b4_1.heavy 646.84 / 660.296 3097.0 26.34830093383789 48 18 10 10 10 4.89337708775678 20.435784573030315 0.0 3 0.9874706622582402 11.013968106822865 3097.0 17.98829105408536 0.0 - - - - - - - 242.0 6 8 PLAGL2 pleiomorphic adenoma gene-like 2 31 4 C20140704_OR005_04 C20140704_OR005_04 TB450802.[MT7]-QEEEVGWK[MT7].2y3_1.heavy 646.84 / 534.316 4646.0 26.34830093383789 48 18 10 10 10 4.89337708775678 20.435784573030315 0.0 3 0.9874706622582402 11.013968106822865 4646.0 53.01882605532587 0.0 - - - - - - - 266.125 9 8 PLAGL2 pleiomorphic adenoma gene-like 2 33 5 C20140704_OR005_04 C20140704_OR005_04 TB450897.[MT7]-DVLAFTC[CAM]EPK[MT7].2y5_1.heavy 734.391 / 778.389 1833.0 34.60499954223633 45 15 10 10 10 3.1936025081133814 31.31260065895769 0.0 3 0.956884077913708 5.922030368645632 1833.0 2.8310366552119124 0.0 - - - - - - - 162.0 3 6 PSG3;PSG5;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 35 5 C20140704_OR005_04 C20140704_OR005_04 TB450897.[MT7]-DVLAFTC[CAM]EPK[MT7].2b4_1.heavy 734.391 / 543.326 4744.0 34.60499954223633 45 15 10 10 10 3.1936025081133814 31.31260065895769 0.0 3 0.956884077913708 5.922030368645632 4744.0 2.477477216800964 1.0 - - - - - - - 242.625 11 8 PSG3;PSG5;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 37 5 C20140704_OR005_04 C20140704_OR005_04 TB450897.[MT7]-DVLAFTC[CAM]EPK[MT7].2y6_1.heavy 734.391 / 925.457 4636.0 34.60499954223633 45 15 10 10 10 3.1936025081133814 31.31260065895769 0.0 3 0.956884077913708 5.922030368645632 4636.0 13.578823529411766 1.0 - - - - - - - 205.0 9 10 PSG3;PSG5;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 39 5 C20140704_OR005_04 C20140704_OR005_04 TB450897.[MT7]-DVLAFTC[CAM]EPK[MT7].2y7_1.heavy 734.391 / 996.494 4420.0 34.60499954223633 45 15 10 10 10 3.1936025081133814 31.31260065895769 0.0 3 0.956884077913708 5.922030368645632 4420.0 14.801542818084172 0.0 - - - - - - - 274.45454545454544 8 11 PSG3;PSG5;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 41 6 C20140704_OR005_04 C20140704_OR005_04 TB413008.[MT7]-SNINEFLDIARR.3b4_1.heavy 531.294 / 573.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 43 6 C20140704_OR005_04 C20140704_OR005_04 TB413008.[MT7]-SNINEFLDIARR.3b5_1.heavy 531.294 / 702.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 45 6 C20140704_OR005_04 C20140704_OR005_04 TB413008.[MT7]-SNINEFLDIARR.3y4_1.heavy 531.294 / 515.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 47 6 C20140704_OR005_04 C20140704_OR005_04 TB413008.[MT7]-SNINEFLDIARR.3y5_1.heavy 531.294 / 630.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 49 7 C20140704_OR005_04 C20140704_OR005_04 TB426971.[MT7]-VSHGC[CAM]VSK[MT7].2y4_1.heavy 581.318 / 637.346 750.0 16.06899929046631 40 14 10 6 10 2.301675542773132 33.927926995030134 0.03339958190917969 3 0.9399187531019557 5.009497137869992 750.0 7.009345794392523 0.0 - - - - - - - 0.0 1 0 PAX1;PAX2;PAX3;PAX5;PAX7;PAX9;PAX8 paired box 1;paired box 2;paired box 3;paired box 5;paired box 7;paired box 9;paired box 8 51 7 C20140704_OR005_04 C20140704_OR005_04 TB426971.[MT7]-VSHGC[CAM]VSK[MT7].2y5_1.heavy 581.318 / 694.367 2302.0 16.06899929046631 40 14 10 6 10 2.301675542773132 33.927926995030134 0.03339958190917969 3 0.9399187531019557 5.009497137869992 2302.0 80.57 0.0 - - - - - - - 138.0 4 7 PAX1;PAX2;PAX3;PAX5;PAX7;PAX9;PAX8 paired box 1;paired box 2;paired box 3;paired box 5;paired box 7;paired box 9;paired box 8 53 7 C20140704_OR005_04 C20140704_OR005_04 TB426971.[MT7]-VSHGC[CAM]VSK[MT7].2y6_1.heavy 581.318 / 831.426 482.0 16.06899929046631 40 14 10 6 10 2.301675542773132 33.927926995030134 0.03339958190917969 3 0.9399187531019557 5.009497137869992 482.0 13.42609415022499 0.0 - - - - - - - 0.0 0 0 PAX1;PAX2;PAX3;PAX5;PAX7;PAX9;PAX8 paired box 1;paired box 2;paired box 3;paired box 5;paired box 7;paired box 9;paired box 8 55 7 C20140704_OR005_04 C20140704_OR005_04 TB426971.[MT7]-VSHGC[CAM]VSK[MT7].2y7_1.heavy 581.318 / 918.458 2410.0 16.06899929046631 40 14 10 6 10 2.301675542773132 33.927926995030134 0.03339958190917969 3 0.9399187531019557 5.009497137869992 2410.0 89.25925925925925 0.0 - - - - - - - 120.75 4 4 PAX1;PAX2;PAX3;PAX5;PAX7;PAX9;PAX8 paired box 1;paired box 2;paired box 3;paired box 5;paired box 7;paired box 9;paired box 8 57 8 C20140704_OR005_04 C20140704_OR005_04 TB426970.[MT7]-HNSPERK[MT7].2y4_1.heavy 578.327 / 673.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 59 8 C20140704_OR005_04 C20140704_OR005_04 TB426970.[MT7]-HNSPERK[MT7].2y5_1.heavy 578.327 / 760.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 61 8 C20140704_OR005_04 C20140704_OR005_04 TB426970.[MT7]-HNSPERK[MT7].2y6_1.heavy 578.327 / 874.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 63 8 C20140704_OR005_04 C20140704_OR005_04 TB426970.[MT7]-HNSPERK[MT7].2b5_1.heavy 578.327 / 709.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 65 9 C20140704_OR005_04 C20140704_OR005_04 TB427518.[MT7]-FSMVLPEVEAALAEIPGVR.3y7_1.heavy 724.733 / 741.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 67 9 C20140704_OR005_04 C20140704_OR005_04 TB427518.[MT7]-FSMVLPEVEAALAEIPGVR.3b4_1.heavy 724.733 / 609.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 69 9 C20140704_OR005_04 C20140704_OR005_04 TB427518.[MT7]-FSMVLPEVEAALAEIPGVR.3b5_1.heavy 724.733 / 722.403 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 71 9 C20140704_OR005_04 C20140704_OR005_04 TB427518.[MT7]-FSMVLPEVEAALAEIPGVR.3b3_1.heavy 724.733 / 510.25 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 73 10 C20140704_OR005_04 C20140704_OR005_04 TB413202.[MT7]-DHLRNHLQTHDPNK[MT7].4b8_2.heavy 504.021 / 579.816 2379.0 16.773399353027344 48 18 10 10 10 11.861580846759809 8.43057947266082 0.0 3 0.9882274303925229 11.363176440818982 2379.0 34.143055555555556 0.0 - - - - - - - 172.9 4 10 PLAGL2 pleiomorphic adenoma gene-like 2 75 10 C20140704_OR005_04 C20140704_OR005_04 TB413202.[MT7]-DHLRNHLQTHDPNK[MT7].4b7_2.heavy 504.021 / 515.787 2054.0 16.773399353027344 48 18 10 10 10 11.861580846759809 8.43057947266082 0.0 3 0.9882274303925229 11.363176440818982 2054.0 49.44814814814815 0.0 - - - - - - - 162.0 4 9 PLAGL2 pleiomorphic adenoma gene-like 2 77 10 C20140704_OR005_04 C20140704_OR005_04 TB413202.[MT7]-DHLRNHLQTHDPNK[MT7].4y3_1.heavy 504.021 / 502.311 15463.0 16.773399353027344 48 18 10 10 10 11.861580846759809 8.43057947266082 0.0 3 0.9882274303925229 11.363176440818982 15463.0 278.98388574304767 0.0 - - - - - - - 221.4 30 10 PLAGL2 pleiomorphic adenoma gene-like 2 79 10 C20140704_OR005_04 C20140704_OR005_04 TB413202.[MT7]-DHLRNHLQTHDPNK[MT7].4b6_1.heavy 504.021 / 917.482 162.0 16.773399353027344 48 18 10 10 10 11.861580846759809 8.43057947266082 0.0 3 0.9882274303925229 11.363176440818982 162.0 0.992 4.0 - - - - - - - 0.0 0 0 PLAGL2 pleiomorphic adenoma gene-like 2 81 11 C20140704_OR005_04 C20140704_OR005_04 TB412750.[MT7]-EAILYTYK[MT7].3y3_1.heavy 430.251 / 555.326 1361.0 33.25740051269531 40 14 10 10 6 1.6294090927824654 61.37194179347232 0.0 5 0.9353215810758964 4.8262922923883 1361.0 1.3534394904458598 2.0 - - - - - - - 167.4 4 5 MSH4 mutS homolog 4 (E. coli) 83 11 C20140704_OR005_04 C20140704_OR005_04 TB412750.[MT7]-EAILYTYK[MT7].3b4_1.heavy 430.251 / 571.357 11408.0 33.25740051269531 40 14 10 10 6 1.6294090927824654 61.37194179347232 0.0 5 0.9353215810758964 4.8262922923883 11408.0 136.28009948437972 0.0 - - - - - - - 170.0 22 8 MSH4 mutS homolog 4 (E. coli) 85 11 C20140704_OR005_04 C20140704_OR005_04 TB412750.[MT7]-EAILYTYK[MT7].3y4_1.heavy 430.251 / 718.389 105.0 33.25740051269531 40 14 10 10 6 1.6294090927824654 61.37194179347232 0.0 5 0.9353215810758964 4.8262922923883 105.0 1.0042822966507177 11.0 - - - - - - - 0.0 0 0 MSH4 mutS homolog 4 (E. coli) 87 11 C20140704_OR005_04 C20140704_OR005_04 TB412750.[MT7]-EAILYTYK[MT7].3b3_1.heavy 430.251 / 458.273 52228.0 33.25740051269531 40 14 10 10 6 1.6294090927824654 61.37194179347232 0.0 5 0.9353215810758964 4.8262922923883 52228.0 338.76743483948877 0.0 - - - - - - - 218.9090909090909 104 11 MSH4 mutS homolog 4 (E. coli) 89 12 C20140704_OR005_04 C20140704_OR005_04 TB412755.[MT7]-GREAESQVK[MT7].2b8_1.heavy 646.364 / 1001.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 91 12 C20140704_OR005_04 C20140704_OR005_04 TB412755.[MT7]-GREAESQVK[MT7].2y4_1.heavy 646.364 / 605.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 93 12 C20140704_OR005_04 C20140704_OR005_04 TB412755.[MT7]-GREAESQVK[MT7].2b7_1.heavy 646.364 / 902.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 95 12 C20140704_OR005_04 C20140704_OR005_04 TB412755.[MT7]-GREAESQVK[MT7].2b5_1.heavy 646.364 / 687.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 97 13 C20140704_OR005_04 C20140704_OR005_04 TB427513.[MT7]-FVAAVHYEQPTIQIELR.4y5_1.heavy 540.3 / 658.388 7764.0 38.58369827270508 35 5 10 10 10 1.1280950210352079 58.36342874491789 0.0 3 0.6439621795351514 2.0035225044758285 7764.0 29.816198952879578 0.0 - - - - - - - 218.14285714285714 15 7 TACSTD2 tumor-associated calcium signal transducer 2 99 13 C20140704_OR005_04 C20140704_OR005_04 TB427513.[MT7]-FVAAVHYEQPTIQIELR.4b5_1.heavy 540.3 / 632.389 1018.0 38.58369827270508 35 5 10 10 10 1.1280950210352079 58.36342874491789 0.0 3 0.6439621795351514 2.0035225044758285 1018.0 2.053877335445963 2.0 - - - - - - - 178.2 2 5 TACSTD2 tumor-associated calcium signal transducer 2 101 13 C20140704_OR005_04 C20140704_OR005_04 TB427513.[MT7]-FVAAVHYEQPTIQIELR.4y6_1.heavy 540.3 / 771.472 1909.0 38.58369827270508 35 5 10 10 10 1.1280950210352079 58.36342874491789 0.0 3 0.6439621795351514 2.0035225044758285 1909.0 4.624296690976044 1.0 - - - - - - - 198.0 3 9 TACSTD2 tumor-associated calcium signal transducer 2 103 13 C20140704_OR005_04 C20140704_OR005_04 TB427513.[MT7]-FVAAVHYEQPTIQIELR.4b9_2.heavy 540.3 / 595.31 6746.0 38.58369827270508 35 5 10 10 10 1.1280950210352079 58.36342874491789 0.0 3 0.6439621795351514 2.0035225044758285 6746.0 60.13199665857092 0.0 - - - - - - - 254.66666666666666 13 6 TACSTD2 tumor-associated calcium signal transducer 2 105 14 C20140704_OR005_04 C20140704_OR005_04 TB426844.[MT7]-AQESQK[MT7].2y4_1.heavy 489.777 / 635.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF20;RNF40 ring finger protein 20;ring finger protein 40 107 14 C20140704_OR005_04 C20140704_OR005_04 TB426844.[MT7]-AQESQK[MT7].2y5_1.heavy 489.777 / 763.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF20;RNF40 ring finger protein 20;ring finger protein 40 109 14 C20140704_OR005_04 C20140704_OR005_04 TB426844.[MT7]-AQESQK[MT7].2y3_1.heavy 489.777 / 506.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF20;RNF40 ring finger protein 20;ring finger protein 40 111 14 C20140704_OR005_04 C20140704_OR005_04 TB426844.[MT7]-AQESQK[MT7].2b5_1.heavy 489.777 / 688.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF20;RNF40 ring finger protein 20;ring finger protein 40 113 15 C20140704_OR005_04 C20140704_OR005_04 TB413206.[MT7]-DYLEERLEAEFGQK[MT7].3y6_1.heavy 672.349 / 823.443 2005.0 39.897300720214844 46 16 10 10 10 2.1937688088703307 31.548223324108264 0.0 3 0.9651419336115551 6.590843925000522 2005.0 11.030840311409055 0.0 - - - - - - - 181.0 4 9 SCLY selenocysteine lyase 115 15 C20140704_OR005_04 C20140704_OR005_04 TB413206.[MT7]-DYLEERLEAEFGQK[MT7].3b4_1.heavy 672.349 / 665.326 2256.0 39.897300720214844 46 16 10 10 10 2.1937688088703307 31.548223324108264 0.0 3 0.9651419336115551 6.590843925000522 2256.0 14.088764940239042 1.0 - - - - - - - 235.0 4 8 SCLY selenocysteine lyase 117 15 C20140704_OR005_04 C20140704_OR005_04 TB413206.[MT7]-DYLEERLEAEFGQK[MT7].3y4_1.heavy 672.349 / 623.363 2632.0 39.897300720214844 46 16 10 10 10 2.1937688088703307 31.548223324108264 0.0 3 0.9651419336115551 6.590843925000522 2632.0 11.891633466135458 0.0 - - - - - - - 572.8571428571429 5 7 SCLY selenocysteine lyase 119 15 C20140704_OR005_04 C20140704_OR005_04 TB413206.[MT7]-DYLEERLEAEFGQK[MT7].3y13_2.heavy 672.349 / 878.455 3759.0 39.897300720214844 46 16 10 10 10 2.1937688088703307 31.548223324108264 0.0 3 0.9651419336115551 6.590843925000522 3759.0 32.29671078677309 0.0 - - - - - - - 250.71428571428572 7 7 SCLY selenocysteine lyase 121 16 C20140704_OR005_04 C20140704_OR005_04 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 135354.0 30.021499633789062 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 135354.0 447.85243680485337 0.0 - - - - - - - 166.0 270 10 123 16 C20140704_OR005_04 C20140704_OR005_04 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 49939.0 30.021499633789062 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 49939.0 722.2731664050234 0.0 - - - - - - - 195.4 99 10 125 16 C20140704_OR005_04 C20140704_OR005_04 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 59223.0 30.021499633789062 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 59223.0 225.28053282182435 0.0 - - - - - - - 310.47058823529414 118 17 127 17 C20140704_OR005_04 C20140704_OR005_04 TB450576.[MT7]-AFFDNR.2b3_1.heavy 457.236 / 510.283 4274.0 28.838850498199463 39 13 10 6 10 1.949257816821512 51.30157700896716 0.03579902648925781 3 0.9090425955382021 4.060646374578793 4274.0 2.4563218390804598 1.0 - - - - - - - 231.83333333333334 9 12 TESC tescalcin 129 17 C20140704_OR005_04 C20140704_OR005_04 TB450576.[MT7]-AFFDNR.2y4_1.heavy 457.236 / 551.257 4374.0 28.838850498199463 39 13 10 6 10 1.949257816821512 51.30157700896716 0.03579902648925781 3 0.9090425955382021 4.060646374578793 4374.0 21.038806099462835 0.0 - - - - - - - 198.8181818181818 8 11 TESC tescalcin 131 17 C20140704_OR005_04 C20140704_OR005_04 TB450576.[MT7]-AFFDNR.2y5_1.heavy 457.236 / 698.326 11630.0 28.838850498199463 39 13 10 6 10 1.949257816821512 51.30157700896716 0.03579902648925781 3 0.9090425955382021 4.060646374578793 11630.0 140.75814787716197 0.0 - - - - - - - 269.7142857142857 23 7 TESC tescalcin 133 17 C20140704_OR005_04 C20140704_OR005_04 TB450576.[MT7]-AFFDNR.2b4_1.heavy 457.236 / 625.31 31809.0 28.838850498199463 39 13 10 6 10 1.949257816821512 51.30157700896716 0.03579902648925781 3 0.9090425955382021 4.060646374578793 31809.0 83.20261569416499 0.0 - - - - - - - 369.2857142857143 63 7 TESC tescalcin 135 18 C20140704_OR005_04 C20140704_OR005_04 TB426981.[MT7]-LSLPYGLK[MT7].2y4_1.heavy 589.873 / 624.384 5106.0 37.890499114990234 46 18 10 10 8 1.466033566286701 50.384444624889454 0.0 4 0.982862564696478 9.41384998375403 5106.0 27.713583515598025 0.0 - - - - - - - 212.66666666666666 10 3 PHF1 PHD finger protein 1 137 18 C20140704_OR005_04 C20140704_OR005_04 TB426981.[MT7]-LSLPYGLK[MT7].2y5_1.heavy 589.873 / 721.437 43913.0 37.890499114990234 46 18 10 10 8 1.466033566286701 50.384444624889454 0.0 4 0.982862564696478 9.41384998375403 43913.0 140.7948490984282 0.0 - - - - - - - 266.8181818181818 87 11 PHF1 PHD finger protein 1 139 18 C20140704_OR005_04 C20140704_OR005_04 TB426981.[MT7]-LSLPYGLK[MT7].2y6_1.heavy 589.873 / 834.521 4596.0 37.890499114990234 46 18 10 10 8 1.466033566286701 50.384444624889454 0.0 4 0.982862564696478 9.41384998375403 4596.0 22.713882352941177 0.0 - - - - - - - 218.71428571428572 9 7 PHF1 PHD finger protein 1 141 18 C20140704_OR005_04 C20140704_OR005_04 TB426981.[MT7]-LSLPYGLK[MT7].2y7_1.heavy 589.873 / 921.553 12127.0 37.890499114990234 46 18 10 10 8 1.466033566286701 50.384444624889454 0.0 4 0.982862564696478 9.41384998375403 12127.0 118.50194496573107 1.0 - - - - - - - 226.88888888888889 36 9 PHF1 PHD finger protein 1 143 19 C20140704_OR005_04 C20140704_OR005_04 TB427512.[MT7]-FVAAVHYEQPTIQIELR.3b5_1.heavy 720.064 / 632.389 26486.0 38.59337329864502 30 14 2 6 8 3.8644752772332773 25.876734310898154 0.038700103759765625 4 0.9491255616836409 5.448211153620419 26486.0 110.79445869634534 0.0 - - - - - - - 240.55555555555554 52 9 TACSTD2 tumor-associated calcium signal transducer 2 145 19 C20140704_OR005_04 C20140704_OR005_04 TB427512.[MT7]-FVAAVHYEQPTIQIELR.3y8_1.heavy 720.064 / 969.573 57429.0 38.59337329864502 30 14 2 6 8 3.8644752772332773 25.876734310898154 0.038700103759765625 4 0.9491255616836409 5.448211153620419 57429.0 570.892604815105 1.0 - - - - - - - 286.625 240 8 TACSTD2 tumor-associated calcium signal transducer 2 147 19 C20140704_OR005_04 C20140704_OR005_04 TB427512.[MT7]-FVAAVHYEQPTIQIELR.3y10_1.heavy 720.064 / 1226.67 5475.0 38.59337329864502 30 14 2 6 8 3.8644752772332773 25.876734310898154 0.038700103759765625 4 0.9491255616836409 5.448211153620419 5475.0 44.32951562872823 0.0 - - - - - - - 145.28571428571428 10 7 TACSTD2 tumor-associated calcium signal transducer 2 149 19 C20140704_OR005_04 C20140704_OR005_04 TB427512.[MT7]-FVAAVHYEQPTIQIELR.3y9_1.heavy 720.064 / 1097.63 8277.0 38.59337329864502 30 14 2 6 8 3.8644752772332773 25.876734310898154 0.038700103759765625 4 0.9491255616836409 5.448211153620419 8277.0 54.446344017603856 0.0 - - - - - - - 236.42857142857142 16 7 TACSTD2 tumor-associated calcium signal transducer 2 151 20 C20140704_OR005_04 C20140704_OR005_04 TB413237.[MT7]-AAELVTQNC[CAM]EAYEAHMR.3y7_1.heavy 713.002 / 877.398 7727.0 30.46762466430664 44 18 10 6 10 5.756027336350165 17.37309330838045 0.03749847412109375 3 0.9870738398018344 10.843230174376467 7727.0 20.184639359314424 0.0 - - - - - - - 169.125 15 8 SCLY selenocysteine lyase 153 20 C20140704_OR005_04 C20140704_OR005_04 TB413237.[MT7]-AAELVTQNC[CAM]EAYEAHMR.3y6_1.heavy 713.002 / 806.361 6471.0 30.46762466430664 44 18 10 6 10 5.756027336350165 17.37309330838045 0.03749847412109375 3 0.9870738398018344 10.843230174376467 6471.0 18.091997041420115 0.0 - - - - - - - 154.8 12 10 SCLY selenocysteine lyase 155 20 C20140704_OR005_04 C20140704_OR005_04 TB413237.[MT7]-AAELVTQNC[CAM]EAYEAHMR.3b4_1.heavy 713.002 / 529.31 22311.0 30.46762466430664 44 18 10 6 10 5.756027336350165 17.37309330838045 0.03749847412109375 3 0.9870738398018344 10.843230174376467 22311.0 133.0555954971768 0.0 - - - - - - - 178.3846153846154 44 13 SCLY selenocysteine lyase 157 20 C20140704_OR005_04 C20140704_OR005_04 TB413237.[MT7]-AAELVTQNC[CAM]EAYEAHMR.3b5_1.heavy 713.002 / 628.379 11397.0 30.46762466430664 44 18 10 6 10 5.756027336350165 17.37309330838045 0.03749847412109375 3 0.9870738398018344 10.843230174376467 11397.0 160.66354735323966 0.0 - - - - - - - 228.36363636363637 22 11 SCLY selenocysteine lyase 159 21 C20140704_OR005_04 C20140704_OR005_04 TB413238.[MT7]-YQLGSTSYLPDK[MT7]LPK[MT7].3y6_1.heavy 714.744 / 985.628 7486.0 34.38019943237305 45 20 10 5 10 88.69862607453945 1.1274131790492814 0.04000091552734375 3 0.9923937865798282 14.141727144502667 7486.0 37.05181869020601 0.0 - - - - - - - 273.5 14 8 PLAGL2 pleiomorphic adenoma gene-like 2 161 21 C20140704_OR005_04 C20140704_OR005_04 TB413238.[MT7]-YQLGSTSYLPDK[MT7]LPK[MT7].3y4_1.heavy 714.744 / 773.549 1037.0 34.38019943237305 45 20 10 5 10 88.69862607453945 1.1274131790492814 0.04000091552734375 3 0.9923937865798282 14.141727144502667 1037.0 4.931773475605933 2.0 - - - - - - - 249.58333333333334 2 12 PLAGL2 pleiomorphic adenoma gene-like 2 163 21 C20140704_OR005_04 C20140704_OR005_04 TB413238.[MT7]-YQLGSTSYLPDK[MT7]LPK[MT7].3b3_1.heavy 714.744 / 549.315 3686.0 34.38019943237305 45 20 10 5 10 88.69862607453945 1.1274131790492814 0.04000091552734375 3 0.9923937865798282 14.141727144502667 3686.0 17.145302931596092 0.0 - - - - - - - 230.25 7 8 PLAGL2 pleiomorphic adenoma gene-like 2 165 21 C20140704_OR005_04 C20140704_OR005_04 TB413238.[MT7]-YQLGSTSYLPDK[MT7]LPK[MT7].3b7_1.heavy 714.744 / 881.448 1382.0 34.38019943237305 45 20 10 5 10 88.69862607453945 1.1274131790492814 0.04000091552734375 3 0.9923937865798282 14.141727144502667 1382.0 2.7965317919075146 0.0 - - - - - - - 230.33333333333334 2 6 PLAGL2 pleiomorphic adenoma gene-like 2 167 22 C20140704_OR005_04 C20140704_OR005_04 TB413235.[MT7]-FLDTEQLLSVLVQIPK[MT7].3b6_1.heavy 711.092 / 878.438 2653.0 54.55945014953613 44 17 10 7 10 1.8059836493898442 43.07598714152155 0.02899932861328125 3 0.970481489263972 7.165409397426121 2653.0 39.373293109187756 0.0 - - - - - - - 103.38461538461539 5 13 MSH4 mutS homolog 4 (E. coli) 169 22 C20140704_OR005_04 C20140704_OR005_04 TB413235.[MT7]-FLDTEQLLSVLVQIPK[MT7].3b5_1.heavy 711.092 / 750.379 959.0 54.55945014953613 44 17 10 7 10 1.8059836493898442 43.07598714152155 0.02899932861328125 3 0.970481489263972 7.165409397426121 959.0 16.58604514613779 0.0 - - - - - - - 0.0 1 0 MSH4 mutS homolog 4 (E. coli) 171 22 C20140704_OR005_04 C20140704_OR005_04 TB413235.[MT7]-FLDTEQLLSVLVQIPK[MT7].3b3_1.heavy 711.092 / 520.289 895.0 54.55945014953613 44 17 10 7 10 1.8059836493898442 43.07598714152155 0.02899932861328125 3 0.970481489263972 7.165409397426121 895.0 6.318625675936654 2.0 - - - - - - - 116.70588235294117 2 17 MSH4 mutS homolog 4 (E. coli) 173 22 C20140704_OR005_04 C20140704_OR005_04 TB413235.[MT7]-FLDTEQLLSVLVQIPK[MT7].3b7_1.heavy 711.092 / 991.522 1438.0 54.55945014953613 44 17 10 7 10 1.8059836493898442 43.07598714152155 0.02899932861328125 3 0.970481489263972 7.165409397426121 1438.0 11.238772015655577 0.0 - - - - - - - 107.63636363636364 2 11 MSH4 mutS homolog 4 (E. coli) 175 23 C20140704_OR005_04 C20140704_OR005_04 TB427111.[MT7]-QDTVNAAESK[MT7].2y4_1.heavy 675.859 / 578.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 177 23 C20140704_OR005_04 C20140704_OR005_04 TB427111.[MT7]-QDTVNAAESK[MT7].2y5_1.heavy 675.859 / 649.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 179 23 C20140704_OR005_04 C20140704_OR005_04 TB427111.[MT7]-QDTVNAAESK[MT7].2y3_1.heavy 675.859 / 507.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 181 23 C20140704_OR005_04 C20140704_OR005_04 TB427111.[MT7]-QDTVNAAESK[MT7].2y6_1.heavy 675.859 / 763.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 183 24 C20140704_OR005_04 C20140704_OR005_04 TB413233.[MT7]-C[CAM]EQSTQGSEGTTSASFDVDIENFVRK[MT7].3y7_1.heavy 1060.84 / 1049.62 1243.0 39.92940139770508 41 16 10 5 10 6.797742476779519 14.710766161205878 0.0428009033203125 3 0.9644899384404588 6.529697402297297 1243.0 14.115191734680657 0.0 - - - - - - - 193.22222222222223 2 9 PKNOX1 PBX/knotted 1 homeobox 1 185 24 C20140704_OR005_04 C20140704_OR005_04 TB413233.[MT7]-C[CAM]EQSTQGSEGTTSASFDVDIENFVRK[MT7].3b3_1.heavy 1060.84 / 562.241 1741.0 39.92940139770508 41 16 10 5 10 6.797742476779519 14.710766161205878 0.0428009033203125 3 0.9644899384404588 6.529697402297297 1741.0 21.032290452131107 0.0 - - - - - - - 311.0 3 4 PKNOX1 PBX/knotted 1 homeobox 1 187 24 C20140704_OR005_04 C20140704_OR005_04 TB413233.[MT7]-C[CAM]EQSTQGSEGTTSASFDVDIENFVRK[MT7].3y8_1.heavy 1060.84 / 1164.65 1119.0 39.92940139770508 41 16 10 5 10 6.797742476779519 14.710766161205878 0.0428009033203125 3 0.9644899384404588 6.529697402297297 1119.0 5.9392965410027205 0.0 - - - - - - - 179.44444444444446 2 9 PKNOX1 PBX/knotted 1 homeobox 1 189 24 C20140704_OR005_04 C20140704_OR005_04 TB413233.[MT7]-C[CAM]EQSTQGSEGTTSASFDVDIENFVRK[MT7].3y5_1.heavy 1060.84 / 807.496 622.0 39.92940139770508 41 16 10 5 10 6.797742476779519 14.710766161205878 0.0428009033203125 3 0.9644899384404588 6.529697402297297 622.0 4.0321474638500385 0.0 - - - - - - - 0.0 1 0 PKNOX1 PBX/knotted 1 homeobox 1 191 25 C20140704_OR005_04 C20140704_OR005_04 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 32620.0 16.11910057067871 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 32620.0 53.81113872779159 0.0 - - - - - - - 194.44444444444446 65 9 193 25 C20140704_OR005_04 C20140704_OR005_04 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 42673.0 16.11910057067871 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 42673.0 413.4018659450699 0.0 - - - - - - - 176.22222222222223 85 9 195 25 C20140704_OR005_04 C20140704_OR005_04 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 29123.0 16.11910057067871 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 29123.0 264.92186699812964 0.0 - - - - - - - 179.64285714285714 58 14 197 26 C20140704_OR005_04 C20140704_OR005_04 TB426959.[MT7]-IYLSNLK[MT7].2b3_1.heavy 569.857 / 534.341 3075.0 34.43020057678223 23 12 2 5 4 0.8963608621114296 68.19157425746704 0.04000091552734375 7 0.8835614969888614 3.5810225350642084 3075.0 0.9553398058252428 6.0 - - - - - - - 724.375 26 8 MSH4 mutS homolog 4 (E. coli) 199 26 C20140704_OR005_04 C20140704_OR005_04 TB426959.[MT7]-IYLSNLK[MT7].2y4_1.heavy 569.857 / 605.374 4494.0 34.43020057678223 23 12 2 5 4 0.8963608621114296 68.19157425746704 0.04000091552734375 7 0.8835614969888614 3.5810225350642084 4494.0 20.488605760410934 0.0 - - - - - - - 276.1111111111111 8 9 MSH4 mutS homolog 4 (E. coli) 201 26 C20140704_OR005_04 C20140704_OR005_04 TB426959.[MT7]-IYLSNLK[MT7].2y5_1.heavy 569.857 / 718.458 1537.0 34.43020057678223 23 12 2 5 4 0.8963608621114296 68.19157425746704 0.04000091552734375 7 0.8835614969888614 3.5810225350642084 1537.0 7.615254237288135 2.0 - - - - - - - 236.63636363636363 3 11 MSH4 mutS homolog 4 (E. coli) 203 26 C20140704_OR005_04 C20140704_OR005_04 TB426959.[MT7]-IYLSNLK[MT7].2y6_1.heavy 569.857 / 881.521 2720.0 34.43020057678223 23 12 2 5 4 0.8963608621114296 68.19157425746704 0.04000091552734375 7 0.8835614969888614 3.5810225350642084 2720.0 6.535461382306228 1.0 - - - - - - - 319.3 5 10 MSH4 mutS homolog 4 (E. coli) 205 27 C20140704_OR005_04 C20140704_OR005_04 TB413332.[MT7]-RTYTEIVDDIAGMISQLGEK[MT7].4y4_1.heavy 632.588 / 590.363 2010.0 53.85872554779053 21 10 4 3 4 1.007805445266448 65.20660821391331 0.06779861450195312 7 0.8488326530433401 3.13331585928006 2010.0 10.616998456163161 1.0 - - - - - - - 132.92857142857142 5 14 MSH4 mutS homolog 4 (E. coli) 207 27 C20140704_OR005_04 C20140704_OR005_04 TB413332.[MT7]-RTYTEIVDDIAGMISQLGEK[MT7].4b5_1.heavy 632.588 / 795.412 707.0 53.85872554779053 21 10 4 3 4 1.007805445266448 65.20660821391331 0.06779861450195312 7 0.8488326530433401 3.13331585928006 707.0 10.817167785234899 0.0 - - - - - - - 0.0 1 0 MSH4 mutS homolog 4 (E. coli) 209 27 C20140704_OR005_04 C20140704_OR005_04 TB413332.[MT7]-RTYTEIVDDIAGMISQLGEK[MT7].4b9_1.heavy 632.588 / 1237.62 372.0 53.85872554779053 21 10 4 3 4 1.007805445266448 65.20660821391331 0.06779861450195312 7 0.8488326530433401 3.13331585928006 372.0 -0.5 1.0 - - - - - - - 0.0 0 0 MSH4 mutS homolog 4 (E. coli) 211 27 C20140704_OR005_04 C20140704_OR005_04 TB413332.[MT7]-RTYTEIVDDIAGMISQLGEK[MT7].4b9_2.heavy 632.588 / 619.313 2122.0 53.85872554779053 21 10 4 3 4 1.007805445266448 65.20660821391331 0.06779861450195312 7 0.8488326530433401 3.13331585928006 2122.0 4.612820029816526 3.0 - - - - - - - 130.1 7 10 MSH4 mutS homolog 4 (E. coli) 213 28 C20140704_OR005_04 C20140704_OR005_04 TB427113.[MT7]-IYPSFTYYR.2y8_1.heavy 677.352 / 1096.51 36559.0 37.04439926147461 50 20 10 10 10 6.793927786903567 14.719026038629192 0.0 3 0.992880576113152 14.617797676439796 36559.0 346.00482142857146 0.0 - - - - - - - 204.75 73 8 PSG8;PSG1;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 215 28 C20140704_OR005_04 C20140704_OR005_04 TB427113.[MT7]-IYPSFTYYR.2y5_1.heavy 677.352 / 749.362 1135.0 37.04439926147461 50 20 10 10 10 6.793927786903567 14.719026038629192 0.0 3 0.992880576113152 14.617797676439796 1135.0 2.714014142705418 6.0 - - - - - - - 273.0 3 6 PSG8;PSG1;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 217 28 C20140704_OR005_04 C20140704_OR005_04 TB427113.[MT7]-IYPSFTYYR.2y6_1.heavy 677.352 / 836.394 4790.0 37.04439926147461 50 20 10 10 10 6.793927786903567 14.719026038629192 0.0 3 0.992880576113152 14.617797676439796 4790.0 17.74074074074074 0.0 - - - - - - - 267.75 9 8 PSG8;PSG1;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 219 28 C20140704_OR005_04 C20140704_OR005_04 TB427113.[MT7]-IYPSFTYYR.2y7_1.heavy 677.352 / 933.446 58242.0 37.04439926147461 50 20 10 10 10 6.793927786903567 14.719026038629192 0.0 3 0.992880576113152 14.617797676439796 58242.0 160.2975680272109 0.0 - - - - - - - 236.25 116 8 PSG8;PSG1;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 221 29 C20140704_OR005_04 C20140704_OR005_04 TB427116.[MT7]-GGDPSK[MT7]EPER.2y5_1.heavy 680.359 / 802.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 223 29 C20140704_OR005_04 C20140704_OR005_04 TB427116.[MT7]-GGDPSK[MT7]EPER.2b6_1.heavy 680.359 / 830.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 225 29 C20140704_OR005_04 C20140704_OR005_04 TB427116.[MT7]-GGDPSK[MT7]EPER.2b5_1.heavy 680.359 / 558.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 227 29 C20140704_OR005_04 C20140704_OR005_04 TB427116.[MT7]-GGDPSK[MT7]EPER.2y7_1.heavy 680.359 / 986.539 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 229 30 C20140704_OR005_04 C20140704_OR005_04 TB427115.[MT7]-HFHANQTSK[MT7].2y8_1.heavy 679.364 / 1076.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 231 30 C20140704_OR005_04 C20140704_OR005_04 TB427115.[MT7]-HFHANQTSK[MT7].2y5_1.heavy 679.364 / 721.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 233 30 C20140704_OR005_04 C20140704_OR005_04 TB427115.[MT7]-HFHANQTSK[MT7].2y6_1.heavy 679.364 / 792.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 235 30 C20140704_OR005_04 C20140704_OR005_04 TB427115.[MT7]-HFHANQTSK[MT7].2y7_1.heavy 679.364 / 929.492 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 237 31 C20140704_OR005_04 C20140704_OR005_04 TB427318.[MT7]-ILSPLEIIMSNTAC[CAM]AVGNSTK[MT7].3b6_1.heavy 836.453 / 797.489 6657.0 53.24629878997803 46 20 10 6 10 6.162616537247703 16.226873665688306 0.036800384521484375 3 0.990510352277425 12.658821719357547 6657.0 56.19602939632546 0.0 - - - - - - - 189.0 13 14 MSH4 mutS homolog 4 (E. coli) 239 31 C20140704_OR005_04 C20140704_OR005_04 TB427318.[MT7]-ILSPLEIIMSNTAC[CAM]AVGNSTK[MT7].3b5_1.heavy 836.453 / 668.446 1404.0 53.24629878997803 46 20 10 6 10 6.162616537247703 16.226873665688306 0.036800384521484375 3 0.990510352277425 12.658821719357547 1404.0 8.975427063339732 0.0 - - - - - - - 185.15384615384616 2 13 MSH4 mutS homolog 4 (E. coli) 241 31 C20140704_OR005_04 C20140704_OR005_04 TB427318.[MT7]-ILSPLEIIMSNTAC[CAM]AVGNSTK[MT7].3y5_1.heavy 836.453 / 650.359 4411.0 53.24629878997803 46 20 10 6 10 6.162616537247703 16.226873665688306 0.036800384521484375 3 0.990510352277425 12.658821719357547 4411.0 48.96495106186519 0.0 - - - - - - - 160.41666666666666 8 12 MSH4 mutS homolog 4 (E. coli) 243 31 C20140704_OR005_04 C20140704_OR005_04 TB427318.[MT7]-ILSPLEIIMSNTAC[CAM]AVGNSTK[MT7].3b7_1.heavy 836.453 / 910.573 3689.0 53.24629878997803 46 20 10 6 10 6.162616537247703 16.226873665688306 0.036800384521484375 3 0.990510352277425 12.658821719357547 3689.0 71.93549999999999 0.0 - - - - - - - 138.76923076923077 7 13 MSH4 mutS homolog 4 (E. coli) 245 32 C20140704_OR005_04 C20140704_OR005_04 TB412789.[MT7]-VRGEPLQVER.3b6_1.heavy 442.925 / 796.48 1204.0 23.127700805664062 43 13 10 10 10 2.317250460773886 43.15459277828917 0.0 3 0.9298004755542769 4.63043011864897 1204.0 21.38076696165192 0.0 - - - - - - - 376.0 2 1 TACSTD2 tumor-associated calcium signal transducer 2 247 32 C20140704_OR005_04 C20140704_OR005_04 TB412789.[MT7]-VRGEPLQVER.3y6_1.heavy 442.925 / 741.425 2559.0 23.127700805664062 43 13 10 10 10 2.317250460773886 43.15459277828917 0.0 3 0.9298004755542769 4.63043011864897 2559.0 2.663853820598007 1.0 - - - - - - - 177.9090909090909 6 11 TACSTD2 tumor-associated calcium signal transducer 2 249 32 C20140704_OR005_04 C20140704_OR005_04 TB412789.[MT7]-VRGEPLQVER.3b4_1.heavy 442.925 / 586.343 4666.0 23.127700805664062 43 13 10 10 10 2.317250460773886 43.15459277828917 0.0 3 0.9298004755542769 4.63043011864897 4666.0 60.14693333333333 1.0 - - - - - - - 164.36363636363637 9 11 TACSTD2 tumor-associated calcium signal transducer 2 251 32 C20140704_OR005_04 C20140704_OR005_04 TB412789.[MT7]-VRGEPLQVER.3y4_1.heavy 442.925 / 531.289 12868.0 23.127700805664062 43 13 10 10 10 2.317250460773886 43.15459277828917 0.0 3 0.9298004755542769 4.63043011864897 12868.0 117.73182372225034 0.0 - - - - - - - 203.5 25 10 TACSTD2 tumor-associated calcium signal transducer 2 253 33 C20140704_OR005_04 C20140704_OR005_04 TB426953.[MT7]-ELGELRK[MT7].2b4_1.heavy 566.85 / 573.3 1211.0 23.825499216715496 20 15 0 5 0 1.8269510619138116 54.736003653675105 0.04109954833984375 23 0.956203211364211 5.875479218114469 1211.0 12.937391304347827 0.0 - - - - - - - 175.8181818181818 2 11 TACSTD2 tumor-associated calcium signal transducer 2 255 33 C20140704_OR005_04 C20140704_OR005_04 TB426953.[MT7]-ELGELRK[MT7].2b6_1.heavy 566.85 / 842.485 242.0 23.825499216715496 20 15 0 5 0 1.8269510619138116 54.736003653675105 0.04109954833984375 23 0.956203211364211 5.875479218114469 242.0 1.4095356037151703 22.0 - - - - - - - 149.85714285714286 7 14 TACSTD2 tumor-associated calcium signal transducer 2 257 33 C20140704_OR005_04 C20140704_OR005_04 TB426953.[MT7]-ELGELRK[MT7].2y3_1.heavy 566.85 / 560.4 N/A 23.825499216715496 20 15 0 5 0 1.8269510619138116 54.736003653675105 0.04109954833984375 23 0.956203211364211 5.875479218114469 1211.0 3.6017352446427267 16.0 - - - - - - - 297.9230769230769 13 13 TACSTD2 tumor-associated calcium signal transducer 2 259 33 C20140704_OR005_04 C20140704_OR005_04 TB426953.[MT7]-ELGELRK[MT7].2y6_1.heavy 566.85 / 859.548 1776.0 23.825499216715496 20 15 0 5 0 1.8269510619138116 54.736003653675105 0.04109954833984375 23 0.956203211364211 5.875479218114469 1776.0 8.605383204987165 0.0 - - - - - - - 190.8181818181818 3 11 TACSTD2 tumor-associated calcium signal transducer 2 261 34 C20140704_OR005_04 C20140704_OR005_04 TB426952.[MT7]-AHPDQLVLIFAGK[MT7].3b6_1.heavy 566.338 / 806.428 12744.0 40.62300109863281 44 14 10 10 10 1.3241837684097721 52.37590550976195 0.0 3 0.9374738997282019 4.909558137257505 12744.0 51.134968814968815 0.0 - - - - - - - 330.5 25 4 UBQLN3 ubiquilin 3 263 34 C20140704_OR005_04 C20140704_OR005_04 TB426952.[MT7]-AHPDQLVLIFAGK[MT7].3b4_1.heavy 566.338 / 565.285 7935.0 40.62300109863281 44 14 10 10 10 1.3241837684097721 52.37590550976195 0.0 3 0.9374738997282019 4.909558137257505 7935.0 20.247838318635793 1.0 - - - - - - - 223.0 16 7 UBQLN3 ubiquilin 3 265 34 C20140704_OR005_04 C20140704_OR005_04 TB426952.[MT7]-AHPDQLVLIFAGK[MT7].3b5_1.heavy 566.338 / 693.344 8175.0 40.62300109863281 44 14 10 10 10 1.3241837684097721 52.37590550976195 0.0 3 0.9374738997282019 4.909558137257505 8175.0 23.794178794178794 0.0 - - - - - - - 345.625 16 8 UBQLN3 ubiquilin 3 267 34 C20140704_OR005_04 C20140704_OR005_04 TB426952.[MT7]-AHPDQLVLIFAGK[MT7].3b7_1.heavy 566.338 / 905.496 12143.0 40.62300109863281 44 14 10 10 10 1.3241837684097721 52.37590550976195 0.0 3 0.9374738997282019 4.909558137257505 12143.0 145.21004166666665 0.0 - - - - - - - 195.0 24 8 UBQLN3 ubiquilin 3 269 35 C20140704_OR005_04 C20140704_OR005_04 TB413129.[MT7]-YVEFIQNSVYAPK[MT7].3b4_1.heavy 616.004 / 683.352 14945.0 38.985599517822266 39 11 10 10 8 1.538237411829613 52.765897109191094 0.0 4 0.8785189223191783 3.5043717651502377 14945.0 58.84803442254926 0.0 - - - - - - - 230.36363636363637 29 11 MSH4 mutS homolog 4 (E. coli) 271 35 C20140704_OR005_04 C20140704_OR005_04 TB413129.[MT7]-YVEFIQNSVYAPK[MT7].3b5_1.heavy 616.004 / 796.436 5953.0 38.985599517822266 39 11 10 10 8 1.538237411829613 52.765897109191094 0.0 4 0.8785189223191783 3.5043717651502377 5953.0 22.769856071533383 0.0 - - - - - - - 267.22222222222223 11 9 MSH4 mutS homolog 4 (E. coli) 273 35 C20140704_OR005_04 C20140704_OR005_04 TB413129.[MT7]-YVEFIQNSVYAPK[MT7].3y4_1.heavy 616.004 / 622.368 10259.0 38.985599517822266 39 11 10 10 8 1.538237411829613 52.765897109191094 0.0 4 0.8785189223191783 3.5043717651502377 10259.0 19.452679616817914 1.0 - - - - - - - 278.6 23 5 MSH4 mutS homolog 4 (E. coli) 275 35 C20140704_OR005_04 C20140704_OR005_04 TB413129.[MT7]-YVEFIQNSVYAPK[MT7].3b3_1.heavy 616.004 / 536.284 5446.0 38.985599517822266 39 11 10 10 8 1.538237411829613 52.765897109191094 0.0 4 0.8785189223191783 3.5043717651502377 5446.0 46.49351285509201 0.0 - - - - - - - 554.375 10 8 MSH4 mutS homolog 4 (E. coli) 277 36 C20140704_OR005_04 C20140704_OR005_04 TB451194.[MT7]-ATFLDAWEAMEELVDEGLVK[MT7].4y4_1.heavy 639.33 / 560.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 279 36 C20140704_OR005_04 C20140704_OR005_04 TB451194.[MT7]-ATFLDAWEAMEELVDEGLVK[MT7].4b5_1.heavy 639.33 / 692.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 281 36 C20140704_OR005_04 C20140704_OR005_04 TB451194.[MT7]-ATFLDAWEAMEELVDEGLVK[MT7].4y6_1.heavy 639.33 / 804.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 283 36 C20140704_OR005_04 C20140704_OR005_04 TB451194.[MT7]-ATFLDAWEAMEELVDEGLVK[MT7].4b6_1.heavy 639.33 / 763.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 285 37 C20140704_OR005_04 C20140704_OR005_04 TB412649.[MT7]-SGDDLFPK[MT7].2b4_1.heavy 583.818 / 519.217 8882.0 29.91860055923462 42 16 10 6 10 3.1894377064879205 31.35348898540362 0.03679847717285156 3 0.9621404281829812 6.322585724280358 8882.0 15.641133942534427 0.0 - - - - - - - 772.125 17 8 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 287 37 C20140704_OR005_04 C20140704_OR005_04 TB412649.[MT7]-SGDDLFPK[MT7].2y3_1.heavy 583.818 / 535.336 2896.0 29.91860055923462 42 16 10 6 10 3.1894377064879205 31.35348898540362 0.03679847717285156 3 0.9621404281829812 6.322585724280358 2896.0 0.6316248636859325 0.0 - - - - - - - 711.875 5 8 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 289 37 C20140704_OR005_04 C20140704_OR005_04 TB412649.[MT7]-SGDDLFPK[MT7].2b6_1.heavy 583.818 / 779.369 3476.0 29.91860055923462 42 16 10 6 10 3.1894377064879205 31.35348898540362 0.03679847717285156 3 0.9621404281829812 6.322585724280358 3476.0 11.866344827586207 1.0 - - - - - - - 282.38461538461536 6 13 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 291 37 C20140704_OR005_04 C20140704_OR005_04 TB412649.[MT7]-SGDDLFPK[MT7].2b5_1.heavy 583.818 / 632.301 3958.0 29.91860055923462 42 16 10 6 10 3.1894377064879205 31.35348898540362 0.03679847717285156 3 0.9621404281829812 6.322585724280358 3958.0 7.706687798299659 1.0 - - - - - - - 317.2857142857143 7 7 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 293 38 C20140704_OR005_04 C20140704_OR005_04 TB426951.[MT7]-SLSPGTGGGVR.2y8_1.heavy 566.316 / 700.374 2716.0 21.021650314331055 43 20 10 7 6 7.46532140537488 13.395270554326306 0.029499053955078125 5 0.9958944907735561 19.2544074667216 2716.0 7.113436527567222 0.0 - - - - - - - 199.9375 5 16 PHF1 PHD finger protein 1 295 38 C20140704_OR005_04 C20140704_OR005_04 TB426951.[MT7]-SLSPGTGGGVR.2y9_1.heavy 566.316 / 787.406 1026.0 21.021650314331055 43 20 10 7 6 7.46532140537488 13.395270554326306 0.029499053955078125 5 0.9958944907735561 19.2544074667216 1026.0 6.628953002091009 1.0 - - - - - - - 171.76923076923077 2 13 PHF1 PHD finger protein 1 297 38 C20140704_OR005_04 C20140704_OR005_04 TB426951.[MT7]-SLSPGTGGGVR.2y10_1.heavy 566.316 / 900.49 1207.0 21.021650314331055 43 20 10 7 6 7.46532140537488 13.395270554326306 0.029499053955078125 5 0.9958944907735561 19.2544074667216 1207.0 2.7058091286307047 2.0 - - - - - - - 163.2941176470588 4 17 PHF1 PHD finger protein 1 299 38 C20140704_OR005_04 C20140704_OR005_04 TB426951.[MT7]-SLSPGTGGGVR.2y7_1.heavy 566.316 / 603.321 543.0 21.021650314331055 43 20 10 7 6 7.46532140537488 13.395270554326306 0.029499053955078125 5 0.9958944907735561 19.2544074667216 543.0 0.6384105960264901 3.0 - - - - - - - 0.0 1 0 PHF1 PHD finger protein 1 301 39 C20140704_OR005_04 C20140704_OR005_04 TB426855.[MT7]-NVMPLGAR.2b3_1.heavy 501.288 / 489.261 23255.0 27.120500564575195 47 17 10 10 10 3.5353098413303403 22.237684815265155 0.0 3 0.9749236877999738 7.7771198606553975 23255.0 79.88027966456457 0.0 - - - - - - - 228.5 46 10 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 303 39 C20140704_OR005_04 C20140704_OR005_04 TB426855.[MT7]-NVMPLGAR.2y5_1.heavy 501.288 / 513.314 41442.0 27.120500564575195 47 17 10 10 10 3.5353098413303403 22.237684815265155 0.0 3 0.9749236877999738 7.7771198606553975 41442.0 593.4529739607126 0.0 - - - - - - - 231.88888888888889 82 9 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 305 39 C20140704_OR005_04 C20140704_OR005_04 TB426855.[MT7]-NVMPLGAR.2y6_1.heavy 501.288 / 644.355 20175.0 27.120500564575195 47 17 10 10 10 3.5353098413303403 22.237684815265155 0.0 3 0.9749236877999738 7.7771198606553975 20175.0 239.2101035480432 0.0 - - - - - - - 220.66666666666666 40 9 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 307 39 C20140704_OR005_04 C20140704_OR005_04 TB426855.[MT7]-NVMPLGAR.2y7_1.heavy 501.288 / 743.423 14311.0 27.120500564575195 47 17 10 10 10 3.5353098413303403 22.237684815265155 0.0 3 0.9749236877999738 7.7771198606553975 14311.0 57.34341758116462 1.0 - - - - - - - 241.28571428571428 30 7 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 309 40 C20140704_OR005_04 C20140704_OR005_04 TB413134.[MT7]-ILGIPVIVTEQYPK[MT7].4b7_1.heavy 465.288 / 850.588 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 311 40 C20140704_OR005_04 C20140704_OR005_04 TB413134.[MT7]-ILGIPVIVTEQYPK[MT7].4b4_1.heavy 465.288 / 541.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 313 40 C20140704_OR005_04 C20140704_OR005_04 TB413134.[MT7]-ILGIPVIVTEQYPK[MT7].4y3_1.heavy 465.288 / 551.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 315 40 C20140704_OR005_04 C20140704_OR005_04 TB413134.[MT7]-ILGIPVIVTEQYPK[MT7].4b6_1.heavy 465.288 / 737.504 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 317 41 C20140704_OR005_04 C20140704_OR005_04 TB413032.[MT7]-IVENIQVFDFK[MT7].3y3_1.heavy 547.315 / 553.31 41829.0 42.70140075683594 39 9 10 10 10 0.8600194318077719 72.88817239648886 0.0 3 0.8186257131416974 2.8528601477439373 41829.0 381.80899999999997 0.0 - - - - - - - 301.0 83 8 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 319 41 C20140704_OR005_04 C20140704_OR005_04 TB413032.[MT7]-IVENIQVFDFK[MT7].3b4_1.heavy 547.315 / 600.347 35478.0 42.70140075683594 39 9 10 10 10 0.8600194318077719 72.88817239648886 0.0 3 0.8186257131416974 2.8528601477439373 35478.0 342.27478899082564 0.0 - - - - - - - 255.0 70 3 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 321 41 C20140704_OR005_04 C20140704_OR005_04 TB413032.[MT7]-IVENIQVFDFK[MT7].3b5_1.heavy 547.315 / 713.431 25732.0 42.70140075683594 39 9 10 10 10 0.8600194318077719 72.88817239648886 0.0 3 0.8186257131416974 2.8528601477439373 25732.0 75.6685296803653 0.0 - - - - - - - 310.0 51 6 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 323 41 C20140704_OR005_04 C20140704_OR005_04 TB413032.[MT7]-IVENIQVFDFK[MT7].3y4_1.heavy 547.315 / 700.379 23652.0 42.70140075683594 39 9 10 10 10 0.8600194318077719 72.88817239648886 0.0 3 0.8186257131416974 2.8528601477439373 23652.0 216.0 0.0 - - - - - - - 273.5 47 4 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 325 42 C20140704_OR005_04 C20140704_OR005_04 TB451189.[MT7]-ILSPLEIIMSNTAC[CAM]AVGNSTK[MT7].4y5_1.heavy 627.592 / 650.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 327 42 C20140704_OR005_04 C20140704_OR005_04 TB451189.[MT7]-ILSPLEIIMSNTAC[CAM]AVGNSTK[MT7].4b7_1.heavy 627.592 / 910.573 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 329 42 C20140704_OR005_04 C20140704_OR005_04 TB451189.[MT7]-ILSPLEIIMSNTAC[CAM]AVGNSTK[MT7].4b5_1.heavy 627.592 / 668.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 331 42 C20140704_OR005_04 C20140704_OR005_04 TB451189.[MT7]-ILSPLEIIMSNTAC[CAM]AVGNSTK[MT7].4b6_1.heavy 627.592 / 797.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 333 43 C20140704_OR005_04 C20140704_OR005_04 TB413138.[MT7]-ALGVSNFSHFQIEK[MT7].2y5_1.heavy 933.012 / 808.469 1120.0 36.164100646972656 44 14 10 10 10 1.4661292001142057 48.011504082556534 0.0 3 0.9451442771648553 5.245004083105541 1120.0 9.302064101234313 1.0 - - - - - - - 227.83333333333334 2 6 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 335 43 C20140704_OR005_04 C20140704_OR005_04 TB413138.[MT7]-ALGVSNFSHFQIEK[MT7].2y3_1.heavy 933.012 / 533.341 1245.0 36.164100646972656 44 14 10 10 10 1.4661292001142057 48.011504082556534 0.0 3 0.9451442771648553 5.245004083105541 1245.0 0.3571428571428572 2.0 - - - - - - - 201.875 3 8 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 337 43 C20140704_OR005_04 C20140704_OR005_04 TB413138.[MT7]-ALGVSNFSHFQIEK[MT7].2y6_1.heavy 933.012 / 945.527 1120.0 36.164100646972656 44 14 10 10 10 1.4661292001142057 48.011504082556534 0.0 3 0.9451442771648553 5.245004083105541 1120.0 7.736546184738956 0.0 - - - - - - - 233.125 2 8 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 339 43 C20140704_OR005_04 C20140704_OR005_04 TB413138.[MT7]-ALGVSNFSHFQIEK[MT7].2y7_1.heavy 933.012 / 1032.56 1867.0 36.164100646972656 44 14 10 10 10 1.4661292001142057 48.011504082556534 0.0 3 0.9451442771648553 5.245004083105541 1867.0 19.24323357947921 0.0 - - - - - - - 228.0 3 6 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 341 44 C20140704_OR005_04 C20140704_OR005_04 TB413139.[MT7]-ALGVSNFSHFQIEK[MT7].4y5_1.heavy 467.009 / 808.469 249.0 36.13185119628906 33 8 10 5 10 6.152097049877128 16.254620040819617 0.042999267578125 3 0.7898976486868963 2.643820366828295 249.0 1.3351206434316354 3.0 - - - - - - - 0.0 0 0 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 343 44 C20140704_OR005_04 C20140704_OR005_04 TB413139.[MT7]-ALGVSNFSHFQIEK[MT7].4y4_1.heavy 467.009 / 661.4 2613.0 36.13185119628906 33 8 10 5 10 6.152097049877128 16.254620040819617 0.042999267578125 3 0.7898976486868963 2.643820366828295 2613.0 25.9718144080256 0.0 - - - - - - - 248.5 5 4 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 345 44 C20140704_OR005_04 C20140704_OR005_04 TB413139.[MT7]-ALGVSNFSHFQIEK[MT7].4y3_1.heavy 467.009 / 533.341 4603.0 36.13185119628906 33 8 10 5 10 6.152097049877128 16.254620040819617 0.042999267578125 3 0.7898976486868963 2.643820366828295 4603.0 28.36031224092079 0.0 - - - - - - - 248.77777777777777 9 9 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 347 44 C20140704_OR005_04 C20140704_OR005_04 TB413139.[MT7]-ALGVSNFSHFQIEK[MT7].4b4_1.heavy 467.009 / 485.32 5350.0 36.13185119628906 33 8 10 5 10 6.152097049877128 16.254620040819617 0.042999267578125 3 0.7898976486868963 2.643820366828295 5350.0 14.343163538873995 0.0 - - - - - - - 323.4 10 5 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 349 45 C20140704_OR005_04 C20140704_OR005_04 TB413033.[MT7]-YYC[CAM]LAAVAALLK[MT7].3b6_1.heavy 548.653 / 886.425 4765.0 49.32085037231445 45 18 10 7 10 9.791944777240232 10.212475894720482 0.02809906005859375 3 0.9898886956336482 12.262870935797261 4765.0 74.59959016393441 0.0 - - - - - - - 144.1818181818182 9 11 MSH4 mutS homolog 4 (E. coli) 351 45 C20140704_OR005_04 C20140704_OR005_04 TB413033.[MT7]-YYC[CAM]LAAVAALLK[MT7].3b4_1.heavy 548.653 / 744.351 2505.0 49.32085037231445 45 18 10 7 10 9.791944777240232 10.212475894720482 0.02809906005859375 3 0.9898886956336482 12.262870935797261 2505.0 61.59836065573771 0.0 - - - - - - - 200.57142857142858 5 7 MSH4 mutS homolog 4 (E. coli) 353 45 C20140704_OR005_04 C20140704_OR005_04 TB413033.[MT7]-YYC[CAM]LAAVAALLK[MT7].3b5_1.heavy 548.653 / 815.388 4582.0 49.32085037231445 45 18 10 7 10 9.791944777240232 10.212475894720482 0.02809906005859375 3 0.9898886956336482 12.262870935797261 4582.0 92.3911475409836 0.0 - - - - - - - 155.45454545454547 9 11 MSH4 mutS homolog 4 (E. coli) 355 45 C20140704_OR005_04 C20140704_OR005_04 TB413033.[MT7]-YYC[CAM]LAAVAALLK[MT7].3b3_1.heavy 548.653 / 631.267 3299.0 49.32085037231445 45 18 10 7 10 9.791944777240232 10.212475894720482 0.02809906005859375 3 0.9898886956336482 12.262870935797261 3299.0 3.7708586381501346 1.0 - - - - - - - 208.58333333333334 6 12 MSH4 mutS homolog 4 (E. coli) 357 46 C20140704_OR005_04 C20140704_OR005_04 TB413325.[MT7]-LIETLRPFGVFEEEEELQR.4y4_1.heavy 620.33 / 545.304 3858.0 45.26459980010986 43 17 10 6 10 2.513709743777498 27.089697232948144 0.038799285888671875 3 0.9741700057769775 7.6623315134919014 3858.0 13.669349463377895 0.0 - - - - - - - 203.66666666666666 7 6 PAPOLB poly(A) polymerase beta (testis specific) 359 46 C20140704_OR005_04 C20140704_OR005_04 TB413325.[MT7]-LIETLRPFGVFEEEEELQR.4y5_1.heavy 620.33 / 674.347 4611.0 45.26459980010986 43 17 10 6 10 2.513709743777498 27.089697232948144 0.038799285888671875 3 0.9741700057769775 7.6623315134919014 4611.0 46.600531914893615 0.0 - - - - - - - 208.88888888888889 9 9 PAPOLB poly(A) polymerase beta (testis specific) 361 46 C20140704_OR005_04 C20140704_OR005_04 TB413325.[MT7]-LIETLRPFGVFEEEEELQR.4b10_2.heavy 620.33 / 635.886 7246.0 45.26459980010986 43 17 10 6 10 2.513709743777498 27.089697232948144 0.038799285888671875 3 0.9741700057769775 7.6623315134919014 7246.0 109.84627659574468 0.0 - - - - - - - 239.45454545454547 14 11 PAPOLB poly(A) polymerase beta (testis specific) 363 46 C20140704_OR005_04 C20140704_OR005_04 TB413325.[MT7]-LIETLRPFGVFEEEEELQR.4b9_2.heavy 620.33 / 586.351 4894.0 45.26459980010986 43 17 10 6 10 2.513709743777498 27.089697232948144 0.038799285888671875 3 0.9741700057769775 7.6623315134919014 4894.0 54.2687640925659 0.0 - - - - - - - 231.86666666666667 9 15 PAPOLB poly(A) polymerase beta (testis specific) 365 47 C20140704_OR005_04 C20140704_OR005_04 TB412792.[MT7]-TLYLFGVTK[MT7].3b6_1.heavy 443.939 / 839.478 599.0 40.81447505950928 34 8 10 6 10 0.433538161732148 114.00926439306645 0.038501739501953125 3 0.7729982172500564 2.539611262734185 599.0 7.487499999999999 0.0 - - - - - - - 0.0 1 0 PSG6;PSG9 pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 367 47 C20140704_OR005_04 C20140704_OR005_04 TB412792.[MT7]-TLYLFGVTK[MT7].3y3_1.heavy 443.939 / 491.331 3476.0 40.81447505950928 34 8 10 6 10 0.433538161732148 114.00926439306645 0.038501739501953125 3 0.7729982172500564 2.539611262734185 3476.0 57.90436666666666 0.0 - - - - - - - 120.0 6 3 PSG6;PSG9 pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 369 47 C20140704_OR005_04 C20140704_OR005_04 TB412792.[MT7]-TLYLFGVTK[MT7].3b4_1.heavy 443.939 / 635.388 3956.0 40.81447505950928 34 8 10 6 10 0.433538161732148 114.00926439306645 0.038501739501953125 3 0.7729982172500564 2.539611262734185 3956.0 26.373333333333335 0.0 - - - - - - - 300.0 7 2 PSG6;PSG9 pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 371 47 C20140704_OR005_04 C20140704_OR005_04 TB412792.[MT7]-TLYLFGVTK[MT7].3y4_1.heavy 443.939 / 548.352 1079.0 40.81447505950928 34 8 10 6 10 0.433538161732148 114.00926439306645 0.038501739501953125 3 0.7729982172500564 2.539611262734185 1079.0 5.2163675570395105 0.0 - - - - - - - 180.0 2 2 PSG6;PSG9 pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 373 48 C20140704_OR005_04 C20140704_OR005_04 TB427309.[MT7]-TGFSSDQIEQLHR.2y5_1.heavy 831.422 / 682.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - TESC tescalcin 375 48 C20140704_OR005_04 C20140704_OR005_04 TB427309.[MT7]-TGFSSDQIEQLHR.2b6_1.heavy 831.422 / 739.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - TESC tescalcin 377 48 C20140704_OR005_04 C20140704_OR005_04 TB427309.[MT7]-TGFSSDQIEQLHR.2y10_1.heavy 831.422 / 1212.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - TESC tescalcin 379 48 C20140704_OR005_04 C20140704_OR005_04 TB427309.[MT7]-TGFSSDQIEQLHR.2y7_1.heavy 831.422 / 923.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - TESC tescalcin 381 49 C20140704_OR005_04 C20140704_OR005_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 151888.0 18.963199615478516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 151888.0 1548.7788674017202 0.0 - - - - - - - 179.94117647058823 303 17 383 49 C20140704_OR005_04 C20140704_OR005_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 85571.0 18.963199615478516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 85571.0 1606.5535784313724 0.0 - - - - - - - 169.0909090909091 171 22 385 49 C20140704_OR005_04 C20140704_OR005_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 92243.0 18.963199615478516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 92243.0 1222.6719215686276 0.0 - - - - - - - 159.9090909090909 184 22 387 50 C20140704_OR005_04 C20140704_OR005_04 TB427306.[MT7]-YQLGSTSYLPDK[MT7].2y4_1.heavy 830.445 / 616.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 389 50 C20140704_OR005_04 C20140704_OR005_04 TB427306.[MT7]-YQLGSTSYLPDK[MT7].2y9_1.heavy 830.445 / 1111.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 391 50 C20140704_OR005_04 C20140704_OR005_04 TB427306.[MT7]-YQLGSTSYLPDK[MT7].2b4_1.heavy 830.445 / 606.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 393 50 C20140704_OR005_04 C20140704_OR005_04 TB427306.[MT7]-YQLGSTSYLPDK[MT7].2y3_1.heavy 830.445 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 395 51 C20140704_OR005_04 C20140704_OR005_04 TB412779.[MT7]-MVMIEEFK[MT7].2y4_1.heavy 657.856 / 696.369 1257.0 38.95402526855469 42 17 10 5 10 3.096691831487081 25.81954135276304 0.0420989990234375 3 0.9733684024697006 7.5456245128241966 1257.0 3.3342175066313 4.0 - - - - - - - 269.2857142857143 2 7 PAPOLB poly(A) polymerase beta (testis specific) 397 51 C20140704_OR005_04 C20140704_OR005_04 TB412779.[MT7]-MVMIEEFK[MT7].2y5_1.heavy 657.856 / 809.453 1885.0 38.95402526855469 42 17 10 5 10 3.096691831487081 25.81954135276304 0.0420989990234375 3 0.9733684024697006 7.5456245128241966 1885.0 0.29999999999999993 1.0 - - - - - - - 233.28571428571428 3 7 PAPOLB poly(A) polymerase beta (testis specific) 399 51 C20140704_OR005_04 C20140704_OR005_04 TB412779.[MT7]-MVMIEEFK[MT7].2y3_1.heavy 657.856 / 567.326 754.0 38.95402526855469 42 17 10 5 10 3.096691831487081 25.81954135276304 0.0420989990234375 3 0.9733684024697006 7.5456245128241966 754.0 0.12843755647930594 11.0 - - - - - - - 263.9 3 10 PAPOLB poly(A) polymerase beta (testis specific) 401 51 C20140704_OR005_04 C20140704_OR005_04 TB412779.[MT7]-MVMIEEFK[MT7].2y6_1.heavy 657.856 / 940.493 1257.0 38.95402526855469 42 17 10 5 10 3.096691831487081 25.81954135276304 0.0420989990234375 3 0.9733684024697006 7.5456245128241966 1257.0 11.178625742074018 3.0 - - - - - - - 195.66666666666666 2 9 PAPOLB poly(A) polymerase beta (testis specific) 403 52 C20140704_OR005_04 C20140704_OR005_04 TB412909.[MT7]-EALHC[CAM]SEC[CAM]GK[MT7].3y3_1.heavy 493.571 / 508.267 11953.0 17.226874828338623 41 14 10 7 10 2.658969996191568 37.60854772458117 0.028100967407226562 3 0.9314945778485015 4.6880135978962985 11953.0 244.54626675755512 0.0 - - - - - - - 185.35294117647058 23 17 PLAGL2 pleiomorphic adenoma gene-like 2 405 52 C20140704_OR005_04 C20140704_OR005_04 TB412909.[MT7]-EALHC[CAM]SEC[CAM]GK[MT7].3b4_1.heavy 493.571 / 595.332 2119.0 17.226874828338623 41 14 10 7 10 2.658969996191568 37.60854772458117 0.028100967407226562 3 0.9314945778485015 4.6880135978962985 2119.0 18.176146788990827 0.0 - - - - - - - 159.21428571428572 4 14 PLAGL2 pleiomorphic adenoma gene-like 2 407 52 C20140704_OR005_04 C20140704_OR005_04 TB412909.[MT7]-EALHC[CAM]SEC[CAM]GK[MT7].3y4_1.heavy 493.571 / 637.31 2173.0 17.226874828338623 41 14 10 7 10 2.658969996191568 37.60854772458117 0.028100967407226562 3 0.9314945778485015 4.6880135978962985 2173.0 32.401145944728995 0.0 - - - - - - - 163.125 4 8 PLAGL2 pleiomorphic adenoma gene-like 2 409 52 C20140704_OR005_04 C20140704_OR005_04 TB412909.[MT7]-EALHC[CAM]SEC[CAM]GK[MT7].3y5_1.heavy 493.571 / 724.342 3803.0 17.226874828338623 41 14 10 7 10 2.658969996191568 37.60854772458117 0.028100967407226562 3 0.9314945778485015 4.6880135978962985 3803.0 26.526592012951973 0.0 - - - - - - - 146.0 7 16 PLAGL2 pleiomorphic adenoma gene-like 2 411 53 C20140704_OR005_04 C20140704_OR005_04 TB451185.[MT7]-LIETLRPFGVFEEEEELQR.3y18_2.heavy 826.771 / 1111.06 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLB poly(A) polymerase beta (testis specific) 413 53 C20140704_OR005_04 C20140704_OR005_04 TB451185.[MT7]-LIETLRPFGVFEEEEELQR.3y15_2.heavy 826.771 / 939.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLB poly(A) polymerase beta (testis specific) 415 53 C20140704_OR005_04 C20140704_OR005_04 TB451185.[MT7]-LIETLRPFGVFEEEEELQR.3y12_2.heavy 826.771 / 756.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLB poly(A) polymerase beta (testis specific) 417 53 C20140704_OR005_04 C20140704_OR005_04 TB451185.[MT7]-LIETLRPFGVFEEEEELQR.3y9_1.heavy 826.771 / 1208.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLB poly(A) polymerase beta (testis specific) 419 54 C20140704_OR005_04 C20140704_OR005_04 TB426963.[MT7]-EIQNLIK[MT7].2b3_1.heavy 573.36 / 515.295 5515.0 31.53880023956299 38 15 9 6 8 1.9359525619953284 41.16459816470936 0.034801483154296875 4 0.9579600938576405 5.9978853742033005 5515.0 7.9569331158238175 3.0 - - - - - - - 296.1 15 10 ISOC1 isochorismatase domain containing 1 421 54 C20140704_OR005_04 C20140704_OR005_04 TB426963.[MT7]-EIQNLIK[MT7].2b4_1.heavy 573.36 / 629.338 4902.0 31.53880023956299 38 15 9 6 8 1.9359525619953284 41.16459816470936 0.034801483154296875 4 0.9579600938576405 5.9978853742033005 4902.0 8.91272727272727 1.0 - - - - - - - 267.0769230769231 9 13 ISOC1 isochorismatase domain containing 1 423 54 C20140704_OR005_04 C20140704_OR005_04 TB426963.[MT7]-EIQNLIK[MT7].2y3_1.heavy 573.36 / 517.383 4085.0 31.53880023956299 38 15 9 6 8 1.9359525619953284 41.16459816470936 0.034801483154296875 4 0.9579600938576405 5.9978853742033005 4085.0 9.017144442237488 2.0 - - - - - - - 250.54545454545453 23 11 ISOC1 isochorismatase domain containing 1 425 54 C20140704_OR005_04 C20140704_OR005_04 TB426963.[MT7]-EIQNLIK[MT7].2b5_1.heavy 573.36 / 742.422 9906.0 31.53880023956299 38 15 9 6 8 1.9359525619953284 41.16459816470936 0.034801483154296875 4 0.9579600938576405 5.9978853742033005 9906.0 62.15529411764706 0.0 - - - - - - - 204.0 19 8 ISOC1 isochorismatase domain containing 1 427 55 C20140704_OR005_04 C20140704_OR005_04 TB412900.[MT7]-DVLAFTC[CAM]EPK[MT7].3y5_1.heavy 489.93 / 778.389 235.0 34.5941743850708 36 20 6 2 8 5.897482973082773 16.95638638660237 0.08390045166015625 4 0.9941184781600491 16.0843836494845 235.0 2.1915254237288133 9.0 - - - - - - - 0.0 0 0 PSG3;PSG5;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 429 55 C20140704_OR005_04 C20140704_OR005_04 TB412900.[MT7]-DVLAFTC[CAM]EPK[MT7].3b4_1.heavy 489.93 / 543.326 15181.0 34.5941743850708 36 20 6 2 8 5.897482973082773 16.95638638660237 0.08390045166015625 4 0.9941184781600491 16.0843836494845 15181.0 72.33442176870749 1.0 - - - - - - - 196.22222222222223 47 9 PSG3;PSG5;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 431 55 C20140704_OR005_04 C20140704_OR005_04 TB412900.[MT7]-DVLAFTC[CAM]EPK[MT7].3b5_1.heavy 489.93 / 690.394 3177.0 34.5941743850708 36 20 6 2 8 5.897482973082773 16.95638638660237 0.08390045166015625 4 0.9941184781600491 16.0843836494845 3177.0 14.180868894566666 0.0 - - - - - - - 274.5 6 6 PSG3;PSG5;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 433 55 C20140704_OR005_04 C20140704_OR005_04 TB412900.[MT7]-DVLAFTC[CAM]EPK[MT7].3y4_1.heavy 489.93 / 677.341 2589.0 34.5941743850708 36 20 6 2 8 5.897482973082773 16.95638638660237 0.08390045166015625 4 0.9941184781600491 16.0843836494845 2589.0 14.304093427293672 1.0 - - - - - - - 206.0 5 8 PSG3;PSG5;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 435 56 C20140704_OR005_04 C20140704_OR005_04 TB426865.[MT7]-VAIDAGYR.2y5_1.heavy 504.783 / 581.268 12118.0 26.519699096679688 44 14 10 10 10 1.4724223742551414 48.311885272862696 0.0 3 0.9371650481250543 4.897348316807119 12118.0 38.45310693670126 1.0 - - - - - - - 306.90909090909093 27 11 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 437 56 C20140704_OR005_04 C20140704_OR005_04 TB426865.[MT7]-VAIDAGYR.2b4_1.heavy 504.783 / 543.326 40329.0 26.519699096679688 44 14 10 10 10 1.4724223742551414 48.311885272862696 0.0 3 0.9371650481250543 4.897348316807119 40329.0 162.81146965380717 0.0 - - - - - - - 261.8181818181818 80 11 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 439 56 C20140704_OR005_04 C20140704_OR005_04 TB426865.[MT7]-VAIDAGYR.2y6_1.heavy 504.783 / 694.352 9337.0 26.519699096679688 44 14 10 10 10 1.4724223742551414 48.311885272862696 0.0 3 0.9371650481250543 4.897348316807119 9337.0 90.55482412060302 0.0 - - - - - - - 211.125 18 8 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 441 56 C20140704_OR005_04 C20140704_OR005_04 TB426865.[MT7]-VAIDAGYR.2y7_1.heavy 504.783 / 765.389 40130.0 26.519699096679688 44 14 10 10 10 1.4724223742551414 48.311885272862696 0.0 3 0.9371650481250543 4.897348316807119 40130.0 221.2083184378267 0.0 - - - - - - - 208.5 80 10 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 443 57 C20140704_OR005_04 C20140704_OR005_04 TB413315.[MT7]-FVVQLFAEEWGQYVDLPK[MT7].4b8_1.heavy 614.833 / 1078.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 445 57 C20140704_OR005_04 C20140704_OR005_04 TB413315.[MT7]-FVVQLFAEEWGQYVDLPK[MT7].4b4_1.heavy 614.833 / 618.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 447 57 C20140704_OR005_04 C20140704_OR005_04 TB413315.[MT7]-FVVQLFAEEWGQYVDLPK[MT7].4b5_1.heavy 614.833 / 731.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 449 57 C20140704_OR005_04 C20140704_OR005_04 TB413315.[MT7]-FVVQLFAEEWGQYVDLPK[MT7].4y3_1.heavy 614.833 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 451 58 C20140704_OR005_04 C20140704_OR005_04 TB427600.[MT7]-HMATHSAQK[MT7]PHQC[CAM]MYC[CAM]DK[MT7].4y4_1.heavy 666.317 / 729.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 453 58 C20140704_OR005_04 C20140704_OR005_04 TB427600.[MT7]-HMATHSAQK[MT7]PHQC[CAM]MYC[CAM]DK[MT7].4b4_1.heavy 666.317 / 585.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 455 58 C20140704_OR005_04 C20140704_OR005_04 TB427600.[MT7]-HMATHSAQK[MT7]PHQC[CAM]MYC[CAM]DK[MT7].4y6_1.heavy 666.317 / 1020.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 457 58 C20140704_OR005_04 C20140704_OR005_04 TB427600.[MT7]-HMATHSAQK[MT7]PHQC[CAM]MYC[CAM]DK[MT7].4y3_1.heavy 666.317 / 566.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 459 59 C20140704_OR005_04 C20140704_OR005_04 TB413184.[MT7]-STTRAEVDLVVQDLK[MT7].4b8_1.heavy 491.283 / 1004.51 1120.0 36.470699310302734 40 10 10 10 10 1.2295515754961661 57.066940240833965 0.0 3 0.8208939770104655 2.87144962188543 1120.0 18.06451612903226 0.0 - - - - - - - 124.0 2 1 SCLY selenocysteine lyase 461 59 C20140704_OR005_04 C20140704_OR005_04 TB413184.[MT7]-STTRAEVDLVVQDLK[MT7].4b8_2.heavy 491.283 / 502.76 6597.0 36.470699310302734 40 10 10 10 10 1.2295515754961661 57.066940240833965 0.0 3 0.8208939770104655 2.87144962188543 6597.0 61.139122619510296 0.0 - - - - - - - 248.71428571428572 13 7 SCLY selenocysteine lyase 463 59 C20140704_OR005_04 C20140704_OR005_04 TB413184.[MT7]-STTRAEVDLVVQDLK[MT7].4y3_1.heavy 491.283 / 519.326 5601.0 36.470699310302734 40 10 10 10 10 1.2295515754961661 57.066940240833965 0.0 3 0.8208939770104655 2.87144962188543 5601.0 77.69129032258066 0.0 - - - - - - - 230.85714285714286 11 7 SCLY selenocysteine lyase 465 59 C20140704_OR005_04 C20140704_OR005_04 TB413184.[MT7]-STTRAEVDLVVQDLK[MT7].4b9_2.heavy 491.283 / 559.302 7593.0 36.470699310302734 40 10 10 10 10 1.2295515754961661 57.066940240833965 0.0 3 0.8208939770104655 2.87144962188543 7593.0 23.378714859437753 0.0 - - - - - - - 325.38461538461536 15 13 SCLY selenocysteine lyase 467 60 C20140704_OR005_04 C20140704_OR005_04 TB413183.[MT7]-STTRAEVDLVVQDLK[MT7].3b9_2.heavy 654.708 / 559.302 12570.0 36.470699310302734 40 10 10 10 10 2.16300015154382 38.87928739711049 0.0 3 0.8388877963827238 3.032403599769492 12570.0 102.51749970094501 0.0 - - - - - - - 335.9 25 10 SCLY selenocysteine lyase 469 60 C20140704_OR005_04 C20140704_OR005_04 TB413183.[MT7]-STTRAEVDLVVQDLK[MT7].3y4_1.heavy 654.708 / 647.385 7841.0 36.470699310302734 40 10 10 10 10 2.16300015154382 38.87928739711049 0.0 3 0.8388877963827238 3.032403599769492 7841.0 48.14966821710434 0.0 - - - - - - - 210.3846153846154 15 13 SCLY selenocysteine lyase 471 60 C20140704_OR005_04 C20140704_OR005_04 TB413183.[MT7]-STTRAEVDLVVQDLK[MT7].3b8_1.heavy 654.708 / 1004.51 6596.0 36.470699310302734 40 10 10 10 10 2.16300015154382 38.87928739711049 0.0 3 0.8388877963827238 3.032403599769492 6596.0 75.29557455628968 0.0 - - - - - - - 234.88888888888889 13 9 SCLY selenocysteine lyase 473 60 C20140704_OR005_04 C20140704_OR005_04 TB413183.[MT7]-STTRAEVDLVVQDLK[MT7].3b8_2.heavy 654.708 / 502.76 13690.0 36.470699310302734 40 10 10 10 10 2.16300015154382 38.87928739711049 0.0 3 0.8388877963827238 3.032403599769492 13690.0 56.65684206442937 0.0 - - - - - - - 357.75 27 8 SCLY selenocysteine lyase 475 61 C20140704_OR005_04 C20140704_OR005_04 TB413311.[MT7]-QRVDVEDLGVDFLTIVGHK[MT7].4b7_1.heavy 607.841 / 986.502 19795.0 47.070274353027344 39 13 10 6 10 1.4427161314325545 49.17194961280073 0.0363006591796875 3 0.9173178646288979 4.262042140393741 19795.0 167.88556202194877 0.0 - - - - - - - 217.4 39 10 SCLY selenocysteine lyase 477 61 C20140704_OR005_04 C20140704_OR005_04 TB413311.[MT7]-QRVDVEDLGVDFLTIVGHK[MT7].4b11_2.heavy 607.841 / 685.855 29188.0 47.070274353027344 39 13 10 6 10 1.4427161314325545 49.17194961280073 0.0363006591796875 3 0.9173178646288979 4.262042140393741 29188.0 303.3701231067423 0.0 - - - - - - - 174.75 58 8 SCLY selenocysteine lyase 479 61 C20140704_OR005_04 C20140704_OR005_04 TB413311.[MT7]-QRVDVEDLGVDFLTIVGHK[MT7].4b9_1.heavy 607.841 / 1156.61 6366.0 47.070274353027344 39 13 10 6 10 1.4427161314325545 49.17194961280073 0.0363006591796875 3 0.9173178646288979 4.262042140393741 6366.0 41.05113733905579 0.0 - - - - - - - 211.8181818181818 12 11 SCLY selenocysteine lyase 481 61 C20140704_OR005_04 C20140704_OR005_04 TB413311.[MT7]-QRVDVEDLGVDFLTIVGHK[MT7].4b9_2.heavy 607.841 / 578.808 34622.0 47.070274353027344 39 13 10 6 10 1.4427161314325545 49.17194961280073 0.0363006591796875 3 0.9173178646288979 4.262042140393741 34622.0 473.1463780125454 0.0 - - - - - - - 247.1818181818182 69 11 SCLY selenocysteine lyase 483 62 C20140704_OR005_04 C20140704_OR005_04 TB412720.[MT7]-RFGIILEK[MT7].2y4_1.heavy 632.405 / 646.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 485 62 C20140704_OR005_04 C20140704_OR005_04 TB412720.[MT7]-RFGIILEK[MT7].2y3_1.heavy 632.405 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 487 62 C20140704_OR005_04 C20140704_OR005_04 TB412720.[MT7]-RFGIILEK[MT7].2b7_1.heavy 632.405 / 973.595 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 489 62 C20140704_OR005_04 C20140704_OR005_04 TB412720.[MT7]-RFGIILEK[MT7].2y7_1.heavy 632.405 / 963.599 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 491 63 C20140704_OR005_04 C20140704_OR005_04 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 213548.0 38.072601318359375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 213548.0 1894.0399206697602 0.0 - - - - - - - 238.0 427 6 493 63 C20140704_OR005_04 C20140704_OR005_04 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 128272.0 38.072601318359375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 128272.0 241.22219183223598 0.0 - - - - - - - 285.6 256 5 495 63 C20140704_OR005_04 C20140704_OR005_04 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 192229.0 38.072601318359375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 192229.0 1591.1392016806722 0.0 - - - - - - - 238.0 384 6 497 64 C20140704_OR005_04 C20140704_OR005_04 TB427601.[MT7]-LVTIMLANNETGIVMPVPEISQR.3y6_1.heavy 890.488 / 729.389 8501.0 48.21039962768555 48 18 10 10 10 5.1886679961994515 19.27276905619074 0.0 3 0.9825887328457613 9.339315010968704 8501.0 28.56985908904312 0.0 - - - - - - - 255.6 17 15 SCLY selenocysteine lyase 499 64 C20140704_OR005_04 C20140704_OR005_04 TB427601.[MT7]-LVTIMLANNETGIVMPVPEISQR.3b4_1.heavy 890.488 / 571.394 7478.0 48.21039962768555 48 18 10 10 10 5.1886679961994515 19.27276905619074 0.0 3 0.9825887328457613 9.339315010968704 7478.0 13.702181159378078 0.0 - - - - - - - 732.0909090909091 14 11 SCLY selenocysteine lyase 501 64 C20140704_OR005_04 C20140704_OR005_04 TB427601.[MT7]-LVTIMLANNETGIVMPVPEISQR.3b5_1.heavy 890.488 / 702.434 11377.0 48.21039962768555 48 18 10 10 10 5.1886679961994515 19.27276905619074 0.0 3 0.9825887328457613 9.339315010968704 11377.0 21.81238014929812 0.0 - - - - - - - 200.4 22 15 SCLY selenocysteine lyase 503 64 C20140704_OR005_04 C20140704_OR005_04 TB427601.[MT7]-LVTIMLANNETGIVMPVPEISQR.3y8_1.heavy 890.488 / 925.51 21476.0 48.21039962768555 48 18 10 10 10 5.1886679961994515 19.27276905619074 0.0 3 0.9825887328457613 9.339315010968704 21476.0 53.70194017839286 0.0 - - - - - - - 230.1 42 10 SCLY selenocysteine lyase 505 65 C20140704_OR005_04 C20140704_OR005_04 TB412528.[MT7]-DYLEER.2y4_1.heavy 484.744 / 546.288 547.0 25.057549476623535 38 13 10 5 10 1.6799610741451616 52.89088033074367 0.043399810791015625 3 0.9103110234708962 4.089706586490977 547.0 0.9596491228070174 10.0 - - - - - - - 231.23076923076923 2 13 SCLY selenocysteine lyase 507 65 C20140704_OR005_04 C20140704_OR005_04 TB412528.[MT7]-DYLEER.2b3_1.heavy 484.744 / 536.284 2461.0 25.057549476623535 38 13 10 5 10 1.6799610741451616 52.89088033074367 0.043399810791015625 3 0.9103110234708962 4.089706586490977 2461.0 12.28483564680933 0.0 - - - - - - - 382.8 4 5 SCLY selenocysteine lyase 509 65 C20140704_OR005_04 C20140704_OR005_04 TB412528.[MT7]-DYLEER.2y5_1.heavy 484.744 / 709.352 3282.0 25.057549476623535 38 13 10 5 10 1.6799610741451616 52.89088033074367 0.043399810791015625 3 0.9103110234708962 4.089706586490977 3282.0 48.08791208791209 0.0 - - - - - - - 136.5 6 4 SCLY selenocysteine lyase 511 65 C20140704_OR005_04 C20140704_OR005_04 TB412528.[MT7]-DYLEER.2b4_1.heavy 484.744 / 665.326 3191.0 25.057549476623535 38 13 10 5 10 1.6799610741451616 52.89088033074367 0.043399810791015625 3 0.9103110234708962 4.089706586490977 3191.0 16.11802583381531 0.0 - - - - - - - 246.0 6 10 SCLY selenocysteine lyase 513 66 C20140704_OR005_04 C20140704_OR005_04 TB427602.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].4b8_2.heavy 672.635 / 524.817 10552.0 50.05299949645996 37 11 10 6 10 0.9913532702748564 61.33938730401585 0.03839874267578125 3 0.8663001191566941 3.3368364618776507 10552.0 65.41864473031708 0.0 - - - - - - - 209.73684210526315 21 19 PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 515 66 C20140704_OR005_04 C20140704_OR005_04 TB427602.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].4b4_1.heavy 672.635 / 585.373 10376.0 50.05299949645996 37 11 10 6 10 0.9913532702748564 61.33938730401585 0.03839874267578125 3 0.8663001191566941 3.3368364618776507 10376.0 112.55027389277387 0.0 - - - - - - - 231.0 20 17 PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 517 66 C20140704_OR005_04 C20140704_OR005_04 TB427602.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].4b5_1.heavy 672.635 / 698.457 9380.0 50.05299949645996 37 11 10 6 10 0.9913532702748564 61.33938730401585 0.03839874267578125 3 0.8663001191566941 3.3368364618776507 9380.0 57.03371750937541 0.0 - - - - - - - 207.3846153846154 18 13 PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 519 66 C20140704_OR005_04 C20140704_OR005_04 TB427602.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].4y3_1.heavy 672.635 / 640.357 26380.0 50.05299949645996 37 11 10 6 10 0.9913532702748564 61.33938730401585 0.03839874267578125 3 0.8663001191566941 3.3368364618776507 26380.0 152.52855840831523 0.0 - - - - - - - 207.0 52 17 PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 521 67 C20140704_OR005_04 C20140704_OR005_04 TB413048.[MT7]-WTDGLLYLGTIK[MT7].3b6_1.heavy 556.659 / 830.453 5630.0 46.11579895019531 33 5 10 10 8 0.7181406790695853 85.0262635380854 0.0 4 0.6886366952039167 2.151568913071548 5630.0 92.50824011007911 0.0 - - - - - - - 158.42857142857142 11 7 PHF1 PHD finger protein 1 523 67 C20140704_OR005_04 C20140704_OR005_04 TB413048.[MT7]-WTDGLLYLGTIK[MT7].3b4_1.heavy 556.659 / 604.285 2730.0 46.11579895019531 33 5 10 10 8 0.7181406790695853 85.0262635380854 0.0 4 0.6886366952039167 2.151568913071548 2730.0 46.54842518059856 1.0 - - - - - - - 153.6 17 10 PHF1 PHD finger protein 1 525 67 C20140704_OR005_04 C20140704_OR005_04 TB413048.[MT7]-WTDGLLYLGTIK[MT7].3b5_1.heavy 556.659 / 717.369 1024.0 46.11579895019531 33 5 10 10 8 0.7181406790695853 85.0262635380854 0.0 4 0.6886366952039167 2.151568913071548 1024.0 11.42393509127789 1.0 - - - - - - - 170.5 2 6 PHF1 PHD finger protein 1 527 67 C20140704_OR005_04 C20140704_OR005_04 TB413048.[MT7]-WTDGLLYLGTIK[MT7].3y4_1.heavy 556.659 / 562.368 11261.0 46.11579895019531 33 5 10 10 8 0.7181406790695853 85.0262635380854 0.0 4 0.6886366952039167 2.151568913071548 11261.0 139.47907720588233 0.0 - - - - - - - 227.5 22 6 PHF1 PHD finger protein 1 529 68 C20140704_OR005_04 C20140704_OR005_04 TB413040.[MT7]-TGFSSDQIEQLHR.3y6_1.heavy 554.617 / 795.447 13723.0 28.395299434661865 43 17 10 6 10 4.515842216348633 22.14426350813843 0.03679847717285156 3 0.9782181195093465 8.346861450913456 13723.0 178.57105121567432 0.0 - - - - - - - 231.88888888888889 27 9 TESC tescalcin 531 68 C20140704_OR005_04 C20140704_OR005_04 TB413040.[MT7]-TGFSSDQIEQLHR.3b6_1.heavy 554.617 / 739.338 33910.0 28.395299434661865 43 17 10 6 10 4.515842216348633 22.14426350813843 0.03679847717285156 3 0.9782181195093465 8.346861450913456 33910.0 327.17185929648235 0.0 - - - - - - - 248.6 67 10 TESC tescalcin 533 68 C20140704_OR005_04 C20140704_OR005_04 TB413040.[MT7]-TGFSSDQIEQLHR.3b7_1.heavy 554.617 / 867.396 27745.0 28.395299434661865 43 17 10 6 10 4.515842216348633 22.14426350813843 0.03679847717285156 3 0.9782181195093465 8.346861450913456 27745.0 147.94183079828673 0.0 - - - - - - - 231.91666666666666 55 12 TESC tescalcin 535 68 C20140704_OR005_04 C20140704_OR005_04 TB413040.[MT7]-TGFSSDQIEQLHR.3y5_1.heavy 554.617 / 682.363 64141.0 28.395299434661865 43 17 10 6 10 4.515842216348633 22.14426350813843 0.03679847717285156 3 0.9782181195093465 8.346861450913456 64141.0 383.1492069543118 0.0 - - - - - - - 234.21428571428572 128 14 TESC tescalcin 537 69 C20140704_OR005_04 C20140704_OR005_04 TB427238.[MT7]-TTTWEDPRLK[MT7].3b6_1.heavy 512.287 / 878.401 2974.0 27.6601505279541 39 17 10 6 6 2.8724199703393403 34.81385070170859 0.036899566650390625 5 0.9721757165649692 7.381390889630698 2974.0 48.965858585858584 0.0 - - - - - - - 242.33333333333334 5 9 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 539 69 C20140704_OR005_04 C20140704_OR005_04 TB427238.[MT7]-TTTWEDPRLK[MT7].3b4_1.heavy 512.287 / 634.332 1289.0 27.6601505279541 39 17 10 6 6 2.8724199703393403 34.81385070170859 0.036899566650390625 5 0.9721757165649692 7.381390889630698 1289.0 0.0 5.0 - - - - - - - 227.8 4 10 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 541 69 C20140704_OR005_04 C20140704_OR005_04 TB427238.[MT7]-TTTWEDPRLK[MT7].3b5_1.heavy 512.287 / 763.374 397.0 27.6601505279541 39 17 10 6 6 2.8724199703393403 34.81385070170859 0.036899566650390625 5 0.9721757165649692 7.381390889630698 397.0 0.5346801346801348 7.0 - - - - - - - 0.0 1 0 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 543 69 C20140704_OR005_04 C20140704_OR005_04 TB427238.[MT7]-TTTWEDPRLK[MT7].3y4_1.heavy 512.287 / 657.453 1289.0 27.6601505279541 39 17 10 6 6 2.8724199703393403 34.81385070170859 0.036899566650390625 5 0.9721757165649692 7.381390889630698 1289.0 3.815758028463911 0.0 - - - - - - - 198.125 2 16 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 545 70 C20140704_OR005_04 C20140704_OR005_04 TB427235.[MT7]-QLSGDQPTIRK[MT7].2y5_1.heavy 765.946 / 758.5 880.0 22.101799964904785 40 14 10 6 10 3.8234242394188933 26.154565577373276 0.03980064392089844 3 0.9490330739088071 5.443222823486107 880.0 13.619047619047619 0.0 - - - - - - - 0.0 1 0 TESC tescalcin 547 70 C20140704_OR005_04 C20140704_OR005_04 TB427235.[MT7]-QLSGDQPTIRK[MT7].2y9_1.heavy 765.946 / 1145.64 377.0 22.101799964904785 40 14 10 6 10 3.8234242394188933 26.154565577373276 0.03980064392089844 3 0.9490330739088071 5.443222823486107 377.0 5.954206349206349 0.0 - - - - - - - 0.0 0 0 TESC tescalcin 549 70 C20140704_OR005_04 C20140704_OR005_04 TB427235.[MT7]-QLSGDQPTIRK[MT7].2y6_1.heavy 765.946 / 886.559 1383.0 22.101799964904785 40 14 10 6 10 3.8234242394188933 26.154565577373276 0.03980064392089844 3 0.9490330739088071 5.443222823486107 1383.0 26.34285714285714 0.0 - - - - - - - 110.0 2 4 TESC tescalcin 551 70 C20140704_OR005_04 C20140704_OR005_04 TB427235.[MT7]-QLSGDQPTIRK[MT7].2b5_1.heavy 765.946 / 645.332 1132.0 22.101799964904785 40 14 10 6 10 3.8234242394188933 26.154565577373276 0.03980064392089844 3 0.9490330739088071 5.443222823486107 1132.0 21.28494186634314 0.0 - - - - - - - 293.3333333333333 2 6 TESC tescalcin 553 71 C20140704_OR005_04 C20140704_OR005_04 TB412915.[MT7]-SDPVTLNLLPK[MT7].3b9_2.heavy 495.636 / 549.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG1;PSG3;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 555 71 C20140704_OR005_04 C20140704_OR005_04 TB412915.[MT7]-SDPVTLNLLPK[MT7].3b4_1.heavy 495.636 / 543.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG1;PSG3;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 557 71 C20140704_OR005_04 C20140704_OR005_04 TB412915.[MT7]-SDPVTLNLLPK[MT7].3b5_1.heavy 495.636 / 644.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG1;PSG3;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 559 71 C20140704_OR005_04 C20140704_OR005_04 TB412915.[MT7]-SDPVTLNLLPK[MT7].3b7_1.heavy 495.636 / 871.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG1;PSG3;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 561 72 C20140704_OR005_04 C20140704_OR005_04 TB450904.[MT7]-EALHC[CAM]SEC[CAM]GK[MT7].2y5_1.heavy 739.852 / 724.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 563 72 C20140704_OR005_04 C20140704_OR005_04 TB450904.[MT7]-EALHC[CAM]SEC[CAM]GK[MT7].2y3_1.heavy 739.852 / 508.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 565 72 C20140704_OR005_04 C20140704_OR005_04 TB450904.[MT7]-EALHC[CAM]SEC[CAM]GK[MT7].2y6_1.heavy 739.852 / 884.372 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 567 72 C20140704_OR005_04 C20140704_OR005_04 TB450904.[MT7]-EALHC[CAM]SEC[CAM]GK[MT7].2y7_1.heavy 739.852 / 1021.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 569 73 C20140704_OR005_04 C20140704_OR005_04 TB426873.[MT7]-TAAQVLIR.2b4_1.heavy 508.323 / 516.29 11519.0 28.57819938659668 50 20 10 10 10 5.8429300209266515 17.114700953433744 0.0 3 0.9920407494428392 13.82412987832592 11519.0 150.54550870956274 0.0 - - - - - - - 255.85714285714286 23 14 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 571 73 C20140704_OR005_04 C20140704_OR005_04 TB426873.[MT7]-TAAQVLIR.2y6_1.heavy 508.323 / 699.451 6776.0 28.57819938659668 50 20 10 10 10 5.8429300209266515 17.114700953433744 0.0 3 0.9920407494428392 13.82412987832592 6776.0 25.65539030540768 0.0 - - - - - - - 229.875 13 8 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 573 73 C20140704_OR005_04 C20140704_OR005_04 TB426873.[MT7]-TAAQVLIR.2b5_1.heavy 508.323 / 615.358 9680.0 28.57819938659668 50 20 10 10 10 5.8429300209266515 17.114700953433744 0.0 3 0.9920407494428392 13.82412987832592 9680.0 97.29896907216495 0.0 - - - - - - - 242.16666666666666 19 12 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 575 73 C20140704_OR005_04 C20140704_OR005_04 TB426873.[MT7]-TAAQVLIR.2y7_1.heavy 508.323 / 770.488 14811.0 28.57819938659668 50 20 10 10 10 5.8429300209266515 17.114700953433744 0.0 3 0.9920407494428392 13.82412987832592 14811.0 77.59839615076183 0.0 - - - - - - - 222.6 29 10 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 577 74 C20140704_OR005_04 C20140704_OR005_04 TB412727.[MT7]-NQPEPQEQR.2y8_1.heavy 635.319 / 1011.49 1162.0 14.963700294494629 38 13 10 5 10 2.045624533260836 48.884826308078445 0.04220008850097656 3 0.9198911090637448 4.330910682099943 1162.0 14.500226177233964 0.0 - - - - - - - 92.6 2 5 PHF1 PHD finger protein 1 579 74 C20140704_OR005_04 C20140704_OR005_04 TB412727.[MT7]-NQPEPQEQR.2y5_1.heavy 635.319 / 657.331 1533.0 14.963700294494629 38 13 10 5 10 2.045624533260836 48.884826308078445 0.04220008850097656 3 0.9198911090637448 4.330910682099943 1533.0 36.62286115007013 0.0 - - - - - - - 92.75 3 4 PHF1 PHD finger protein 1 581 74 C20140704_OR005_04 C20140704_OR005_04 TB412727.[MT7]-NQPEPQEQR.2b4_1.heavy 635.319 / 613.306 1301.0 14.963700294494629 38 13 10 5 10 2.045624533260836 48.884826308078445 0.04220008850097656 3 0.9198911090637448 4.330910682099943 1301.0 35.005323741007196 0.0 - - - - - - - 172.42857142857142 2 7 PHF1 PHD finger protein 1 583 74 C20140704_OR005_04 C20140704_OR005_04 TB412727.[MT7]-NQPEPQEQR.2y7_1.heavy 635.319 / 883.427 1952.0 14.963700294494629 38 13 10 5 10 2.045624533260836 48.884826308078445 0.04220008850097656 3 0.9198911090637448 4.330910682099943 1952.0 63.42402992052361 0.0 - - - - - - - 279.0 3 1 PHF1 PHD finger protein 1 585 75 C20140704_OR005_04 C20140704_OR005_04 TB413316.[MT7]-LALQTIPEDLDLRDDSLLK[MT7].3b4_1.heavy 819.467 / 570.373 2635.0 43.84939956665039 48 18 10 10 10 5.25773406710956 19.01960021629147 0.0 3 0.9804465048764909 8.811299348211818 2635.0 28.36560235905247 0.0 - - - - - - - 212.7 5 10 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 587 75 C20140704_OR005_04 C20140704_OR005_04 TB413316.[MT7]-LALQTIPEDLDLRDDSLLK[MT7].3y8_1.heavy 819.467 / 1103.65 1317.0 43.84939956665039 48 18 10 10 10 5.25773406710956 19.01960021629147 0.0 3 0.9804465048764909 8.811299348211818 1317.0 7.961072076743583 0.0 - - - - - - - 209.78571428571428 2 14 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 589 75 C20140704_OR005_04 C20140704_OR005_04 TB413316.[MT7]-LALQTIPEDLDLRDDSLLK[MT7].3y8_2.heavy 819.467 / 552.331 3040.0 43.84939956665039 48 18 10 10 10 5.25773406710956 19.01960021629147 0.0 3 0.9804465048764909 8.811299348211818 3040.0 -0.2928694793979767 2.0 - - - - - - - 263.4 8 5 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 591 75 C20140704_OR005_04 C20140704_OR005_04 TB413316.[MT7]-LALQTIPEDLDLRDDSLLK[MT7].3y13_2.heavy 819.467 / 836.947 3141.0 43.84939956665039 48 18 10 10 10 5.25773406710956 19.01960021629147 0.0 3 0.9804465048764909 8.811299348211818 3141.0 27.968649035956226 0.0 - - - - - - - 177.25 6 8 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 593 76 C20140704_OR005_04 C20140704_OR005_04 TB427609.[MT7]-VYMDYNATTPLEPEVIQAMTK[MT7].3b6_1.heavy 901.46 / 930.415 4514.0 44.7335262298584 32 12 10 2 8 0.918841112583466 54.719214853946625 0.08390045166015625 4 0.8980897705814698 3.8326072238414866 4514.0 10.266374864436797 1.0 - - - - - - - 196.54545454545453 10 11 SCLY selenocysteine lyase 595 76 C20140704_OR005_04 C20140704_OR005_04 TB427609.[MT7]-VYMDYNATTPLEPEVIQAMTK[MT7].3b4_1.heavy 901.46 / 653.308 11378.0 44.7335262298584 32 12 10 2 8 0.918841112583466 54.719214853946625 0.08390045166015625 4 0.8980897705814698 3.8326072238414866 11378.0 61.79198633154342 0.0 - - - - - - - 147.71428571428572 22 7 SCLY selenocysteine lyase 597 76 C20140704_OR005_04 C20140704_OR005_04 TB427609.[MT7]-VYMDYNATTPLEPEVIQAMTK[MT7].3b5_1.heavy 901.46 / 816.372 3385.0 44.7335262298584 32 12 10 2 8 0.918841112583466 54.719214853946625 0.08390045166015625 4 0.8980897705814698 3.8326072238414866 3385.0 0.7002659574468083 2.0 - - - - - - - 206.8 7 10 SCLY selenocysteine lyase 599 76 C20140704_OR005_04 C20140704_OR005_04 TB427609.[MT7]-VYMDYNATTPLEPEVIQAMTK[MT7].3y9_1.heavy 901.46 / 1160.65 12788.0 44.7335262298584 32 12 10 2 8 0.918841112583466 54.719214853946625 0.08390045166015625 4 0.8980897705814698 3.8326072238414866 12788.0 17.517727230698107 0.0 - - - - - - - 317.25 25 8 SCLY selenocysteine lyase 601 77 C20140704_OR005_04 C20140704_OR005_04 TB412514.[MT7]-IGALYIR.2y5_1.heavy 475.301 / 635.388 1175.0 34.460201263427734 43 20 10 5 8 3.9501737699341137 25.315342013844607 0.04000091552734375 4 0.9927047374963751 14.440343686620297 1175.0 4.401192504258944 0.0 - - - - - - - 235.0 2 1 SCLY selenocysteine lyase 603 77 C20140704_OR005_04 C20140704_OR005_04 TB412514.[MT7]-IGALYIR.2b4_1.heavy 475.301 / 499.336 3642.0 34.460201263427734 43 20 10 5 8 3.9501737699341137 25.315342013844607 0.04000091552734375 4 0.9927047374963751 14.440343686620297 3642.0 4.3807741290504865 2.0 - - - - - - - 293.25 11 4 SCLY selenocysteine lyase 605 77 C20140704_OR005_04 C20140704_OR005_04 TB412514.[MT7]-IGALYIR.2y6_1.heavy 475.301 / 692.409 10220.0 34.460201263427734 43 20 10 5 8 3.9501737699341137 25.315342013844607 0.04000091552734375 4 0.9927047374963751 14.440343686620297 10220.0 50.74973766924565 0.0 - - - - - - - 258.0 20 5 SCLY selenocysteine lyase 607 77 C20140704_OR005_04 C20140704_OR005_04 TB412514.[MT7]-IGALYIR.2b5_1.heavy 475.301 / 662.399 2702.0 34.460201263427734 43 20 10 5 8 3.9501737699341137 25.315342013844607 0.04000091552734375 4 0.9927047374963751 14.440343686620297 2702.0 17.627283558994197 0.0 - - - - - - - 305.2 5 5 SCLY selenocysteine lyase 609 78 C20140704_OR005_04 C20140704_OR005_04 TB413191.[MT7]-GAEAANVTGPGGVPVQGSK[MT7].3y6_1.heavy 662.028 / 759.448 10986.0 25.15690040588379 43 13 10 10 10 1.711001898627058 46.25570346404581 0.0 3 0.913134078938125 4.156641534776114 10986.0 74.02534682448771 0.0 - - - - - - - 291.5 21 6 YBX1 Y box binding protein 1 611 78 C20140704_OR005_04 C20140704_OR005_04 TB413191.[MT7]-GAEAANVTGPGGVPVQGSK[MT7].3b6_1.heavy 662.028 / 658.328 4764.0 25.15690040588379 43 13 10 10 10 1.711001898627058 46.25570346404581 0.0 3 0.913134078938125 4.156641534776114 4764.0 48.30899325442281 0.0 - - - - - - - 313.22222222222223 9 9 YBX1 Y box binding protein 1 613 78 C20140704_OR005_04 C20140704_OR005_04 TB413191.[MT7]-GAEAANVTGPGGVPVQGSK[MT7].3b5_1.heavy 662.028 / 544.285 3694.0 25.15690040588379 43 13 10 10 10 1.711001898627058 46.25570346404581 0.0 3 0.913134078938125 4.156641534776114 3694.0 14.424672407045009 0.0 - - - - - - - 277.7142857142857 7 7 YBX1 Y box binding protein 1 615 78 C20140704_OR005_04 C20140704_OR005_04 TB413191.[MT7]-GAEAANVTGPGGVPVQGSK[MT7].3b7_1.heavy 662.028 / 757.396 2333.0 25.15690040588379 43 13 10 10 10 1.711001898627058 46.25570346404581 0.0 3 0.913134078938125 4.156641534776114 2333.0 -0.3999999999999999 2.0 - - - - - - - 194.33333333333334 4 6 YBX1 Y box binding protein 1 617 79 C20140704_OR005_04 C20140704_OR005_04 TB412610.[MT7]-YFNETK[MT7].2b3_1.heavy 545.295 / 569.284 957.0 25.30964946746826 31 16 4 5 6 2.6805790826790408 30.16994304073949 0.04369926452636719 5 0.9680645620107435 6.887527124650145 957.0 0.7330319408174695 2.0 - - - - - - - 0.0 1 0 MSH4 mutS homolog 4 (E. coli) 619 79 C20140704_OR005_04 C20140704_OR005_04 TB412610.[MT7]-YFNETK[MT7].2y4_1.heavy 545.295 / 635.348 3925.0 25.30964946746826 31 16 4 5 6 2.6805790826790408 30.16994304073949 0.04369926452636719 5 0.9680645620107435 6.887527124650145 3925.0 42.44397302001741 1.0 - - - - - - - 207.66666666666666 13 6 MSH4 mutS homolog 4 (E. coli) 621 79 C20140704_OR005_04 C20140704_OR005_04 TB412610.[MT7]-YFNETK[MT7].2y5_1.heavy 545.295 / 782.417 3734.0 25.30964946746826 31 16 4 5 6 2.6805790826790408 30.16994304073949 0.04369926452636719 5 0.9680645620107435 6.887527124650145 3734.0 56.842696662303666 0.0 - - - - - - - 182.72727272727272 7 11 MSH4 mutS homolog 4 (E. coli) 623 79 C20140704_OR005_04 C20140704_OR005_04 TB412610.[MT7]-YFNETK[MT7].2y3_1.heavy 545.295 / 521.305 1436.0 25.30964946746826 31 16 4 5 6 2.6805790826790408 30.16994304073949 0.04369926452636719 5 0.9680645620107435 6.887527124650145 1436.0 0.776103668136727 2.0 - - - - - - - 274.4 3 15 MSH4 mutS homolog 4 (E. coli) 625 80 C20140704_OR005_04 C20140704_OR005_04 TB450532.[MT7]-LLQGAR.2y4_1.heavy 401.257 / 431.236 3932.0 23.921499252319336 50 20 10 10 10 5.09881243388811 19.612410006567902 0.0 3 0.9946035160186065 16.79234796046835 3932.0 22.89505855392351 1.0 - - - - - - - 184.5 12 4 PNPLA5;ISOC1 patatin-like phospholipase domain containing 5;isochorismatase domain containing 1 627 80 C20140704_OR005_04 C20140704_OR005_04 TB450532.[MT7]-LLQGAR.2y5_1.heavy 401.257 / 544.32 17119.0 23.921499252319336 50 20 10 10 10 5.09881243388811 19.612410006567902 0.0 3 0.9946035160186065 16.79234796046835 17119.0 237.9541 0.0 - - - - - - - 253.45454545454547 34 11 PNPLA5;ISOC1 patatin-like phospholipase domain containing 5;isochorismatase domain containing 1 629 80 C20140704_OR005_04 C20140704_OR005_04 TB450532.[MT7]-LLQGAR.2b4_1.heavy 401.257 / 556.357 1802.0 23.921499252319336 50 20 10 10 10 5.09881243388811 19.612410006567902 0.0 3 0.9946035160186065 16.79234796046835 1802.0 17.8589609929479 1.0 - - - - - - - 225.25 12 4 PNPLA5;ISOC1 patatin-like phospholipase domain containing 5;isochorismatase domain containing 1 631 80 C20140704_OR005_04 C20140704_OR005_04 TB450532.[MT7]-LLQGAR.2b5_1.heavy 401.257 / 627.395 1884.0 23.921499252319336 50 20 10 10 10 5.09881243388811 19.612410006567902 0.0 3 0.9946035160186065 16.79234796046835 1884.0 12.196273445551359 0.0 - - - - - - - 218.66666666666666 3 12 PNPLA5;ISOC1 patatin-like phospholipase domain containing 5;isochorismatase domain containing 1 633 81 C20140704_OR005_04 C20140704_OR005_04 TB427226.[MT7]-AEVDLVVQDLK[MT7].3b6_1.heavy 506.299 / 771.437 2531.0 38.4965238571167 21 5 2 6 8 8.253693898997815 12.115787333976883 0.038700103759765625 4 0.635474563382421 1.978442527706353 2531.0 23.91496062992126 0.0 - - - - - - - 253.0 5 2 SCLY selenocysteine lyase 635 81 C20140704_OR005_04 C20140704_OR005_04 TB427226.[MT7]-AEVDLVVQDLK[MT7].3y3_1.heavy 506.299 / 519.326 3670.0 38.4965238571167 21 5 2 6 8 8.253693898997815 12.115787333976883 0.038700103759765625 4 0.635474563382421 1.978442527706353 3670.0 9.429034671988028 1.0 - - - - - - - 177.4 15 5 SCLY selenocysteine lyase 637 81 C20140704_OR005_04 C20140704_OR005_04 TB427226.[MT7]-AEVDLVVQDLK[MT7].3b5_1.heavy 506.299 / 672.369 1012.0 38.4965238571167 21 5 2 6 8 8.253693898997815 12.115787333976883 0.038700103759765625 4 0.635474563382421 1.978442527706353 1012.0 8.23517060367454 1.0 - - - - - - - 380.0 2 2 SCLY selenocysteine lyase 639 81 C20140704_OR005_04 C20140704_OR005_04 TB427226.[MT7]-AEVDLVVQDLK[MT7].3y4_1.heavy 506.299 / 647.385 2657.0 38.4965238571167 21 5 2 6 8 8.253693898997815 12.115787333976883 0.038700103759765625 4 0.635474563382421 1.978442527706353 2657.0 10.212803446362944 0.0 - - - - - - - 211.33333333333334 5 6 SCLY selenocysteine lyase 641 82 C20140704_OR005_04 C20140704_OR005_04 TB426885.[MT7]-LQEEVK[MT7].2y4_1.heavy 517.31 / 648.369 4472.0 22.44300079345703 48 20 10 10 8 5.777134242913482 17.3096202710998 0.0 4 0.9912105997595554 13.15419077989884 4472.0 51.081604052342755 0.0 - - - - - - - 206.44444444444446 8 9 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 643 82 C20140704_OR005_04 C20140704_OR005_04 TB426885.[MT7]-LQEEVK[MT7].2y5_1.heavy 517.31 / 776.427 6467.0 22.44300079345703 48 20 10 10 8 5.777134242913482 17.3096202710998 0.0 4 0.9912105997595554 13.15419077989884 6467.0 40.623697843551795 1.0 - - - - - - - 131.45454545454547 13 11 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 645 82 C20140704_OR005_04 C20140704_OR005_04 TB426885.[MT7]-LQEEVK[MT7].2b4_1.heavy 517.31 / 644.337 3784.0 22.44300079345703 48 20 10 10 8 5.777134242913482 17.3096202710998 0.0 4 0.9912105997595554 13.15419077989884 3784.0 19.881772614107884 0.0 - - - - - - - 221.21428571428572 7 14 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 647 82 C20140704_OR005_04 C20140704_OR005_04 TB426885.[MT7]-LQEEVK[MT7].2y3_1.heavy 517.31 / 519.326 4197.0 22.44300079345703 48 20 10 10 8 5.777134242913482 17.3096202710998 0.0 4 0.9912105997595554 13.15419077989884 4197.0 43.48179400590966 0.0 - - - - - - - 220.2 8 10 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 649 83 C20140704_OR005_04 C20140704_OR005_04 TB426883.[MT7]-LVSC[CAM]EK[MT7].2y4_1.heavy 512.291 / 667.32 3552.0 21.407699584960938 38 20 2 10 6 8.326836990105011 12.009362032525976 0.0 5 0.996889338834722 22.121948311785207 3552.0 11.190667016010039 0.0 - - - - - - - 201.63636363636363 7 11 PHF1 PHD finger protein 1 651 83 C20140704_OR005_04 C20140704_OR005_04 TB426883.[MT7]-LVSC[CAM]EK[MT7].2y5_1.heavy 512.291 / 766.389 2664.0 21.407699584960938 38 20 2 10 6 8.326836990105011 12.009362032525976 0.0 5 0.996889338834722 22.121948311785207 2664.0 44.879460067491564 1.0 - - - - - - - 86.875 19 8 PHF1 PHD finger protein 1 653 83 C20140704_OR005_04 C20140704_OR005_04 TB426883.[MT7]-LVSC[CAM]EK[MT7].2y3_1.heavy 512.291 / 580.288 1015.0 21.407699584960938 38 20 2 10 6 8.326836990105011 12.009362032525976 0.0 5 0.996889338834722 22.121948311785207 1015.0 6.206629573511513 1.0 - - - - - - - 179.61111111111111 3 18 PHF1 PHD finger protein 1 655 83 C20140704_OR005_04 C20140704_OR005_04 TB426883.[MT7]-LVSC[CAM]EK[MT7].2b5_1.heavy 512.291 / 733.367 507.0 21.407699584960938 38 20 2 10 6 8.326836990105011 12.009362032525976 0.0 5 0.996889338834722 22.121948311785207 507.0 5.365260617760617 10.0 - - - - - - - 180.30769230769232 6 13 PHF1 PHD finger protein 1 657 84 C20140704_OR005_04 C20140704_OR005_04 TB412926.[MT7]-NRFPNFLGIIR.3y6_1.heavy 497.629 / 718.461 672.0 42.32809829711914 43 13 10 10 10 1.523847752768059 55.992024977690534 0.0 3 0.9039245890320233 3.949264669484107 672.0 5.68 1.0 - - - - - - - 0.0 1 0 UBQLN3 ubiquilin 3 659 84 C20140704_OR005_04 C20140704_OR005_04 TB412926.[MT7]-NRFPNFLGIIR.3b5_1.heavy 497.629 / 773.417 1569.0 42.32809829711914 43 13 10 10 10 1.523847752768059 55.992024977690534 0.0 3 0.9039245890320233 3.949264669484107 1569.0 18.398392857142856 0.0 - - - - - - - 168.0 3 2 UBQLN3 ubiquilin 3 661 84 C20140704_OR005_04 C20140704_OR005_04 TB412926.[MT7]-NRFPNFLGIIR.3y5_1.heavy 497.629 / 571.393 4819.0 42.32809829711914 43 13 10 10 10 1.523847752768059 55.992024977690534 0.0 3 0.9039245890320233 3.949264669484107 4819.0 81.75089285714286 0.0 - - - - - - - 196.0 9 4 UBQLN3 ubiquilin 3 663 84 C20140704_OR005_04 C20140704_OR005_04 TB412926.[MT7]-NRFPNFLGIIR.3b7_2.heavy 497.629 / 517.289 2242.0 42.32809829711914 43 13 10 10 10 1.523847752768059 55.992024977690534 0.0 3 0.9039245890320233 3.949264669484107 2242.0 19.6175 0.0 - - - - - - - 252.0 4 4 UBQLN3 ubiquilin 3 665 85 C20140704_OR005_04 C20140704_OR005_04 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1120240.0 34.98469924926758 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1120240.0 1836.4509892407598 0.0 - - - - - - - 296.2 2240 5 667 85 C20140704_OR005_04 C20140704_OR005_04 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 188096.0 34.98469924926758 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 188096.0 243.69169086803097 1.0 - - - - - - - 246.66666666666666 390 9 669 85 C20140704_OR005_04 C20140704_OR005_04 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 277700.0 34.98469924926758 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 277700.0 535.7361713050018 0.0 - - - - - - - 341.84615384615387 555 13 671 86 C20140704_OR005_04 C20140704_OR005_04 TB412510.[MT7]-RVAGGAK[MT7].2y4_1.heavy 473.805 / 476.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 673 86 C20140704_OR005_04 C20140704_OR005_04 TB412510.[MT7]-RVAGGAK[MT7].2y5_1.heavy 473.805 / 547.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 675 86 C20140704_OR005_04 C20140704_OR005_04 TB412510.[MT7]-RVAGGAK[MT7].2b6_1.heavy 473.805 / 656.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 677 86 C20140704_OR005_04 C20140704_OR005_04 TB412510.[MT7]-RVAGGAK[MT7].2y6_1.heavy 473.805 / 646.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 679 87 C20140704_OR005_04 C20140704_OR005_04 TB412823.[MT7]-DTNYPQTLK[MT7].2y5_1.heavy 684.374 / 730.458 4564.0 24.673250198364258 39 14 10 5 10 1.9613302226404978 50.985804861239586 0.040500640869140625 3 0.9325776742211207 4.725956011809253 4564.0 97.43370786516854 0.0 - - - - - - - 89.0 9 2 MSH4 mutS homolog 4 (E. coli) 681 87 C20140704_OR005_04 C20140704_OR005_04 TB412823.[MT7]-DTNYPQTLK[MT7].2b4_1.heavy 684.374 / 638.29 4117.0 24.673250198364258 39 14 10 5 10 1.9613302226404978 50.985804861239586 0.040500640869140625 3 0.9325776742211207 4.725956011809253 4117.0 41.60674157303371 0.0 - - - - - - - 219.36363636363637 8 11 MSH4 mutS homolog 4 (E. coli) 683 87 C20140704_OR005_04 C20140704_OR005_04 TB412823.[MT7]-DTNYPQTLK[MT7].2y3_1.heavy 684.374 / 505.347 1074.0 24.673250198364258 39 14 10 5 10 1.9613302226404978 50.985804861239586 0.040500640869140625 3 0.9325776742211207 4.725956011809253 1074.0 13.982022471910113 0.0 - - - - - - - 223.5 2 6 MSH4 mutS homolog 4 (E. coli) 685 87 C20140704_OR005_04 C20140704_OR005_04 TB412823.[MT7]-DTNYPQTLK[MT7].2y6_1.heavy 684.374 / 893.521 537.0 24.673250198364258 39 14 10 5 10 1.9613302226404978 50.985804861239586 0.040500640869140625 3 0.9325776742211207 4.725956011809253 537.0 2.6134831460674155 1.0 - - - - - - - 0.0 1 0 MSH4 mutS homolog 4 (E. coli) 687 88 C20140704_OR005_04 C20140704_OR005_04 TB427089.[MT7]-VRGEPLQVER.2y8_1.heavy 663.884 / 927.489 1851.0 23.127700805664062 39 9 10 10 10 0.8713911386613891 73.13472729913227 0.0 3 0.8169432941899623 2.839293119307996 1851.0 35.018918918918914 0.0 - - - - - - - 118.4 3 5 TACSTD2 tumor-associated calcium signal transducer 2 689 88 C20140704_OR005_04 C20140704_OR005_04 TB427089.[MT7]-VRGEPLQVER.2b4_1.heavy 663.884 / 586.343 666.0 23.127700805664062 39 9 10 10 10 0.8713911386613891 73.13472729913227 0.0 3 0.8169432941899623 2.839293119307996 666.0 5.0600000000000005 3.0 - - - - - - - 0.0 1 0 TACSTD2 tumor-associated calcium signal transducer 2 691 88 C20140704_OR005_04 C20140704_OR005_04 TB427089.[MT7]-VRGEPLQVER.2y6_1.heavy 663.884 / 741.425 518.0 23.127700805664062 39 9 10 10 10 0.8713911386613891 73.13472729913227 0.0 3 0.8169432941899623 2.839293119307996 518.0 9.8 0.0 - - - - - - - 0.0 1 0 TACSTD2 tumor-associated calcium signal transducer 2 693 88 C20140704_OR005_04 C20140704_OR005_04 TB427089.[MT7]-VRGEPLQVER.2b7_1.heavy 663.884 / 924.538 444.0 23.127700805664062 39 9 10 10 10 0.8713911386613891 73.13472729913227 0.0 3 0.8169432941899623 2.839293119307996 444.0 5.32 3.0 - - - - - - - 0.0 0 0 TACSTD2 tumor-associated calcium signal transducer 2 695 89 C20140704_OR005_04 C20140704_OR005_04 TB450672.[MT7]-LLEGEETR.2b3_1.heavy 545.797 / 500.32 3916.0 25.91230010986328 48 18 10 10 10 6.956334945745762 14.375386001382282 0.0 3 0.9867653805861964 10.715846849387889 3916.0 9.938142600098779 1.0 - - - - - - - 294.0 7 11 NEFM;NEFL;INA neurofilament, medium polypeptide;neurofilament, light polypeptide;internexin neuronal intermediate filament protein, alpha 697 89 C20140704_OR005_04 C20140704_OR005_04 TB450672.[MT7]-LLEGEETR.2y5_1.heavy 545.797 / 591.273 4602.0 25.91230010986328 48 18 10 10 10 6.956334945745762 14.375386001382282 0.0 3 0.9867653805861964 10.715846849387889 4602.0 12.765621683473075 0.0 - - - - - - - 258.3636363636364 9 11 NEFM;NEFL;INA neurofilament, medium polypeptide;neurofilament, light polypeptide;internexin neuronal intermediate filament protein, alpha 699 89 C20140704_OR005_04 C20140704_OR005_04 TB450672.[MT7]-LLEGEETR.2y6_1.heavy 545.797 / 720.316 4112.0 25.91230010986328 48 18 10 10 10 6.956334945745762 14.375386001382282 0.0 3 0.9867653805861964 10.715846849387889 4112.0 16.79320423228917 0.0 - - - - - - - 240.54545454545453 8 11 NEFM;NEFL;INA neurofilament, medium polypeptide;neurofilament, light polypeptide;internexin neuronal intermediate filament protein, alpha 701 89 C20140704_OR005_04 C20140704_OR005_04 TB450672.[MT7]-LLEGEETR.2y7_1.heavy 545.797 / 833.4 9301.0 25.91230010986328 48 18 10 10 10 6.956334945745762 14.375386001382282 0.0 3 0.9867653805861964 10.715846849387889 9301.0 63.272108843537424 0.0 - - - - - - - 211.07692307692307 18 13 NEFM;NEFL;INA neurofilament, medium polypeptide;neurofilament, light polypeptide;internexin neuronal intermediate filament protein, alpha 703 90 C20140704_OR005_04 C20140704_OR005_04 TB427623.[MT7]-TGIIVTTSEAVLLQLVADK[MT7]DHPK[MT7].4y4_1.heavy 720.925 / 640.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 705 90 C20140704_OR005_04 C20140704_OR005_04 TB427623.[MT7]-TGIIVTTSEAVLLQLVADK[MT7]DHPK[MT7].4b4_1.heavy 720.925 / 529.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 707 90 C20140704_OR005_04 C20140704_OR005_04 TB427623.[MT7]-TGIIVTTSEAVLLQLVADK[MT7]DHPK[MT7].4b5_1.heavy 720.925 / 628.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 709 90 C20140704_OR005_04 C20140704_OR005_04 TB427623.[MT7]-TGIIVTTSEAVLLQLVADK[MT7]DHPK[MT7].4y6_1.heavy 720.925 / 1027.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 711 91 C20140704_OR005_04 C20140704_OR005_04 TB427621.[MT7]-K[MT7]QIAAQTNLTLLQVNNWFINAR.4y5_1.heavy 711.908 / 620.352 2503.0 46.27690124511719 44 14 10 10 10 2.3376815263810613 42.77742663895235 0.0 3 0.9310479380942076 4.672627102226774 2503.0 31.544373061106704 0.0 - - - - - - - 158.3 5 10 PKNOX1 PBX/knotted 1 homeobox 1 713 91 C20140704_OR005_04 C20140704_OR005_04 TB427621.[MT7]-K[MT7]QIAAQTNLTLLQVNNWFINAR.4b8_2.heavy 711.908 / 572.34 3504.0 46.27690124511719 44 14 10 10 10 2.3376815263810613 42.77742663895235 0.0 3 0.9310479380942076 4.672627102226774 3504.0 18.5858874251497 0.0 - - - - - - - 216.7 7 10 PKNOX1 PBX/knotted 1 homeobox 1 715 91 C20140704_OR005_04 C20140704_OR005_04 TB427621.[MT7]-K[MT7]QIAAQTNLTLLQVNNWFINAR.4b4_1.heavy 711.908 / 729.486 1251.0 46.27690124511719 44 14 10 10 10 2.3376815263810613 42.77742663895235 0.0 3 0.9310479380942076 4.672627102226774 1251.0 4.994011976047903 0.0 - - - - - - - 159.75 2 12 PKNOX1 PBX/knotted 1 homeobox 1 717 91 C20140704_OR005_04 C20140704_OR005_04 TB427621.[MT7]-K[MT7]QIAAQTNLTLLQVNNWFINAR.4b5_1.heavy 711.908 / 800.523 834.0 46.27690124511719 44 14 10 10 10 2.3376815263810613 42.77742663895235 0.0 3 0.9310479380942076 4.672627102226774 834.0 4.394491017964072 2.0 - - - - - - - 0.0 1 0 PKNOX1 PBX/knotted 1 homeobox 1 719 92 C20140704_OR005_04 C20140704_OR005_04 TB427083.[MT7]-ASRNVMPLGAR.3y6_2.heavy 439.251 / 322.681 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 721 92 C20140704_OR005_04 C20140704_OR005_04 TB427083.[MT7]-ASRNVMPLGAR.3b6_1.heavy 439.251 / 803.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 723 92 C20140704_OR005_04 C20140704_OR005_04 TB427083.[MT7]-ASRNVMPLGAR.3y6_1.heavy 439.251 / 644.355 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 725 92 C20140704_OR005_04 C20140704_OR005_04 TB427083.[MT7]-ASRNVMPLGAR.3y5_1.heavy 439.251 / 513.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 727 93 C20140704_OR005_04 C20140704_OR005_04 TB412546.[MT7]-QNTSQK[MT7].2y4_1.heavy 497.282 / 607.353 398.0 12.045499801635742 48 18 10 10 10 6.57112281185796 15.218099381667981 0.0 3 0.9847349470505233 9.976063362693727 398.0 10.561156737998843 0.0 - - - - - - - 0.0 0 0 TACSTD2 tumor-associated calcium signal transducer 2 729 93 C20140704_OR005_04 C20140704_OR005_04 TB412546.[MT7]-QNTSQK[MT7].2b5_1.heavy 497.282 / 703.349 125.0 12.045499801635742 48 18 10 10 10 6.57112281185796 15.218099381667981 0.0 3 0.9847349470505233 9.976063362693727 125.0 -0.5 3.0 - - - - - - - 0.0 0 0 TACSTD2 tumor-associated calcium signal transducer 2 731 93 C20140704_OR005_04 C20140704_OR005_04 TB412546.[MT7]-QNTSQK[MT7].2y5_1.heavy 497.282 / 721.396 979.0 12.045499801635742 48 18 10 10 10 6.57112281185796 15.218099381667981 0.0 3 0.9847349470505233 9.976063362693727 979.0 8.312264150943395 0.0 - - - - - - - 0.0 1 0 TACSTD2 tumor-associated calcium signal transducer 2 733 93 C20140704_OR005_04 C20140704_OR005_04 TB412546.[MT7]-QNTSQK[MT7].2y3_1.heavy 497.282 / 506.306 489.0 12.045499801635742 48 18 10 10 10 6.57112281185796 15.218099381667981 0.0 3 0.9847349470505233 9.976063362693727 489.0 43.492177822177815 0.0 - - - - - - - 0.0 0 0 TACSTD2 tumor-associated calcium signal transducer 2 735 94 C20140704_OR005_04 C20140704_OR005_04 TB427620.[MT7]-HIDC[CAM]AYVYQNEHEVGEAIQEK[MT7].4b7_1.heavy 705.843 / 1003.48 5450.0 31.979299545288086 40 10 10 10 10 0.695486060589743 72.88999754539498 0.0 3 0.835747851464426 3.002443095597802 5450.0 44.717948717948715 0.0 - - - - - - - 212.54545454545453 10 11 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 737 94 C20140704_OR005_04 C20140704_OR005_04 TB427620.[MT7]-HIDC[CAM]AYVYQNEHEVGEAIQEK[MT7].4b5_1.heavy 705.843 / 741.347 8759.0 31.979299545288086 40 10 10 10 10 0.695486060589743 72.88999754539498 0.0 3 0.835747851464426 3.002443095597802 8759.0 118.18959927976275 0.0 - - - - - - - 233.6 17 5 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 739 94 C20140704_OR005_04 C20140704_OR005_04 TB427620.[MT7]-HIDC[CAM]AYVYQNEHEVGEAIQEK[MT7].4y3_1.heavy 705.843 / 548.316 16837.0 31.979299545288086 40 10 10 10 10 0.695486060589743 72.88999754539498 0.0 3 0.835747851464426 3.002443095597802 16837.0 96.29249939106677 0.0 - - - - - - - 221.45454545454547 33 11 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 741 94 C20140704_OR005_04 C20140704_OR005_04 TB427620.[MT7]-HIDC[CAM]AYVYQNEHEVGEAIQEK[MT7].4b3_1.heavy 705.843 / 510.279 7591.0 31.979299545288086 40 10 10 10 10 0.695486060589743 72.88999754539498 0.0 3 0.835747851464426 3.002443095597802 7591.0 112.6670547184774 0.0 - - - - - - - 214.1 15 10 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 743 95 C20140704_OR005_04 C20140704_OR005_04 TB413065.[MT7]-AHPDQLVLIFAGK[MT7].4b7_1.heavy 425.005 / 905.496 N/A 40.58150100708008 42 12 10 10 10 1.009818069090145 56.774898565472796 0.0 3 0.8808743845490594 3.5395749803130028 0.0 0.0 4.0 - - - - - - - 0.0 0 0 UBQLN3 ubiquilin 3 745 95 C20140704_OR005_04 C20140704_OR005_04 TB413065.[MT7]-AHPDQLVLIFAGK[MT7].4b4_1.heavy 425.005 / 565.285 1563.0 40.58150100708008 42 12 10 10 10 1.009818069090145 56.774898565472796 0.0 3 0.8808743845490594 3.5395749803130028 1563.0 23.445 0.0 - - - - - - - 210.25 3 4 UBQLN3 ubiquilin 3 747 95 C20140704_OR005_04 C20140704_OR005_04 TB413065.[MT7]-AHPDQLVLIFAGK[MT7].4b5_1.heavy 425.005 / 693.344 841.0 40.58150100708008 42 12 10 10 10 1.009818069090145 56.774898565472796 0.0 3 0.8808743845490594 3.5395749803130028 841.0 9.110833333333334 0.0 - - - - - - - 0.0 1 0 UBQLN3 ubiquilin 3 749 95 C20140704_OR005_04 C20140704_OR005_04 TB413065.[MT7]-AHPDQLVLIFAGK[MT7].4b6_1.heavy 425.005 / 806.428 721.0 40.58150100708008 42 12 10 10 10 1.009818069090145 56.774898565472796 0.0 3 0.8808743845490594 3.5395749803130028 721.0 -1.2016666666666669 0.0 - - - - - - - 0.0 1 0 UBQLN3 ubiquilin 3 751 96 C20140704_OR005_04 C20140704_OR005_04 TB450772.[MT7]-THHILIDLR.3y3_1.heavy 421.255 / 403.23 N/A N/A - - - - - - - - - 0.0 - - - - - - - TACSTD2 tumor-associated calcium signal transducer 2 753 96 C20140704_OR005_04 C20140704_OR005_04 TB450772.[MT7]-THHILIDLR.3y3_2.heavy 421.255 / 202.119 N/A N/A - - - - - - - - - 0.0 - - - - - - - TACSTD2 tumor-associated calcium signal transducer 2 755 97 C20140704_OR005_04 C20140704_OR005_04 TB412937.[MT7]-LFEAPSFFQK[MT7].2b3_1.heavy 751.418 / 534.304 2198.0 42.65869903564453 44 14 10 10 10 3.724624494356722 26.848344081802786 0.0 3 0.9336603906539755 4.764806385531689 2198.0 12.078216574063127 0.0 - - - - - - - 128.33333333333334 4 6 PAPOLB poly(A) polymerase beta (testis specific) 757 97 C20140704_OR005_04 C20140704_OR005_04 TB412937.[MT7]-LFEAPSFFQK[MT7].2y3_1.heavy 751.418 / 566.342 330.0 42.65869903564453 44 14 10 10 10 3.724624494356722 26.848344081802786 0.0 3 0.9336603906539755 4.764806385531689 330.0 -0.21005459508644217 24.0 - - - - - - - 288.75 2 8 PAPOLB poly(A) polymerase beta (testis specific) 759 97 C20140704_OR005_04 C20140704_OR005_04 TB412937.[MT7]-LFEAPSFFQK[MT7].2y6_1.heavy 751.418 / 897.495 3956.0 42.65869903564453 44 14 10 10 10 3.724624494356722 26.848344081802786 0.0 3 0.9336603906539755 4.764806385531689 3956.0 43.156363636363636 0.0 - - - - - - - 195.55555555555554 7 9 PAPOLB poly(A) polymerase beta (testis specific) 761 97 C20140704_OR005_04 C20140704_OR005_04 TB412937.[MT7]-LFEAPSFFQK[MT7].2y7_1.heavy 751.418 / 968.532 1649.0 42.65869903564453 44 14 10 10 10 3.724624494356722 26.848344081802786 0.0 3 0.9336603906539755 4.764806385531689 1649.0 8.994545454545454 0.0 - - - - - - - 220.0 3 11 PAPOLB poly(A) polymerase beta (testis specific) 763 98 C20140704_OR005_04 C20140704_OR005_04 TB426894.[MT7]-TVINDDAR.2y5_1.heavy 524.281 / 590.253 1292.0 20.128049850463867 32 17 2 7 6 3.5288617527720563 28.337749395097774 0.027099609375 6 0.9755676260485895 7.879366679959242 1292.0 7.545760874474908 1.0 - - - - - - - 174.66666666666666 8 18 MSH4 mutS homolog 4 (E. coli) 765 98 C20140704_OR005_04 C20140704_OR005_04 TB426894.[MT7]-TVINDDAR.2b4_1.heavy 524.281 / 572.352 843.0 20.128049850463867 32 17 2 7 6 3.5288617527720563 28.337749395097774 0.027099609375 6 0.9755676260485895 7.879366679959242 843.0 0.770992366412214 0.0 - - - - - - - 0.0 1 0 MSH4 mutS homolog 4 (E. coli) 767 98 C20140704_OR005_04 C20140704_OR005_04 TB426894.[MT7]-TVINDDAR.2y6_1.heavy 524.281 / 703.337 2191.0 20.128049850463867 32 17 2 7 6 3.5288617527720563 28.337749395097774 0.027099609375 6 0.9755676260485895 7.879366679959242 2191.0 12.976021038790272 2.0 - - - - - - - 122.95238095238095 8 21 MSH4 mutS homolog 4 (E. coli) 769 98 C20140704_OR005_04 C20140704_OR005_04 TB426894.[MT7]-TVINDDAR.2b5_1.heavy 524.281 / 687.379 1742.0 20.128049850463867 32 17 2 7 6 3.5288617527720563 28.337749395097774 0.027099609375 6 0.9755676260485895 7.879366679959242 1742.0 45.88303571428571 0.0 - - - - - - - 129.1 3 10 MSH4 mutS homolog 4 (E. coli) 771 99 C20140704_OR005_04 C20140704_OR005_04 TB427215.[MT7]-LFEAPSFFQK[MT7].3b6_1.heavy 501.281 / 789.426 212.0 42.65869903564453 42 12 10 10 10 0.9868068820705006 67.557966890936 0.0 3 0.8890186515146635 3.6697502174544496 212.0 1.8666666666666667 3.0 - - - - - - - 0.0 0 0 PAPOLB poly(A) polymerase beta (testis specific) 773 99 C20140704_OR005_04 C20140704_OR005_04 TB427215.[MT7]-LFEAPSFFQK[MT7].3y3_1.heavy 501.281 / 566.342 5200.0 42.65869903564453 42 12 10 10 10 0.9868068820705006 67.557966890936 0.0 3 0.8890186515146635 3.6697502174544496 5200.0 24.83686884838148 0.0 - - - - - - - 212.0 10 4 PAPOLB poly(A) polymerase beta (testis specific) 775 99 C20140704_OR005_04 C20140704_OR005_04 TB427215.[MT7]-LFEAPSFFQK[MT7].3b4_1.heavy 501.281 / 605.341 3608.0 42.65869903564453 42 12 10 10 10 0.9868068820705006 67.557966890936 0.0 3 0.8890186515146635 3.6697502174544496 3608.0 42.66062893081761 0.0 - - - - - - - 106.0 7 3 PAPOLB poly(A) polymerase beta (testis specific) 777 99 C20140704_OR005_04 C20140704_OR005_04 TB427215.[MT7]-LFEAPSFFQK[MT7].3b3_1.heavy 501.281 / 534.304 4882.0 42.65869903564453 42 12 10 10 10 0.9868068820705006 67.557966890936 0.0 3 0.8890186515146635 3.6697502174544496 4882.0 65.40037735849056 0.0 - - - - - - - 148.4 9 5 PAPOLB poly(A) polymerase beta (testis specific) 779 100 C20140704_OR005_04 C20140704_OR005_04 TB426999.[MT7]-GLGSTVQEIDLTGVK[MT7].3b5_1.heavy 602.347 / 560.316 27737.0 37.222999572753906 45 15 10 10 10 3.018937052153167 33.12424150370342 0.0 3 0.9535943146707213 5.7066708307508955 27737.0 62.161896280424 0.0 - - - - - - - 267.3333333333333 55 9 ISOC1 isochorismatase domain containing 1 781 100 C20140704_OR005_04 C20140704_OR005_04 TB426999.[MT7]-GLGSTVQEIDLTGVK[MT7].3y4_1.heavy 602.347 / 548.352 59653.0 37.222999572753906 45 15 10 10 10 3.018937052153167 33.12424150370342 0.0 3 0.9535943146707213 5.7066708307508955 59653.0 129.19286659506903 0.0 - - - - - - - 237.375 119 8 ISOC1 isochorismatase domain containing 1 783 100 C20140704_OR005_04 C20140704_OR005_04 TB426999.[MT7]-GLGSTVQEIDLTGVK[MT7].3b8_1.heavy 602.347 / 916.486 29003.0 37.222999572753906 45 15 10 10 10 3.018937052153167 33.12424150370342 0.0 3 0.9535943146707213 5.7066708307508955 29003.0 299.35110505594696 0.0 - - - - - - - 278.4 58 5 ISOC1 isochorismatase domain containing 1 785 100 C20140704_OR005_04 C20140704_OR005_04 TB426999.[MT7]-GLGSTVQEIDLTGVK[MT7].3b7_1.heavy 602.347 / 787.443 20137.0 37.222999572753906 45 15 10 10 10 3.018937052153167 33.12424150370342 0.0 3 0.9535943146707213 5.7066708307508955 20137.0 172.90952631513477 0.0 - - - - - - - 177.4 40 5 ISOC1 isochorismatase domain containing 1 787 101 C20140704_OR005_04 C20140704_OR005_04 TB427217.[MT7]-DFLC[CAM]QYC[CAM]AQR.2b3_1.heavy 752.843 / 520.289 4425.0 32.268449783325195 38 14 10 6 8 3.8929053349149085 25.687755390071878 0.039897918701171875 4 0.935334790753563 4.826790662633361 4425.0 8.592233009708737 1.0 - - - - - - - 250.14285714285714 10 7 PLAG1;PLAGL2 pleiomorphic adenoma gene 1;pleiomorphic adenoma gene-like 2 789 101 C20140704_OR005_04 C20140704_OR005_04 TB427217.[MT7]-DFLC[CAM]QYC[CAM]AQR.2y8_1.heavy 752.843 / 1098.48 3293.0 32.268449783325195 38 14 10 6 8 3.8929053349149085 25.687755390071878 0.039897918701171875 4 0.935334790753563 4.826790662633361 3293.0 9.09126213592233 1.0 - - - - - - - 217.44444444444446 6 9 PLAG1;PLAGL2 pleiomorphic adenoma gene 1;pleiomorphic adenoma gene-like 2 791 101 C20140704_OR005_04 C20140704_OR005_04 TB427217.[MT7]-DFLC[CAM]QYC[CAM]AQR.2y9_1.heavy 752.843 / 1245.55 1955.0 32.268449783325195 38 14 10 6 8 3.8929053349149085 25.687755390071878 0.039897918701171875 4 0.935334790753563 4.826790662633361 1955.0 4.555339805825243 1.0 - - - - - - - 234.0909090909091 6 11 PLAG1;PLAGL2 pleiomorphic adenoma gene 1;pleiomorphic adenoma gene-like 2 793 101 C20140704_OR005_04 C20140704_OR005_04 TB427217.[MT7]-DFLC[CAM]QYC[CAM]AQR.2y7_1.heavy 752.843 / 985.398 14817.0 32.268449783325195 38 14 10 6 8 3.8929053349149085 25.687755390071878 0.039897918701171875 4 0.935334790753563 4.826790662633361 14817.0 94.42052226965357 0.0 - - - - - - - 171.66666666666666 29 9 PLAG1;PLAGL2 pleiomorphic adenoma gene 1;pleiomorphic adenoma gene-like 2 795 102 C20140704_OR005_04 C20140704_OR005_04 TB426898.[MT7]-GLDYGGVAR.2b6_1.heavy 526.286 / 707.348 1496.0 25.77110004425049 43 20 10 5 8 6.172684604303576 16.200406534667316 0.044399261474609375 4 0.9907167616844735 12.799001061368877 1496.0 3.8204735920067723 2.0 - - - - - - - 244.8181818181818 8 11 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 797 102 C20140704_OR005_04 C20140704_OR005_04 TB426898.[MT7]-GLDYGGVAR.2y6_1.heavy 526.286 / 622.331 4686.0 25.77110004425049 43 20 10 5 8 6.172684604303576 16.200406534667316 0.044399261474609375 4 0.9907167616844735 12.799001061368877 4686.0 58.6456432160804 0.0 - - - - - - - 235.72727272727272 9 11 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 799 102 C20140704_OR005_04 C20140704_OR005_04 TB426898.[MT7]-GLDYGGVAR.2b5_1.heavy 526.286 / 650.327 499.0 25.77110004425049 43 20 10 5 8 6.172684604303576 16.200406534667316 0.044399261474609375 4 0.9907167616844735 12.799001061368877 499.0 0.7627190922942759 14.0 - - - - - - - 0.0 1 0 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 801 102 C20140704_OR005_04 C20140704_OR005_04 TB426898.[MT7]-GLDYGGVAR.2y7_1.heavy 526.286 / 737.358 1496.0 25.77110004425049 43 20 10 5 8 6.172684604303576 16.200406534667316 0.044399261474609375 4 0.9907167616844735 12.799001061368877 1496.0 7.512559452782305 0.0 - - - - - - - 259.1 2 10 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 803 103 C20140704_OR005_04 C20140704_OR005_04 TB426993.[MT7]-ESILDLSK[MT7].2y4_1.heavy 596.855 / 606.358 21182.0 34.05294990539551 45 20 10 5 10 30.015243630882463 3.331640456754805 0.041103363037109375 3 0.9993194299022197 47.30437450113709 21182.0 70.56077646345162 0.0 - - - - - - - 789.8571428571429 42 7 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 805 103 C20140704_OR005_04 C20140704_OR005_04 TB426993.[MT7]-ESILDLSK[MT7].2y5_1.heavy 596.855 / 719.442 21771.0 34.05294990539551 45 20 10 5 10 30.015243630882463 3.331640456754805 0.041103363037109375 3 0.9993194299022197 47.30437450113709 21771.0 59.82399433427762 0.0 - - - - - - - 323.5 43 8 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 807 103 C20140704_OR005_04 C20140704_OR005_04 TB426993.[MT7]-ESILDLSK[MT7].2b5_1.heavy 596.855 / 702.379 22124.0 34.05294990539551 45 20 10 5 10 30.015243630882463 3.331640456754805 0.041103363037109375 3 0.9993194299022197 47.30437450113709 22124.0 50.68731245202872 0.0 - - - - - - - 235.5 44 8 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 809 103 C20140704_OR005_04 C20140704_OR005_04 TB426993.[MT7]-ESILDLSK[MT7].2y7_1.heavy 596.855 / 919.558 17652.0 34.05294990539551 45 20 10 5 10 30.015243630882463 3.331640456754805 0.041103363037109375 3 0.9993194299022197 47.30437450113709 17652.0 71.20764331210191 0.0 - - - - - - - 267.6363636363636 35 11 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 811 104 C20140704_OR005_04 C20140704_OR005_04 TB412545.[MT7]-STPEMER.2y5_1.heavy 497.243 / 661.297 1447.0 18.11590051651001 34 18 4 6 6 3.4356554625678233 29.106527441275958 0.03199958801269531 5 0.9818913776635697 9.157187451065285 1447.0 39.64390963405526 0.0 - - - - - - - 143.66666666666666 2 9 MSH4 mutS homolog 4 (E. coli) 813 104 C20140704_OR005_04 C20140704_OR005_04 TB412545.[MT7]-STPEMER.2b4_1.heavy 497.243 / 559.284 1085.0 18.11590051651001 34 18 4 6 6 3.4356554625678233 29.106527441275958 0.03199958801269531 5 0.9818913776635697 9.157187451065285 1085.0 6.301694915254238 1.0 - - - - - - - 166.92307692307693 5 13 MSH4 mutS homolog 4 (E. coli) 815 104 C20140704_OR005_04 C20140704_OR005_04 TB412545.[MT7]-STPEMER.2b6_1.heavy 497.243 / 819.367 155.0 18.11590051651001 34 18 4 6 6 3.4356554625678233 29.106527441275958 0.03199958801269531 5 0.9818913776635697 9.157187451065285 155.0 1.7884615384615385 7.0 - - - - - - - 0.0 0 0 MSH4 mutS homolog 4 (E. coli) 817 104 C20140704_OR005_04 C20140704_OR005_04 TB412545.[MT7]-STPEMER.2y6_1.heavy 497.243 / 762.345 568.0 18.11590051651001 34 18 4 6 6 3.4356554625678233 29.106527441275958 0.03199958801269531 5 0.9818913776635697 9.157187451065285 568.0 5.514563106796117 1.0 - - - - - - - 0.0 1 0 MSH4 mutS homolog 4 (E. coli) 819 105 C20140704_OR005_04 C20140704_OR005_04 TB427092.[MT7]-LWEGQDVLAR.2y8_1.heavy 665.865 / 887.458 17134.0 36.536251068115234 45 20 10 5 10 11.902345846952445 8.401705116441786 0.043701171875 3 0.9961327058301753 19.838950973078795 17134.0 75.6536635651479 0.0 - - - - - - - 225.0 34 5 PHF1 PHD finger protein 1 821 105 C20140704_OR005_04 C20140704_OR005_04 TB427092.[MT7]-LWEGQDVLAR.2y9_1.heavy 665.865 / 1073.54 48525.0 36.536251068115234 45 20 10 5 10 11.902345846952445 8.401705116441786 0.043701171875 3 0.9961327058301753 19.838950973078795 48525.0 136.0641 0.0 - - - - - - - 312.5 97 6 PHF1 PHD finger protein 1 823 105 C20140704_OR005_04 C20140704_OR005_04 TB427092.[MT7]-LWEGQDVLAR.2b6_1.heavy 665.865 / 873.422 11506.0 36.536251068115234 45 20 10 5 10 11.902345846952445 8.401705116441786 0.043701171875 3 0.9961327058301753 19.838950973078795 11506.0 50.770408997867804 0.0 - - - - - - - 250.0 23 2 PHF1 PHD finger protein 1 825 105 C20140704_OR005_04 C20140704_OR005_04 TB427092.[MT7]-LWEGQDVLAR.2b7_1.heavy 665.865 / 972.491 5753.0 36.536251068115234 45 20 10 5 10 11.902345846952445 8.401705116441786 0.043701171875 3 0.9961327058301753 19.838950973078795 5753.0 25.04472666666667 0.0 - - - - - - - 250.0 11 5 PHF1 PHD finger protein 1 827 106 C20140704_OR005_04 C20140704_OR005_04 TB427091.[MT7]-TLYLFGVTK[MT7].2y4_1.heavy 665.405 / 548.352 12462.0 40.824100494384766 48 18 10 10 10 4.0043603289559755 24.972777618659556 0.0 3 0.9844354989640962 9.87938376705926 12462.0 26.243546652461028 1.0 - - - - - - - 219.77777777777777 24 9 PSG6;PSG9 pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 829 106 C20140704_OR005_04 C20140704_OR005_04 TB427091.[MT7]-TLYLFGVTK[MT7].2y5_1.heavy 665.405 / 695.421 15025.0 40.824100494384766 48 18 10 10 10 4.0043603289559755 24.972777618659556 0.0 3 0.9844354989640962 9.87938376705926 15025.0 161.79227596087344 0.0 - - - - - - - 252.0 30 6 PSG6;PSG9 pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 831 106 C20140704_OR005_04 C20140704_OR005_04 TB427091.[MT7]-TLYLFGVTK[MT7].2b4_1.heavy 665.405 / 635.388 9551.0 40.824100494384766 48 18 10 10 10 4.0043603289559755 24.972777618659556 0.0 3 0.9844354989640962 9.87938376705926 9551.0 12.207339055793991 1.0 - - - - - - - 732.1428571428571 19 7 PSG6;PSG9 pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 833 106 C20140704_OR005_04 C20140704_OR005_04 TB427091.[MT7]-TLYLFGVTK[MT7].2y6_1.heavy 665.405 / 808.505 7454.0 40.824100494384766 48 18 10 10 10 4.0043603289559755 24.972777618659556 0.0 3 0.9844354989640962 9.87938376705926 7454.0 25.626863596530097 0.0 - - - - - - - 253.9090909090909 14 11 PSG6;PSG9 pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 835 107 C20140704_OR005_04 C20140704_OR005_04 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 14244.0 22.655099868774414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 14244.0 111.45366813585689 0.0 - - - - - - - 123.625 28 8 837 107 C20140704_OR005_04 C20140704_OR005_04 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 14701.0 22.655099868774414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 14701.0 88.688 0.0 - - - - - - - 185.0 29 7 839 107 C20140704_OR005_04 C20140704_OR005_04 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 67032.0 22.655099868774414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 67032.0 1225.98 0.0 - - - - - - - 152.2 134 10 841 108 C20140704_OR005_04 C20140704_OR005_04 TB427358.[MT7]-TLIYYLDEIPPK[MT7].3b7_1.heavy 585.006 / 1026.56 3630.0 46.22652530670166 40 18 10 2 10 6.102493363847409 16.386744571067176 0.08060073852539062 3 0.9871126174777672 10.859566627551406 3630.0 1.110868186311765 1.0 - - - - - - - 712.3333333333334 7 9 TACSTD2 tumor-associated calcium signal transducer 2 843 108 C20140704_OR005_04 C20140704_OR005_04 TB427358.[MT7]-TLIYYLDEIPPK[MT7].3b4_1.heavy 585.006 / 635.388 7259.0 46.22652530670166 40 18 10 2 10 6.102493363847409 16.386744571067176 0.08060073852539062 3 0.9871126174777672 10.859566627551406 7259.0 26.42648567339961 0.0 - - - - - - - 283.3333333333333 14 3 TACSTD2 tumor-associated calcium signal transducer 2 845 108 C20140704_OR005_04 C20140704_OR005_04 TB427358.[MT7]-TLIYYLDEIPPK[MT7].3b5_1.heavy 585.006 / 798.452 4865.0 46.22652530670166 40 18 10 2 10 6.102493363847409 16.386744571067176 0.08060073852539062 3 0.9871126174777672 10.859566627551406 4865.0 17.704789644012944 0.0 - - - - - - - 695.1428571428571 9 7 TACSTD2 tumor-associated calcium signal transducer 2 847 108 C20140704_OR005_04 C20140704_OR005_04 TB427358.[MT7]-TLIYYLDEIPPK[MT7].3b3_1.heavy 585.006 / 472.325 9576.0 46.22652530670166 40 18 10 2 10 6.102493363847409 16.386744571067176 0.08060073852539062 3 0.9871126174777672 10.859566627551406 9576.0 16.184262991566847 0.0 - - - - - - - 283.0 19 6 TACSTD2 tumor-associated calcium signal transducer 2 849 109 C20140704_OR005_04 C20140704_OR005_04 TB427357.[MT7]-TLIYYLDEIPPK[MT7].2b3_1.heavy 877.005 / 472.325 3858.0 46.21644973754883 40 15 10 5 10 4.029313921015229 24.81812089111288 0.0402984619140625 3 0.9555749393281081 5.833474460809532 3858.0 3.5709255898366608 0.0 - - - - - - - 262.22222222222223 7 9 TACSTD2 tumor-associated calcium signal transducer 2 851 109 C20140704_OR005_04 C20140704_OR005_04 TB427357.[MT7]-TLIYYLDEIPPK[MT7].2b4_1.heavy 877.005 / 635.388 2441.0 46.21644973754883 40 15 10 5 10 4.029313921015229 24.81812089111288 0.0402984619140625 3 0.9555749393281081 5.833474460809532 2441.0 2.893649449618967 0.0 - - - - - - - 262.3333333333333 4 9 TACSTD2 tumor-associated calcium signal transducer 2 853 109 C20140704_OR005_04 C20140704_OR005_04 TB427357.[MT7]-TLIYYLDEIPPK[MT7].2y3_1.heavy 877.005 / 485.32 12991.0 46.21644973754883 40 15 10 5 10 4.029313921015229 24.81812089111288 0.0402984619140625 3 0.9555749393281081 5.833474460809532 12991.0 57.89406826299089 0.0 - - - - - - - 787.0 25 1 TACSTD2 tumor-associated calcium signal transducer 2 855 109 C20140704_OR005_04 C20140704_OR005_04 TB427357.[MT7]-TLIYYLDEIPPK[MT7].2b5_1.heavy 877.005 / 798.452 866.0 46.21644973754883 40 15 10 5 10 4.029313921015229 24.81812089111288 0.0402984619140625 3 0.9555749393281081 5.833474460809532 866.0 0.6399661303979678 9.0 - - - - - - - 236.1818181818182 2 11 TACSTD2 tumor-associated calcium signal transducer 2 857 110 C20140704_OR005_04 C20140704_OR005_04 TB427635.[MT7]-TLVRPSEHALVDNDGLYDPDC[CAM]DPEGR.4y8_1.heavy 771.867 / 945.373 981.0 31.849149703979492 39 13 10 6 10 2.1349800774541348 36.49530896376589 0.03730010986328125 3 0.9109307267912184 4.104128233238081 981.0 3.4201530612244895 0.0 - - - - - - - 0.0 1 0 TACSTD2 tumor-associated calcium signal transducer 2 859 110 C20140704_OR005_04 C20140704_OR005_04 TB427635.[MT7]-TLVRPSEHALVDNDGLYDPDC[CAM]DPEGR.4b7_1.heavy 771.867 / 927.538 196.0 31.849149703979492 39 13 10 6 10 2.1349800774541348 36.49530896376589 0.03730010986328125 3 0.9109307267912184 4.104128233238081 196.0 1.1 20.0 - - - - - - - 0.0 0 0 TACSTD2 tumor-associated calcium signal transducer 2 861 110 C20140704_OR005_04 C20140704_OR005_04 TB427635.[MT7]-TLVRPSEHALVDNDGLYDPDC[CAM]DPEGR.4y6_1.heavy 771.867 / 733.293 588.0 31.849149703979492 39 13 10 6 10 2.1349800774541348 36.49530896376589 0.03730010986328125 3 0.9109307267912184 4.104128233238081 588.0 2.8499999999999996 3.0 - - - - - - - 0.0 1 0 TACSTD2 tumor-associated calcium signal transducer 2 863 110 C20140704_OR005_04 C20140704_OR005_04 TB427635.[MT7]-TLVRPSEHALVDNDGLYDPDC[CAM]DPEGR.4b9_2.heavy 771.867 / 568.321 1961.0 31.849149703979492 39 13 10 6 10 2.1349800774541348 36.49530896376589 0.03730010986328125 3 0.9109307267912184 4.104128233238081 1961.0 4.669047619047619 0.0 - - - - - - - 294.0 3 9 TACSTD2 tumor-associated calcium signal transducer 2 865 111 C20140704_OR005_04 C20140704_OR005_04 TB427637.[MT7]-IQNSQLQLQLNQDLSILHQDDGSSK[MT7].4y4_1.heavy 778.413 / 522.3 5027.0 41.96707534790039 43 18 10 5 10 3.488245979568757 28.667703076479356 0.04229736328125 3 0.9816307515856597 9.091794702428352 5027.0 12.983575463767888 0.0 - - - - - - - 223.36363636363637 10 11 PKNOX1 PBX/knotted 1 homeobox 1 867 111 C20140704_OR005_04 C20140704_OR005_04 TB427637.[MT7]-IQNSQLQLQLNQDLSILHQDDGSSK[MT7].4y8_1.heavy 778.413 / 1017.47 2221.0 41.96707534790039 43 18 10 5 10 3.488245979568757 28.667703076479356 0.04229736328125 3 0.9816307515856597 9.091794702428352 2221.0 3.596581196581197 1.0 - - - - - - - 234.0 4 10 PKNOX1 PBX/knotted 1 homeobox 1 869 111 C20140704_OR005_04 C20140704_OR005_04 TB427637.[MT7]-IQNSQLQLQLNQDLSILHQDDGSSK[MT7].4b5_1.heavy 778.413 / 715.385 6313.0 41.96707534790039 43 18 10 5 10 3.488245979568757 28.667703076479356 0.04229736328125 3 0.9816307515856597 9.091794702428352 6313.0 20.505930051983945 0.0 - - - - - - - 263.25 12 8 PKNOX1 PBX/knotted 1 homeobox 1 871 111 C20140704_OR005_04 C20140704_OR005_04 TB427637.[MT7]-IQNSQLQLQLNQDLSILHQDDGSSK[MT7].4b6_1.heavy 778.413 / 828.47 2455.0 41.96707534790039 43 18 10 5 10 3.488245979568757 28.667703076479356 0.04229736328125 3 0.9816307515856597 9.091794702428352 2455.0 20.07389598601288 0.0 - - - - - - - 257.4 4 5 PKNOX1 PBX/knotted 1 homeobox 1 873 112 C20140704_OR005_04 C20140704_OR005_04 TB451214.[MT7]-GTSVVLIC[CAM]PQDGMEAIPNPFIQQQDA.3b6_1.heavy 991.492 / 701.431 12265.0 48.805949211120605 46 20 10 6 10 5.853557178414806 17.083629142421884 0.030200958251953125 3 0.9913393611797763 13.251757143809755 12265.0 -1.0971464352804365 1.0 - - - - - - - 207.33333333333334 24 3 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 875 112 C20140704_OR005_04 C20140704_OR005_04 TB451214.[MT7]-GTSVVLIC[CAM]PQDGMEAIPNPFIQQQDA.3b5_1.heavy 991.492 / 588.347 13042.0 48.805949211120605 46 20 10 6 10 5.853557178414806 17.083629142421884 0.030200958251953125 3 0.9913393611797763 13.251757143809755 13042.0 -0.5478297395687484 0.0 - - - - - - - 440.0 26 3 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 877 112 C20140704_OR005_04 C20140704_OR005_04 TB451214.[MT7]-GTSVVLIC[CAM]PQDGMEAIPNPFIQQQDA.3b7_1.heavy 991.492 / 814.516 6987.0 48.805949211120605 46 20 10 6 10 5.853557178414806 17.083629142421884 0.030200958251953125 3 0.9913393611797763 13.251757143809755 6987.0 1.208293489955823 1.0 - - - - - - - 252.25 13 4 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 879 112 C20140704_OR005_04 C20140704_OR005_04 TB451214.[MT7]-GTSVVLIC[CAM]PQDGMEAIPNPFIQQQDA.3y10_1.heavy 991.492 / 1157.56 2484.0 48.805949211120605 46 20 10 6 10 5.853557178414806 17.083629142421884 0.030200958251953125 3 0.9913393611797763 13.251757143809755 2484.0 0.25595054095826886 2.0 - - - - - - - 271.875 4 8 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 881 113 C20140704_OR005_04 C20140704_OR005_04 TB427097.[MT7]-AYYGSLEDK[MT7].2b3_1.heavy 667.348 / 542.273 1984.0 27.467500686645508 35 14 6 5 10 1.2818146264241697 45.111009293150175 0.040599822998046875 3 0.9330702297098251 4.743513604086638 1984.0 16.032323232323233 0.0 - - - - - - - 243.36363636363637 3 11 MSH4 mutS homolog 4 (E. coli) 883 113 C20140704_OR005_04 C20140704_OR005_04 TB427097.[MT7]-AYYGSLEDK[MT7].2y8_1.heavy 667.348 / 1118.55 1587.0 27.467500686645508 35 14 6 5 10 1.2818146264241697 45.111009293150175 0.040599822998046875 3 0.9330702297098251 4.743513604086638 1587.0 6.939292251372789 2.0 - - - - - - - 178.4 6 5 MSH4 mutS homolog 4 (E. coli) 885 113 C20140704_OR005_04 C20140704_OR005_04 TB427097.[MT7]-AYYGSLEDK[MT7].2y6_1.heavy 667.348 / 792.422 1884.0 27.467500686645508 35 14 6 5 10 1.2818146264241697 45.111009293150175 0.040599822998046875 3 0.9330702297098251 4.743513604086638 1884.0 17.883113391984363 0.0 - - - - - - - 235.5 3 8 MSH4 mutS homolog 4 (E. coli) 887 113 C20140704_OR005_04 C20140704_OR005_04 TB427097.[MT7]-AYYGSLEDK[MT7].2y7_1.heavy 667.348 / 955.485 2083.0 27.467500686645508 35 14 6 5 10 1.2818146264241697 45.111009293150175 0.040599822998046875 3 0.9330702297098251 4.743513604086638 2083.0 7.1641414141414135 1.0 - - - - - - - 176.11111111111111 4 9 MSH4 mutS homolog 4 (E. coli) 889 114 C20140704_OR005_04 C20140704_OR005_04 TB412941.[MT7]-NVNFTTIQRK[MT7].3y6_1.heavy 503.631 / 890.554 2393.0 26.261899948120117 44 14 10 10 10 1.7930239149503313 47.26264196622107 0.0 3 0.9360800004231036 4.855154438689604 2393.0 31.169125628140705 0.0 - - - - - - - 199.5 4 4 MSH4 mutS homolog 4 (E. coli) 891 114 C20140704_OR005_04 C20140704_OR005_04 TB412941.[MT7]-NVNFTTIQRK[MT7].3y8_1.heavy 503.631 / 1151.67 N/A 26.261899948120117 44 14 10 10 10 1.7930239149503313 47.26264196622107 0.0 3 0.9360800004231036 4.855154438689604 0.0 0.0 12.0 - - - - - - - 0.0 0 0 MSH4 mutS homolog 4 (E. coli) 893 114 C20140704_OR005_04 C20140704_OR005_04 TB412941.[MT7]-NVNFTTIQRK[MT7].3y8_2.heavy 503.631 / 576.336 3790.0 26.261899948120117 44 14 10 10 10 1.7930239149503313 47.26264196622107 0.0 3 0.9360800004231036 4.855154438689604 3790.0 26.631532075091172 2.0 - - - - - - - 162.0 7 8 MSH4 mutS homolog 4 (E. coli) 895 114 C20140704_OR005_04 C20140704_OR005_04 TB412941.[MT7]-NVNFTTIQRK[MT7].3y5_1.heavy 503.631 / 789.506 1496.0 26.261899948120117 44 14 10 10 10 1.7930239149503313 47.26264196622107 0.0 3 0.9360800004231036 4.855154438689604 1496.0 7.242412060301507 1.0 - - - - - - - 199.33333333333334 2 6 MSH4 mutS homolog 4 (E. coli) 897 115 C20140704_OR005_04 C20140704_OR005_04 TB413070.[MT7]-DAPAPAASQPSGC[CAM]GK[MT7].2y4_1.heavy 851.427 / 565.288 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 899 115 C20140704_OR005_04 C20140704_OR005_04 TB413070.[MT7]-DAPAPAASQPSGC[CAM]GK[MT7].2y8_1.heavy 851.427 / 964.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 901 115 C20140704_OR005_04 C20140704_OR005_04 TB413070.[MT7]-DAPAPAASQPSGC[CAM]GK[MT7].2y6_1.heavy 851.427 / 749.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 903 115 C20140704_OR005_04 C20140704_OR005_04 TB413070.[MT7]-DAPAPAASQPSGC[CAM]GK[MT7].2y11_1.heavy 851.427 / 1203.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 905 116 C20140704_OR005_04 C20140704_OR005_04 TB412808.[MT7]-ASAPESGLLSK[MT7].2y8_1.heavy 674.39 / 974.564 8840.0 28.12367534637451 37 15 10 6 6 3.379277913457234 29.592120731405934 0.035900115966796875 5 0.9581284251016233 6.010015194444634 8840.0 124.80369524389624 0.0 - - - - - - - 207.0 17 12 ISOC1 isochorismatase domain containing 1 907 116 C20140704_OR005_04 C20140704_OR005_04 TB412808.[MT7]-ASAPESGLLSK[MT7].2y6_1.heavy 674.39 / 748.469 1291.0 28.12367534637451 37 15 10 6 6 3.379277913457234 29.592120731405934 0.035900115966796875 5 0.9581284251016233 6.010015194444634 1291.0 2.4917380352644836 2.0 - - - - - - - 231.66666666666666 2 9 ISOC1 isochorismatase domain containing 1 909 116 C20140704_OR005_04 C20140704_OR005_04 TB412808.[MT7]-ASAPESGLLSK[MT7].2y10_1.heavy 674.39 / 1132.63 1589.0 28.12367534637451 37 15 10 6 6 3.379277913457234 29.592120731405934 0.035900115966796875 5 0.9581284251016233 6.010015194444634 1589.0 3.7623677581863975 2.0 - - - - - - - 204.625 10 16 ISOC1 isochorismatase domain containing 1 911 116 C20140704_OR005_04 C20140704_OR005_04 TB412808.[MT7]-ASAPESGLLSK[MT7].2b7_1.heavy 674.39 / 744.364 596.0 28.12367534637451 37 15 10 6 6 3.379277913457234 29.592120731405934 0.035900115966796875 5 0.9581284251016233 6.010015194444634 596.0 0.8 2.0 - - - - - - - 0.0 1 0 ISOC1 isochorismatase domain containing 1 913 117 C20140704_OR005_04 C20140704_OR005_04 TB427204.[MT7]-IWQGIDIETK[MT7].3y3_1.heavy 497.62 / 521.305 18005.0 37.93550109863281 40 12 10 10 8 1.778218660216196 44.3504376377103 0.0 4 0.8917429934253613 3.7165180411104326 18005.0 18.07670933392484 0.0 - - - - - - - 255.5 36 4 TESC tescalcin 915 117 C20140704_OR005_04 C20140704_OR005_04 TB427204.[MT7]-IWQGIDIETK[MT7].3b6_1.heavy 497.62 / 857.464 5108.0 37.93550109863281 40 12 10 10 8 1.778218660216196 44.3504376377103 0.0 4 0.8917429934253613 3.7165180411104326 5108.0 70.6340625 0.0 - - - - - - - 128.0 10 4 TESC tescalcin 917 117 C20140704_OR005_04 C20140704_OR005_04 TB427204.[MT7]-IWQGIDIETK[MT7].3b4_1.heavy 497.62 / 629.353 11109.0 37.93550109863281 40 12 10 10 8 1.778218660216196 44.3504376377103 0.0 4 0.8917429934253613 3.7165180411104326 11109.0 155.526 0.0 - - - - - - - 128.0 22 2 TESC tescalcin 919 117 C20140704_OR005_04 C20140704_OR005_04 TB427204.[MT7]-IWQGIDIETK[MT7].3b3_1.heavy 497.62 / 572.331 7534.0 37.93550109863281 40 12 10 10 8 1.778218660216196 44.3504376377103 0.0 4 0.8917429934253613 3.7165180411104326 7534.0 16.640193155500686 2.0 - - - - - - - 287.25 16 4 TESC tescalcin 921 118 C20140704_OR005_04 C20140704_OR005_04 TB450556.[MT7]-NSATGK[MT7].2y4_1.heavy 433.253 / 520.321 379.0 12.55519962310791 43 13 10 10 10 1.5895197089782405 54.41243375249536 0.0 3 0.9256032214105843 4.496300194186662 379.0 5.243590411672746 0.0 - - - - - - - 0.0 0 0 PSG8;PSG1;PSG4;PSG5;PSG6;PSG7 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene) 923 118 C20140704_OR005_04 C20140704_OR005_04 TB450556.[MT7]-NSATGK[MT7].2b5_1.heavy 433.253 / 575.291 76.0 12.55519962310791 43 13 10 10 10 1.5895197089782405 54.41243375249536 0.0 3 0.9256032214105843 4.496300194186662 76.0 3.6096 9.0 - - - - - - - 0.0 0 0 PSG8;PSG1;PSG4;PSG5;PSG6;PSG7 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene) 925 118 C20140704_OR005_04 C20140704_OR005_04 TB450556.[MT7]-NSATGK[MT7].2y5_1.heavy 433.253 / 607.353 1265.0 12.55519962310791 43 13 10 10 10 1.5895197089782405 54.41243375249536 0.0 3 0.9256032214105843 4.496300194186662 1265.0 23.30263157894737 0.0 - - - - - - - 155.42857142857142 2 7 PSG8;PSG1;PSG4;PSG5;PSG6;PSG7 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene) 927 118 C20140704_OR005_04 C20140704_OR005_04 TB450556.[MT7]-NSATGK[MT7].2y3_1.heavy 433.253 / 449.284 835.0 12.55519962310791 43 13 10 10 10 1.5895197089782405 54.41243375249536 0.0 3 0.9256032214105843 4.496300194186662 835.0 26.653861386138612 0.0 - - - - - - - 0.0 1 0 PSG8;PSG1;PSG4;PSG5;PSG6;PSG7 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene) 929 119 C20140704_OR005_04 C20140704_OR005_04 TB412946.[MT7]-LSYLDVYLIHWPQGFK[MT7].3b6_1.heavy 756.42 / 835.468 12369.0 48.59369945526123 38 12 10 6 10 0.9218324981036691 54.44552696286573 0.030399322509765625 3 0.8922607141314488 3.7256042455490186 12369.0 95.022265625 0.0 - - - - - - - 165.7058823529412 24 17 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 931 119 C20140704_OR005_04 C20140704_OR005_04 TB412946.[MT7]-LSYLDVYLIHWPQGFK[MT7].3b5_1.heavy 756.42 / 736.4 13907.0 48.59369945526123 38 12 10 6 10 0.9218324981036691 54.44552696286573 0.030399322509765625 3 0.8922607141314488 3.7256042455490186 13907.0 225.98875 0.0 - - - - - - - 140.8 27 15 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 933 119 C20140704_OR005_04 C20140704_OR005_04 TB412946.[MT7]-LSYLDVYLIHWPQGFK[MT7].3b7_1.heavy 756.42 / 998.531 15445.0 48.59369945526123 38 12 10 6 10 0.9218324981036691 54.44552696286573 0.030399322509765625 3 0.8922607141314488 3.7256042455490186 15445.0 269.080859375 0.0 - - - - - - - 145.13333333333333 30 15 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 935 119 C20140704_OR005_04 C20140704_OR005_04 TB412946.[MT7]-LSYLDVYLIHWPQGFK[MT7].3y5_1.heavy 756.42 / 720.416 39029.0 48.59369945526123 38 12 10 6 10 0.9218324981036691 54.44552696286573 0.030399322509765625 3 0.8922607141314488 3.7256042455490186 39029.0 326.1914509799142 0.0 - - - - - - - 205.0 78 15 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 937 120 C20140704_OR005_04 C20140704_OR005_04 TB450917.[MT7]-NHLQTHDPNK[MT7].2b3_1.heavy 746.399 / 509.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL1;PLAGL2 pleiomorphic adenoma gene-like 1;pleiomorphic adenoma gene-like 2 939 120 C20140704_OR005_04 C20140704_OR005_04 TB450917.[MT7]-NHLQTHDPNK[MT7].2b4_1.heavy 746.399 / 637.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL1;PLAGL2 pleiomorphic adenoma gene-like 1;pleiomorphic adenoma gene-like 2 941 120 C20140704_OR005_04 C20140704_OR005_04 TB450917.[MT7]-NHLQTHDPNK[MT7].2y3_1.heavy 746.399 / 502.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL1;PLAGL2 pleiomorphic adenoma gene-like 1;pleiomorphic adenoma gene-like 2 943 120 C20140704_OR005_04 C20140704_OR005_04 TB450917.[MT7]-NHLQTHDPNK[MT7].2b7_1.heavy 746.399 / 990.487 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL1;PLAGL2 pleiomorphic adenoma gene-like 1;pleiomorphic adenoma gene-like 2 945 121 C20140704_OR005_04 C20140704_OR005_04 TB450916.[MT7]-IWQGIDIETK[MT7].2y4_1.heavy 745.927 / 634.389 9212.0 37.92425060272217 39 14 10 5 10 19.247602618711625 5.195452232725579 0.045001983642578125 3 0.9323816537041928 4.719021894605929 9212.0 30.97670166195328 0.0 - - - - - - - 319.85714285714283 18 7 TESC tescalcin 947 121 C20140704_OR005_04 C20140704_OR005_04 TB450916.[MT7]-IWQGIDIETK[MT7].2y9_1.heavy 745.927 / 1233.66 2863.0 37.92425060272217 39 14 10 5 10 19.247602618711625 5.195452232725579 0.045001983642578125 3 0.9323816537041928 4.719021894605929 2863.0 32.39559236947791 0.0 - - - - - - - 195.28571428571428 5 7 TESC tescalcin 949 121 C20140704_OR005_04 C20140704_OR005_04 TB450916.[MT7]-IWQGIDIETK[MT7].2y3_1.heavy 745.927 / 521.305 7345.0 37.92425060272217 39 14 10 5 10 19.247602618711625 5.195452232725579 0.045001983642578125 3 0.9323816537041928 4.719021894605929 7345.0 20.563609809010963 0.0 - - - - - - - 248.9 14 10 TESC tescalcin 951 121 C20140704_OR005_04 C20140704_OR005_04 TB450916.[MT7]-IWQGIDIETK[MT7].2y7_1.heavy 745.927 / 919.522 10955.0 37.92425060272217 39 14 10 5 10 19.247602618711625 5.195452232725579 0.045001983642578125 3 0.9323816537041928 4.719021894605929 10955.0 70.50819096216087 1.0 - - - - - - - 165.66666666666666 25 6 TESC tescalcin 953 122 C20140704_OR005_04 C20140704_OR005_04 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 93052.0 32.28839874267578 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 93052.0 276.05456909776393 1.0 - - - - - - - 142.66666666666666 192 3 955 122 C20140704_OR005_04 C20140704_OR005_04 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 99355.0 32.28839874267578 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 99355.0 480.80391588785045 0.0 - - - - - - - 213.83333333333334 198 6 957 122 C20140704_OR005_04 C20140704_OR005_04 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 184287.0 32.28839874267578 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 184287.0 542.5080508696564 0.0 - - - - - - - 305.0 368 7 959 123 C20140704_OR005_04 C20140704_OR005_04 TB412802.[MT7]-HLVVHTGRK[MT7].2y8_1.heavy 667.917 / 1053.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 961 123 C20140704_OR005_04 C20140704_OR005_04 TB412802.[MT7]-HLVVHTGRK[MT7].2y5_1.heavy 667.917 / 742.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 963 123 C20140704_OR005_04 C20140704_OR005_04 TB412802.[MT7]-HLVVHTGRK[MT7].2y6_1.heavy 667.917 / 841.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 965 123 C20140704_OR005_04 C20140704_OR005_04 TB412802.[MT7]-HLVVHTGRK[MT7].2y7_1.heavy 667.917 / 940.581 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 967 124 C20140704_OR005_04 C20140704_OR005_04 TB412739.[MT7]-ETDC[CAM]LLTQR.2y6_1.heavy 640.325 / 790.424 7445.0 27.04914951324463 33 11 10 2 10 1.566685391666911 54.18440926087587 0.08090019226074219 3 0.8652800848513399 3.3238827238445285 7445.0 44.039124047657644 0.0 - - - - - - - 184.28571428571428 14 7 PAPOLB poly(A) polymerase beta (testis specific) 969 124 C20140704_OR005_04 C20140704_OR005_04 TB412739.[MT7]-ETDC[CAM]LLTQR.2y8_1.heavy 640.325 / 1006.5 15188.0 27.04914951324463 33 11 10 2 10 1.566685391666911 54.18440926087587 0.08090019226074219 3 0.8652800848513399 3.3238827238445285 15188.0 183.4226898012382 0.0 - - - - - - - 264.8333333333333 30 6 PAPOLB poly(A) polymerase beta (testis specific) 971 124 C20140704_OR005_04 C20140704_OR005_04 TB412739.[MT7]-ETDC[CAM]LLTQR.2y5_1.heavy 640.325 / 630.393 1688.0 27.04914951324463 33 11 10 2 10 1.566685391666911 54.18440926087587 0.08090019226074219 3 0.8652800848513399 3.3238827238445285 1688.0 6.09858064516129 2.0 - - - - - - - 360.90909090909093 3 11 PAPOLB poly(A) polymerase beta (testis specific) 973 124 C20140704_OR005_04 C20140704_OR005_04 TB412739.[MT7]-ETDC[CAM]LLTQR.2b4_1.heavy 640.325 / 650.257 2482.0 27.04914951324463 33 11 10 2 10 1.566685391666911 54.18440926087587 0.08090019226074219 3 0.8652800848513399 3.3238827238445285 2482.0 7.6291275167785235 1.0 - - - - - - - 225.54545454545453 4 11 PAPOLB poly(A) polymerase beta (testis specific) 975 125 C20140704_OR005_04 C20140704_OR005_04 TB412533.[MT7]-EVMEAVR.2b3_1.heavy 489.264 / 504.261 2925.0 24.533300399780273 46 18 10 10 8 6.3494090276764235 15.749497246768989 0.0 4 0.9892137577048623 11.872334999139012 2925.0 15.995354704437922 2.0 - - - - - - - 283.0 6 8 PSG6 pregnancy specific beta-1-glycoprotein 6 977 125 C20140704_OR005_04 C20140704_OR005_04 TB412533.[MT7]-EVMEAVR.2y5_1.heavy 489.264 / 605.308 5756.0 24.533300399780273 46 18 10 10 8 6.3494090276764235 15.749497246768989 0.0 4 0.9892137577048623 11.872334999139012 5756.0 20.066816072206983 1.0 - - - - - - - 235.75 11 4 PSG6 pregnancy specific beta-1-glycoprotein 6 979 125 C20140704_OR005_04 C20140704_OR005_04 TB412533.[MT7]-EVMEAVR.2b4_1.heavy 489.264 / 633.303 5473.0 24.533300399780273 46 18 10 10 8 6.3494090276764235 15.749497246768989 0.0 4 0.9892137577048623 11.872334999139012 5473.0 19.415485154949028 2.0 - - - - - - - 188.66666666666666 11 6 PSG6 pregnancy specific beta-1-glycoprotein 6 981 125 C20140704_OR005_04 C20140704_OR005_04 TB412533.[MT7]-EVMEAVR.2y3_1.heavy 489.264 / 345.224 8115.0 24.533300399780273 46 18 10 10 8 6.3494090276764235 15.749497246768989 0.0 4 0.9892137577048623 11.872334999139012 8115.0 34.418428269567954 0.0 - - - - - - - 266.0 16 11 PSG6 pregnancy specific beta-1-glycoprotein 6 983 126 C20140704_OR005_04 C20140704_OR005_04 TB427639.[MT7]-GADIDALC[CAM]VAPSHVDRSDFFTSFYAK[MT7].4b7_1.heavy 795.144 / 800.427 2424.0 40.87247371673584 36 20 0 6 10 18.217680247221885 5.4891730803788565 0.039501190185546875 3 0.9930855972240783 14.833187079615328 2424.0 20.630377165539233 0.0 - - - - - - - 278.8 4 10 PAPOLB poly(A) polymerase beta (testis specific) 985 126 C20140704_OR005_04 C20140704_OR005_04 TB427639.[MT7]-GADIDALC[CAM]VAPSHVDRSDFFTSFYAK[MT7].4b4_1.heavy 795.144 / 501.279 1455.0 40.87247371673584 36 20 0 6 10 18.217680247221885 5.4891730803788565 0.039501190185546875 3 0.9930855972240783 14.833187079615328 1455.0 9.189056398147308 4.0 - - - - - - - 242.28571428571428 67 7 PAPOLB poly(A) polymerase beta (testis specific) 987 126 C20140704_OR005_04 C20140704_OR005_04 TB427639.[MT7]-GADIDALC[CAM]VAPSHVDRSDFFTSFYAK[MT7].4y3_1.heavy 795.144 / 525.315 2182.0 40.87247371673584 36 20 0 6 10 18.217680247221885 5.4891730803788565 0.039501190185546875 3 0.9930855972240783 14.833187079615328 2182.0 3.2398516552686196 0.0 - - - - - - - 252.5 4 12 PAPOLB poly(A) polymerase beta (testis specific) 989 126 C20140704_OR005_04 C20140704_OR005_04 TB427639.[MT7]-GADIDALC[CAM]VAPSHVDRSDFFTSFYAK[MT7].4b6_1.heavy 795.144 / 687.343 5697.0 40.87247371673584 36 20 0 6 10 18.217680247221885 5.4891730803788565 0.039501190185546875 3 0.9930855972240783 14.833187079615328 5697.0 26.594701742901563 0.0 - - - - - - - 286.3636363636364 11 11 PAPOLB poly(A) polymerase beta (testis specific) 991 127 C20140704_OR005_04 C20140704_OR005_04 TB450955.[MT7]-FQGGREASGILK[MT7].3b9_1.heavy 517.635 / 1034.51 293.0 26.772899627685547 36 13 10 5 8 1.69257805569424 45.95099333193764 0.04399871826171875 4 0.9177771667923128 4.274098295833878 293.0 4.489370225013082 0.0 - - - - - - - 0.0 0 0 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 993 127 C20140704_OR005_04 C20140704_OR005_04 TB450955.[MT7]-FQGGREASGILK[MT7].3y10_2.heavy 517.635 / 566.334 6541.0 26.772899627685547 36 13 10 5 8 1.69257805569424 45.95099333193764 0.04399871826171875 4 0.9177771667923128 4.274098295833878 6541.0 29.69671823420802 0.0 - - - - - - - 292.9 13 10 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 995 127 C20140704_OR005_04 C20140704_OR005_04 TB450955.[MT7]-FQGGREASGILK[MT7].3y5_1.heavy 517.635 / 661.437 4295.0 26.772899627685547 36 13 10 5 8 1.69257805569424 45.95099333193764 0.04399871826171875 4 0.9177771667923128 4.274098295833878 4295.0 34.65708640013382 1.0 - - - - - - - 205.1 20 10 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 997 127 C20140704_OR005_04 C20140704_OR005_04 TB450955.[MT7]-FQGGREASGILK[MT7].3y11_2.heavy 517.635 / 630.363 20891.0 26.772899627685547 36 13 10 5 8 1.69257805569424 45.95099333193764 0.04399871826171875 4 0.9177771667923128 4.274098295833878 20891.0 106.321606370876 0.0 - - - - - - - 206.22222222222223 41 9 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 999 128 C20140704_OR005_04 C20140704_OR005_04 TB412857.[MT7]-EPERVVHYEI.3b6_1.heavy 472.253 / 854.485 987.0 28.892550468444824 36 14 10 6 6 5.5707819112327 17.950801448242665 0.035800933837890625 5 0.9440478764042813 5.1928766839151725 987.0 3.6390485782453945 1.0 - - - - - - - 0.0 1 0 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1001 128 C20140704_OR005_04 C20140704_OR005_04 TB412857.[MT7]-EPERVVHYEI.3b4_1.heavy 472.253 / 656.348 1185.0 28.892550468444824 36 14 10 6 6 5.5707819112327 17.950801448242665 0.035800933837890625 5 0.9440478764042813 5.1928766839151725 1185.0 13.653542178542176 0.0 - - - - - - - 205.66666666666666 2 12 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1003 128 C20140704_OR005_04 C20140704_OR005_04 TB412857.[MT7]-EPERVVHYEI.3b5_1.heavy 472.253 / 755.417 1086.0 28.892550468444824 36 14 10 6 6 5.5707819112327 17.950801448242665 0.035800933837890625 5 0.9440478764042813 5.1928766839151725 1086.0 11.309646425281654 2.0 - - - - - - - 210.0 2 8 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1005 128 C20140704_OR005_04 C20140704_OR005_04 TB412857.[MT7]-EPERVVHYEI.3b7_2.heavy 472.253 / 496.276 14807.0 28.892550468444824 36 14 10 6 6 5.5707819112327 17.950801448242665 0.035800933837890625 5 0.9440478764042813 5.1928766839151725 14807.0 139.80213197969545 0.0 - - - - - - - 167.8 29 10 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1007 129 C20140704_OR005_04 C20140704_OR005_04 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 198982.0 26.605899810791016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 198982.0 230.4677350547887 0.0 - - - - - - - 1760.625 397 8 1009 129 C20140704_OR005_04 C20140704_OR005_04 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 248282.0 26.605899810791016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 248282.0 280.7500054623229 0.0 - - - - - - - 992.0 496 1 1011 129 C20140704_OR005_04 C20140704_OR005_04 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 370885.0 26.605899810791016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 370885.0 303.8489133910509 0.0 - - - - - - - 4322.142857142857 741 7 1013 130 C20140704_OR005_04 C20140704_OR005_04 TB427363.[MT7]-LSDEEMATILSFNR.2y9_1.heavy 885.447 / 1052.56 7283.0 44.129926681518555 38 12 10 6 10 1.0583534779560613 62.99092699673106 0.03730010986328125 3 0.8949429270110149 3.773741536739101 7283.0 33.66455230442693 0.0 - - - - - - - 226.41666666666666 14 12 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1015 130 C20140704_OR005_04 C20140704_OR005_04 TB427363.[MT7]-LSDEEMATILSFNR.2b4_1.heavy 885.447 / 589.295 5535.0 44.129926681518555 38 12 10 6 10 1.0583534779560613 62.99092699673106 0.03730010986328125 3 0.8949429270110149 3.773741536739101 5535.0 56.65695743573954 0.0 - - - - - - - 183.33333333333334 11 9 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1017 130 C20140704_OR005_04 C20140704_OR005_04 TB427363.[MT7]-LSDEEMATILSFNR.2b5_1.heavy 885.447 / 718.338 4273.0 44.129926681518555 38 12 10 6 10 1.0583534779560613 62.99092699673106 0.03730010986328125 3 0.8949429270110149 3.773741536739101 4273.0 32.0475 0.0 - - - - - - - 277.14285714285717 8 7 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1019 130 C20140704_OR005_04 C20140704_OR005_04 TB427363.[MT7]-LSDEEMATILSFNR.2y7_1.heavy 885.447 / 850.478 3690.0 44.129926681518555 38 12 10 6 10 1.0583534779560613 62.99092699673106 0.03730010986328125 3 0.8949429270110149 3.773741536739101 3690.0 14.724196482716799 0.0 - - - - - - - 247.0 7 11 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1021 131 C20140704_OR005_04 C20140704_OR005_04 TB450817.[MT7]-LLNK[MT7]PGLK[MT7].2y4_1.heavy 657.945 / 558.373 5637.0 26.694900512695312 37 16 10 1 10 3.563020876194272 28.06607187404746 0.09000015258789062 3 0.9661462342405893 6.688457820693903 5637.0 16.45484508001362 0.0 - - - - - - - 268.57142857142856 11 7 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1023 131 C20140704_OR005_04 C20140704_OR005_04 TB450817.[MT7]-LLNK[MT7]PGLK[MT7].2y5_1.heavy 657.945 / 830.57 890.0 26.694900512695312 37 16 10 1 10 3.563020876194272 28.06607187404746 0.09000015258789062 3 0.9661462342405893 6.688457820693903 890.0 7.491582491582491 1.0 - - - - - - - 0.0 1 0 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1025 131 C20140704_OR005_04 C20140704_OR005_04 TB450817.[MT7]-LLNK[MT7]PGLK[MT7].2b4_1.heavy 657.945 / 757.517 3659.0 26.694900512695312 37 16 10 1 10 3.563020876194272 28.06607187404746 0.09000015258789062 3 0.9661462342405893 6.688457820693903 3659.0 26.118114478114478 0.0 - - - - - - - 219.88888888888889 7 9 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1027 131 C20140704_OR005_04 C20140704_OR005_04 TB450817.[MT7]-LLNK[MT7]PGLK[MT7].2y7_1.heavy 657.945 / 1057.7 989.0 26.694900512695312 37 16 10 1 10 3.563020876194272 28.06607187404746 0.09000015258789062 3 0.9661462342405893 6.688457820693903 989.0 7.192727272727272 1.0 - - - - - - - 0.0 1 0 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1029 132 C20140704_OR005_04 C20140704_OR005_04 TB427364.[MT7]-LSDEEMATILSFNR.3b4_1.heavy 590.634 / 589.295 11229.0 44.120601654052734 43 13 10 10 10 1.2387744433669405 54.28542230912141 0.0 3 0.9051710084269247 3.9755621991279706 11229.0 130.8551141688677 0.0 - - - - - - - 268.77777777777777 22 9 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1031 132 C20140704_OR005_04 C20140704_OR005_04 TB427364.[MT7]-LSDEEMATILSFNR.3b5_1.heavy 590.634 / 718.338 21103.0 44.120601654052734 43 13 10 10 10 1.2387744433669405 54.28542230912141 0.0 3 0.9051710084269247 3.9755621991279706 21103.0 266.3869274795592 0.0 - - - - - - - 225.88888888888889 42 9 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1033 132 C20140704_OR005_04 C20140704_OR005_04 TB427364.[MT7]-LSDEEMATILSFNR.3y4_1.heavy 590.634 / 523.262 30880.0 44.120601654052734 43 13 10 10 10 1.2387744433669405 54.28542230912141 0.0 3 0.9051710084269247 3.9755621991279706 30880.0 205.9552495697074 0.0 - - - - - - - 185.0 61 11 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1035 132 C20140704_OR005_04 C20140704_OR005_04 TB427364.[MT7]-LSDEEMATILSFNR.3y5_1.heavy 590.634 / 636.346 36592.0 44.120601654052734 43 13 10 10 10 1.2387744433669405 54.28542230912141 0.0 3 0.9051710084269247 3.9755621991279706 36592.0 157.52851109329058 0.0 - - - - - - - 274.25 73 12 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1037 133 C20140704_OR005_04 C20140704_OR005_04 TB427589.[MT7]-EGK[MT7]PFFC[CAM]EDPETDNLMVK[MT7].3b9_2.heavy 863.429 / 699.834 4455.0 36.01629829406738 38 13 10 5 10 4.151853165175568 24.085630204547787 0.040599822998046875 3 0.911954375110686 4.128281295525284 4455.0 23.415768194070083 0.0 - - - - - - - 247.33333333333334 8 9 PKNOX1 PBX/knotted 1 homeobox 1 1039 133 C20140704_OR005_04 C20140704_OR005_04 TB427589.[MT7]-EGK[MT7]PFFC[CAM]EDPETDNLMVK[MT7].3y3_1.heavy 863.429 / 521.324 1732.0 36.01629829406738 38 13 10 5 10 4.151853165175568 24.085630204547787 0.040599822998046875 3 0.911954375110686 4.128281295525284 1732.0 12.587932610683033 2.0 - - - - - - - 282.7142857142857 3 7 PKNOX1 PBX/knotted 1 homeobox 1 1041 133 C20140704_OR005_04 C20140704_OR005_04 TB427589.[MT7]-EGK[MT7]PFFC[CAM]EDPETDNLMVK[MT7].3b3_1.heavy 863.429 / 603.37 990.0 36.01629829406738 38 13 10 5 10 4.151853165175568 24.085630204547787 0.040599822998046875 3 0.911954375110686 4.128281295525284 990.0 2.783360258481421 1.0 - - - - - - - 0.0 1 0 PKNOX1 PBX/knotted 1 homeobox 1 1043 133 C20140704_OR005_04 C20140704_OR005_04 TB427589.[MT7]-EGK[MT7]PFFC[CAM]EDPETDNLMVK[MT7].3y9_1.heavy 863.429 / 1190.62 1856.0 36.01629829406738 38 13 10 5 10 4.151853165175568 24.085630204547787 0.040599822998046875 3 0.911954375110686 4.128281295525284 1856.0 21.805939663053415 0.0 - - - - - - - 216.33333333333334 3 12 PKNOX1 PBX/knotted 1 homeobox 1 1045 134 C20140704_OR005_04 C20140704_OR005_04 TB412951.[MT7]-LFTLITENFK[MT7].3y3_1.heavy 505.3 / 552.326 3452.0 48.039673805236816 34 8 10 6 10 2.119963444315428 36.99198539409753 0.032497406005859375 3 0.7858920601260572 2.6180243570222603 3452.0 61.86084057971014 0.0 - - - - - - - 165.6 6 5 MSH4 mutS homolog 4 (E. coli) 1047 134 C20140704_OR005_04 C20140704_OR005_04 TB412951.[MT7]-LFTLITENFK[MT7].3b4_1.heavy 505.3 / 619.394 621.0 48.039673805236816 34 8 10 6 10 2.119963444315428 36.99198539409753 0.032497406005859375 3 0.7858920601260572 2.6180243570222603 621.0 9.27 0.0 - - - - - - - 0.0 1 0 MSH4 mutS homolog 4 (E. coli) 1049 134 C20140704_OR005_04 C20140704_OR005_04 TB412951.[MT7]-LFTLITENFK[MT7].3y4_1.heavy 505.3 / 681.369 2278.0 48.039673805236816 34 8 10 6 10 2.119963444315428 36.99198539409753 0.032497406005859375 3 0.7858920601260572 2.6180243570222603 2278.0 41.268115942028984 0.0 - - - - - - - 151.8 4 10 MSH4 mutS homolog 4 (E. coli) 1051 134 C20140704_OR005_04 C20140704_OR005_04 TB412951.[MT7]-LFTLITENFK[MT7].3y5_1.heavy 505.3 / 782.417 1174.0 48.039673805236816 34 8 10 6 10 2.119963444315428 36.99198539409753 0.032497406005859375 3 0.7858920601260572 2.6180243570222603 1174.0 21.83526570048309 0.0 - - - - - - - 224.25 2 4 MSH4 mutS homolog 4 (E. coli) 1053 135 C20140704_OR005_04 C20140704_OR005_04 TB413290.[MT7]-GGEALPQGSPAPVQDPHLIK[MT7].4y5_1.heavy 575.572 / 751.495 18816.0 30.021499633789062 41 11 10 10 10 0.7509981559015643 86.12685103888853 0.0 3 0.8737395983496465 3.435972317766149 18816.0 134.33072164948453 0.0 - - - - - - - 194.0 37 11 UBQLN3 ubiquilin 3 1055 135 C20140704_OR005_04 C20140704_OR005_04 TB413290.[MT7]-GGEALPQGSPAPVQDPHLIK[MT7].4y9_2.heavy 575.572 / 595.854 35401.0 30.021499633789062 41 11 10 10 10 0.7509981559015643 86.12685103888853 0.0 3 0.8737395983496465 3.435972317766149 35401.0 137.43304270986744 0.0 - - - - - - - 339.5 70 8 UBQLN3 ubiquilin 3 1057 135 C20140704_OR005_04 C20140704_OR005_04 TB413290.[MT7]-GGEALPQGSPAPVQDPHLIK[MT7].4b5_1.heavy 575.572 / 572.316 71092.0 30.021499633789062 41 11 10 10 10 0.7509981559015643 86.12685103888853 0.0 3 0.8737395983496465 3.435972317766149 71092.0 190.8699793814433 0.0 - - - - - - - 339.5 142 12 UBQLN3 ubiquilin 3 1059 135 C20140704_OR005_04 C20140704_OR005_04 TB413290.[MT7]-GGEALPQGSPAPVQDPHLIK[MT7].4y3_1.heavy 575.572 / 517.383 15033.0 30.021499633789062 41 11 10 10 10 0.7509981559015643 86.12685103888853 0.0 3 0.8737395983496465 3.435972317766149 15033.0 60.57110824742267 0.0 - - - - - - - 310.4 30 10 UBQLN3 ubiquilin 3 1061 136 C20140704_OR005_04 C20140704_OR005_04 TB412853.[MT7]-TMWVIGLGLK[MT7].2b3_1.heavy 703.428 / 563.277 3170.0 45.47782516479492 44 18 10 6 10 9.64870182874242 10.364088534906427 0.0384979248046875 3 0.9854522250275332 10.219653495612373 3170.0 43.94772727272727 0.0 - - - - - - - 140.8 6 10 PAPOLB poly(A) polymerase beta (testis specific) 1063 136 C20140704_OR005_04 C20140704_OR005_04 TB412853.[MT7]-TMWVIGLGLK[MT7].2y5_1.heavy 703.428 / 631.426 4226.0 45.47782516479492 44 18 10 6 10 9.64870182874242 10.364088534906427 0.0384979248046875 3 0.9854522250275332 10.219653495612373 4226.0 34.25621212121212 0.0 - - - - - - - 224.0 8 11 PAPOLB poly(A) polymerase beta (testis specific) 1065 136 C20140704_OR005_04 C20140704_OR005_04 TB412853.[MT7]-TMWVIGLGLK[MT7].2b4_1.heavy 703.428 / 662.345 2289.0 45.47782516479492 44 18 10 6 10 9.64870182874242 10.364088534906427 0.0384979248046875 3 0.9854522250275332 10.219653495612373 2289.0 12.74556818181818 0.0 - - - - - - - 238.85714285714286 4 7 PAPOLB poly(A) polymerase beta (testis specific) 1067 136 C20140704_OR005_04 C20140704_OR005_04 TB412853.[MT7]-TMWVIGLGLK[MT7].2y6_1.heavy 703.428 / 744.51 4138.0 45.47782516479492 44 18 10 6 10 9.64870182874242 10.364088534906427 0.0384979248046875 3 0.9854522250275332 10.219653495612373 4138.0 33.22939393939394 0.0 - - - - - - - 190.66666666666666 8 6 PAPOLB poly(A) polymerase beta (testis specific) 1069 137 C20140704_OR005_04 C20140704_OR005_04 TB413293.[MT7]-LRTEVIQLEDTLAQVRK[MT7].4y9_2.heavy 575.844 / 602.344 18723.0 41.44064903259277 33 7 10 6 10 0.5761839454054434 100.06166410459775 0.039699554443359375 3 0.7463392722519938 2.3966022849498705 18723.0 42.80758636363636 0.0 - - - - - - - 660.0 37 8 RNF20;RNF40 ring finger protein 20;ring finger protein 40 1071 137 C20140704_OR005_04 C20140704_OR005_04 TB413293.[MT7]-LRTEVIQLEDTLAQVRK[MT7].4b4_1.heavy 575.844 / 644.385 4681.0 41.44064903259277 33 7 10 6 10 0.5761839454054434 100.06166410459775 0.039699554443359375 3 0.7463392722519938 2.3966022849498705 4681.0 18.77269694307038 1.0 - - - - - - - 253.33333333333334 9 9 RNF20;RNF40 ring finger protein 20;ring finger protein 40 1073 137 C20140704_OR005_04 C20140704_OR005_04 TB413293.[MT7]-LRTEVIQLEDTLAQVRK[MT7].4b5_1.heavy 575.844 / 743.453 8041.0 41.44064903259277 33 7 10 6 10 0.5761839454054434 100.06166410459775 0.039699554443359375 3 0.7463392722519938 2.3966022849498705 8041.0 30.37341944406502 1.0 - - - - - - - 300.0 16 4 RNF20;RNF40 ring finger protein 20;ring finger protein 40 1075 137 C20140704_OR005_04 C20140704_OR005_04 TB413293.[MT7]-LRTEVIQLEDTLAQVRK[MT7].4b6_1.heavy 575.844 / 856.537 3601.0 41.44064903259277 33 7 10 6 10 0.5761839454054434 100.06166410459775 0.039699554443359375 3 0.7463392722519938 2.3966022849498705 3601.0 17.50486111111111 0.0 - - - - - - - 186.66666666666666 7 9 RNF20;RNF40 ring finger protein 20;ring finger protein 40 1077 138 C20140704_OR005_04 C20140704_OR005_04 TB427068.[MT7]-QEEEVGWK[MT7].3y3_1.heavy 431.562 / 534.316 17258.0 26.36935043334961 39 14 10 5 10 1.864464145979529 42.77165361753701 0.0420989990234375 3 0.9311892651096942 4.677479601181451 17258.0 44.48539817690253 0.0 - - - - - - - 149.875 34 8 PLAGL2 pleiomorphic adenoma gene-like 2 1079 138 C20140704_OR005_04 C20140704_OR005_04 TB427068.[MT7]-QEEEVGWK[MT7].3b4_1.heavy 431.562 / 660.296 8180.0 26.36935043334961 39 14 10 5 10 1.864464145979529 42.77165361753701 0.0420989990234375 3 0.9311892651096942 4.677479601181451 8180.0 49.03082164328657 0.0 - - - - - - - 199.75 16 8 PLAGL2 pleiomorphic adenoma gene-like 2 1081 138 C20140704_OR005_04 C20140704_OR005_04 TB427068.[MT7]-QEEEVGWK[MT7].3y4_1.heavy 431.562 / 633.384 2494.0 26.36935043334961 39 14 10 5 10 1.864464145979529 42.77165361753701 0.0420989990234375 3 0.9311892651096942 4.677479601181451 2494.0 9.18691789594226 0.0 - - - - - - - 269.4 4 10 PLAGL2 pleiomorphic adenoma gene-like 2 1083 138 C20140704_OR005_04 C20140704_OR005_04 TB427068.[MT7]-QEEEVGWK[MT7].3b3_1.heavy 431.562 / 531.253 7482.0 26.36935043334961 39 14 10 5 10 1.864464145979529 42.77165361753701 0.0420989990234375 3 0.9311892651096942 4.677479601181451 7482.0 15.98974898043165 0.0 - - - - - - - 262.125 14 8 PLAGL2 pleiomorphic adenoma gene-like 2 1085 139 C20140704_OR005_04 C20140704_OR005_04 TB427595.[MT7]-LIETLRPFGVFEEEEELQRR.4b9_2.heavy 659.356 / 586.351 2604.0 43.14207458496094 42 17 10 5 10 5.887401167076601 16.98542313698918 0.0438995361328125 3 0.9774281286847379 8.198950831662671 2604.0 1.4140083015990068 1.0 - - - - - - - 260.2 9 5 PAPOLB poly(A) polymerase beta (testis specific) 1087 139 C20140704_OR005_04 C20140704_OR005_04 TB427595.[MT7]-LIETLRPFGVFEEEEELQRR.4b10_2.heavy 659.356 / 635.886 8028.0 43.14207458496094 42 17 10 5 10 5.887401167076601 16.98542313698918 0.0438995361328125 3 0.9774281286847379 8.198950831662671 8028.0 58.61208365827721 0.0 - - - - - - - 257.375 16 8 PAPOLB poly(A) polymerase beta (testis specific) 1089 139 C20140704_OR005_04 C20140704_OR005_04 TB427595.[MT7]-LIETLRPFGVFEEEEELQRR.4b3_1.heavy 659.356 / 500.32 8895.0 43.14207458496094 42 17 10 5 10 5.887401167076601 16.98542313698918 0.0438995361328125 3 0.9774281286847379 8.198950831662671 8895.0 51.85334101382488 0.0 - - - - - - - 203.125 17 8 PAPOLB poly(A) polymerase beta (testis specific) 1091 139 C20140704_OR005_04 C20140704_OR005_04 TB427595.[MT7]-LIETLRPFGVFEEEEELQRR.4y14_2.heavy 659.356 / 882.931 18659.0 43.14207458496094 42 17 10 5 10 5.887401167076601 16.98542313698918 0.0438995361328125 3 0.9774281286847379 8.198950831662671 18659.0 182.5115300546448 0.0 - - - - - - - 243.75 37 4 PAPOLB poly(A) polymerase beta (testis specific) 1093 140 C20140704_OR005_04 C20140704_OR005_04 TB451221.[MT7]-GFDPLLNLVLDGTIEYMRDPDDQYK[MT7].4b7_1.heavy 804.66 / 901.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1095 140 C20140704_OR005_04 C20140704_OR005_04 TB451221.[MT7]-GFDPLLNLVLDGTIEYMRDPDDQYK[MT7].4b4_1.heavy 804.66 / 561.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1097 140 C20140704_OR005_04 C20140704_OR005_04 TB451221.[MT7]-GFDPLLNLVLDGTIEYMRDPDDQYK[MT7].4b5_1.heavy 804.66 / 674.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1099 140 C20140704_OR005_04 C20140704_OR005_04 TB451221.[MT7]-GFDPLLNLVLDGTIEYMRDPDDQYK[MT7].4b6_1.heavy 804.66 / 787.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1101 141 C20140704_OR005_04 C20140704_OR005_04 TB427273.[MT7]-TSVQPVGRPSFK[MT7].3b4_1.heavy 530.978 / 560.316 2360.0 24.887524604797363 37 12 10 5 10 1.253510039720983 55.95524942875176 0.041500091552734375 3 0.8889050050284736 3.6678365018879084 2360.0 5.559481743227327 0.0 - - - - - - - 243.91666666666666 4 12 SLCO1C1 solute carrier organic anion transporter family, member 1C1 1103 141 C20140704_OR005_04 C20140704_OR005_04 TB427273.[MT7]-TSVQPVGRPSFK[MT7].3y4_1.heavy 530.978 / 622.368 2077.0 24.887524604797363 37 12 10 5 10 1.253510039720983 55.95524942875176 0.041500091552734375 3 0.8889050050284736 3.6678365018879084 2077.0 10.007776396957539 0.0 - - - - - - - 251.77777777777777 4 9 SLCO1C1 solute carrier organic anion transporter family, member 1C1 1105 141 C20140704_OR005_04 C20140704_OR005_04 TB427273.[MT7]-TSVQPVGRPSFK[MT7].3y8_1.heavy 530.978 / 1031.61 2265.0 24.887524604797363 37 12 10 5 10 1.253510039720983 55.95524942875176 0.041500091552734375 3 0.8889050050284736 3.6678365018879084 2265.0 35.36082404593043 0.0 - - - - - - - 188.75 4 4 SLCO1C1 solute carrier organic anion transporter family, member 1C1 1107 141 C20140704_OR005_04 C20140704_OR005_04 TB427273.[MT7]-TSVQPVGRPSFK[MT7].3y8_2.heavy 530.978 / 516.31 3304.0 24.887524604797363 37 12 10 5 10 1.253510039720983 55.95524942875176 0.041500091552734375 3 0.8889050050284736 3.6678365018879084 3304.0 19.564 1.0 - - - - - - - 228.08333333333334 6 12 SLCO1C1 solute carrier organic anion transporter family, member 1C1 1109 142 C20140704_OR005_04 C20140704_OR005_04 TB427454.[MT7]-NVVEELLSGNPHIEK[MT7].4y5_1.heavy 492.277 / 767.453 2784.0 41.76865005493164 37 12 10 5 10 0.7512028047659062 68.57855191964558 0.04129791259765625 3 0.8829326728526916 3.5711963378234883 2784.0 9.36 0.0 - - - - - - - 319.0 5 4 TESC tescalcin 1111 142 C20140704_OR005_04 C20140704_OR005_04 TB427454.[MT7]-NVVEELLSGNPHIEK[MT7].4b4_1.heavy 492.277 / 586.332 12063.0 41.76865005493164 37 12 10 5 10 0.7512028047659062 68.57855191964558 0.04129791259765625 3 0.8829326728526916 3.5711963378234883 12063.0 151.82741379310343 0.0 - - - - - - - 270.6666666666667 24 9 TESC tescalcin 1113 142 C20140704_OR005_04 C20140704_OR005_04 TB427454.[MT7]-NVVEELLSGNPHIEK[MT7].4b5_1.heavy 492.277 / 715.374 13687.0 41.76865005493164 37 12 10 5 10 0.7512028047659062 68.57855191964558 0.04129791259765625 3 0.8829326728526916 3.5711963378234883 13687.0 88.49353448275862 0.0 - - - - - - - 174.0 27 2 TESC tescalcin 1115 142 C20140704_OR005_04 C20140704_OR005_04 TB427454.[MT7]-NVVEELLSGNPHIEK[MT7].4y3_1.heavy 492.277 / 533.341 4408.0 41.76865005493164 37 12 10 5 10 0.7512028047659062 68.57855191964558 0.04129791259765625 3 0.8829326728526916 3.5711963378234883 4408.0 10.26 0.0 - - - - - - - 154.66666666666666 8 3 TESC tescalcin 1117 143 C20140704_OR005_04 C20140704_OR005_04 TB427591.[MT7]-LPLEHLVEEQVAAVTFVPVSK[MT7].4y4_1.heavy 649.127 / 574.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 1119 143 C20140704_OR005_04 C20140704_OR005_04 TB427591.[MT7]-LPLEHLVEEQVAAVTFVPVSK[MT7].4b5_1.heavy 649.127 / 734.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 1121 143 C20140704_OR005_04 C20140704_OR005_04 TB427591.[MT7]-LPLEHLVEEQVAAVTFVPVSK[MT7].4b9_2.heavy 649.127 / 602.838 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 1123 143 C20140704_OR005_04 C20140704_OR005_04 TB427591.[MT7]-LPLEHLVEEQVAAVTFVPVSK[MT7].4b10_2.heavy 649.127 / 666.868 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 1125 144 C20140704_OR005_04 C20140704_OR005_04 TB427378.[MT7]-LLFEVFDENRLTR.3y11_2.heavy 599.332 / 713.36 6348.0 45.15599822998047 44 14 10 10 10 1.387456434857379 43.38522254258625 0.0 3 0.9425137831411715 5.122450012879133 6348.0 79.2450063644221 0.0 - - - - - - - 198.66666666666666 12 9 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 1127 144 C20140704_OR005_04 C20140704_OR005_04 TB427378.[MT7]-LLFEVFDENRLTR.3b4_1.heavy 599.332 / 647.388 5990.0 45.15599822998047 44 14 10 10 10 1.387456434857379 43.38522254258625 0.0 3 0.9425137831411715 5.122450012879133 5990.0 18.621919903587653 0.0 - - - - - - - 664.1428571428571 11 7 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 1129 144 C20140704_OR005_04 C20140704_OR005_04 TB427378.[MT7]-LLFEVFDENRLTR.3b3_1.heavy 599.332 / 518.346 5364.0 45.15599822998047 44 14 10 10 10 1.387456434857379 43.38522254258625 0.0 3 0.9425137831411715 5.122450012879133 5364.0 25.619104477611938 0.0 - - - - - - - 226.84615384615384 10 13 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 1131 144 C20140704_OR005_04 C20140704_OR005_04 TB427378.[MT7]-LLFEVFDENRLTR.3y12_2.heavy 599.332 / 769.902 13232.0 45.15599822998047 44 14 10 10 10 1.387456434857379 43.38522254258625 0.0 3 0.9425137831411715 5.122450012879133 13232.0 167.88206017645726 0.0 - - - - - - - 226.84615384615384 26 13 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 1133 145 C20140704_OR005_04 C20140704_OR005_04 TB427180.[MT7]-ASAPESGLLSK[MT7]V.3b5_1.heavy 482.952 / 600.311 1094.0 35.02870178222656 45 18 9 10 8 4.604228601657113 21.719164848593508 0.0 4 0.9885068993724354 11.500770491011611 1094.0 1.1989041095890407 0.0 - - - - - - - 260.7142857142857 2 7 ISOC1 isochorismatase domain containing 1 1135 145 C20140704_OR005_04 C20140704_OR005_04 TB427180.[MT7]-ASAPESGLLSK[MT7]V.3y4_1.heavy 482.952 / 590.399 1580.0 35.02870178222656 45 18 9 10 8 4.604228601657113 21.719164848593508 0.0 4 0.9885068993724354 11.500770491011611 1580.0 6.154043319430004 2.0 - - - - - - - 267.6 4 5 ISOC1 isochorismatase domain containing 1 1137 145 C20140704_OR005_04 C20140704_OR005_04 TB427180.[MT7]-ASAPESGLLSK[MT7]V.3b8_1.heavy 482.952 / 857.448 486.0 35.02870178222656 45 18 9 10 8 4.604228601657113 21.719164848593508 0.0 4 0.9885068993724354 11.500770491011611 486.0 3.3315068493150686 3.0 - - - - - - - 0.0 0 0 ISOC1 isochorismatase domain containing 1 1139 145 C20140704_OR005_04 C20140704_OR005_04 TB427180.[MT7]-ASAPESGLLSK[MT7]V.3b7_1.heavy 482.952 / 744.364 1458.0 35.02870178222656 45 18 9 10 8 4.604228601657113 21.719164848593508 0.0 4 0.9885068993724354 11.500770491011611 1458.0 12.491065573770491 0.0 - - - - - - - 273.5 2 4 ISOC1 isochorismatase domain containing 1 1141 146 C20140704_OR005_04 C20140704_OR005_04 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 182835.0 37.66559982299805 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 182835.0 159.72827616720042 0.0 - - - - - - - 183.44444444444446 365 9 1143 146 C20140704_OR005_04 C20140704_OR005_04 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 441798.0 37.66559982299805 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 441798.0 296.6682493709314 0.0 - - - - - - - 199.57142857142858 883 7 1145 146 C20140704_OR005_04 C20140704_OR005_04 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 355138.0 37.66559982299805 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 355138.0 132.98769244502824 1.0 - - - - - - - 688.7142857142857 751 7 1147 147 C20140704_OR005_04 C20140704_OR005_04 TB412967.[MT7]-GGEALPQGSPAPVQDPHLIK[MT7].3y3_1.heavy 767.093 / 517.383 4263.0 30.031149864196777 44 18 10 6 10 5.234290740882895 19.10478514671359 0.038600921630859375 3 0.9825857902889459 9.33852362008755 4263.0 22.85637068717883 0.0 - - - - - - - 238.0 8 11 UBQLN3 ubiquilin 3 1149 147 C20140704_OR005_04 C20140704_OR005_04 TB412967.[MT7]-GGEALPQGSPAPVQDPHLIK[MT7].3b5_1.heavy 767.093 / 572.316 17827.0 30.031149864196777 44 18 10 6 10 5.234290740882895 19.10478514671359 0.038600921630859375 3 0.9825857902889459 9.33852362008755 17827.0 207.4476644466746 0.0 - - - - - - - 213.2 35 5 UBQLN3 ubiquilin 3 1151 147 C20140704_OR005_04 C20140704_OR005_04 TB412967.[MT7]-GGEALPQGSPAPVQDPHLIK[MT7].3y5_1.heavy 767.093 / 751.495 8332.0 30.031149864196777 44 18 10 6 10 5.234290740882895 19.10478514671359 0.038600921630859375 3 0.9825857902889459 9.33852362008755 8332.0 117.24927835051545 0.0 - - - - - - - 193.875 16 8 UBQLN3 ubiquilin 3 1153 147 C20140704_OR005_04 C20140704_OR005_04 TB412967.[MT7]-GGEALPQGSPAPVQDPHLIK[MT7].3y9_1.heavy 767.093 / 1190.7 2422.0 30.031149864196777 44 18 10 6 10 5.234290740882895 19.10478514671359 0.038600921630859375 3 0.9825857902889459 9.33852362008755 2422.0 11.950344056638928 0.0 - - - - - - - 271.4 4 5 UBQLN3 ubiquilin 3 1155 148 C20140704_OR005_04 C20140704_OR005_04 TB412964.[MT7]-NEFITLAHVNPQSFPAPK[MT7].3b4_1.heavy 766.754 / 648.347 1018.0 38.3843994140625 43 13 10 10 10 1.1017054053010045 54.34431336085947 0.0 3 0.909027053428928 4.0602940517845845 1018.0 6.812598425196851 0.0 - - - - - - - 159.0 2 4 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1157 148 C20140704_OR005_04 C20140704_OR005_04 TB412964.[MT7]-NEFITLAHVNPQSFPAPK[MT7].3y4_1.heavy 766.754 / 556.357 3182.0 38.3843994140625 43 13 10 10 10 1.1017054053010045 54.34431336085947 0.0 3 0.909027053428928 4.0602940517845845 3182.0 12.27843137254902 1.0 - - - - - - - 254.8 6 5 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1159 148 C20140704_OR005_04 C20140704_OR005_04 TB412964.[MT7]-NEFITLAHVNPQSFPAPK[MT7].3b3_1.heavy 766.754 / 535.263 1527.0 38.3843994140625 43 13 10 10 10 1.1017054053010045 54.34431336085947 0.0 3 0.909027053428928 4.0602940517845845 1527.0 20.680629921259843 3.0 - - - - - - - 145.28571428571428 3 7 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1161 148 C20140704_OR005_04 C20140704_OR005_04 TB412964.[MT7]-NEFITLAHVNPQSFPAPK[MT7].3b7_1.heavy 766.754 / 933.516 2291.0 38.3843994140625 43 13 10 10 10 1.1017054053010045 54.34431336085947 0.0 3 0.909027053428928 4.0602940517845845 2291.0 8.61253858849937 1.0 - - - - - - - 169.66666666666666 4 3 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1163 149 C20140704_OR005_04 C20140704_OR005_04 TB427278.[MT7]-SLPQSVIENVGGK[MT7].2y4_1.heavy 808.466 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLB poly(A) polymerase beta (testis specific) 1165 149 C20140704_OR005_04 C20140704_OR005_04 TB427278.[MT7]-SLPQSVIENVGGK[MT7].2y5_1.heavy 808.466 / 618.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLB poly(A) polymerase beta (testis specific) 1167 149 C20140704_OR005_04 C20140704_OR005_04 TB427278.[MT7]-SLPQSVIENVGGK[MT7].2y6_1.heavy 808.466 / 747.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLB poly(A) polymerase beta (testis specific) 1169 149 C20140704_OR005_04 C20140704_OR005_04 TB427278.[MT7]-SLPQSVIENVGGK[MT7].2y7_1.heavy 808.466 / 860.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLB poly(A) polymerase beta (testis specific) 1171 150 C20140704_OR005_04 C20140704_OR005_04 TB451122.[MT7]-VTDEILHLVPNIDNFR.3y7_1.heavy 680.373 / 875.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1173 150 C20140704_OR005_04 C20140704_OR005_04 TB451122.[MT7]-VTDEILHLVPNIDNFR.3b6_1.heavy 680.373 / 815.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1175 150 C20140704_OR005_04 C20140704_OR005_04 TB451122.[MT7]-VTDEILHLVPNIDNFR.3b4_1.heavy 680.373 / 589.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1177 150 C20140704_OR005_04 C20140704_OR005_04 TB451122.[MT7]-VTDEILHLVPNIDNFR.3b5_1.heavy 680.373 / 702.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1179 151 C20140704_OR005_04 C20140704_OR005_04 TB427371.[MT7]-NETGPYQC[CAM]EIRDR.3y10_2.heavy 594.617 / 647.304 1642.0 22.559249877929688 37 15 10 2 10 3.448099359955694 29.001484458755545 0.08519935607910156 3 0.9569456277102677 5.926292759372399 1642.0 17.01760355153495 0.0 - - - - - - - 133.22222222222223 3 9 PSG1;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1181 151 C20140704_OR005_04 C20140704_OR005_04 TB427371.[MT7]-NETGPYQC[CAM]EIRDR.3y12_2.heavy 594.617 / 762.349 948.0 22.559249877929688 37 15 10 2 10 3.448099359955694 29.001484458755545 0.08519935607910156 3 0.9569456277102677 5.926292759372399 948.0 12.60960993289554 1.0 - - - - - - - 126.16666666666667 2 6 PSG1;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1183 151 C20140704_OR005_04 C20140704_OR005_04 TB427371.[MT7]-NETGPYQC[CAM]EIRDR.3b4_1.heavy 594.617 / 546.264 3095.0 22.559249877929688 37 15 10 2 10 3.448099359955694 29.001484458755545 0.08519935607910156 3 0.9569456277102677 5.926292759372399 3095.0 7.197461876358935 3.0 - - - - - - - 215.83333333333334 6 12 PSG1;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1185 151 C20140704_OR005_04 C20140704_OR005_04 TB427371.[MT7]-NETGPYQC[CAM]EIRDR.3y11_2.heavy 594.617 / 697.828 1895.0 22.559249877929688 37 15 10 2 10 3.448099359955694 29.001484458755545 0.08519935607910156 3 0.9569456277102677 5.926292759372399 1895.0 26.462226240707253 0.0 - - - - - - - 195.8 3 10 PSG1;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1187 152 C20140704_OR005_04 C20140704_OR005_04 TB427370.[MT7]-YK[MT7]PVTNQVEC[CAM]HPYLTQEK[MT7].3y7_1.heavy 889.471 / 1022.56 4984.0 26.783899307250977 47 17 10 10 10 7.672169798025308 13.034122371188705 0.0 3 0.9797537880211821 8.658746200140289 4984.0 99.63016 0.0 - - - - - - - 224.25 9 4 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1189 152 C20140704_OR005_04 C20140704_OR005_04 TB427370.[MT7]-YK[MT7]PVTNQVEC[CAM]HPYLTQEK[MT7].3y6_1.heavy 889.471 / 925.511 498.0 26.783899307250977 47 17 10 10 10 7.672169798025308 13.034122371188705 0.0 3 0.9797537880211821 8.658746200140289 498.0 2.30251256281407 2.0 - - - - - - - 0.0 0 0 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1191 152 C20140704_OR005_04 C20140704_OR005_04 TB427370.[MT7]-YK[MT7]PVTNQVEC[CAM]HPYLTQEK[MT7].3y4_1.heavy 889.471 / 649.364 2093.0 26.783899307250977 47 17 10 10 10 7.672169798025308 13.034122371188705 0.0 3 0.9797537880211821 8.658746200140289 2093.0 30.3169472361809 0.0 - - - - - - - 179.4 4 5 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1193 152 C20140704_OR005_04 C20140704_OR005_04 TB427370.[MT7]-YK[MT7]PVTNQVEC[CAM]HPYLTQEK[MT7].3b7_2.heavy 889.471 / 560.324 3389.0 26.783899307250977 47 17 10 10 10 7.672169798025308 13.034122371188705 0.0 3 0.9797537880211821 8.658746200140289 3389.0 7.655660030334639 0.0 - - - - - - - 274.25 6 4 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1195 153 C20140704_OR005_04 C20140704_OR005_04 TB451228.[MT7]-GLLLTASLLNFWNLPTTAQVIIEAK[MT7]PPK[MT7].3y3_1.heavy 1161.02 / 485.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG6 pregnancy specific beta-1-glycoprotein 6 1197 153 C20140704_OR005_04 C20140704_OR005_04 TB451228.[MT7]-GLLLTASLLNFWNLPTTAQVIIEAK[MT7]PPK[MT7].3b4_1.heavy 1161.02 / 541.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG6 pregnancy specific beta-1-glycoprotein 6 1199 153 C20140704_OR005_04 C20140704_OR005_04 TB451228.[MT7]-GLLLTASLLNFWNLPTTAQVIIEAK[MT7]PPK[MT7].3b5_1.heavy 1161.02 / 642.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG6 pregnancy specific beta-1-glycoprotein 6 1201 153 C20140704_OR005_04 C20140704_OR005_04 TB451228.[MT7]-GLLLTASLLNFWNLPTTAQVIIEAK[MT7]PPK[MT7].3b7_1.heavy 1161.02 / 800.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG6 pregnancy specific beta-1-glycoprotein 6 1203 154 C20140704_OR005_04 C20140704_OR005_04 TB412863.[MT7]-LQGHVVLAQC[CAM]R.3y6_1.heavy 475.602 / 746.398 7032.0 25.375200271606445 46 16 10 10 10 6.609199770165003 15.130424783256844 0.0 3 0.9647586083803955 6.554689067715588 7032.0 84.6681212121212 0.0 - - - - - - - 220.0 14 9 SCLY selenocysteine lyase 1205 154 C20140704_OR005_04 C20140704_OR005_04 TB412863.[MT7]-LQGHVVLAQC[CAM]R.3b4_1.heavy 475.602 / 580.332 11390.0 25.375200271606445 46 16 10 10 10 6.609199770165003 15.130424783256844 0.0 3 0.9647586083803955 6.554689067715588 11390.0 63.120890725436176 0.0 - - - - - - - 254.57142857142858 22 7 SCLY selenocysteine lyase 1207 154 C20140704_OR005_04 C20140704_OR005_04 TB412863.[MT7]-LQGHVVLAQC[CAM]R.3y4_1.heavy 475.602 / 534.245 10994.0 25.375200271606445 46 16 10 10 10 6.609199770165003 15.130424783256844 0.0 3 0.9647586083803955 6.554689067715588 10994.0 37.98847776382315 0.0 - - - - - - - 253.0 21 9 SCLY selenocysteine lyase 1209 154 C20140704_OR005_04 C20140704_OR005_04 TB412863.[MT7]-LQGHVVLAQC[CAM]R.3y5_1.heavy 475.602 / 647.329 16441.0 25.375200271606445 46 16 10 10 10 6.609199770165003 15.130424783256844 0.0 3 0.9647586083803955 6.554689067715588 16441.0 95.76744107744108 0.0 - - - - - - - 222.75 32 8 SCLY selenocysteine lyase 1211 155 C20140704_OR005_04 C20140704_OR005_04 TB413285.[MT7]-LSYLDVYLIHWPQGFK[MT7].4y5_1.heavy 567.567 / 720.416 24976.0 48.57849979400635 43 17 10 6 10 3.0730318790413347 32.54115282110125 0.030399322509765625 3 0.9754947017168445 7.86758575449445 24976.0 223.0 0.0 - - - - - - - 187.4 49 15 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1213 155 C20140704_OR005_04 C20140704_OR005_04 TB413285.[MT7]-LSYLDVYLIHWPQGFK[MT7].4b5_1.heavy 567.567 / 736.4 20072.0 48.57849979400635 43 17 10 6 10 3.0730318790413347 32.54115282110125 0.030399322509765625 3 0.9754947017168445 7.86758575449445 20072.0 389.62367346938777 0.0 - - - - - - - 185.25 40 12 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1215 155 C20140704_OR005_04 C20140704_OR005_04 TB413285.[MT7]-LSYLDVYLIHWPQGFK[MT7].4y6_1.heavy 567.567 / 906.495 8303.0 48.57849979400635 43 17 10 6 10 3.0730318790413347 32.54115282110125 0.030399322509765625 3 0.9754947017168445 7.86758575449445 8303.0 81.75913265306123 0.0 - - - - - - - 163.5 16 14 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1217 155 C20140704_OR005_04 C20140704_OR005_04 TB413285.[MT7]-LSYLDVYLIHWPQGFK[MT7].4b3_1.heavy 567.567 / 508.289 16149.0 48.57849979400635 43 17 10 6 10 3.0730318790413347 32.54115282110125 0.030399322509765625 3 0.9754947017168445 7.86758575449445 16149.0 257.6381864980144 0.0 - - - - - - - 216.3846153846154 32 13 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1219 156 C20140704_OR005_04 C20140704_OR005_04 TB427657.[MT7]-GLLLTASLLNFWNLPTTAQVIIEAK[MT7]PPK[MT7].4y8_1.heavy 871.019 / 1183.77 1094.0 54.72610092163086 47 17 10 10 10 4.161688098658002 24.028710857079002 0.0 3 0.9767030675030868 8.069864275920084 1094.0 8.570743823845328 0.0 - - - - - - - 97.23809523809524 2 21 PSG6 pregnancy specific beta-1-glycoprotein 6 1221 156 C20140704_OR005_04 C20140704_OR005_04 TB427657.[MT7]-GLLLTASLLNFWNLPTTAQVIIEAK[MT7]PPK[MT7].4b7_1.heavy 871.019 / 800.5 1848.0 54.72610092163086 47 17 10 10 10 4.161688098658002 24.028710857079002 0.0 3 0.9767030675030868 8.069864275920084 1848.0 74.93608247422681 0.0 - - - - - - - 72.93333333333334 3 15 PSG6 pregnancy specific beta-1-glycoprotein 6 1223 156 C20140704_OR005_04 C20140704_OR005_04 TB427657.[MT7]-GLLLTASLLNFWNLPTTAQVIIEAK[MT7]PPK[MT7].4b10_1.heavy 871.019 / 1140.71 924.0 54.72610092163086 47 17 10 10 10 4.161688098658002 24.028710857079002 0.0 3 0.9767030675030868 8.069864275920084 924.0 -0.24900067370312096 0.0 - - - - - - - 0.0 1 0 PSG6 pregnancy specific beta-1-glycoprotein 6 1225 156 C20140704_OR005_04 C20140704_OR005_04 TB427657.[MT7]-GLLLTASLLNFWNLPTTAQVIIEAK[MT7]PPK[MT7].4b4_1.heavy 871.019 / 541.383 3113.0 54.72610092163086 47 17 10 10 10 4.161688098658002 24.028710857079002 0.0 3 0.9767030675030868 8.069864275920084 3113.0 19.132044795250625 0.0 - - - - - - - 116.30434782608695 6 23 PSG6 pregnancy specific beta-1-glycoprotein 6 1227 157 C20140704_OR005_04 C20140704_OR005_04 TB413282.[MT7]-QTLEFLRNPAMMQEMIR.3y7_1.heavy 751.387 / 938.426 2474.0 42.36840057373047 45 17 10 10 8 3.9151179023336935 19.95434819816267 0.0 4 0.9758212099578298 7.920746664722418 2474.0 19.132266666666666 1.0 - - - - - - - 208.71428571428572 7 7 UBQLN3 ubiquilin 3 1229 157 C20140704_OR005_04 C20140704_OR005_04 TB413282.[MT7]-QTLEFLRNPAMMQEMIR.3b4_1.heavy 751.387 / 616.342 2362.0 42.36840057373047 45 17 10 10 8 3.9151179023336935 19.95434819816267 0.0 4 0.9758212099578298 7.920746664722418 2362.0 8.989384470946652 1.0 - - - - - - - 312.22222222222223 4 9 UBQLN3 ubiquilin 3 1231 157 C20140704_OR005_04 C20140704_OR005_04 TB413282.[MT7]-QTLEFLRNPAMMQEMIR.3y10_1.heavy 751.387 / 1220.56 1237.0 42.36840057373047 45 17 10 10 8 3.9151179023336935 19.95434819816267 0.0 4 0.9758212099578298 7.920746664722418 1237.0 11.772212802034762 0.0 - - - - - - - 199.55555555555554 2 9 UBQLN3 ubiquilin 3 1233 157 C20140704_OR005_04 C20140704_OR005_04 TB413282.[MT7]-QTLEFLRNPAMMQEMIR.3y9_1.heavy 751.387 / 1106.52 5624.0 42.36840057373047 45 17 10 10 8 3.9151179023336935 19.95434819816267 0.0 4 0.9758212099578298 7.920746664722418 5624.0 12.497777777777776 0.0 - - - - - - - 224.55555555555554 11 9 UBQLN3 ubiquilin 3 1235 158 C20140704_OR005_04 C20140704_OR005_04 TB427389.[MT7]-TGFSSDQIEQLHRR.4y8_2.heavy 455.24 / 540.307 4933.0 25.966450691223145 28 5 10 5 8 1.6678505121697476 53.94112038766404 0.043399810791015625 4 0.6503331165861583 2.0229287706880204 4933.0 36.68136230964467 0.0 - - - - - - - 197.16666666666666 9 6 TESC tescalcin 1237 158 C20140704_OR005_04 C20140704_OR005_04 TB427389.[MT7]-TGFSSDQIEQLHRR.4b5_1.heavy 455.24 / 624.311 197.0 25.966450691223145 28 5 10 5 8 1.6678505121697476 53.94112038766404 0.043399810791015625 4 0.6503331165861583 2.0229287706880204 197.0 2.2042164892164893 14.0 - - - - - - - 0.0 0 0 TESC tescalcin 1239 158 C20140704_OR005_04 C20140704_OR005_04 TB427389.[MT7]-TGFSSDQIEQLHRR.4y7_2.heavy 455.24 / 476.278 3749.0 25.966450691223145 28 5 10 5 8 1.6678505121697476 53.94112038766404 0.043399810791015625 4 0.6503331165861583 2.0229287706880204 3749.0 30.314123513617186 1.0 - - - - - - - 252.33333333333334 7 9 TESC tescalcin 1241 158 C20140704_OR005_04 C20140704_OR005_04 TB427389.[MT7]-TGFSSDQIEQLHRR.4b6_1.heavy 455.24 / 739.338 1283.0 25.966450691223145 28 5 10 5 8 1.6678505121697476 53.94112038766404 0.043399810791015625 4 0.6503331165861583 2.0229287706880204 1283.0 15.162727272727274 0.0 - - - - - - - 99.0 2 4 TESC tescalcin 1243 159 C20140704_OR005_04 C20140704_OR005_04 TB450830.[MT7]-LIQYC[CAM]HSK[MT7].3y3_1.heavy 446.248 / 515.306 6982.0 23.636699676513672 32 14 0 10 8 2.2098773810742403 38.35215995976916 0.0 4 0.9495731431045943 5.472544487583879 6982.0 26.05753669813258 0.0 - - - - - - - 218.33333333333334 13 9 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1245 159 C20140704_OR005_04 C20140704_OR005_04 TB450830.[MT7]-LIQYC[CAM]HSK[MT7].3b4_1.heavy 446.248 / 662.399 3525.0 23.636699676513672 32 14 0 10 8 2.2098773810742403 38.35215995976916 0.0 4 0.9495731431045943 5.472544487583879 3525.0 22.57375175521667 1.0 - - - - - - - 234.36363636363637 52 11 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1247 159 C20140704_OR005_04 C20140704_OR005_04 TB450830.[MT7]-LIQYC[CAM]HSK[MT7].3y4_1.heavy 446.248 / 675.336 3186.0 23.636699676513672 32 14 0 10 8 2.2098773810742403 38.35215995976916 0.0 4 0.9495731431045943 5.472544487583879 3186.0 34.71439874104623 0.0 - - - - - - - 237.5 6 4 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1249 159 C20140704_OR005_04 C20140704_OR005_04 TB450830.[MT7]-LIQYC[CAM]HSK[MT7].3b3_1.heavy 446.248 / 499.336 6168.0 23.636699676513672 32 14 0 10 8 2.2098773810742403 38.35215995976916 0.0 4 0.9495731431045943 5.472544487583879 6168.0 9.05259844839767 0.0 - - - - - - - 220.25 12 8 AKR1B15;AKR1B10 aldo-keto reductase family 1, member B15;aldo-keto reductase family 1, member B10 (aldose reductase) 1251 160 C20140704_OR005_04 C20140704_OR005_04 TB427560.[MT7]-TYTEIVDDIAGMISQLGEK[MT7].3y6_1.heavy 791.082 / 805.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1253 160 C20140704_OR005_04 C20140704_OR005_04 TB427560.[MT7]-TYTEIVDDIAGMISQLGEK[MT7].3b4_1.heavy 791.082 / 639.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1255 160 C20140704_OR005_04 C20140704_OR005_04 TB427560.[MT7]-TYTEIVDDIAGMISQLGEK[MT7].3b5_1.heavy 791.082 / 752.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1257 160 C20140704_OR005_04 C20140704_OR005_04 TB427560.[MT7]-TYTEIVDDIAGMISQLGEK[MT7].3b8_1.heavy 791.082 / 1081.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1259 161 C20140704_OR005_04 C20140704_OR005_04 TB426794.[MT7]-ALNQER.2y4_1.heavy 437.747 / 546.263 2458.0 16.194049835205078 41 15 10 6 10 2.617493484441246 33.70281853332321 0.0334014892578125 3 0.9599291651678561 6.144509070350717 2458.0 38.80478935698448 0.0 - - - - - - - 179.57142857142858 4 7 SCLY selenocysteine lyase 1261 161 C20140704_OR005_04 C20140704_OR005_04 TB426794.[MT7]-ALNQER.2b3_1.heavy 437.747 / 443.273 1857.0 16.194049835205078 41 15 10 6 10 2.617493484441246 33.70281853332321 0.0334014892578125 3 0.9599291651678561 6.144509070350717 1857.0 11.358329435349148 0.0 - - - - - - - 159.5 3 12 SCLY selenocysteine lyase 1263 161 C20140704_OR005_04 C20140704_OR005_04 TB426794.[MT7]-ALNQER.2y5_1.heavy 437.747 / 659.347 3715.0 16.194049835205078 41 15 10 6 10 2.617493484441246 33.70281853332321 0.0334014892578125 3 0.9599291651678561 6.144509070350717 3715.0 96.8750542118432 0.0 - - - - - - - 97.33333333333333 7 9 SCLY selenocysteine lyase 1265 161 C20140704_OR005_04 C20140704_OR005_04 TB426794.[MT7]-ALNQER.2b4_1.heavy 437.747 / 571.332 2568.0 16.194049835205078 41 15 10 6 10 2.617493484441246 33.70281853332321 0.0334014892578125 3 0.9599291651678561 6.144509070350717 2568.0 36.23730140971134 0.0 - - - - - - - 145.66666666666666 5 3 SCLY selenocysteine lyase 1267 162 C20140704_OR005_04 C20140704_OR005_04 TB427240.[MT7]-EELSPVLC[CAM]MASR.2b3_1.heavy 768.388 / 516.279 5266.0 36.426998138427734 46 16 10 10 10 1.3538039550299814 47.93172829713097 0.0 3 0.9610516111896631 6.233010485726991 5266.0 26.189946808510637 0.0 - - - - - - - 292.3333333333333 10 6 PLAGL2 pleiomorphic adenoma gene-like 2 1269 162 C20140704_OR005_04 C20140704_OR005_04 TB427240.[MT7]-EELSPVLC[CAM]MASR.2y8_1.heavy 768.388 / 933.464 9152.0 36.426998138427734 46 16 10 10 10 1.3538039550299814 47.93172829713097 0.0 3 0.9610516111896631 6.233010485726991 9152.0 92.6883404255319 0.0 - - - - - - - 292.3333333333333 18 3 PLAGL2 pleiomorphic adenoma gene-like 2 1271 162 C20140704_OR005_04 C20140704_OR005_04 TB427240.[MT7]-EELSPVLC[CAM]MASR.2y9_1.heavy 768.388 / 1020.5 4137.0 36.426998138427734 46 16 10 10 10 1.3538039550299814 47.93172829713097 0.0 3 0.9610516111896631 6.233010485726991 4137.0 30.32610434268833 1.0 - - - - - - - 234.875 13 8 PLAGL2 pleiomorphic adenoma gene-like 2 1273 162 C20140704_OR005_04 C20140704_OR005_04 TB427240.[MT7]-EELSPVLC[CAM]MASR.2y10_1.heavy 768.388 / 1133.58 2006.0 36.426998138427734 46 16 10 10 10 1.3538039550299814 47.93172829713097 0.0 3 0.9610516111896631 6.233010485726991 2006.0 2.202395209580838 1.0 - - - - - - - 214.71428571428572 4 7 PLAGL2 pleiomorphic adenoma gene-like 2 1275 163 C20140704_OR005_04 C20140704_OR005_04 TB427381.[MT7]-LPMPYITINNLNPR.3y7_1.heavy 600.67 / 840.469 4255.0 43.48030090332031 47 17 10 10 10 2.949399460847016 27.071672923613853 0.0 3 0.9793607564856236 8.575623001685573 4255.0 -0.2991176163566026 2.0 - - - - - - - 259.875 11 8 PSG6 pregnancy specific beta-1-glycoprotein 6 1277 163 C20140704_OR005_04 C20140704_OR005_04 TB427381.[MT7]-LPMPYITINNLNPR.3y6_1.heavy 600.67 / 727.385 18506.0 43.48030090332031 47 17 10 10 10 2.949399460847016 27.071672923613853 0.0 3 0.9793607564856236 8.575623001685573 18506.0 106.0464257964258 0.0 - - - - - - - 339.42857142857144 37 7 PSG6 pregnancy specific beta-1-glycoprotein 6 1279 163 C20140704_OR005_04 C20140704_OR005_04 TB427381.[MT7]-LPMPYITINNLNPR.3b5_1.heavy 600.67 / 746.403 14251.0 43.48030090332031 47 17 10 10 10 2.949399460847016 27.071672923613853 0.0 3 0.9793607564856236 8.575623001685573 14251.0 99.6130505050505 0.0 - - - - - - - 264.0 28 9 PSG6 pregnancy specific beta-1-glycoprotein 6 1281 163 C20140704_OR005_04 C20140704_OR005_04 TB427381.[MT7]-LPMPYITINNLNPR.3y8_1.heavy 600.67 / 941.516 12667.0 43.48030090332031 47 17 10 10 10 2.949399460847016 27.071672923613853 0.0 3 0.9793607564856236 8.575623001685573 12667.0 59.9839417989418 0.0 - - - - - - - 267.3 25 10 PSG6 pregnancy specific beta-1-glycoprotein 6 1283 164 C20140704_OR005_04 C20140704_OR005_04 TB427382.[MT7]-LPMPYITINNLNPR.2y8_1.heavy 900.502 / 941.516 5712.0 43.469825744628906 40 15 10 5 10 2.5198949203042322 39.68419444566633 0.041900634765625 3 0.9595584064077433 6.1160867257296365 5712.0 7.531979695431473 1.0 - - - - - - - 284.22222222222223 11 9 PSG6 pregnancy specific beta-1-glycoprotein 6 1285 164 C20140704_OR005_04 C20140704_OR005_04 TB427382.[MT7]-LPMPYITINNLNPR.2y9_1.heavy 900.502 / 1054.6 4137.0 43.469825744628906 40 15 10 5 10 2.5198949203042322 39.68419444566633 0.041900634765625 3 0.9595584064077433 6.1160867257296365 4137.0 13.3 0.0 - - - - - - - 196.66666666666666 8 12 PSG6 pregnancy specific beta-1-glycoprotein 6 1287 164 C20140704_OR005_04 C20140704_OR005_04 TB427382.[MT7]-LPMPYITINNLNPR.2y6_1.heavy 900.502 / 727.385 1576.0 43.469825744628906 40 15 10 5 10 2.5198949203042322 39.68419444566633 0.041900634765625 3 0.9595584064077433 6.1160867257296365 1576.0 1.8285714285714285 1.0 - - - - - - - 262.3333333333333 3 12 PSG6 pregnancy specific beta-1-glycoprotein 6 1289 164 C20140704_OR005_04 C20140704_OR005_04 TB427382.[MT7]-LPMPYITINNLNPR.2y7_1.heavy 900.502 / 840.469 1379.0 43.469825744628906 40 15 10 5 10 2.5198949203042322 39.68419444566633 0.041900634765625 3 0.9595584064077433 6.1160867257296365 1379.0 0.7466666666666666 1.0 - - - - - - - 258.125 2 8 PSG6 pregnancy specific beta-1-glycoprotein 6 1291 165 C20140704_OR005_04 C20140704_OR005_04 TB427463.[MT7]-ILQPMLDSSC[CAM]SETPK[MT7].3y6_1.heavy 665.344 / 865.421 2701.0 34.89889907836914 50 20 10 10 10 29.545824177016158 3.384573041553212 0.0 3 0.9991114613121618 41.399208319732054 2701.0 16.11780481181594 0.0 - - - - - - - 315.85714285714283 5 7 PKNOX1 PBX/knotted 1 homeobox 1 1293 165 C20140704_OR005_04 C20140704_OR005_04 TB427463.[MT7]-ILQPMLDSSC[CAM]SETPK[MT7].3b5_1.heavy 665.344 / 727.429 5525.0 34.89889907836914 50 20 10 10 10 29.545824177016158 3.384573041553212 0.0 3 0.9991114613121618 41.399208319732054 5525.0 11.19869706840391 0.0 - - - - - - - 322.375 11 8 PKNOX1 PBX/knotted 1 homeobox 1 1295 165 C20140704_OR005_04 C20140704_OR005_04 TB427463.[MT7]-ILQPMLDSSC[CAM]SETPK[MT7].3b3_1.heavy 665.344 / 499.336 27505.0 34.89889907836914 50 20 10 10 10 29.545824177016158 3.384573041553212 0.0 3 0.9991114613121618 41.399208319732054 27505.0 25.610383708139125 0.0 - - - - - - - 306.75 55 4 PKNOX1 PBX/knotted 1 homeobox 1 1297 165 C20140704_OR005_04 C20140704_OR005_04 TB427463.[MT7]-ILQPMLDSSC[CAM]SETPK[MT7].3y5_1.heavy 665.344 / 705.39 3438.0 34.89889907836914 50 20 10 10 10 29.545824177016158 3.384573041553212 0.0 3 0.9991114613121618 41.399208319732054 3438.0 3.0174774224297014 1.0 - - - - - - - 301.3636363636364 7 11 PKNOX1 PBX/knotted 1 homeobox 1 1299 166 C20140704_OR005_04 C20140704_OR005_04 TB426900.[MT7]-YAFELK[MT7].2y4_1.heavy 529.81 / 680.41 4864.0 34.03239822387695 48 18 10 10 10 4.168735024531332 23.98809216981654 0.0 3 0.9828283222029408 9.404432091080974 4864.0 5.35924308917905 1.0 - - - - - - - 202.75 12 8 DOCK10;C9 dedicator of cytokinesis 10;complement component 9 1301 166 C20140704_OR005_04 C20140704_OR005_04 TB426900.[MT7]-YAFELK[MT7].2y5_1.heavy 529.81 / 751.447 9843.0 34.03239822387695 48 18 10 10 10 4.168735024531332 23.98809216981654 0.0 3 0.9828283222029408 9.404432091080974 9843.0 69.09564940872502 0.0 - - - - - - - 270.3333333333333 19 3 DOCK10;C9 dedicator of cytokinesis 10;complement component 9 1303 166 C20140704_OR005_04 C20140704_OR005_04 TB426900.[MT7]-YAFELK[MT7].2b4_1.heavy 529.81 / 655.321 4864.0 34.03239822387695 48 18 10 10 10 4.168735024531332 23.98809216981654 0.0 3 0.9828283222029408 9.404432091080974 4864.0 28.27484247513549 0.0 - - - - - - - 185.6 9 5 DOCK10;C9 dedicator of cytokinesis 10;complement component 9 1305 166 C20140704_OR005_04 C20140704_OR005_04 TB426900.[MT7]-YAFELK[MT7].2y3_1.heavy 529.81 / 533.341 3821.0 34.03239822387695 48 18 10 10 10 4.168735024531332 23.98809216981654 0.0 3 0.9828283222029408 9.404432091080974 3821.0 6.416219685270445 1.0 - - - - - - - 270.1666666666667 7 6 DOCK10;C9 dedicator of cytokinesis 10;complement component 9 1307 167 C20140704_OR005_04 C20140704_OR005_04 TB450837.[MT7]-HFHANQTSK[MT7].3y3_1.heavy 453.245 / 479.295 8176.0 14.85830020904541 44 14 10 10 10 2.9662032838261188 28.366375707450814 0.0 3 0.9493033624803277 5.45783904790048 8176.0 46.589274939172746 0.0 - - - - - - - 199.54545454545453 16 11 SCLY selenocysteine lyase 1309 167 C20140704_OR005_04 C20140704_OR005_04 TB450837.[MT7]-HFHANQTSK[MT7].3y4_1.heavy 453.245 / 607.353 1396.0 14.85830020904541 44 14 10 10 10 2.9662032838261188 28.366375707450814 0.0 3 0.9493033624803277 5.45783904790048 1396.0 9.245869346733668 0.0 - - - - - - - 145.5 2 12 SCLY selenocysteine lyase 1311 167 C20140704_OR005_04 C20140704_OR005_04 TB450837.[MT7]-HFHANQTSK[MT7].3b3_1.heavy 453.245 / 566.296 1246.0 14.85830020904541 44 14 10 10 10 2.9662032838261188 28.366375707450814 0.0 3 0.9493033624803277 5.45783904790048 1246.0 32.396 0.0 - - - - - - - 124.83333333333333 2 6 SCLY selenocysteine lyase 1313 167 C20140704_OR005_04 C20140704_OR005_04 TB450837.[MT7]-HFHANQTSK[MT7].3y5_1.heavy 453.245 / 721.396 698.0 14.85830020904541 44 14 10 10 10 2.9662032838261188 28.366375707450814 0.0 3 0.9493033624803277 5.45783904790048 698.0 14.781475080213905 1.0 - - - - - - - 0.0 1 0 SCLY selenocysteine lyase 1315 168 C20140704_OR005_04 C20140704_OR005_04 TB450932.[MT7]-LFTLITENFK[MT7].2b3_1.heavy 757.447 / 506.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1317 168 C20140704_OR005_04 C20140704_OR005_04 TB450932.[MT7]-LFTLITENFK[MT7].2y5_1.heavy 757.447 / 782.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1319 168 C20140704_OR005_04 C20140704_OR005_04 TB450932.[MT7]-LFTLITENFK[MT7].2y3_1.heavy 757.447 / 552.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1321 168 C20140704_OR005_04 C20140704_OR005_04 TB450932.[MT7]-LFTLITENFK[MT7].2y6_1.heavy 757.447 / 895.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1323 169 C20140704_OR005_04 C20140704_OR005_04 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 94923.0 40.494598388671875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 94923.0 461.68258952088297 0.0 - - - - - - - 285.6 189 5 1325 169 C20140704_OR005_04 C20140704_OR005_04 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 156498.0 40.494598388671875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 156498.0 498.0406379831933 0.0 - - - - - - - 261.8 312 5 1327 169 C20140704_OR005_04 C20140704_OR005_04 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 200566.0 40.494598388671875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 200566.0 649.6454556236673 0.0 - - - - - - - 297.5 401 2 1329 170 C20140704_OR005_04 C20140704_OR005_04 TB427387.[MT7]-NNHTLFGVLNYTK[MT7].4b7_2.heavy 453.003 / 464.741 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1331 170 C20140704_OR005_04 C20140704_OR005_04 TB427387.[MT7]-NNHTLFGVLNYTK[MT7].4b4_2.heavy 453.003 / 306.155 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1333 170 C20140704_OR005_04 C20140704_OR005_04 TB427387.[MT7]-NNHTLFGVLNYTK[MT7].4b4_1.heavy 453.003 / 611.302 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1335 170 C20140704_OR005_04 C20140704_OR005_04 TB427387.[MT7]-NNHTLFGVLNYTK[MT7].4b3_1.heavy 453.003 / 510.254 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1337 171 C20140704_OR005_04 C20140704_OR005_04 TB426906.[MT7]-ITLEEYR.2y5_1.heavy 534.296 / 709.352 9549.0 31.019399642944336 47 17 10 10 10 1.8868401666386936 40.22904895270672 0.0 3 0.9755087965473476 7.869858677190816 9549.0 37.20026843327884 0.0 - - - - - - - 182.64285714285714 19 14 TESC tescalcin 1339 171 C20140704_OR005_04 C20140704_OR005_04 TB426906.[MT7]-ITLEEYR.2b4_1.heavy 534.296 / 601.368 9352.0 31.019399642944336 47 17 10 10 10 1.8868401666386936 40.22904895270672 0.0 3 0.9755087965473476 7.869858677190816 9352.0 119.50245036319612 0.0 - - - - - - - 209.125 18 8 TESC tescalcin 1341 171 C20140704_OR005_04 C20140704_OR005_04 TB426906.[MT7]-ITLEEYR.2y6_1.heavy 534.296 / 810.399 42722.0 31.019399642944336 47 17 10 10 10 1.8868401666386936 40.22904895270672 0.0 3 0.9755087965473476 7.869858677190816 42722.0 412.03959390862946 0.0 - - - - - - - 221.5 85 8 TESC tescalcin 1343 171 C20140704_OR005_04 C20140704_OR005_04 TB426906.[MT7]-ITLEEYR.2b5_1.heavy 534.296 / 730.41 19195.0 31.019399642944336 47 17 10 10 10 1.8868401666386936 40.22904895270672 0.0 3 0.9755087965473476 7.869858677190816 19195.0 94.97782279178725 0.0 - - - - - - - 196.7 38 10 TESC tescalcin 1345 172 C20140704_OR005_04 C20140704_OR005_04 TB427047.[MT7]-ITNLIYLK[MT7].2y4_1.heavy 633.407 / 680.446 4594.0 39.9828987121582 36 14 4 10 8 1.7037391220077642 52.454187050244144 0.0 4 0.9421436386633364 5.105877004918768 4594.0 25.551752066115704 0.0 - - - - - - - 287.375 9 8 MSH4 mutS homolog 4 (E. coli) 1347 172 C20140704_OR005_04 C20140704_OR005_04 TB427047.[MT7]-ITNLIYLK[MT7].2b4_1.heavy 633.407 / 586.368 8826.0 39.9828987121582 36 14 4 10 8 1.7037391220077642 52.454187050244144 0.0 4 0.9421436386633364 5.105877004918768 8826.0 31.37227515799708 0.0 - - - - - - - 278.3 17 10 MSH4 mutS homolog 4 (E. coli) 1349 172 C20140704_OR005_04 C20140704_OR005_04 TB427047.[MT7]-ITNLIYLK[MT7].2y3_1.heavy 633.407 / 567.362 8463.0 39.9828987121582 36 14 4 10 8 1.7037391220077642 52.454187050244144 0.0 4 0.9421436386633364 5.105877004918768 8463.0 36.230033057851244 0.0 - - - - - - - 242.0 16 8 MSH4 mutS homolog 4 (E. coli) 1351 172 C20140704_OR005_04 C20140704_OR005_04 TB427047.[MT7]-ITNLIYLK[MT7].2y7_1.heavy 633.407 / 1008.62 7375.0 39.9828987121582 36 14 4 10 8 1.7037391220077642 52.454187050244144 0.0 4 0.9421436386633364 5.105877004918768 7375.0 22.148468325256893 1.0 - - - - - - - 255.44444444444446 32 9 MSH4 mutS homolog 4 (E. coli) 1353 173 C20140704_OR005_04 C20140704_OR005_04 TB426903.[MT7]-TASHMTK[MT7].2y4_1.heavy 532.294 / 660.362 2070.0 15.069100379943848 47 17 10 10 10 3.7456944143028514 26.69731935903586 0.0 3 0.9709255275225255 7.2201887911128795 2070.0 5.693872679045092 0.0 - - - - - - - 146.91666666666666 4 12 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1355 173 C20140704_OR005_04 C20140704_OR005_04 TB426903.[MT7]-TASHMTK[MT7].2y5_1.heavy 532.294 / 747.394 1035.0 15.069100379943848 47 17 10 10 10 3.7456944143028514 26.69731935903586 0.0 3 0.9709255275225255 7.2201887911128795 1035.0 27.865384615384613 0.0 - - - - - - - 77.75 2 4 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1357 173 C20140704_OR005_04 C20140704_OR005_04 TB426903.[MT7]-TASHMTK[MT7].2y3_1.heavy 532.294 / 523.303 9108.0 15.069100379943848 47 17 10 10 10 3.7456944143028514 26.69731935903586 0.0 3 0.9709255275225255 7.2201887911128795 9108.0 13.357559359469906 2.0 - - - - - - - 661.3333333333334 18 9 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1359 173 C20140704_OR005_04 C20140704_OR005_04 TB426903.[MT7]-TASHMTK[MT7].2y6_1.heavy 532.294 / 818.431 1242.0 15.069100379943848 47 17 10 10 10 3.7456944143028514 26.69731935903586 0.0 3 0.9709255275225255 7.2201887911128795 1242.0 29.644615384615385 0.0 - - - - - - - 181.25 2 8 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1361 174 C20140704_OR005_04 C20140704_OR005_04 TB427044.[MT7]-RFGIILEK[MT7].3y3_1.heavy 421.939 / 533.341 13365.0 33.02994918823242 36 11 10 5 10 1.1719527931321176 56.40576458509831 0.041900634765625 3 0.879558265489396 3.519778720807255 13365.0 133.7032116788321 0.0 - - - - - - - 262.8 26 5 MSH4 mutS homolog 4 (E. coli) 1363 174 C20140704_OR005_04 C20140704_OR005_04 TB427044.[MT7]-RFGIILEK[MT7].3b4_1.heavy 421.939 / 618.384 4711.0 33.02994918823242 36 11 10 5 10 1.1719527931321176 56.40576458509831 0.041900634765625 3 0.879558265489396 3.519778720807255 4711.0 35.544181482560965 0.0 - - - - - - - 219.33333333333334 9 3 MSH4 mutS homolog 4 (E. coli) 1365 174 C20140704_OR005_04 C20140704_OR005_04 TB427044.[MT7]-RFGIILEK[MT7].3b5_1.heavy 421.939 / 731.469 1424.0 33.02994918823242 36 11 10 5 10 1.1719527931321176 56.40576458509831 0.041900634765625 3 0.879558265489396 3.519778720807255 1424.0 25.11418181818182 1.0 - - - - - - - 219.33333333333334 4 3 MSH4 mutS homolog 4 (E. coli) 1367 174 C20140704_OR005_04 C20140704_OR005_04 TB427044.[MT7]-RFGIILEK[MT7].3b3_1.heavy 421.939 / 505.3 4272.0 33.02994918823242 36 11 10 5 10 1.1719527931321176 56.40576458509831 0.041900634765625 3 0.879558265489396 3.519778720807255 4272.0 19.49709589041096 1.0 - - - - - - - 259.09090909090907 8 11 MSH4 mutS homolog 4 (E. coli) 1369 175 C20140704_OR005_04 C20140704_OR005_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 110486.0 35.52149963378906 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 110486.0 433.0897728109753 1.0 - - - - - - - 212.88888888888889 234 9 1371 175 C20140704_OR005_04 C20140704_OR005_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 31549.0 35.52149963378906 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 31549.0 475.4532890625 1.0 - - - - - - - 191.5 93 6 1373 175 C20140704_OR005_04 C20140704_OR005_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 29889.0 35.52149963378906 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 29889.0 124.36157603059611 0.0 - - - - - - - 273.42857142857144 59 7 1375 176 C20140704_OR005_04 C20140704_OR005_04 TB427040.[MT7]-THHILIDLR.2y8_1.heavy 631.378 / 1016.6 6040.0 28.340100288391113 31 5 10 6 10 0.5396522860027237 97.84897201568577 0.036800384521484375 3 0.6977763761667736 2.1857385295096945 6040.0 20.580740740740744 0.0 - - - - - - - 267.3 12 10 TACSTD2 tumor-associated calcium signal transducer 2 1377 176 C20140704_OR005_04 C20140704_OR005_04 TB427040.[MT7]-THHILIDLR.2y3_2.heavy 631.378 / 202.119 891.0 28.340100288391113 31 5 10 6 10 0.5396522860027237 97.84897201568577 0.036800384521484375 3 0.6977763761667736 2.1857385295096945 891.0 3.8324999999999996 6.0 - - - - - - - 206.25 3 12 TACSTD2 tumor-associated calcium signal transducer 2 1379 176 C20140704_OR005_04 C20140704_OR005_04 TB427040.[MT7]-THHILIDLR.2b7_1.heavy 631.378 / 974.554 18418.0 28.340100288391113 31 5 10 6 10 0.5396522860027237 97.84897201568577 0.036800384521484375 3 0.6977763761667736 2.1857385295096945 18418.0 256.7357575757576 0.0 - - - - - - - 198.0 36 8 TACSTD2 tumor-associated calcium signal transducer 2 1381 176 C20140704_OR005_04 C20140704_OR005_04 TB427040.[MT7]-THHILIDLR.2y7_1.heavy 631.378 / 879.541 9902.0 28.340100288391113 31 5 10 6 10 0.5396522860027237 97.84897201568577 0.036800384521484375 3 0.6977763761667736 2.1857385295096945 9902.0 77.6823569023569 0.0 - - - - - - - 231.0 19 9 TACSTD2 tumor-associated calcium signal transducer 2 1383 177 C20140704_OR005_04 C20140704_OR005_04 TB427664.[MT7]-VLMASVGAAC[CAM]HSDHGDQPSPVLLSYGVPFDVAR.4y8_1.heavy 899.949 / 860.463 4424.0 42.47964954376221 42 17 10 5 10 12.493032639137711 8.004461597796816 0.040599822998046875 3 0.9740504119748188 7.644577520288412 4424.0 24.54749604753857 0.0 - - - - - - - 262.625 8 8 SCLY selenocysteine lyase 1385 177 C20140704_OR005_04 C20140704_OR005_04 TB427664.[MT7]-VLMASVGAAC[CAM]HSDHGDQPSPVLLSYGVPFDVAR.4y9_1.heavy 899.949 / 1023.53 2102.0 42.47964954376221 42 17 10 5 10 12.493032639137711 8.004461597796816 0.040599822998046875 3 0.9740504119748188 7.644577520288412 2102.0 0.029442058139357047 3.0 - - - - - - - 276.5 6 10 SCLY selenocysteine lyase 1387 177 C20140704_OR005_04 C20140704_OR005_04 TB427664.[MT7]-VLMASVGAAC[CAM]HSDHGDQPSPVLLSYGVPFDVAR.4y10_1.heavy 899.949 / 1110.56 5088.0 42.47964954376221 42 17 10 5 10 12.493032639137711 8.004461597796816 0.040599822998046875 3 0.9740504119748188 7.644577520288412 5088.0 56.270087919244546 0.0 - - - - - - - 271.54545454545456 10 11 SCLY selenocysteine lyase 1389 177 C20140704_OR005_04 C20140704_OR005_04 TB427664.[MT7]-VLMASVGAAC[CAM]HSDHGDQPSPVLLSYGVPFDVAR.4y6_1.heavy 899.949 / 704.373 7411.0 42.47964954376221 42 17 10 5 10 12.493032639137711 8.004461597796816 0.040599822998046875 3 0.9740504119748188 7.644577520288412 7411.0 61.702443438914024 0.0 - - - - - - - 232.3 14 10 SCLY selenocysteine lyase 1391 178 C20140704_OR005_04 C20140704_OR005_04 TB427254.[MT7]-FQGGREASGILK[MT7].2y10_1.heavy 775.948 / 1131.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1393 178 C20140704_OR005_04 C20140704_OR005_04 TB427254.[MT7]-FQGGREASGILK[MT7].2b9_1.heavy 775.948 / 1034.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1395 178 C20140704_OR005_04 C20140704_OR005_04 TB427254.[MT7]-FQGGREASGILK[MT7].2b10_1.heavy 775.948 / 1147.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1397 178 C20140704_OR005_04 C20140704_OR005_04 TB427254.[MT7]-FQGGREASGILK[MT7].2y7_1.heavy 775.948 / 861.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1399 179 C20140704_OR005_04 C20140704_OR005_04 TB412849.[MT7]-GHTGGHHSPVK[MT7].3b6_1.heavy 467.924 / 691.339 782.0 13.063599586486816 47 17 10 10 10 7.320815883544002 13.659679684717062 0.0 3 0.9773726680970954 8.188858508944676 782.0 12.498632478632478 0.0 - - - - - - - 0.0 1 0 SCLY selenocysteine lyase 1401 179 C20140704_OR005_04 C20140704_OR005_04 TB412849.[MT7]-GHTGGHHSPVK[MT7].3y3_1.heavy 467.924 / 487.336 4339.0 13.063599586486816 47 17 10 10 10 7.320815883544002 13.659679684717062 0.0 3 0.9773726680970954 8.188858508944676 4339.0 92.06467948717949 0.0 - - - - - - - 72.42857142857143 8 7 SCLY selenocysteine lyase 1403 179 C20140704_OR005_04 C20140704_OR005_04 TB412849.[MT7]-GHTGGHHSPVK[MT7].3b5_1.heavy 467.924 / 554.28 1016.0 13.063599586486816 47 17 10 10 10 7.320815883544002 13.659679684717062 0.0 3 0.9773726680970954 8.188858508944676 1016.0 22.11102564102564 0.0 - - - - - - - 132.6 2 5 SCLY selenocysteine lyase 1405 179 C20140704_OR005_04 C20140704_OR005_04 TB412849.[MT7]-GHTGGHHSPVK[MT7].3y4_1.heavy 467.924 / 574.368 2072.0 13.063599586486816 47 17 10 10 10 7.320815883544002 13.659679684717062 0.0 3 0.9773726680970954 8.188858508944676 2072.0 43.07811965811966 0.0 - - - - - - - 100.28571428571429 4 7 SCLY selenocysteine lyase 1407 180 C20140704_OR005_04 C20140704_OR005_04 TB427573.[MT7]-DK[MT7]EDFSVTDTC[CAM]TIQQLK[MT7].4y4_1.heavy 615.822 / 660.416 21322.0 32.585201263427734 43 13 10 10 10 2.642599938557185 30.195980070822493 0.0 3 0.9187026354537882 4.298698879320149 21322.0 47.032956300993696 0.0 - - - - - - - 216.66666666666666 42 9 UBQLN3 ubiquilin 3 1409 180 C20140704_OR005_04 C20140704_OR005_04 TB427573.[MT7]-DK[MT7]EDFSVTDTC[CAM]TIQQLK[MT7].4b4_1.heavy 615.822 / 776.403 7483.0 32.585201263427734 43 13 10 10 10 2.642599938557185 30.195980070822493 0.0 3 0.9187026354537882 4.298698879320149 7483.0 37.415 0.0 - - - - - - - 236.1 14 10 UBQLN3 ubiquilin 3 1411 180 C20140704_OR005_04 C20140704_OR005_04 TB427573.[MT7]-DK[MT7]EDFSVTDTC[CAM]TIQQLK[MT7].4b9_2.heavy 615.822 / 663.327 25935.0 32.585201263427734 43 13 10 10 10 2.642599938557185 30.195980070822493 0.0 3 0.9187026354537882 4.298698879320149 25935.0 136.9289135254989 0.0 - - - - - - - 256.5 51 14 UBQLN3 ubiquilin 3 1413 180 C20140704_OR005_04 C20140704_OR005_04 TB427573.[MT7]-DK[MT7]EDFSVTDTC[CAM]TIQQLK[MT7].4b6_2.heavy 615.822 / 505.755 16402.0 32.585201263427734 43 13 10 10 10 2.642599938557185 30.195980070822493 0.0 3 0.9187026354537882 4.298698879320149 16402.0 80.35649393547024 0.0 - - - - - - - 205.22222222222223 32 9 UBQLN3 ubiquilin 3 1415 181 C20140704_OR005_04 C20140704_OR005_04 TB427571.[MT7]-QAIYRHPLFPLLALLFEK[MT7].4b8_2.heavy 615.121 / 562.328 1409.0 53.63247585296631 43 17 10 6 10 7.898301120922134 12.660950560001554 0.036899566650390625 3 0.9777811897651805 8.264080682122378 1409.0 1.8890953986838945 3.0 - - - - - - - 190.45454545454547 2 11 PKNOX1 PBX/knotted 1 homeobox 1 1417 181 C20140704_OR005_04 C20140704_OR005_04 TB427571.[MT7]-QAIYRHPLFPLLALLFEK[MT7].4b11_2.heavy 615.121 / 740.931 6280.0 53.63247585296631 43 17 10 6 10 7.898301120922134 12.660950560001554 0.036899566650390625 3 0.9777811897651805 8.264080682122378 6280.0 1.6209150326797386 0.0 - - - - - - - 221.25 12 4 PKNOX1 PBX/knotted 1 homeobox 1 1419 181 C20140704_OR005_04 C20140704_OR005_04 TB427571.[MT7]-QAIYRHPLFPLLALLFEK[MT7].4y3_1.heavy 615.121 / 567.326 8978.0 53.63247585296631 43 17 10 6 10 7.898301120922134 12.660950560001554 0.036899566650390625 3 0.9777811897651805 8.264080682122378 8978.0 2.082538752909882 0.0 - - - - - - - 224.42857142857142 17 7 PKNOX1 PBX/knotted 1 homeobox 1 1421 181 C20140704_OR005_04 C20140704_OR005_04 TB427571.[MT7]-QAIYRHPLFPLLALLFEK[MT7].4b9_2.heavy 615.121 / 635.862 7086.0 53.63247585296631 43 17 10 6 10 7.898301120922134 12.660950560001554 0.036899566650390625 3 0.9777811897651805 8.264080682122378 7086.0 -0.0874814814814755 0.0 - - - - - - - 156.0 14 8 PKNOX1 PBX/knotted 1 homeobox 1 1423 182 C20140704_OR005_04 C20140704_OR005_04 TB450941.[MT7]-QLSGDQPTIRK[MT7].3y10_2.heavy 510.966 / 629.865 14125.0 22.081899642944336 46 16 10 10 10 1.8797364547319297 37.88693226802377 0.0 3 0.9682785242374631 6.910841045008832 14125.0 69.52509918954027 0.0 - - - - - - - 192.8 28 10 TESC tescalcin 1425 182 C20140704_OR005_04 C20140704_OR005_04 TB450941.[MT7]-QLSGDQPTIRK[MT7].3b5_1.heavy 510.966 / 645.332 19797.0 22.081899642944336 46 16 10 10 10 1.8797364547319297 37.88693226802377 0.0 3 0.9682785242374631 6.910841045008832 19797.0 109.7124821427504 0.0 - - - - - - - 175.1818181818182 39 11 TESC tescalcin 1427 182 C20140704_OR005_04 C20140704_OR005_04 TB450941.[MT7]-QLSGDQPTIRK[MT7].3y5_1.heavy 510.966 / 758.5 13160.0 22.081899642944336 46 16 10 10 10 1.8797364547319297 37.88693226802377 0.0 3 0.9682785242374631 6.910841045008832 13160.0 70.16843084941367 0.0 - - - - - - - 205.15384615384616 26 13 TESC tescalcin 1429 182 C20140704_OR005_04 C20140704_OR005_04 TB450941.[MT7]-QLSGDQPTIRK[MT7].3y9_1.heavy 510.966 / 1145.64 N/A 22.081899642944336 46 16 10 10 10 1.8797364547319297 37.88693226802377 0.0 3 0.9682785242374631 6.910841045008832 0.0 0.0 6.0 - - - - - - - 0.0 0 0 TESC tescalcin 1431 183 C20140704_OR005_04 C20140704_OR005_04 TB427396.[MT7]-HPLFPLLALLFEK[MT7].3b6_1.heavy 609.378 / 849.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKNOX1 PBX/knotted 1 homeobox 1 1433 183 C20140704_OR005_04 C20140704_OR005_04 TB427396.[MT7]-HPLFPLLALLFEK[MT7].3y3_1.heavy 609.378 / 567.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKNOX1 PBX/knotted 1 homeobox 1 1435 183 C20140704_OR005_04 C20140704_OR005_04 TB427396.[MT7]-HPLFPLLALLFEK[MT7].3b4_1.heavy 609.378 / 639.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKNOX1 PBX/knotted 1 homeobox 1 1437 183 C20140704_OR005_04 C20140704_OR005_04 TB427396.[MT7]-HPLFPLLALLFEK[MT7].3y4_1.heavy 609.378 / 680.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKNOX1 PBX/knotted 1 homeobox 1 1439 184 C20140704_OR005_04 C20140704_OR005_04 TB412983.[MT7]-VSGPC[CAM]HGNQTESH.2b8_1.heavy 777.348 / 953.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG6 pregnancy specific beta-1-glycoprotein 6 1441 184 C20140704_OR005_04 C20140704_OR005_04 TB412983.[MT7]-VSGPC[CAM]HGNQTESH.2b6_1.heavy 777.348 / 782.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG6 pregnancy specific beta-1-glycoprotein 6 1443 184 C20140704_OR005_04 C20140704_OR005_04 TB412983.[MT7]-VSGPC[CAM]HGNQTESH.2b11_2.heavy 777.348 / 656.297 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG6 pregnancy specific beta-1-glycoprotein 6 1445 184 C20140704_OR005_04 C20140704_OR005_04 TB412983.[MT7]-VSGPC[CAM]HGNQTESH.2b5_1.heavy 777.348 / 645.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG6 pregnancy specific beta-1-glycoprotein 6 1447 185 C20140704_OR005_04 C20140704_OR005_04 TB450742.[MT7]-TAQNRPVQR.3b4_1.heavy 405.234 / 559.296 510.0 13.456299781799316 46 18 10 10 8 2.34599763359928 31.383603025640074 0.0 4 0.9891011541345528 11.81073380988778 510.0 8.438682920698756 0.0 - - - - - - - 0.0 1 0 PKNOX1 PBX/knotted 1 homeobox 1 1449 185 C20140704_OR005_04 C20140704_OR005_04 TB450742.[MT7]-TAQNRPVQR.3b3_1.heavy 405.234 / 445.253 1384.0 13.456299781799316 46 18 10 10 8 2.34599763359928 31.383603025640074 0.0 4 0.9891011541345528 11.81073380988778 1384.0 27.278210380796786 1.0 - - - - - - - 117.61538461538461 15 13 PKNOX1 PBX/knotted 1 homeobox 1 1451 185 C20140704_OR005_04 C20140704_OR005_04 TB450742.[MT7]-TAQNRPVQR.3y4_1.heavy 405.234 / 499.299 10127.0 13.456299781799316 46 18 10 10 8 2.34599763359928 31.383603025640074 0.0 4 0.9891011541345528 11.81073380988778 10127.0 559.51675 0.0 - - - - - - - 133.33333333333334 20 6 PKNOX1 PBX/knotted 1 homeobox 1 1453 185 C20140704_OR005_04 C20140704_OR005_04 TB450742.[MT7]-TAQNRPVQR.3y8_2.heavy 405.234 / 484.773 2732.0 13.456299781799316 46 18 10 10 8 2.34599763359928 31.383603025640074 0.0 4 0.9891011541345528 11.81073380988778 2732.0 18.975243409297512 0.0 - - - - - - - 230.66666666666666 5 6 PKNOX1 PBX/knotted 1 homeobox 1 1455 186 C20140704_OR005_04 C20140704_OR005_04 TB450645.[MT7]-YIAC[CAM]LK[MT7].2y4_1.heavy 528.312 / 635.367 11627.0 30.641850471496582 46 20 10 6 10 10.260432430119101 9.746177919992327 0.03750038146972656 3 0.9946348201113855 16.84130969469373 11627.0 68.19002123722319 0.0 - - - - - - - 217.22222222222223 23 9 PKNOX1 PBX/knotted 1 homeobox 1 1457 186 C20140704_OR005_04 C20140704_OR005_04 TB450645.[MT7]-YIAC[CAM]LK[MT7].2y5_1.heavy 528.312 / 748.451 9771.0 30.641850471496582 46 20 10 6 10 10.260432430119101 9.746177919992327 0.03750038146972656 3 0.9946348201113855 16.84130969469373 9771.0 53.35699658703072 0.0 - - - - - - - 251.14285714285714 19 14 PKNOX1 PBX/knotted 1 homeobox 1 1459 186 C20140704_OR005_04 C20140704_OR005_04 TB450645.[MT7]-YIAC[CAM]LK[MT7].2b4_1.heavy 528.312 / 652.325 2150.0 30.641850471496582 46 20 10 6 10 10.260432430119101 9.746177919992327 0.03750038146972656 3 0.9946348201113855 16.84130969469373 2150.0 9.91743720899731 2.0 - - - - - - - 187.92307692307693 8 13 PKNOX1 PBX/knotted 1 homeobox 1 1461 186 C20140704_OR005_04 C20140704_OR005_04 TB450645.[MT7]-YIAC[CAM]LK[MT7].2y3_1.heavy 528.312 / 564.33 8305.0 30.641850471496582 46 20 10 6 10 10.260432430119101 9.746177919992327 0.03750038146972656 3 0.9946348201113855 16.84130969469373 8305.0 17.54139722172325 0.0 - - - - - - - 206.33333333333334 16 9 PKNOX1 PBX/knotted 1 homeobox 1 1463 187 C20140704_OR005_04 C20140704_OR005_04 TB427051.[MT7]-LLSALNSHK[MT7].3y3_1.heavy 424.262 / 515.306 5367.0 30.49524974822998 41 15 10 6 10 1.7311139507311526 45.92516442593818 0.03650093078613281 3 0.953729024103341 5.715037021322732 5367.0 30.42585246188891 0.0 - - - - - - - 248.54545454545453 10 11 PHF1 PHD finger protein 1 1465 187 C20140704_OR005_04 C20140704_OR005_04 TB427051.[MT7]-LLSALNSHK[MT7].3b4_1.heavy 424.262 / 529.347 5757.0 30.49524974822998 41 15 10 6 10 1.7311139507311526 45.92516442593818 0.03650093078613281 3 0.953729024103341 5.715037021322732 5757.0 54.63275510204081 1.0 - - - - - - - 206.11111111111111 11 9 PHF1 PHD finger protein 1 1467 187 C20140704_OR005_04 C20140704_OR005_04 TB427051.[MT7]-LLSALNSHK[MT7].3b5_1.heavy 424.262 / 642.431 2049.0 30.49524974822998 41 15 10 6 10 1.7311139507311526 45.92516442593818 0.03650093078613281 3 0.953729024103341 5.715037021322732 2049.0 11.017000559503161 0.0 - - - - - - - 251.0 4 7 PHF1 PHD finger protein 1 1469 187 C20140704_OR005_04 C20140704_OR005_04 TB427051.[MT7]-LLSALNSHK[MT7].3b3_1.heavy 424.262 / 458.31 3513.0 30.49524974822998 41 15 10 6 10 1.7311139507311526 45.92516442593818 0.03650093078613281 3 0.953729024103341 5.715037021322732 3513.0 9.166612742987367 0.0 - - - - - - - 301.72727272727275 7 11 PHF1 PHD finger protein 1 1471 188 C20140704_OR005_04 C20140704_OR005_04 TB427546.[MT7]-NEFITLAHVNPQSFPAPK[MT7].4b7_1.heavy 575.318 / 933.516 3704.0 38.3843994140625 42 20 2 10 10 7.557740730916604 13.231467386930591 0.0 3 0.9943850001884064 16.46205595790372 3704.0 34.450735966057444 0.0 - - - - - - - 271.25 7 8 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1473 188 C20140704_OR005_04 C20140704_OR005_04 TB427546.[MT7]-NEFITLAHVNPQSFPAPK[MT7].4b4_1.heavy 575.318 / 648.347 3321.0 38.3843994140625 42 20 2 10 10 7.557740730916604 13.231467386930591 0.0 3 0.9943850001884064 16.46205595790372 3321.0 12.179775382463799 1.0 - - - - - - - 319.1666666666667 6 6 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1475 188 C20140704_OR005_04 C20140704_OR005_04 TB427546.[MT7]-NEFITLAHVNPQSFPAPK[MT7].4b5_1.heavy 575.318 / 749.395 2555.0 38.3843994140625 42 20 2 10 10 7.557740730916604 13.231467386930591 0.0 3 0.9943850001884064 16.46205595790372 2555.0 3.3637010676156582 2.0 - - - - - - - 255.33333333333334 32 9 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1477 188 C20140704_OR005_04 C20140704_OR005_04 TB427546.[MT7]-NEFITLAHVNPQSFPAPK[MT7].4b3_1.heavy 575.318 / 535.263 6770.0 38.3843994140625 42 20 2 10 10 7.557740730916604 13.231467386930591 0.0 3 0.9943850001884064 16.46205595790372 6770.0 37.54270365680519 1.0 - - - - - - - 255.28571428571428 13 7 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1479 189 C20140704_OR005_04 C20140704_OR005_04 TB413107.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].3y7_1.heavy 896.51 / 1074.57 10214.0 50.05299949645996 40 14 10 6 10 1.8251844615145485 54.788982762333745 0.03839874267578125 3 0.9312474482522699 4.679481663096497 10214.0 69.33291785436641 0.0 - - - - - - - 155.31578947368422 20 19 PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1481 189 C20140704_OR005_04 C20140704_OR005_04 TB413107.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].3y3_1.heavy 896.51 / 640.357 11463.0 50.05299949645996 40 14 10 6 10 1.8251844615145485 54.788982762333745 0.03839874267578125 3 0.9312474482522699 4.679481663096497 11463.0 73.8636971830986 0.0 - - - - - - - 198.55555555555554 22 18 PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1483 189 C20140704_OR005_04 C20140704_OR005_04 TB413107.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].3b4_1.heavy 896.51 / 585.373 15038.0 50.05299949645996 40 14 10 6 10 1.8251844615145485 54.788982762333745 0.03839874267578125 3 0.9312474482522699 4.679481663096497 15038.0 89.23128086164043 0.0 - - - - - - - 176.05263157894737 30 19 PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1485 189 C20140704_OR005_04 C20140704_OR005_04 TB413107.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].3b5_1.heavy 896.51 / 698.457 9249.0 50.05299949645996 40 14 10 6 10 1.8251844615145485 54.788982762333745 0.03839874267578125 3 0.9312474482522699 4.679481663096497 9249.0 37.79982378854625 1.0 - - - - - - - 159.5 18 16 PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1487 190 C20140704_OR005_04 C20140704_OR005_04 TB450858.[MT7]-MPIVGLGTWK[MT7].3b4_1.heavy 463.944 / 585.355 2113.0 41.58430099487305 46 16 10 10 10 2.1546942493165706 37.94478267277099 0.0 3 0.9648544571646547 6.563674056052243 2113.0 7.665398812817479 2.0 - - - - - - - 207.16666666666666 5 6 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1489 190 C20140704_OR005_04 C20140704_OR005_04 TB450858.[MT7]-MPIVGLGTWK[MT7].3b5_1.heavy 463.944 / 642.377 6090.0 41.58430099487305 46 16 10 10 10 2.1546942493165706 37.94478267277099 0.0 3 0.9648544571646547 6.563674056052243 6090.0 88.3541129032258 0.0 - - - - - - - 124.0 12 3 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1491 190 C20140704_OR005_04 C20140704_OR005_04 TB450858.[MT7]-MPIVGLGTWK[MT7].3y4_1.heavy 463.944 / 635.363 6339.0 41.58430099487305 46 16 10 10 10 2.1546942493165706 37.94478267277099 0.0 3 0.9648544571646547 6.563674056052243 6339.0 99.17467741935482 0.0 - - - - - - - 186.5 12 2 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1493 190 C20140704_OR005_04 C20140704_OR005_04 TB450858.[MT7]-MPIVGLGTWK[MT7].3b3_1.heavy 463.944 / 486.287 7209.0 41.58430099487305 46 16 10 10 10 2.1546942493165706 37.94478267277099 0.0 3 0.9648544571646547 6.563674056052243 7209.0 36.33490616621984 0.0 - - - - - - - 223.6 14 10 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1495 191 C20140704_OR005_04 C20140704_OR005_04 TB426822.[MT7]-DVMGTK[MT7].2b3_1.heavy 469.765 / 490.245 1984.0 19.965700149536133 41 16 10 7 8 2.2829201857109798 43.80354627634806 0.02700042724609375 4 0.9693149792438268 7.027200263604864 1984.0 18.755773242630383 2.0 - - - - - - - 173.14285714285714 4 14 PLAGL2 pleiomorphic adenoma gene-like 2 1497 191 C20140704_OR005_04 C20140704_OR005_04 TB426822.[MT7]-DVMGTK[MT7].2y4_1.heavy 469.765 / 580.325 5677.0 19.965700149536133 41 16 10 7 8 2.2829201857109798 43.80354627634806 0.02700042724609375 4 0.9693149792438268 7.027200263604864 5677.0 26.825487543309684 0.0 - - - - - - - 188.16666666666666 11 12 PLAGL2 pleiomorphic adenoma gene-like 2 1499 191 C20140704_OR005_04 C20140704_OR005_04 TB426822.[MT7]-DVMGTK[MT7].2y5_1.heavy 469.765 / 679.393 2260.0 19.965700149536133 41 16 10 7 8 2.2829201857109798 43.80354627634806 0.02700042724609375 4 0.9693149792438268 7.027200263604864 2260.0 37.82545454545455 1.0 - - - - - - - 125.85714285714286 4 7 PLAGL2 pleiomorphic adenoma gene-like 2 1501 191 C20140704_OR005_04 C20140704_OR005_04 TB426822.[MT7]-DVMGTK[MT7].2b4_1.heavy 469.765 / 547.267 1047.0 19.965700149536133 41 16 10 7 8 2.2829201857109798 43.80354627634806 0.02700042724609375 4 0.9693149792438268 7.027200263604864 1047.0 8.566363636363636 0.0 - - - - - - - 146.8 2 15 PLAGL2 pleiomorphic adenoma gene-like 2 1503 192 C20140704_OR005_04 C20140704_OR005_04 TB426823.[MT7]-AMLGMK[MT7].2y4_1.heavy 469.774 / 592.361 7420.0 27.74465036392212 43 17 10 6 10 2.7859175286265745 30.32253857244003 0.03780174255371094 3 0.9711407869240223 7.247197673753072 7420.0 48.21750841750841 0.0 - - - - - - - 231.0 14 9 PHF1 PHD finger protein 1 1505 192 C20140704_OR005_04 C20140704_OR005_04 TB426823.[MT7]-AMLGMK[MT7].2y5_1.heavy 469.774 / 723.401 5046.0 27.74465036392212 43 17 10 6 10 2.7859175286265745 30.32253857244003 0.03780174255371094 3 0.9711407869240223 7.247197673753072 5046.0 64.73151515151515 0.0 - - - - - - - 198.0 10 6 PHF1 PHD finger protein 1 1507 192 C20140704_OR005_04 C20140704_OR005_04 TB426823.[MT7]-AMLGMK[MT7].2b4_1.heavy 469.774 / 517.292 2968.0 27.74465036392212 43 17 10 6 10 2.7859175286265745 30.32253857244003 0.03780174255371094 3 0.9711407869240223 7.247197673753072 2968.0 34.326868686868686 0.0 - - - - - - - 247.5 5 8 PHF1 PHD finger protein 1 1509 192 C20140704_OR005_04 C20140704_OR005_04 TB426823.[MT7]-AMLGMK[MT7].2y3_1.heavy 469.774 / 479.277 7717.0 27.74465036392212 43 17 10 6 10 2.7859175286265745 30.32253857244003 0.03780174255371094 3 0.9711407869240223 7.247197673753072 7717.0 29.36097643097643 0.0 - - - - - - - 297.0 15 3 PHF1 PHD finger protein 1 1511 193 C20140704_OR005_04 C20140704_OR005_04 TB427407.[MT7]-ILGIPVIVTEQYPK[MT7].3y3_1.heavy 620.048 / 551.331 32958.0 43.96929931640625 50 20 10 10 10 3.5315698899843904 28.316018970374106 0.0 3 0.9916498802184442 13.496257397865906 32958.0 73.55091368572614 0.0 - - - - - - - 270.8333333333333 65 12 ISOC1 isochorismatase domain containing 1 1513 193 C20140704_OR005_04 C20140704_OR005_04 TB427407.[MT7]-ILGIPVIVTEQYPK[MT7].3b6_1.heavy 620.048 / 737.504 38436.0 43.96929931640625 50 20 10 10 10 3.5315698899843904 28.316018970374106 0.0 3 0.9916498802184442 13.496257397865906 38436.0 107.01992661766229 0.0 - - - - - - - 253.45454545454547 76 11 ISOC1 isochorismatase domain containing 1 1515 193 C20140704_OR005_04 C20140704_OR005_04 TB427407.[MT7]-ILGIPVIVTEQYPK[MT7].3b4_1.heavy 620.048 / 541.383 112708.0 43.96929931640625 50 20 10 10 10 3.5315698899843904 28.316018970374106 0.0 3 0.9916498802184442 13.496257397865906 112708.0 341.4233383463536 0.0 - - - - - - - 295.54545454545456 225 11 ISOC1 isochorismatase domain containing 1 1517 193 C20140704_OR005_04 C20140704_OR005_04 TB427407.[MT7]-ILGIPVIVTEQYPK[MT7].3b7_1.heavy 620.048 / 850.588 11791.0 43.96929931640625 50 20 10 10 10 3.5315698899843904 28.316018970374106 0.0 3 0.9916498802184442 13.496257397865906 11791.0 136.53168124167485 0.0 - - - - - - - 186.0 23 6 ISOC1 isochorismatase domain containing 1 1519 194 C20140704_OR005_04 C20140704_OR005_04 TB412676.[MT7]-LEAEFGQK[MT7].3y3_1.heavy 403.895 / 476.295 13933.0 29.226725101470947 44 18 10 6 10 3.5856152835044472 22.27223757086306 0.03569984436035156 3 0.9836075751799828 9.625996885613372 13933.0 22.99576668998997 0.0 - - - - - - - 745.8 27 10 SCLY selenocysteine lyase 1521 194 C20140704_OR005_04 C20140704_OR005_04 TB412676.[MT7]-LEAEFGQK[MT7].3b4_1.heavy 403.895 / 587.316 11971.0 29.226725101470947 44 18 10 6 10 3.5856152835044472 22.27223757086306 0.03569984436035156 3 0.9836075751799828 9.625996885613372 11971.0 158.39180272108842 0.0 - - - - - - - 126.0 23 7 SCLY selenocysteine lyase 1523 194 C20140704_OR005_04 C20140704_OR005_04 TB412676.[MT7]-LEAEFGQK[MT7].3y4_1.heavy 403.895 / 623.363 981.0 29.226725101470947 44 18 10 6 10 3.5856152835044472 22.27223757086306 0.03569984436035156 3 0.9836075751799828 9.625996885613372 981.0 14.815102040816326 0.0 - - - - - - - 0.0 1 0 SCLY selenocysteine lyase 1525 194 C20140704_OR005_04 C20140704_OR005_04 TB412676.[MT7]-LEAEFGQK[MT7].3b3_1.heavy 403.895 / 458.273 10695.0 29.226725101470947 44 18 10 6 10 3.5856152835044472 22.27223757086306 0.03569984436035156 3 0.9836075751799828 9.625996885613372 10695.0 120.04591836734693 0.0 - - - - - - - 186.2 21 10 SCLY selenocysteine lyase 1527 195 C20140704_OR005_04 C20140704_OR005_04 TB412675.[MT7]-LEAEFGQK[MT7].2y4_1.heavy 605.34 / 623.363 5681.0 29.21780014038086 44 20 4 10 10 7.7137373397246325 12.963884508358152 0.0 3 0.9939483331602794 15.856436904709263 5681.0 22.897908163265306 0.0 - - - - - - - 277.6666666666667 11 12 SCLY selenocysteine lyase 1529 195 C20140704_OR005_04 C20140704_OR005_04 TB412675.[MT7]-LEAEFGQK[MT7].2b4_1.heavy 605.34 / 587.316 N/A 29.21780014038086 44 20 4 10 10 7.7137373397246325 12.963884508358152 0.0 3 0.9939483331602794 15.856436904709263 6073.0 1.5631275511044287 9.0 - - - - - - - 490.0 21 1 SCLY selenocysteine lyase 1531 195 C20140704_OR005_04 C20140704_OR005_04 TB412675.[MT7]-LEAEFGQK[MT7].2y6_1.heavy 605.34 / 823.443 4016.0 29.21780014038086 44 20 4 10 10 7.7137373397246325 12.963884508358152 0.0 3 0.9939483331602794 15.856436904709263 4016.0 73.3534693877551 0.0 - - - - - - - 248.76923076923077 8 13 SCLY selenocysteine lyase 1533 195 C20140704_OR005_04 C20140704_OR005_04 TB412675.[MT7]-LEAEFGQK[MT7].2y7_1.heavy 605.34 / 952.486 6269.0 29.21780014038086 44 20 4 10 10 7.7137373397246325 12.963884508358152 0.0 3 0.9939483331602794 15.856436904709263 6269.0 23.56205782312925 0.0 - - - - - - - 196.0 12 10 SCLY selenocysteine lyase 1535 196 C20140704_OR005_04 C20140704_OR005_04 TB412891.[MT7]-HTLELVDPLK[MT7].3y3_1.heavy 484.96 / 501.352 10470.0 34.81560134887695 47 17 10 10 10 4.547482942364751 21.990186938007223 0.0 3 0.9716712135265906 7.3150578425929265 10470.0 56.033351800554016 0.0 - - - - - - - 251.54545454545453 20 11 MSH4 mutS homolog 4 (E. coli) 1537 196 C20140704_OR005_04 C20140704_OR005_04 TB412891.[MT7]-HTLELVDPLK[MT7].3b4_1.heavy 484.96 / 625.343 5536.0 34.81560134887695 47 17 10 10 10 4.547482942364751 21.990186938007223 0.0 3 0.9716712135265906 7.3150578425929265 5536.0 51.644810631229234 0.0 - - - - - - - 180.33333333333334 11 6 MSH4 mutS homolog 4 (E. coli) 1539 196 C20140704_OR005_04 C20140704_OR005_04 TB412891.[MT7]-HTLELVDPLK[MT7].3b5_1.heavy 484.96 / 738.427 2407.0 34.81560134887695 47 17 10 10 10 4.547482942364751 21.990186938007223 0.0 3 0.9716712135265906 7.3150578425929265 2407.0 12.701759002770084 0.0 - - - - - - - 160.33333333333334 4 6 MSH4 mutS homolog 4 (E. coli) 1541 196 C20140704_OR005_04 C20140704_OR005_04 TB412891.[MT7]-HTLELVDPLK[MT7].3y4_1.heavy 484.96 / 616.379 1685.0 34.81560134887695 47 17 10 10 10 4.547482942364751 21.990186938007223 0.0 3 0.9716712135265906 7.3150578425929265 1685.0 7.727191895241687 2.0 - - - - - - - 240.71428571428572 3 7 MSH4 mutS homolog 4 (E. coli) 1543 197 C20140704_OR005_04 C20140704_OR005_04 TB427125.[MT7]-AGVLGVQWLQR.2y8_1.heavy 685.905 / 999.573 23913.0 40.59187602996826 36 13 10 5 8 1.6921627503669099 59.09597051366194 0.041500091552734375 4 0.9061331152360379 3.9962163250100007 23913.0 284.37126150627614 0.0 - - - - - - - 254.25 47 8 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1545 197 C20140704_OR005_04 C20140704_OR005_04 TB427125.[MT7]-AGVLGVQWLQR.2y10_1.heavy 685.905 / 1155.66 5381.0 40.59187602996826 36 13 10 5 8 1.6921627503669099 59.09597051366194 0.041500091552734375 4 0.9061331152360379 3.9962163250100007 5381.0 4.0410308926437954 1.0 - - - - - - - 203.6 11 10 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1547 197 C20140704_OR005_04 C20140704_OR005_04 TB427125.[MT7]-AGVLGVQWLQR.2b5_1.heavy 685.905 / 542.342 4663.0 40.59187602996826 36 13 10 5 8 1.6921627503669099 59.09597051366194 0.041500091552734375 4 0.9061331152360379 3.9962163250100007 4663.0 8.846953201634175 1.0 - - - - - - - 279.0833333333333 14 12 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1549 197 C20140704_OR005_04 C20140704_OR005_04 TB427125.[MT7]-AGVLGVQWLQR.2y7_1.heavy 685.905 / 886.489 21283.0 40.59187602996826 36 13 10 5 8 1.6921627503669099 59.09597051366194 0.041500091552734375 4 0.9061331152360379 3.9962163250100007 21283.0 99.806928765399 0.0 - - - - - - - 248.3846153846154 42 13 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1551 198 C20140704_OR005_04 C20140704_OR005_04 TB451178.[MT7]-LALQTIPEDLDLRDDSLLK[MT7].4y8_2.heavy 614.852 / 552.331 11256.0 43.84939956665039 39 9 10 10 10 0.9481264015266403 69.27015381623804 0.0 3 0.8177904277845317 2.8461011935940275 11256.0 -0.6401516587677722 0.0 - - - - - - - 293.0 22 2 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1553 198 C20140704_OR005_04 C20140704_OR005_04 TB451178.[MT7]-LALQTIPEDLDLRDDSLLK[MT7].4b4_1.heavy 614.852 / 570.373 14538.0 43.84939956665039 39 9 10 10 10 0.9481264015266403 69.27015381623804 0.0 3 0.8177904277845317 2.8461011935940275 14538.0 -0.4649680170575694 0.0 - - - - - - - 257.8 29 5 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1555 198 C20140704_OR005_04 C20140704_OR005_04 TB451178.[MT7]-LALQTIPEDLDLRDDSLLK[MT7].4y13_2.heavy 614.852 / 836.947 19463.0 43.84939956665039 39 9 10 10 10 0.9481264015266403 69.27015381623804 0.0 3 0.8177904277845317 2.8461011935940275 19463.0 -1.2 1.0 - - - - - - - 234.4 38 5 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1557 198 C20140704_OR005_04 C20140704_OR005_04 TB451178.[MT7]-LALQTIPEDLDLRDDSLLK[MT7].4b5_1.heavy 614.852 / 671.421 6918.0 43.84939956665039 39 9 10 10 10 0.9481264015266403 69.27015381623804 0.0 3 0.8177904277845317 2.8461011935940275 6918.0 -0.5055785627283802 0.0 - - - - - - - 195.16666666666666 13 6 PAPOLA;PAPOLB poly(A) polymerase alpha;poly(A) polymerase beta (testis specific) 1559 199 C20140704_OR005_04 C20140704_OR005_04 TB426926.[MT7]-QLGLVVC[CAM]R.2b4_1.heavy 544.822 / 556.357 9261.0 30.85170030593872 43 20 9 6 8 14.262609190675441 7.011339837130057 0.03560066223144531 4 0.9979041861042381 26.953187520157993 9261.0 26.396205057811095 0.0 - - - - - - - 178.30769230769232 18 13 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1561 199 C20140704_OR005_04 C20140704_OR005_04 TB426926.[MT7]-QLGLVVC[CAM]R.2y6_1.heavy 544.822 / 703.392 15401.0 30.85170030593872 43 20 9 6 8 14.262609190675441 7.011339837130057 0.03560066223144531 4 0.9979041861042381 26.953187520157993 15401.0 45.0496902699949 0.0 - - - - - - - 215.64285714285714 30 14 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1563 199 C20140704_OR005_04 C20140704_OR005_04 TB426926.[MT7]-QLGLVVC[CAM]R.2b5_1.heavy 544.822 / 655.426 6744.0 30.85170030593872 43 20 9 6 8 14.262609190675441 7.011339837130057 0.03560066223144531 4 0.9979041861042381 26.953187520157993 6744.0 21.260079836012515 0.0 - - - - - - - 226.625 13 8 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1565 199 C20140704_OR005_04 C20140704_OR005_04 TB426926.[MT7]-QLGLVVC[CAM]R.2y7_1.heavy 544.822 / 816.476 24562.0 30.85170030593872 43 20 9 6 8 14.262609190675441 7.011339837130057 0.03560066223144531 4 0.9979041861042381 26.953187520157993 24562.0 93.53079470198676 1.0 - - - - - - - 201.45454545454547 59 11 LSM7 LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) 1567 200 C20140704_OR005_04 C20140704_OR005_04 TB427681.[MT7]-VEVDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAK[MT7].4b7_1.heavy 1116.35 / 934.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 1569 200 C20140704_OR005_04 C20140704_OR005_04 TB427681.[MT7]-VEVDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAK[MT7].4b4_1.heavy 1116.35 / 587.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 1571 200 C20140704_OR005_04 C20140704_OR005_04 TB427681.[MT7]-VEVDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAK[MT7].4b5_1.heavy 1116.35 / 674.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 1573 200 C20140704_OR005_04 C20140704_OR005_04 TB427681.[MT7]-VEVDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAK[MT7].4b9_1.heavy 1116.35 / 1134.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 1575 201 C20140704_OR005_04 C20140704_OR005_04 TB413391.[MT7]-MIGGK[MT7]PQDIIFTSGGTESNNLVIHSVVK[MT7].4y4_1.heavy 844.218 / 576.384 6384.0 37.96917533874512 41 16 10 5 10 2.4958682239055294 32.90167119541006 0.04489898681640625 3 0.9669021292703674 6.764834164910957 6384.0 24.58745568200032 0.0 - - - - - - - 204.4 12 10 SCLY selenocysteine lyase 1577 201 C20140704_OR005_04 C20140704_OR005_04 TB413391.[MT7]-MIGGK[MT7]PQDIIFTSGGTESNNLVIHSVVK[MT7].4b8_2.heavy 844.218 / 558.31 12256.0 37.96917533874512 41 16 10 5 10 2.4958682239055294 32.90167119541006 0.04489898681640625 3 0.9669021292703674 6.764834164910957 12256.0 55.53465339366516 0.0 - - - - - - - 255.25 24 8 SCLY selenocysteine lyase 1579 201 C20140704_OR005_04 C20140704_OR005_04 TB413391.[MT7]-MIGGK[MT7]PQDIIFTSGGTESNNLVIHSVVK[MT7].4b9_1.heavy 844.218 / 1228.7 1021.0 37.96917533874512 41 16 10 5 10 2.4958682239055294 32.90167119541006 0.04489898681640625 3 0.9669021292703674 6.764834164910957 1021.0 3.905391644908616 2.0 - - - - - - - 229.9 2 10 SCLY selenocysteine lyase 1581 201 C20140704_OR005_04 C20140704_OR005_04 TB413391.[MT7]-MIGGK[MT7]PQDIIFTSGGTESNNLVIHSVVK[MT7].4b9_2.heavy 844.218 / 614.852 7916.0 37.96917533874512 41 16 10 5 10 2.4958682239055294 32.90167119541006 0.04489898681640625 3 0.9669021292703674 6.764834164910957 7916.0 13.096470421328618 0.0 - - - - - - - 306.4 15 5 SCLY selenocysteine lyase 1583 202 C20140704_OR005_04 C20140704_OR005_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 137401.0 44.02126693725586 23 -3 10 6 10 null 0.0 0.03769683837890625 3 0.0 0.0 137401.0 445.3687586206896 1.0 - - - - - - - 210.9090909090909 274 11 1585 202 C20140704_OR005_04 C20140704_OR005_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 229709.0 44.02126693725586 23 -3 10 6 10 null 0.0 0.03769683837890625 3 0.0 0.0 229709.0 265.1096847118803 0.0 - - - - - - - 268.3333333333333 459 9 1587 202 C20140704_OR005_04 C20140704_OR005_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 217157.0 44.02126693725586 23 -3 10 6 10 null 0.0 0.03769683837890625 3 0.0 0.0 217157.0 162.65145816733065 1.0 - - - - - - - 231.9 434 10 1589 203 C20140704_OR005_04 C20140704_OR005_04 TB451165.[MT7]-SWLFQHIGHPYPTEDEK[MT7].4y5_1.heavy 593.803 / 765.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKNOX1 PBX/knotted 1 homeobox 1 1591 203 C20140704_OR005_04 C20140704_OR005_04 TB451165.[MT7]-SWLFQHIGHPYPTEDEK[MT7].4b4_1.heavy 593.803 / 678.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKNOX1 PBX/knotted 1 homeobox 1 1593 203 C20140704_OR005_04 C20140704_OR005_04 TB451165.[MT7]-SWLFQHIGHPYPTEDEK[MT7].4y6_1.heavy 593.803 / 862.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKNOX1 PBX/knotted 1 homeobox 1 1595 203 C20140704_OR005_04 C20140704_OR005_04 TB451165.[MT7]-SWLFQHIGHPYPTEDEK[MT7].4b3_1.heavy 593.803 / 531.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKNOX1 PBX/knotted 1 homeobox 1 1597 204 C20140704_OR005_04 C20140704_OR005_04 TB427552.[MT7]-LFIPQITTNHSGLYAC[CAM]SVR.3b3_1.heavy 774.411 / 518.346 8328.0 39.507301330566406 47 17 10 10 10 2.9897960374560912 33.447097643853446 0.0 3 0.9705208569332566 7.1702160738878336 8328.0 37.28069422432719 0.0 - - - - - - - 298.3 16 10 PSG6 pregnancy specific beta-1-glycoprotein 6 1599 204 C20140704_OR005_04 C20140704_OR005_04 TB427552.[MT7]-LFIPQITTNHSGLYAC[CAM]SVR.3y8_1.heavy 774.411 / 925.456 2859.0 39.507301330566406 47 17 10 10 10 2.9897960374560912 33.447097643853446 0.0 3 0.9705208569332566 7.1702160738878336 2859.0 2.5706326186554724 1.0 - - - - - - - 337.42857142857144 5 7 PSG6 pregnancy specific beta-1-glycoprotein 6 1601 204 C20140704_OR005_04 C20140704_OR005_04 TB427552.[MT7]-LFIPQITTNHSGLYAC[CAM]SVR.3y10_1.heavy 774.411 / 1149.55 1864.0 39.507301330566406 47 17 10 10 10 2.9897960374560912 33.447097643853446 0.0 3 0.9705208569332566 7.1702160738878336 1864.0 9.962330125330295 0.0 - - - - - - - 302.0 3 7 PSG6 pregnancy specific beta-1-glycoprotein 6 1603 204 C20140704_OR005_04 C20140704_OR005_04 TB427552.[MT7]-LFIPQITTNHSGLYAC[CAM]SVR.3y9_1.heavy 774.411 / 1012.49 9571.0 39.507301330566406 47 17 10 10 10 2.9897960374560912 33.447097643853446 0.0 3 0.9705208569332566 7.1702160738878336 9571.0 37.2195225637107 0.0 - - - - - - - 310.8 19 10 PSG6 pregnancy specific beta-1-glycoprotein 6 1605 205 C20140704_OR005_04 C20140704_OR005_04 TB427412.[MT7]-ALGVSNFSHFQIEK[MT7].3y3_1.heavy 622.344 / 533.341 24831.0 36.12110137939453 44 14 10 10 10 2.193750812107589 30.984253681804674 0.0 3 0.9323924838704936 4.719404221618864 24831.0 37.081031595369204 0.0 - - - - - - - 776.0 49 8 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1607 205 C20140704_OR005_04 C20140704_OR005_04 TB427412.[MT7]-ALGVSNFSHFQIEK[MT7].3b6_1.heavy 622.344 / 686.395 17134.0 36.12110137939453 44 14 10 10 10 2.193750812107589 30.984253681804674 0.0 3 0.9323924838704936 4.719404221618864 17134.0 99.42379665087297 0.0 - - - - - - - 272.8 34 10 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1609 205 C20140704_OR005_04 C20140704_OR005_04 TB427412.[MT7]-ALGVSNFSHFQIEK[MT7].3y4_1.heavy 622.344 / 661.4 29053.0 36.12110137939453 44 14 10 10 10 2.193750812107589 30.984253681804674 0.0 3 0.9323924838704936 4.719404221618864 29053.0 129.68741616681623 0.0 - - - - - - - 260.5 58 10 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1611 205 C20140704_OR005_04 C20140704_OR005_04 TB427412.[MT7]-ALGVSNFSHFQIEK[MT7].3y5_1.heavy 622.344 / 808.469 27315.0 36.12110137939453 44 14 10 10 10 2.193750812107589 30.984253681804674 0.0 3 0.9323924838704936 4.719404221618864 27315.0 81.09225926370068 0.0 - - - - - - - 236.72727272727272 54 11 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1613 206 C20140704_OR005_04 C20140704_OR005_04 TB412484.[MT7]-GNAIGGK[MT7].2y4_1.heavy 452.776 / 518.342 2130.0 16.867900848388672 40 10 10 10 10 0.7716497889436732 78.6093621322584 0.0 3 0.8249712625732762 2.905758513767264 2130.0 26.161490266278808 0.0 - - - - - - - 121.44444444444444 4 9 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1615 206 C20140704_OR005_04 C20140704_OR005_04 TB412484.[MT7]-GNAIGGK[MT7].2y5_1.heavy 452.776 / 589.379 2348.0 16.867900848388672 40 10 10 10 10 0.7716497889436732 78.6093621322584 0.0 3 0.8249712625732762 2.905758513767264 2348.0 57.808974145120935 0.0 - - - - - - - 118.5 4 6 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1617 206 C20140704_OR005_04 C20140704_OR005_04 TB412484.[MT7]-GNAIGGK[MT7].2b4_1.heavy 452.776 / 500.295 3823.0 16.867900848388672 40 10 10 10 10 0.7716497889436732 78.6093621322584 0.0 3 0.8249712625732762 2.905758513767264 3823.0 31.916788990825687 0.0 - - - - - - - 185.66666666666666 7 15 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1619 206 C20140704_OR005_04 C20140704_OR005_04 TB412484.[MT7]-GNAIGGK[MT7].2y6_1.heavy 452.776 / 703.422 1529.0 16.867900848388672 40 10 10 10 10 0.7716497889436732 78.6093621322584 0.0 3 0.8249712625732762 2.905758513767264 1529.0 22.265504587155963 0.0 - - - - - - - 182.0 3 9 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1621 207 C20140704_OR005_04 C20140704_OR005_04 TB451091.[MT7]-ENFNNVPDLELNPIR.3y7_1.heavy 643.338 / 854.509 14282.0 39.375 46 16 10 10 10 3.6096481477383318 27.703531177313277 0.0 3 0.9694605051911275 7.044009668900256 14282.0 36.352875989445906 1.0 - - - - - - - 252.66666666666666 28 3 TESC tescalcin 1623 207 C20140704_OR005_04 C20140704_OR005_04 TB451091.[MT7]-ENFNNVPDLELNPIR.3b4_1.heavy 643.338 / 649.306 21234.0 39.375 46 16 10 10 10 3.6096481477383318 27.703531177313277 0.0 3 0.9694605051911275 7.044009668900256 21234.0 5.643550051599587 1.0 - - - - - - - 126.0 42 1 TESC tescalcin 1625 207 C20140704_OR005_04 C20140704_OR005_04 TB451091.[MT7]-ENFNNVPDLELNPIR.3b5_1.heavy 643.338 / 763.349 41962.0 39.375 46 16 10 10 10 3.6096481477383318 27.703531177313277 0.0 3 0.9694605051911275 7.044009668900256 41962.0 66.2011129387796 0.0 - - - - - - - 284.25 83 4 TESC tescalcin 1627 207 C20140704_OR005_04 C20140704_OR005_04 TB451091.[MT7]-ENFNNVPDLELNPIR.3y9_1.heavy 643.338 / 1066.59 85061.0 39.375 46 16 10 10 10 3.6096481477383318 27.703531177313277 0.0 3 0.9694605051911275 7.044009668900256 85061.0 682.5431708358449 0.0 - - - - - - - 210.33333333333334 170 3 TESC tescalcin 1629 208 C20140704_OR005_04 C20140704_OR005_04 TB427137.[MT7]-GFPDQPSSLMR.3y6_1.heavy 460.235 / 690.36 2283.0 32.935675621032715 43 18 10 5 10 3.972859928738519 25.170784219355163 0.041896820068359375 3 0.9838855289750906 9.7088861853511 2283.0 23.068405699065657 0.0 - - - - - - - 260.8 4 5 UBQLN3 ubiquilin 3 1631 208 C20140704_OR005_04 C20140704_OR005_04 TB427137.[MT7]-GFPDQPSSLMR.3b4_1.heavy 460.235 / 561.279 3045.0 32.935675621032715 43 18 10 5 10 3.972859928738519 25.170784219355163 0.041896820068359375 3 0.9838855289750906 9.7088861853511 3045.0 14.303313334536268 1.0 - - - - - - - 217.33333333333334 6 3 UBQLN3 ubiquilin 3 1633 208 C20140704_OR005_04 C20140704_OR005_04 TB427137.[MT7]-GFPDQPSSLMR.3y4_1.heavy 460.235 / 506.276 979.0 32.935675621032715 43 18 10 5 10 3.972859928738519 25.170784219355163 0.041896820068359375 3 0.9838855289750906 9.7088861853511 979.0 2.415846978351315 4.0 - - - - - - - 244.625 3 8 UBQLN3 ubiquilin 3 1635 208 C20140704_OR005_04 C20140704_OR005_04 TB427137.[MT7]-GFPDQPSSLMR.3y5_1.heavy 460.235 / 593.308 1196.0 32.935675621032715 43 18 10 5 10 3.972859928738519 25.170784219355163 0.041896820068359375 3 0.9838855289750906 9.7088861853511 1196.0 2.734969325153375 1.0 - - - - - - - 289.77777777777777 2 9 UBQLN3 ubiquilin 3 1637 209 C20140704_OR005_04 C20140704_OR005_04 TB426915.[MT7]-EAESQVK[MT7].2y4_1.heavy 539.803 / 605.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 1639 209 C20140704_OR005_04 C20140704_OR005_04 TB426915.[MT7]-EAESQVK[MT7].2b4_1.heavy 539.803 / 561.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 1641 209 C20140704_OR005_04 C20140704_OR005_04 TB426915.[MT7]-EAESQVK[MT7].2y6_1.heavy 539.803 / 805.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 1643 209 C20140704_OR005_04 C20140704_OR005_04 TB426915.[MT7]-EAESQVK[MT7].2b5_1.heavy 539.803 / 689.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 1645 210 C20140704_OR005_04 C20140704_OR005_04 TB427038.[MT7]-ALGSGMAVDC[CAM]STLTSK[MT7].3b9_1.heavy 629.325 / 946.478 4200.0 31.617000579833984 45 15 10 10 10 2.299561835503254 35.74356407670575 0.0 3 0.9558632400440886 5.852638471799068 4200.0 73.08 0.0 - - - - - - - 180.0 8 10 TACSTD2 tumor-associated calcium signal transducer 2 1647 210 C20140704_OR005_04 C20140704_OR005_04 TB427038.[MT7]-ALGSGMAVDC[CAM]STLTSK[MT7].3b6_1.heavy 629.325 / 661.346 8900.0 31.617000579833984 45 15 10 10 10 2.299561835503254 35.74356407670575 0.0 3 0.9558632400440886 5.852638471799068 8900.0 40.821333333333335 0.0 - - - - - - - 263.6363636363636 17 11 TACSTD2 tumor-associated calcium signal transducer 2 1649 210 C20140704_OR005_04 C20140704_OR005_04 TB427038.[MT7]-ALGSGMAVDC[CAM]STLTSK[MT7].3y4_1.heavy 629.325 / 592.379 5700.0 31.617000579833984 45 15 10 10 10 2.299561835503254 35.74356407670575 0.0 3 0.9558632400440886 5.852638471799068 5700.0 21.487272727272725 0.0 - - - - - - - 657.1428571428571 11 7 TACSTD2 tumor-associated calcium signal transducer 2 1651 210 C20140704_OR005_04 C20140704_OR005_04 TB427038.[MT7]-ALGSGMAVDC[CAM]STLTSK[MT7].3b7_1.heavy 629.325 / 732.383 12600.0 31.617000579833984 45 15 10 10 10 2.299561835503254 35.74356407670575 0.0 3 0.9558632400440886 5.852638471799068 12600.0 27.090000000000003 0.0 - - - - - - - 657.1428571428571 25 7 TACSTD2 tumor-associated calcium signal transducer 2 1653 211 C20140704_OR005_04 C20140704_OR005_04 TB413244.[MT7]-FVAAVHYEQPTIQIELR.2y8_1.heavy 1079.59 / 969.573 5072.0 38.58369827270508 47 17 10 10 10 7.509090038802364 13.317192826728864 0.0 3 0.9769180615622574 8.10750657794326 5072.0 57.30960629921259 0.0 - - - - - - - 181.42857142857142 10 7 TACSTD2 tumor-associated calcium signal transducer 2 1655 211 C20140704_OR005_04 C20140704_OR005_04 TB413244.[MT7]-FVAAVHYEQPTIQIELR.2y9_1.heavy 1079.59 / 1097.63 3424.0 38.58369827270508 47 17 10 10 10 7.509090038802364 13.317192826728864 0.0 3 0.9769180615622574 8.10750657794326 3424.0 11.681340973998097 0.0 - - - - - - - 169.16666666666666 6 6 TACSTD2 tumor-associated calcium signal transducer 2 1657 211 C20140704_OR005_04 C20140704_OR005_04 TB413244.[MT7]-FVAAVHYEQPTIQIELR.2y10_1.heavy 1079.59 / 1226.67 2156.0 38.58369827270508 47 17 10 10 10 7.509090038802364 13.317192826728864 0.0 3 0.9769180615622574 8.10750657794326 2156.0 5.100231390707064 0.0 - - - - - - - 222.0 4 4 TACSTD2 tumor-associated calcium signal transducer 2 1659 211 C20140704_OR005_04 C20140704_OR005_04 TB413244.[MT7]-FVAAVHYEQPTIQIELR.2b5_1.heavy 1079.59 / 632.389 5706.0 38.58369827270508 47 17 10 10 10 7.509090038802364 13.317192826728864 0.0 3 0.9769180615622574 8.10750657794326 5706.0 37.48035640281807 0.0 - - - - - - - 253.5 11 2 TACSTD2 tumor-associated calcium signal transducer 2 1661 212 C20140704_OR005_04 C20140704_OR005_04 TB412680.[MT7]-TPLSTGNPQR.2y8_1.heavy 607.834 / 872.458 2011.0 20.899224281311035 45 18 10 7 10 3.82460555421399 26.14648715599416 0.026500701904296875 3 0.9890803173652044 11.799439328580496 2011.0 1.4151964813613096 0.0 - - - - - - - 195.2 4 10 MSH4 mutS homolog 4 (E. coli) 1663 212 C20140704_OR005_04 C20140704_OR005_04 TB412680.[MT7]-TPLSTGNPQR.2y5_1.heavy 607.834 / 571.295 2700.0 20.899224281311035 45 18 10 7 10 3.82460555421399 26.14648715599416 0.026500701904296875 3 0.9890803173652044 11.799439328580496 2700.0 4.340046754180903 0.0 - - - - - - - 172.2941176470588 5 17 MSH4 mutS homolog 4 (E. coli) 1665 212 C20140704_OR005_04 C20140704_OR005_04 TB412680.[MT7]-TPLSTGNPQR.2y9_1.heavy 607.834 / 969.511 33033.0 20.899224281311035 45 18 10 7 10 3.82460555421399 26.14648715599416 0.026500701904296875 3 0.9890803173652044 11.799439328580496 33033.0 225.96486956521738 0.0 - - - - - - - 191.41666666666666 66 12 MSH4 mutS homolog 4 (E. coli) 1667 212 C20140704_OR005_04 C20140704_OR005_04 TB412680.[MT7]-TPLSTGNPQR.2y7_1.heavy 607.834 / 759.374 3792.0 20.899224281311035 45 18 10 7 10 3.82460555421399 26.14648715599416 0.026500701904296875 3 0.9890803173652044 11.799439328580496 3792.0 96.79578947368421 0.0 - - - - - - - 85.83333333333333 7 6 MSH4 mutS homolog 4 (E. coli) 1669 213 C20140704_OR005_04 C20140704_OR005_04 TB412585.[MT7]-DIINAARESLAK[MT7].3y10_2.heavy 530.314 / 608.86 2799.0 33.019474029541016 31 10 10 5 6 0.9616260449167329 60.5398883908034 0.041900634765625 5 0.8403711733465447 3.0468609084765843 2799.0 33.727829457364344 0.0 - - - - - - - 207.07692307692307 5 13 SCLY selenocysteine lyase 1671 213 C20140704_OR005_04 C20140704_OR005_04 TB412585.[MT7]-DIINAARESLAK[MT7].3b4_1.heavy 530.314 / 600.347 1292.0 33.019474029541016 31 10 10 5 6 0.9616260449167329 60.5398883908034 0.041900634765625 5 0.8403711733465447 3.0468609084765843 1292.0 6.008855537304401 3.0 - - - - - - - 205.54545454545453 3 11 SCLY selenocysteine lyase 1673 213 C20140704_OR005_04 C20140704_OR005_04 TB412585.[MT7]-DIINAARESLAK[MT7].3y4_1.heavy 530.314 / 562.368 861.0 33.019474029541016 31 10 10 5 6 0.9616260449167329 60.5398883908034 0.041900634765625 5 0.8403711733465447 3.0468609084765843 861.0 3.4372462341878993 4.0 - - - - - - - 0.0 1 0 SCLY selenocysteine lyase 1675 213 C20140704_OR005_04 C20140704_OR005_04 TB412585.[MT7]-DIINAARESLAK[MT7].3b8_2.heavy 530.314 / 514.286 754.0 33.019474029541016 31 10 10 5 6 0.9616260449167329 60.5398883908034 0.041900634765625 5 0.8403711733465447 3.0468609084765843 754.0 0.5137339302772566 33.0 - - - - - - - 296.125 5 8 SCLY selenocysteine lyase 1677 214 C20140704_OR005_04 C20140704_OR005_04 TB413110.[MT7]-IK[MT7]TEPVDMLGLLSC[CAM]SSTVSVK[MT7].3b7_1.heavy 899.503 / 1071.63 2566.0 42.827301025390625 40 16 8 10 6 13.29722420165744 7.520366542931226 0.0 5 0.9678829830631204 6.867924471911709 2566.0 4.252585685319412 3.0 - - - - - - - 233.45454545454547 11 11 PLAGL2 pleiomorphic adenoma gene-like 2 1679 214 C20140704_OR005_04 C20140704_OR005_04 TB413110.[MT7]-IK[MT7]TEPVDMLGLLSC[CAM]SSTVSVK[MT7].3b4_1.heavy 899.503 / 760.481 428.0 42.827301025390625 40 16 8 10 6 13.29722420165744 7.520366542931226 0.0 5 0.9678829830631204 6.867924471911709 428.0 1.3333333333333333 20.0 - - - - - - - 243.1818181818182 13 11 PLAGL2 pleiomorphic adenoma gene-like 2 1681 214 C20140704_OR005_04 C20140704_OR005_04 TB413110.[MT7]-IK[MT7]TEPVDMLGLLSC[CAM]SSTVSVK[MT7].3b7_2.heavy 899.503 / 536.318 5026.0 42.827301025390625 40 16 8 10 6 13.29722420165744 7.520366542931226 0.0 5 0.9678829830631204 6.867924471911709 5026.0 23.01626168224299 0.0 - - - - - - - 246.1 10 10 PLAGL2 pleiomorphic adenoma gene-like 2 1683 214 C20140704_OR005_04 C20140704_OR005_04 TB413110.[MT7]-IK[MT7]TEPVDMLGLLSC[CAM]SSTVSVK[MT7].3y9_1.heavy 899.503 / 1098.56 1818.0 42.827301025390625 40 16 8 10 6 13.29722420165744 7.520366542931226 0.0 5 0.9678829830631204 6.867924471911709 1818.0 11.327102803738319 1.0 - - - - - - - 252.9090909090909 3 11 PLAGL2 pleiomorphic adenoma gene-like 2 1685 215 C20140704_OR005_04 C20140704_OR005_04 TB427420.[MT7]-AAGDVDIGDAAYYFER.2b6_1.heavy 938.945 / 673.327 17591.0 40.321998596191406 48 18 10 10 10 3.903419213775307 25.618565294523428 0.0 3 0.9803074552171845 8.780033335380024 17591.0 178.0035348151128 0.0 - - - - - - - 349.0 35 7 TACSTD2 tumor-associated calcium signal transducer 2 1687 215 C20140704_OR005_04 C20140704_OR005_04 TB427420.[MT7]-AAGDVDIGDAAYYFER.2y10_1.heavy 938.945 / 1204.56 6597.0 40.321998596191406 48 18 10 10 10 3.903419213775307 25.618565294523428 0.0 3 0.9803074552171845 8.780033335380024 6597.0 12.956464811783961 0.0 - - - - - - - 271.22222222222223 13 9 TACSTD2 tumor-associated calcium signal transducer 2 1689 215 C20140704_OR005_04 C20140704_OR005_04 TB427420.[MT7]-AAGDVDIGDAAYYFER.2b5_1.heavy 938.945 / 558.3 6352.0 40.321998596191406 48 18 10 10 10 3.903419213775307 25.618565294523428 0.0 3 0.9803074552171845 8.780033335380024 6352.0 60.32704247269995 0.0 - - - - - - - 198.25 12 8 TACSTD2 tumor-associated calcium signal transducer 2 1691 215 C20140704_OR005_04 C20140704_OR005_04 TB427420.[MT7]-AAGDVDIGDAAYYFER.2y7_1.heavy 938.945 / 919.431 13560.0 40.321998596191406 48 18 10 10 10 3.903419213775307 25.618565294523428 0.0 3 0.9803074552171845 8.780033335380024 13560.0 41.09373071185584 0.0 - - - - - - - 223.66666666666666 27 12 TACSTD2 tumor-associated calcium signal transducer 2 1693 216 C20140704_OR005_04 C20140704_OR005_04 TB412491.[MT7]-DIINAAR.2y5_1.heavy 458.77 / 544.32 6976.0 24.28380012512207 50 20 10 10 10 10.426493577334076 9.590952054810428 0.0 3 0.9939662844439875 15.88003093225724 6976.0 4.29083507931757 1.0 - - - - - - - 192.1818181818182 15 11 SCLY selenocysteine lyase 1695 216 C20140704_OR005_04 C20140704_OR005_04 TB412491.[MT7]-DIINAAR.2b4_1.heavy 458.77 / 600.347 4222.0 24.28380012512207 50 20 10 10 10 10.426493577334076 9.590952054810428 0.0 3 0.9939662844439875 15.88003093225724 4222.0 17.21297601697913 0.0 - - - - - - - 170.57142857142858 8 7 SCLY selenocysteine lyase 1697 216 C20140704_OR005_04 C20140704_OR005_04 TB412491.[MT7]-DIINAAR.2y6_1.heavy 458.77 / 657.404 8812.0 24.28380012512207 50 20 10 10 10 10.426493577334076 9.590952054810428 0.0 3 0.9939662844439875 15.88003093225724 8812.0 59.49667351778656 0.0 - - - - - - - 183.66666666666666 17 9 SCLY selenocysteine lyase 1699 216 C20140704_OR005_04 C20140704_OR005_04 TB412491.[MT7]-DIINAAR.2b5_1.heavy 458.77 / 671.385 3763.0 24.28380012512207 50 20 10 10 10 10.426493577334076 9.590952054810428 0.0 3 0.9939662844439875 15.88003093225724 3763.0 28.661268774703558 0.0 - - - - - - - 172.125 7 8 SCLY selenocysteine lyase 1701 217 C20140704_OR005_04 C20140704_OR005_04 TB427526.[MT7]-DISPAALPGEELLC[CAM]C[CAM]VC[CAM]R.3y6_1.heavy 735.359 / 867.363 3580.0 43.329599380493164 41 16 10 5 10 3.108271735671155 25.691576529536725 0.045200347900390625 3 0.96873130045976 6.960962021767957 3580.0 10.099255680140068 0.0 - - - - - - - 204.57142857142858 7 7 PHF1 PHD finger protein 1 1703 217 C20140704_OR005_04 C20140704_OR005_04 TB427526.[MT7]-DISPAALPGEELLC[CAM]C[CAM]VC[CAM]R.3b6_1.heavy 735.359 / 699.379 11967.0 43.329599380493164 41 16 10 5 10 3.108271735671155 25.691576529536725 0.045200347900390625 3 0.96873130045976 6.960962021767957 11967.0 41.23270253128247 0.0 - - - - - - - 219.28571428571428 23 7 PHF1 PHD finger protein 1 1705 217 C20140704_OR005_04 C20140704_OR005_04 TB427526.[MT7]-DISPAALPGEELLC[CAM]C[CAM]VC[CAM]R.3b5_1.heavy 735.359 / 628.342 7978.0 43.329599380493164 41 16 10 5 10 3.108271735671155 25.691576529536725 0.045200347900390625 3 0.96873130045976 6.960962021767957 7978.0 37.811042345276874 0.0 - - - - - - - 225.0 15 5 PHF1 PHD finger protein 1 1707 217 C20140704_OR005_04 C20140704_OR005_04 TB427526.[MT7]-DISPAALPGEELLC[CAM]C[CAM]VC[CAM]R.3y5_1.heavy 735.359 / 754.279 5319.0 43.329599380493164 41 16 10 5 10 3.108271735671155 25.691576529536725 0.045200347900390625 3 0.96873130045976 6.960962021767957 5319.0 59.94972832968804 0.0 - - - - - - - 190.0 10 7 PHF1 PHD finger protein 1 1709 218 C20140704_OR005_04 C20140704_OR005_04 TB426940.[MT7]-EITTQITR.2y5_1.heavy 553.32 / 618.357 2831.0 24.774499893188477 47 17 10 10 10 4.803785019958434 20.8169182393731 0.0 3 0.9714132743484468 7.281822852547989 2831.0 9.201977563923236 0.0 - - - - - - - 240.3846153846154 5 13 MSH4 mutS homolog 4 (E. coli) 1711 218 C20140704_OR005_04 C20140704_OR005_04 TB426940.[MT7]-EITTQITR.2y6_1.heavy 553.32 / 719.405 5857.0 24.774499893188477 47 17 10 10 10 4.803785019958434 20.8169182393731 0.0 3 0.9714132743484468 7.281822852547989 5857.0 49.78537134856043 0.0 - - - - - - - 253.8 11 5 MSH4 mutS homolog 4 (E. coli) 1713 218 C20140704_OR005_04 C20140704_OR005_04 TB426940.[MT7]-EITTQITR.2b5_1.heavy 553.32 / 717.39 879.0 24.774499893188477 47 17 10 10 10 4.803785019958434 20.8169182393731 0.0 3 0.9714132743484468 7.281822852547989 879.0 -0.27021006285786275 4.0 - - - - - - - 216.88888888888889 3 9 MSH4 mutS homolog 4 (E. coli) 1715 218 C20140704_OR005_04 C20140704_OR005_04 TB426940.[MT7]-EITTQITR.2y7_1.heavy 553.32 / 832.489 6443.0 24.774499893188477 47 17 10 10 10 4.803785019958434 20.8169182393731 0.0 3 0.9714132743484468 7.281822852547989 6443.0 86.08654889600892 0.0 - - - - - - - 137.0 12 5 MSH4 mutS homolog 4 (E. coli) 1717 219 C20140704_OR005_04 C20140704_OR005_04 TB427286.[MT7]-NLTIEVLMSSVK[MT7].3b6_1.heavy 541.319 / 814.479 2494.0 45.668800354003906 41 11 10 10 10 1.2995066885473514 60.264429647127 0.0 3 0.8525683059362242 3.1738093277345065 2494.0 28.415343801986186 1.0 - - - - - - - 124.5 7 4 SLC22A11 solute carrier family 22 (organic anion/urate transporter), member 11 1719 219 C20140704_OR005_04 C20140704_OR005_04 TB427286.[MT7]-NLTIEVLMSSVK[MT7].3b5_1.heavy 541.319 / 715.411 3409.0 45.668800354003906 41 11 10 10 10 1.2995066885473514 60.264429647127 0.0 3 0.8525683059362242 3.1738093277345065 3409.0 76.80518072289155 0.0 - - - - - - - 194.0 6 6 SLC22A11 solute carrier family 22 (organic anion/urate transporter), member 11 1721 219 C20140704_OR005_04 C20140704_OR005_04 TB427286.[MT7]-NLTIEVLMSSVK[MT7].3y4_1.heavy 541.319 / 564.347 6152.0 45.668800354003906 41 11 10 10 10 1.2995066885473514 60.264429647127 0.0 3 0.8525683059362242 3.1738093277345065 6152.0 107.10409638554216 0.0 - - - - - - - 166.14285714285714 12 7 SLC22A11 solute carrier family 22 (organic anion/urate transporter), member 11 1723 219 C20140704_OR005_04 C20140704_OR005_04 TB427286.[MT7]-NLTIEVLMSSVK[MT7].3y5_1.heavy 541.319 / 695.388 2827.0 45.668800354003906 41 11 10 10 10 1.2995066885473514 60.264429647127 0.0 3 0.8525683059362242 3.1738093277345065 2827.0 36.444457831325295 0.0 - - - - - - - 228.5 5 4 SLC22A11 solute carrier family 22 (organic anion/urate transporter), member 11 1725 220 C20140704_OR005_04 C20140704_OR005_04 TB412494.[MT7]-FHQAFQ.2b3_1.heavy 461.239 / 557.295 9668.0 25.60110092163086 50 20 10 10 10 3.3577487871294327 23.315966337780452 0.0 3 0.9908415416554562 12.886030915017683 9668.0 141.3492037122494 0.0 - - - - - - - 197.4 19 5 PLAG1;PLAGL2 pleiomorphic adenoma gene 1;pleiomorphic adenoma gene-like 2 1727 220 C20140704_OR005_04 C20140704_OR005_04 TB412494.[MT7]-FHQAFQ.2b3_2.heavy 461.239 / 279.151 22198.0 25.60110092163086 50 20 10 10 10 3.3577487871294327 23.315966337780452 0.0 3 0.9908415416554562 12.886030915017683 22198.0 225.40727503168569 0.0 - - - - - - - 237.0 44 5 PLAG1;PLAGL2 pleiomorphic adenoma gene 1;pleiomorphic adenoma gene-like 2 1729 220 C20140704_OR005_04 C20140704_OR005_04 TB412494.[MT7]-FHQAFQ.2b4_1.heavy 461.239 / 628.332 12135.0 25.60110092163086 50 20 10 10 10 3.3577487871294327 23.315966337780452 0.0 3 0.9908415416554562 12.886030915017683 12135.0 80.67093007691436 0.0 - - - - - - - 226.8 24 10 PLAG1;PLAGL2 pleiomorphic adenoma gene 1;pleiomorphic adenoma gene-like 2 1731 220 C20140704_OR005_04 C20140704_OR005_04 TB412494.[MT7]-FHQAFQ.2b5_1.heavy 461.239 / 775.401 2170.0 25.60110092163086 50 20 10 10 10 3.3577487871294327 23.315966337780452 0.0 3 0.9908415416554562 12.886030915017683 2170.0 23.615982156591294 0.0 - - - - - - - 115.33333333333333 4 6 PLAG1;PLAGL2 pleiomorphic adenoma gene 1;pleiomorphic adenoma gene-like 2 1733 221 C20140704_OR005_04 C20140704_OR005_04 TB427427.[MT7]-SNPVTLNVLYGPDLPR.2y8_1.heavy 950.026 / 930.504 3975.0 40.94150161743164 45 15 10 10 10 1.8228845310892183 38.51699626886981 0.0 3 0.9593045425662888 6.096849454902629 3975.0 10.806069299653272 1.0 - - - - - - - 210.6 8 5 PSG6 pregnancy specific beta-1-glycoprotein 6 1735 221 C20140704_OR005_04 C20140704_OR005_04 TB427427.[MT7]-SNPVTLNVLYGPDLPR.2b4_1.heavy 950.026 / 542.305 9703.0 40.94150161743164 45 15 10 10 10 1.8228845310892183 38.51699626886981 0.0 3 0.9593045425662888 6.096849454902629 9703.0 108.64042735042736 0.0 - - - - - - - 273.0 19 6 PSG6 pregnancy specific beta-1-glycoprotein 6 1737 221 C20140704_OR005_04 C20140704_OR005_04 TB427427.[MT7]-SNPVTLNVLYGPDLPR.2y3_1.heavy 950.026 / 385.256 8767.0 40.94150161743164 45 15 10 10 10 1.8228845310892183 38.51699626886981 0.0 3 0.9593045425662888 6.096849454902629 8767.0 33.98539302827463 0.0 - - - - - - - 234.0 17 10 PSG6 pregnancy specific beta-1-glycoprotein 6 1739 221 C20140704_OR005_04 C20140704_OR005_04 TB427427.[MT7]-SNPVTLNVLYGPDLPR.2y10_1.heavy 950.026 / 1143.62 6663.0 40.94150161743164 45 15 10 10 10 1.8228845310892183 38.51699626886981 0.0 3 0.9593045425662888 6.096849454902629 6663.0 26.765897435897436 0.0 - - - - - - - 198.9 13 10 PSG6 pregnancy specific beta-1-glycoprotein 6 1741 222 C20140704_OR005_04 C20140704_OR005_04 TB450875.[MT7]-LLFEVFDENR.2y8_1.heavy 713.378 / 1055.48 3796.0 47.070274353027344 40 14 10 6 10 1.3188095196314287 44.11897444911189 0.0363006591796875 3 0.9349770006852327 4.813345576198793 3796.0 15.022311922431689 0.0 - - - - - - - 221.66666666666666 7 6 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 1743 222 C20140704_OR005_04 C20140704_OR005_04 TB450875.[MT7]-LLFEVFDENR.2y9_1.heavy 713.378 / 1168.56 1993.0 47.070274353027344 40 14 10 6 10 1.3188095196314287 44.11897444911189 0.0363006591796875 3 0.9349770006852327 4.813345576198793 1993.0 -1.4685263157894752 0.0 - - - - - - - 224.36363636363637 3 11 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 1745 222 C20140704_OR005_04 C20140704_OR005_04 TB450875.[MT7]-LLFEVFDENR.2y6_1.heavy 713.378 / 779.368 759.0 47.070274353027344 40 14 10 6 10 1.3188095196314287 44.11897444911189 0.0363006591796875 3 0.9349770006852327 4.813345576198793 759.0 7.350315789473685 2.0 - - - - - - - 0.0 1 0 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 1747 222 C20140704_OR005_04 C20140704_OR005_04 TB450875.[MT7]-LLFEVFDENR.2y7_1.heavy 713.378 / 908.411 2183.0 47.070274353027344 40 14 10 6 10 1.3188095196314287 44.11897444911189 0.0363006591796875 3 0.9349770006852327 4.813345576198793 2183.0 24.131355421686745 0.0 - - - - - - - 158.33333333333334 4 6 NEDD4L;NEDD4 neural precursor cell expressed, developmentally down-regulated 4-like;neural precursor cell expressed, developmentally down-regulated 4 1749 223 C20140704_OR005_04 C20140704_OR005_04 TB426800.[MT7]-ENIQLFC[CAM]K[MT7].3y3_1.heavy 447.248 / 598.314 2327.0 33.28799915313721 34 14 9 5 6 1.3362683320803588 49.89017928972184 0.040798187255859375 5 0.9359072031628906 4.848533655113377 2327.0 5.305201753414332 4.0 - - - - - - - 300.7142857142857 5 7 SLCO1C1 solute carrier organic anion transporter family, member 1C1 1751 223 C20140704_OR005_04 C20140704_OR005_04 TB426800.[MT7]-ENIQLFC[CAM]K[MT7].3b4_1.heavy 447.248 / 629.338 1773.0 33.28799915313721 34 14 9 5 6 1.3362683320803588 49.89017928972184 0.040798187255859375 5 0.9359072031628906 4.848533655113377 1773.0 18.118739824161512 0.0 - - - - - - - 194.0 3 4 SLCO1C1 solute carrier organic anion transporter family, member 1C1 1753 223 C20140704_OR005_04 C20140704_OR005_04 TB426800.[MT7]-ENIQLFC[CAM]K[MT7].3y4_1.heavy 447.248 / 711.398 443.0 33.28799915313721 34 14 9 5 6 1.3362683320803588 49.89017928972184 0.040798187255859375 5 0.9359072031628906 4.848533655113377 443.0 4.192792792792793 2.0 - - - - - - - 0.0 0 0 SLCO1C1 solute carrier organic anion transporter family, member 1C1 1755 223 C20140704_OR005_04 C20140704_OR005_04 TB426800.[MT7]-ENIQLFC[CAM]K[MT7].3b3_1.heavy 447.248 / 501.279 1330.0 33.28799915313721 34 14 9 5 6 1.3362683320803588 49.89017928972184 0.040798187255859375 5 0.9359072031628906 4.848533655113377 1330.0 6.593849673601366 1.0 - - - - - - - 258.6666666666667 5 6 SLCO1C1 solute carrier organic anion transporter family, member 1C1 1757 224 C20140704_OR005_04 C20140704_OR005_04 TB412694.[MT7]-SHSQELLK[MT7].3y3_1.heavy 410.575 / 517.383 7663.0 20.38742446899414 38 13 10 7 8 1.6859786229353557 50.322421356116415 0.02610015869140625 4 0.9293324635437159 4.61488682667986 7663.0 36.477559945192965 0.0 - - - - - - - 225.55555555555554 15 18 PLAGL2 pleiomorphic adenoma gene-like 2 1759 224 C20140704_OR005_04 C20140704_OR005_04 TB412694.[MT7]-SHSQELLK[MT7].3b4_1.heavy 410.575 / 584.291 1393.0 20.38742446899414 38 13 10 7 8 1.6859786229353557 50.322421356116415 0.02610015869140625 4 0.9293324635437159 4.61488682667986 1393.0 5.161122544896848 1.0 - - - - - - - 150.27272727272728 2 22 PLAGL2 pleiomorphic adenoma gene-like 2 1761 224 C20140704_OR005_04 C20140704_OR005_04 TB412694.[MT7]-SHSQELLK[MT7].3b5_1.heavy 410.575 / 713.333 1858.0 20.38742446899414 38 13 10 7 8 1.6859786229353557 50.322421356116415 0.02610015869140625 4 0.9293324635437159 4.61488682667986 1858.0 35.237931034482756 0.0 - - - - - - - 120.46153846153847 3 13 PLAGL2 pleiomorphic adenoma gene-like 2 1763 224 C20140704_OR005_04 C20140704_OR005_04 TB412694.[MT7]-SHSQELLK[MT7].3y4_1.heavy 410.575 / 646.426 2729.0 20.38742446899414 38 13 10 7 8 1.6859786229353557 50.322421356116415 0.02610015869140625 4 0.9293324635437159 4.61488682667986 2729.0 44.55882944774399 2.0 - - - - - - - 194.71428571428572 7 14 PLAGL2 pleiomorphic adenoma gene-like 2 1765 225 C20140704_OR005_04 C20140704_OR005_04 TB426803.[MT7]-ASAPESGLLSK[MT7].3b6_1.heavy 449.929 / 687.343 496.0 28.12367534637451 38 14 10 6 8 2.623190537776075 38.121515978316765 0.035900115966796875 4 0.9362245525168797 4.860713579860018 496.0 1.7535353535353535 13.0 - - - - - - - 236.3846153846154 5 13 ISOC1 isochorismatase domain containing 1 1767 225 C20140704_OR005_04 C20140704_OR005_04 TB426803.[MT7]-ASAPESGLLSK[MT7].3y3_1.heavy 449.929 / 491.331 7839.0 28.12367534637451 38 14 10 6 8 2.623190537776075 38.121515978316765 0.035900115966796875 4 0.9362245525168797 4.860713579860018 7839.0 30.282760228593926 0.0 - - - - - - - 185.875 15 8 ISOC1 isochorismatase domain containing 1 1769 225 C20140704_OR005_04 C20140704_OR005_04 TB426803.[MT7]-ASAPESGLLSK[MT7].3b5_1.heavy 449.929 / 600.311 1687.0 28.12367534637451 38 14 10 6 8 2.623190537776075 38.121515978316765 0.035900115966796875 4 0.9362245525168797 4.860713579860018 1687.0 7.434676739901305 1.0 - - - - - - - 235.625 3 8 ISOC1 isochorismatase domain containing 1 1771 225 C20140704_OR005_04 C20140704_OR005_04 TB426803.[MT7]-ASAPESGLLSK[MT7].3b7_1.heavy 449.929 / 744.364 2282.0 28.12367534637451 38 14 10 6 8 2.623190537776075 38.121515978316765 0.035900115966796875 4 0.9362245525168797 4.860713579860018 2282.0 14.127329672564573 0.0 - - - - - - - 198.33333333333334 4 9 ISOC1 isochorismatase domain containing 1 1773 226 C20140704_OR005_04 C20140704_OR005_04 TB427147.[MT7]-YFGDIISVGQR.2y9_1.heavy 699.879 / 944.516 4578.0 39.463199615478516 44 14 10 10 10 3.8454213552605445 26.004952581646165 0.0 3 0.9395822561196101 4.995384194276184 4578.0 69.03919354838709 0.0 - - - - - - - 247.5 9 4 ISOC1 isochorismatase domain containing 1 1775 226 C20140704_OR005_04 C20140704_OR005_04 TB427147.[MT7]-YFGDIISVGQR.2b4_1.heavy 699.879 / 627.289 11507.0 39.463199615478516 44 14 10 10 10 3.8454213552605445 26.004952581646165 0.0 3 0.9395822561196101 4.995384194276184 11507.0 26.57103121282105 0.0 - - - - - - - 309.25 23 8 ISOC1 isochorismatase domain containing 1 1777 226 C20140704_OR005_04 C20140704_OR005_04 TB427147.[MT7]-YFGDIISVGQR.2y10_1.heavy 699.879 / 1091.58 13363.0 39.463199615478516 44 14 10 10 10 3.8454213552605445 26.004952581646165 0.0 3 0.9395822561196101 4.995384194276184 13363.0 34.54959481731695 0.0 - - - - - - - 232.0 26 8 ISOC1 isochorismatase domain containing 1 1779 226 C20140704_OR005_04 C20140704_OR005_04 TB427147.[MT7]-YFGDIISVGQR.2y7_1.heavy 699.879 / 772.468 4454.0 39.463199615478516 44 14 10 10 10 3.8454213552605445 26.004952581646165 0.0 3 0.9395822561196101 4.995384194276184 4454.0 32.861184689954875 1.0 - - - - - - - 176.71428571428572 9 7 ISOC1 isochorismatase domain containing 1 1781 227 C20140704_OR005_04 C20140704_OR005_04 TB412870.[MT7]-SNINEFLDIAR.3y6_1.heavy 479.26 / 734.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1783 227 C20140704_OR005_04 C20140704_OR005_04 TB412870.[MT7]-SNINEFLDIAR.3b4_1.heavy 479.26 / 573.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1785 227 C20140704_OR005_04 C20140704_OR005_04 TB412870.[MT7]-SNINEFLDIAR.3b5_1.heavy 479.26 / 702.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1787 227 C20140704_OR005_04 C20140704_OR005_04 TB412870.[MT7]-SNINEFLDIAR.3y5_1.heavy 479.26 / 587.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - MSH4 mutS homolog 4 (E. coli) 1789 228 C20140704_OR005_04 C20140704_OR005_04 TB426805.[MT7]-VVHYEI.2b3_1.heavy 452.256 / 480.305 40328.0 30.797275066375732 46 20 10 6 10 24.039382830056333 4.159840571072001 0.03650093078613281 3 0.9990351377636794 39.727825039916695 40328.0 104.54723287312699 0.0 - - - - - - - 296.0 80 4 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1791 228 C20140704_OR005_04 C20140704_OR005_04 TB426805.[MT7]-VVHYEI.2b3_2.heavy 452.256 / 240.656 7888.0 30.797275066375732 46 20 10 6 10 24.039382830056333 4.159840571072001 0.03650093078613281 3 0.9990351377636794 39.727825039916695 7888.0 87.69616161616162 0.0 - - - - - - - 312.3333333333333 15 6 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1793 228 C20140704_OR005_04 C20140704_OR005_04 TB426805.[MT7]-VVHYEI.2b4_1.heavy 452.256 / 643.368 2859.0 30.797275066375732 46 20 10 6 10 24.039382830056333 4.159840571072001 0.03650093078613281 3 0.9990351377636794 39.727825039916695 2859.0 24.236192893401014 0.0 - - - - - - - 172.5 5 4 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1795 228 C20140704_OR005_04 C20140704_OR005_04 TB426805.[MT7]-VVHYEI.2b5_1.heavy 452.256 / 772.411 986.0 30.797275066375732 46 20 10 6 10 24.039382830056333 4.159840571072001 0.03650093078613281 3 0.9990351377636794 39.727825039916695 986.0 2.002030456852792 0.0 - - - - - - - 0.0 1 0 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 1797 229 C20140704_OR005_04 C20140704_OR005_04 TB427148.[MT7]-GHTGGHHSPVK[MT7].2y4_1.heavy 701.383 / 574.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 1799 229 C20140704_OR005_04 C20140704_OR005_04 TB427148.[MT7]-GHTGGHHSPVK[MT7].2y5_1.heavy 701.383 / 711.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 1801 229 C20140704_OR005_04 C20140704_OR005_04 TB427148.[MT7]-GHTGGHHSPVK[MT7].2b6_1.heavy 701.383 / 691.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 1803 229 C20140704_OR005_04 C20140704_OR005_04 TB427148.[MT7]-GHTGGHHSPVK[MT7].2b5_1.heavy 701.383 / 554.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCLY selenocysteine lyase 1805 230 C20140704_OR005_04 C20140704_OR005_04 TB426809.[MT7]-GFAVSER.2y4_1.heavy 455.249 / 490.262 702.0 23.636699676513672 39 15 6 10 8 2.0013385788971028 39.83711737986534 0.0 4 0.9516323186758251 5.58879935615546 702.0 10.167231247839613 5.0 - - - - - - - 0.0 1 0 ISOC1 isochorismatase domain containing 1 1807 230 C20140704_OR005_04 C20140704_OR005_04 TB426809.[MT7]-GFAVSER.2y5_1.heavy 455.249 / 561.299 1053.0 23.636699676513672 39 15 6 10 8 2.0013385788971028 39.83711737986534 0.0 4 0.9516323186758251 5.58879935615546 1053.0 11.023195644659523 0.0 - - - - - - - 253.44444444444446 2 9 ISOC1 isochorismatase domain containing 1 1809 230 C20140704_OR005_04 C20140704_OR005_04 TB426809.[MT7]-GFAVSER.2b4_1.heavy 455.249 / 519.305 1842.0 23.636699676513672 39 15 6 10 8 2.0013385788971028 39.83711737986534 0.0 4 0.9516323186758251 5.58879935615546 1842.0 23.734930867611478 1.0 - - - - - - - 263.25 5 8 ISOC1 isochorismatase domain containing 1 1811 230 C20140704_OR005_04 C20140704_OR005_04 TB426809.[MT7]-GFAVSER.2y6_1.heavy 455.249 / 708.367 2017.0 23.636699676513672 39 15 6 10 8 2.0013385788971028 39.83711737986534 0.0 4 0.9516323186758251 5.58879935615546 2017.0 31.92098961038961 0.0 - - - - - - - 164.375 4 8 ISOC1 isochorismatase domain containing 1 1813 231 C20140704_OR005_04 C20140704_OR005_04 TB427009.[MT7]-TAQNRPVQR.2b8_1.heavy 607.348 / 1039.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKNOX1 PBX/knotted 1 homeobox 1 1815 231 C20140704_OR005_04 C20140704_OR005_04 TB427009.[MT7]-TAQNRPVQR.2b4_1.heavy 607.348 / 559.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKNOX1 PBX/knotted 1 homeobox 1 1817 231 C20140704_OR005_04 C20140704_OR005_04 TB427009.[MT7]-TAQNRPVQR.2b6_1.heavy 607.348 / 812.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKNOX1 PBX/knotted 1 homeobox 1 1819 231 C20140704_OR005_04 C20140704_OR005_04 TB427009.[MT7]-TAQNRPVQR.2b5_1.heavy 607.348 / 715.397 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKNOX1 PBX/knotted 1 homeobox 1 1821 232 C20140704_OR005_04 C20140704_OR005_04 TB427140.[MT7]-MPIVGLGTWK[MT7].2y4_1.heavy 695.412 / 635.363 8273.0 41.58430099487305 45 15 10 10 10 3.580954346628715 27.925516585863452 0.0 3 0.9594501185172011 6.107858854491768 8273.0 29.68824421951545 0.0 - - - - - - - 213.45454545454547 16 11 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1823 232 C20140704_OR005_04 C20140704_OR005_04 TB427140.[MT7]-MPIVGLGTWK[MT7].2y9_1.heavy 695.412 / 1114.67 23143.0 41.58430099487305 45 15 10 10 10 3.580954346628715 27.925516585863452 0.0 3 0.9594501185172011 6.107858854491768 23143.0 164.80752052238807 0.0 - - - - - - - 287.42857142857144 46 7 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1825 232 C20140704_OR005_04 C20140704_OR005_04 TB427140.[MT7]-MPIVGLGTWK[MT7].2y6_1.heavy 695.412 / 805.469 13305.0 41.58430099487305 45 15 10 10 10 3.580954346628715 27.925516585863452 0.0 3 0.9594501185172011 6.107858854491768 13305.0 83.21737476030681 0.0 - - - - - - - 223.88888888888889 26 9 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1827 232 C20140704_OR005_04 C20140704_OR005_04 TB427140.[MT7]-MPIVGLGTWK[MT7].2y7_1.heavy 695.412 / 904.537 9839.0 41.58430099487305 45 15 10 10 10 3.580954346628715 27.925516585863452 0.0 3 0.9594501185172011 6.107858854491768 9839.0 36.40585386035545 0.0 - - - - - - - 236.11111111111111 19 9 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1829 233 C20140704_OR005_04 C20140704_OR005_04 TB413276.[MT7]-SGASSLWDPASPAPTSGPRPR.3b6_1.heavy 746.718 / 647.348 2048.0 30.687925338745117 37 14 10 3 10 3.4556719813169923 28.937931765702185 0.07289886474609375 3 0.9453421723901978 5.254579021609709 2048.0 10.525863306204602 0.0 - - - - - - - 292.85714285714283 4 14 PHF1 PHD finger protein 1 1831 233 C20140704_OR005_04 C20140704_OR005_04 TB413276.[MT7]-SGASSLWDPASPAPTSGPRPR.3b5_1.heavy 746.718 / 534.264 1853.0 30.687925338745117 37 14 10 3 10 3.4556719813169923 28.937931765702185 0.07289886474609375 3 0.9453421723901978 5.254579021609709 1853.0 11.839419152276296 0.0 - - - - - - - 210.30769230769232 3 13 PHF1 PHD finger protein 1 1833 233 C20140704_OR005_04 C20140704_OR005_04 TB413276.[MT7]-SGASSLWDPASPAPTSGPRPR.3b8_1.heavy 746.718 / 948.454 3999.0 30.687925338745117 37 14 10 3 10 3.4556719813169923 28.937931765702185 0.07289886474609375 3 0.9453421723901978 5.254579021609709 3999.0 59.87827629513344 0.0 - - - - - - - 219.5 7 8 PHF1 PHD finger protein 1 1835 233 C20140704_OR005_04 C20140704_OR005_04 TB413276.[MT7]-SGASSLWDPASPAPTSGPRPR.3y13_2.heavy 746.718 / 645.849 9656.0 30.687925338745117 37 14 10 3 10 3.4556719813169923 28.937931765702185 0.07289886474609375 3 0.9453421723901978 5.254579021609709 9656.0 47.53723076923077 1.0 - - - - - - - 158.625 19 8 PHF1 PHD finger protein 1 1837 234 C20140704_OR005_04 C20140704_OR005_04 TB427143.[MT7]-REDLFIVSK[MT7].2b3_1.heavy 697.916 / 545.28 2444.0 31.72209930419922 40 16 10 10 4 2.158381297261556 46.331016733176334 0.0 9 0.968448013505867 6.929476849568547 2444.0 10.196579467167702 0.0 - - - - - - - 203.88888888888889 4 9 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1839 234 C20140704_OR005_04 C20140704_OR005_04 TB427143.[MT7]-REDLFIVSK[MT7].2b4_1.heavy 697.916 / 658.364 407.0 31.72209930419922 40 16 10 10 4 2.158381297261556 46.331016733176334 0.0 9 0.968448013505867 6.929476849568547 407.0 0.31984282907662087 30.0 - - - - - - - 243.0 2 13 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1841 234 C20140704_OR005_04 C20140704_OR005_04 TB427143.[MT7]-REDLFIVSK[MT7].2b6_1.heavy 697.916 / 918.516 1528.0 31.72209930419922 40 16 10 10 4 2.158381297261556 46.331016733176334 0.0 9 0.968448013505867 6.929476849568547 1528.0 10.757541070482246 0.0 - - - - - - - 185.36363636363637 3 11 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1843 234 C20140704_OR005_04 C20140704_OR005_04 TB427143.[MT7]-REDLFIVSK[MT7].2b5_1.heavy 697.916 / 805.432 509.0 31.72209930419922 40 16 10 10 4 2.158381297261556 46.331016733176334 0.0 9 0.968448013505867 6.929476849568547 509.0 0.97 14.0 - - - - - - - 0.0 1 0 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 1845 235 C20140704_OR005_04 C20140704_OR005_04 TB451158.[MT7]-LRTEVIQLEDTLAQVRK[MT7].3b6_1.heavy 767.456 / 856.537 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF20;RNF40 ring finger protein 20;ring finger protein 40 1847 235 C20140704_OR005_04 C20140704_OR005_04 TB451158.[MT7]-LRTEVIQLEDTLAQVRK[MT7].3b4_1.heavy 767.456 / 644.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF20;RNF40 ring finger protein 20;ring finger protein 40 1849 235 C20140704_OR005_04 C20140704_OR005_04 TB451158.[MT7]-LRTEVIQLEDTLAQVRK[MT7].3b5_1.heavy 767.456 / 743.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF20;RNF40 ring finger protein 20;ring finger protein 40 1851 235 C20140704_OR005_04 C20140704_OR005_04 TB451158.[MT7]-LRTEVIQLEDTLAQVRK[MT7].3y5_1.heavy 767.456 / 745.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - RNF20;RNF40 ring finger protein 20;ring finger protein 40 1853 236 C20140704_OR005_04 C20140704_OR005_04 TB426932.[MT7]-FQLSGQK[MT7].2b3_1.heavy 548.324 / 533.32 4585.0 26.34830093383789 50 20 10 10 10 26.123469021601714 3.827975523362122 0.0 3 0.9987659312209156 35.12756245698443 4585.0 12.149751168752829 0.0 - - - - - - - 316.90909090909093 9 11 PSG8;PSG3;PSG4;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1855 236 C20140704_OR005_04 C20140704_OR005_04 TB426932.[MT7]-FQLSGQK[MT7].2y4_1.heavy 548.324 / 563.327 14950.0 26.34830093383789 50 20 10 10 10 26.123469021601714 3.827975523362122 0.0 3 0.9987659312209156 35.12756245698443 14950.0 50.51524812532836 0.0 - - - - - - - 299.0 29 7 PSG8;PSG3;PSG4;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1857 236 C20140704_OR005_04 C20140704_OR005_04 TB426932.[MT7]-FQLSGQK[MT7].2y5_1.heavy 548.324 / 676.411 9169.0 26.34830093383789 50 20 10 10 10 26.123469021601714 3.827975523362122 0.0 3 0.9987659312209156 35.12756245698443 9169.0 45.83850033868402 0.0 - - - - - - - 299.0 18 9 PSG8;PSG3;PSG4;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1859 236 C20140704_OR005_04 C20140704_OR005_04 TB426932.[MT7]-FQLSGQK[MT7].2y6_1.heavy 548.324 / 804.47 6478.0 26.34830093383789 50 20 10 10 10 26.123469021601714 3.827975523362122 0.0 3 0.9987659312209156 35.12756245698443 6478.0 45.86186748277729 0.0 - - - - - - - 282.5 12 6 PSG8;PSG3;PSG4;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1861 237 C20140704_OR005_04 C20140704_OR005_04 TB427533.[MT7]-VAAGLPPILVHTDAAQALGK[MT7].3b5_1.heavy 744.11 / 556.357 22523.0 39.63800048828125 48 18 10 10 10 4.783773207403977 20.904001018532245 0.0 3 0.9808062378752983 8.8937560510275 22523.0 75.80912195121951 0.0 - - - - - - - 307.5 45 8 SCLY selenocysteine lyase 1863 237 C20140704_OR005_04 C20140704_OR005_04 TB427533.[MT7]-VAAGLPPILVHTDAAQALGK[MT7].3y4_1.heavy 744.11 / 532.357 6277.0 39.63800048828125 48 18 10 10 10 4.783773207403977 20.904001018532245 0.0 3 0.9808062378752983 8.8937560510275 6277.0 26.238530171844644 0.0 - - - - - - - 333.85714285714283 12 7 SCLY selenocysteine lyase 1865 237 C20140704_OR005_04 C20140704_OR005_04 TB427533.[MT7]-VAAGLPPILVHTDAAQALGK[MT7].3y10_1.heavy 744.11 / 1155.62 2585.0 39.63800048828125 48 18 10 10 10 4.783773207403977 20.904001018532245 0.0 3 0.9808062378752983 8.8937560510275 2585.0 2.3864335261963365 1.0 - - - - - - - 298.7142857142857 7 7 SCLY selenocysteine lyase 1867 237 C20140704_OR005_04 C20140704_OR005_04 TB427533.[MT7]-VAAGLPPILVHTDAAQALGK[MT7].3y9_1.heavy 744.11 / 1018.56 9846.0 39.63800048828125 48 18 10 10 10 4.783773207403977 20.904001018532245 0.0 3 0.9808062378752983 8.8937560510275 9846.0 77.44719512195121 0.0 - - - - - - - 229.6 19 15 SCLY selenocysteine lyase 1869 238 C20140704_OR005_04 C20140704_OR005_04 TB451144.[MT7]-NPQIILSQFADNTTYAK[MT7].3b6_1.heavy 738.067 / 823.516 4010.0 41.420799255371094 41 18 10 3 10 7.063809643991578 14.156666875226348 0.07939910888671875 3 0.9845697653860512 9.92238512665564 4010.0 -0.31994680851063784 0.0 - - - - - - - 268.57142857142856 8 7 MSH4 mutS homolog 4 (E. coli) 1871 238 C20140704_OR005_04 C20140704_OR005_04 TB451144.[MT7]-NPQIILSQFADNTTYAK[MT7].3y3_1.heavy 738.067 / 525.315 5388.0 41.420799255371094 41 18 10 3 10 7.063809643991578 14.156666875226348 0.07939910888671875 3 0.9845697653860512 9.92238512665564 5388.0 -1.0030851063829793 0.0 - - - - - - - 250.75 10 4 MSH4 mutS homolog 4 (E. coli) 1873 238 C20140704_OR005_04 C20140704_OR005_04 TB451144.[MT7]-NPQIILSQFADNTTYAK[MT7].3b4_1.heavy 738.067 / 597.348 12907.0 41.420799255371094 41 18 10 3 10 7.063809643991578 14.156666875226348 0.07939910888671875 3 0.9845697653860512 9.92238512665564 12907.0 -0.9366473149492016 0.0 - - - - - - - 125.0 25 2 MSH4 mutS homolog 4 (E. coli) 1875 238 C20140704_OR005_04 C20140704_OR005_04 TB451144.[MT7]-NPQIILSQFADNTTYAK[MT7].3b5_1.heavy 738.067 / 710.432 9649.0 41.420799255371094 41 18 10 3 10 7.063809643991578 14.156666875226348 0.07939910888671875 3 0.9845697653860512 9.92238512665564 9649.0 -0.19221115537848732 0.0 - - - - - - - 175.4 19 5 MSH4 mutS homolog 4 (E. coli) 1877 239 C20140704_OR005_04 C20140704_OR005_04 TB427532.[MT7]-QHVSVPEFVTQLIDDPFIPGLLSNTGLVR.3y7_1.heavy 1112.61 / 746.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBQLN3 ubiquilin 3 1879 239 C20140704_OR005_04 C20140704_OR005_04 TB427532.[MT7]-QHVSVPEFVTQLIDDPFIPGLLSNTGLVR.3y11_1.heavy 1112.61 / 1126.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBQLN3 ubiquilin 3 1881 239 C20140704_OR005_04 C20140704_OR005_04 TB427532.[MT7]-QHVSVPEFVTQLIDDPFIPGLLSNTGLVR.3b5_1.heavy 1112.61 / 695.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBQLN3 ubiquilin 3 1883 239 C20140704_OR005_04 C20140704_OR005_04 TB427532.[MT7]-QHVSVPEFVTQLIDDPFIPGLLSNTGLVR.3b3_1.heavy 1112.61 / 509.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBQLN3 ubiquilin 3 1885 240 C20140704_OR005_04 C20140704_OR005_04 TB450981.[MT7]-SLPQSVIENVGGK[MT7].3b6_1.heavy 539.313 / 756.437 9903.0 34.43020057678223 41 16 10 5 10 1.8119653638681616 38.33963936113782 0.04000091552734375 3 0.9633043821106245 6.422708070822797 9903.0 26.1868159198257 0.0 - - - - - - - 277.6666666666667 19 3 PAPOLB poly(A) polymerase beta (testis specific) 1887 240 C20140704_OR005_04 C20140704_OR005_04 TB450981.[MT7]-SLPQSVIENVGGK[MT7].3b4_1.heavy 539.313 / 570.337 9799.0 34.43020057678223 41 16 10 5 10 1.8119653638681616 38.33963936113782 0.04000091552734375 3 0.9633043821106245 6.422708070822797 9799.0 15.280534004679456 1.0 - - - - - - - 286.625 19 8 PAPOLB poly(A) polymerase beta (testis specific) 1889 240 C20140704_OR005_04 C20140704_OR005_04 TB450981.[MT7]-SLPQSVIENVGGK[MT7].3b5_1.heavy 539.313 / 657.369 10216.0 34.43020057678223 41 16 10 5 10 1.8119653638681616 38.33963936113782 0.04000091552734375 3 0.9633043821106245 6.422708070822797 10216.0 15.486756238003839 1.0 - - - - - - - 273.625 20 8 PAPOLB poly(A) polymerase beta (testis specific) 1891 240 C20140704_OR005_04 C20140704_OR005_04 TB450981.[MT7]-SLPQSVIENVGGK[MT7].3y4_1.heavy 539.313 / 504.326 13760.0 34.43020057678223 41 16 10 5 10 1.8119653638681616 38.33963936113782 0.04000091552734375 3 0.9633043821106245 6.422708070822797 13760.0 18.803244469245584 0.0 - - - - - - - 243.0 27 6 PAPOLB poly(A) polymerase beta (testis specific) 1893 241 C20140704_OR005_04 C20140704_OR005_04 TB427438.[MT7]-ENFNNVPDLELNPIR.2b4_1.heavy 964.503 / 649.306 6321.0 39.375 41 11 10 10 10 1.3925190463601185 63.38456018165849 0.0 3 0.8606290152378617 3.2666162044959677 6321.0 21.613741935483873 0.0 - - - - - - - 268.6666666666667 12 12 TESC tescalcin 1895 241 C20140704_OR005_04 C20140704_OR005_04 TB427438.[MT7]-ENFNNVPDLELNPIR.2y9_1.heavy 964.503 / 1066.59 59617.0 39.375 41 11 10 10 10 1.3925190463601185 63.38456018165849 0.0 3 0.8606290152378617 3.2666162044959677 59617.0 53.40954141085077 0.0 - - - - - - - 223.2 119 5 TESC tescalcin 1897 241 C20140704_OR005_04 C20140704_OR005_04 TB427438.[MT7]-ENFNNVPDLELNPIR.2b5_1.heavy 964.503 / 763.349 12270.0 39.375 41 11 10 10 10 1.3925190463601185 63.38456018165849 0.0 3 0.8606290152378617 3.2666162044959677 12270.0 59.229608294930884 0.0 - - - - - - - 248.0 24 10 TESC tescalcin 1899 241 C20140704_OR005_04 C20140704_OR005_04 TB427438.[MT7]-ENFNNVPDLELNPIR.2y7_1.heavy 964.503 / 854.509 7561.0 39.375 41 11 10 10 10 1.3925190463601185 63.38456018165849 0.0 3 0.8606290152378617 3.2666162044959677 7561.0 24.74280121529832 0.0 - - - - - - - 294.5 15 8 TESC tescalcin 1901 242 C20140704_OR005_04 C20140704_OR005_04 TB450881.[MT7]-SNINEFLDIAR.2y8_1.heavy 718.387 / 977.505 2809.0 40.33272361755371 31 14 10 5 2 3.419488535590847 29.24413957209574 0.04290008544921875 11 0.9451625134702768 5.245884264583007 2809.0 -3.5222570532915363 0.0 - - - - - - - 191.5 5 2 MSH4 mutS homolog 4 (E. coli) 1903 242 C20140704_OR005_04 C20140704_OR005_04 TB450881.[MT7]-SNINEFLDIAR.2b4_1.heavy 718.387 / 573.311 766.0 40.33272361755371 31 14 10 5 2 3.419488535590847 29.24413957209574 0.04290008544921875 11 0.9451625134702768 5.245884264583007 766.0 1.7999999999999998 15.0 - - - - - - - 200.71428571428572 2 7 MSH4 mutS homolog 4 (E. coli) 1905 242 C20140704_OR005_04 C20140704_OR005_04 TB450881.[MT7]-SNINEFLDIAR.2y6_1.heavy 718.387 / 734.42 894.0 40.33272361755371 31 14 10 5 2 3.419488535590847 29.24413957209574 0.04290008544921875 11 0.9451625134702768 5.245884264583007 894.0 -0.006984375000000043 5.0 - - - - - - - 191.75 6 4 MSH4 mutS homolog 4 (E. coli) 1907 242 C20140704_OR005_04 C20140704_OR005_04 TB450881.[MT7]-SNINEFLDIAR.2y10_1.heavy 718.387 / 1204.63 383.0 40.33272361755371 31 14 10 5 2 3.419488535590847 29.24413957209574 0.04290008544921875 11 0.9451625134702768 5.245884264583007 383.0 0.0 6.0 - - - - - - - 0.0 1 0 MSH4 mutS homolog 4 (E. coli) 1909 243 C20140704_OR005_04 C20140704_OR005_04 TB427530.[MT7]-GLGEFTPLYPMLFGGGQER.2b4_1.heavy 1107.06 / 501.279 6627.0 50.47079849243164 44 14 10 10 10 2.0771963671504374 38.329396176728274 0.0 3 0.9388075463585923 4.9633343797817036 6627.0 43.097207093948555 0.0 - - - - - - - 192.28571428571428 13 7 SCLY selenocysteine lyase 1911 243 C20140704_OR005_04 C20140704_OR005_04 TB427530.[MT7]-GLGEFTPLYPMLFGGGQER.2y10_1.heavy 1107.06 / 1091.53 11152.0 50.47079849243164 44 14 10 10 10 2.0771963671504374 38.329396176728274 0.0 3 0.9388075463585923 4.9633343797817036 11152.0 59.471349993019686 0.0 - - - - - - - 202.08333333333334 22 12 SCLY selenocysteine lyase 1913 243 C20140704_OR005_04 C20140704_OR005_04 TB427530.[MT7]-GLGEFTPLYPMLFGGGQER.2b5_1.heavy 1107.06 / 648.347 6088.0 50.47079849243164 44 14 10 10 10 2.0771963671504374 38.329396176728274 0.0 3 0.9388075463585923 4.9633343797817036 6088.0 62.22794578727125 0.0 - - - - - - - 182.0 12 8 SCLY selenocysteine lyase 1915 243 C20140704_OR005_04 C20140704_OR005_04 TB427530.[MT7]-GLGEFTPLYPMLFGGGQER.2b9_1.heavy 1107.06 / 1122.6 2532.0 50.47079849243164 44 14 10 10 10 2.0771963671504374 38.329396176728274 0.0 3 0.9388075463585923 4.9633343797817036 2532.0 11.03379863833883 1.0 - - - - - - - 116.83333333333333 6 12 SCLY selenocysteine lyase 1917 244 C20140704_OR005_04 C20140704_OR005_04 TB427292.[MT7]-NSYSFTSADLIK[MT7].3y3_1.heavy 545.294 / 517.383 N/A 35.608299255371094 28 14 0 10 4 1.68294726749576 51.8447930963216 0.0 8 0.9398829876380093 5.007991500602299 3591.0 0.4784291149379254 10.0 - - - - - - - 464.25 9 4 MSH4 mutS homolog 4 (E. coli) 1919 244 C20140704_OR005_04 C20140704_OR005_04 TB427292.[MT7]-NSYSFTSADLIK[MT7].3b4_1.heavy 545.294 / 596.28 2724.0 35.608299255371094 28 14 0 10 4 1.68294726749576 51.8447930963216 0.0 8 0.9398829876380093 5.007991500602299 2724.0 9.512260296908138 1.0 - - - - - - - 322.1 5 10 MSH4 mutS homolog 4 (E. coli) 1921 244 C20140704_OR005_04 C20140704_OR005_04 TB427292.[MT7]-NSYSFTSADLIK[MT7].3b5_1.heavy 545.294 / 743.348 743.0 35.608299255371094 28 14 0 10 4 1.68294726749576 51.8447930963216 0.0 8 0.9398829876380093 5.007991500602299 743.0 3.0238090583251873 7.0 - - - - - - - 326.72727272727275 3 11 MSH4 mutS homolog 4 (E. coli) 1923 244 C20140704_OR005_04 C20140704_OR005_04 TB427292.[MT7]-NSYSFTSADLIK[MT7].3b3_1.heavy 545.294 / 509.248 3468.0 35.608299255371094 28 14 0 10 4 1.68294726749576 51.8447930963216 0.0 8 0.9398829876380093 5.007991500602299 3468.0 4.433950235837204 1.0 - - - - - - - 357.77777777777777 28 9 MSH4 mutS homolog 4 (E. coli) 1925 245 C20140704_OR005_04 C20140704_OR005_04 TB427013.[MT7]-QAVAQLEDQA.2b4_1.heavy 608.818 / 514.311 19678.0 28.57819938659668 43 13 10 10 10 1.101213895201424 59.81972774672245 0.0 3 0.9053088781923244 3.978502707447258 19678.0 44.015184890056645 0.0 - - - - - - - 188.33333333333334 39 12 SCLY selenocysteine lyase 1927 245 C20140704_OR005_04 C20140704_OR005_04 TB427013.[MT7]-QAVAQLEDQA.2b6_1.heavy 608.818 / 755.453 20268.0 28.57819938659668 43 13 10 10 10 1.101213895201424 59.81972774672245 0.0 3 0.9053088781923244 3.978502707447258 20268.0 162.6706227307924 0.0 - - - - - - - 285.3 40 10 SCLY selenocysteine lyase 1929 245 C20140704_OR005_04 C20140704_OR005_04 TB427013.[MT7]-QAVAQLEDQA.2b7_1.heavy 608.818 / 884.496 17021.0 28.57819938659668 43 13 10 10 10 1.101213895201424 59.81972774672245 0.0 3 0.9053088781923244 3.978502707447258 17021.0 199.53344659691288 0.0 - - - - - - - 234.6153846153846 34 13 SCLY selenocysteine lyase 1931 245 C20140704_OR005_04 C20140704_OR005_04 TB427013.[MT7]-QAVAQLEDQA.2b5_1.heavy 608.818 / 642.369 45358.0 28.57819938659668 43 13 10 10 10 1.101213895201424 59.81972774672245 0.0 3 0.9053088781923244 3.978502707447258 45358.0 169.11045567400708 0.0 - - - - - - - 275.6 90 10 SCLY selenocysteine lyase 1933 246 C20140704_OR005_04 C20140704_OR005_04 TB450709.[MT7]-MFEMGMK[MT7].2b3_1.heavy 581.289 / 552.261 4749.0 34.340200424194336 35 9 10 6 10 0.6651655355297998 86.31237079880236 0.039997100830078125 3 0.8064821846918911 2.7588978402270175 4749.0 7.952132701421801 0.0 - - - - - - - 255.16666666666666 9 12 PAPOLB poly(A) polymerase beta (testis specific) 1935 246 C20140704_OR005_04 C20140704_OR005_04 TB450709.[MT7]-MFEMGMK[MT7].2y4_1.heavy 581.289 / 610.317 1689.0 34.340200424194336 35 9 10 6 10 0.6651655355297998 86.31237079880236 0.039997100830078125 3 0.8064821846918911 2.7588978402270175 1689.0 3.1968454258675076 1.0 - - - - - - - 316.75 3 8 PAPOLB poly(A) polymerase beta (testis specific) 1937 246 C20140704_OR005_04 C20140704_OR005_04 TB450709.[MT7]-MFEMGMK[MT7].2y5_1.heavy 581.289 / 739.36 1583.0 34.340200424194336 35 9 10 6 10 0.6651655355297998 86.31237079880236 0.039997100830078125 3 0.8064821846918911 2.7588978402270175 1583.0 5.246925411514942 0.0 - - - - - - - 255.25 3 12 PAPOLB poly(A) polymerase beta (testis specific) 1939 246 C20140704_OR005_04 C20140704_OR005_04 TB450709.[MT7]-MFEMGMK[MT7].2y6_1.heavy 581.289 / 886.428 2216.0 34.340200424194336 35 9 10 6 10 0.6651655355297998 86.31237079880236 0.039997100830078125 3 0.8064821846918911 2.7588978402270175 2216.0 5.931293375394322 1.0 - - - - - - - 211.14285714285714 4 7 PAPOLB poly(A) polymerase beta (testis specific) 1941 247 C20140704_OR005_04 C20140704_OR005_04 TB427157.[MT7]-GEIGMASIDLK[MT7].2y8_1.heavy 711.399 / 978.541 2096.0 35.1598014831543 45 15 10 10 10 2.9449115052051105 33.95687776126743 0.0 3 0.9516226989898953 5.588239109423031 2096.0 3.228858066991941 1.0 - - - - - - - 291.54545454545456 4 11 MSH4 mutS homolog 4 (E. coli) 1943 247 C20140704_OR005_04 C20140704_OR005_04 TB427157.[MT7]-GEIGMASIDLK[MT7].2y5_1.heavy 711.399 / 719.442 986.0 35.1598014831543 45 15 10 10 10 2.9449115052051105 33.95687776126743 0.0 3 0.9516226989898953 5.588239109423031 986.0 1.7587701771912296 4.0 - - - - - - - 0.0 1 0 MSH4 mutS homolog 4 (E. coli) 1945 247 C20140704_OR005_04 C20140704_OR005_04 TB427157.[MT7]-GEIGMASIDLK[MT7].2b4_1.heavy 711.399 / 501.279 2835.0 35.1598014831543 45 15 10 10 10 2.9449115052051105 33.95687776126743 0.0 3 0.9516226989898953 5.588239109423031 2835.0 5.751721134704711 0.0 - - - - - - - 332.0 5 13 MSH4 mutS homolog 4 (E. coli) 1947 247 C20140704_OR005_04 C20140704_OR005_04 TB427157.[MT7]-GEIGMASIDLK[MT7].2b6_1.heavy 711.399 / 703.357 1602.0 35.1598014831543 45 15 10 10 10 2.9449115052051105 33.95687776126743 0.0 3 0.9516226989898953 5.588239109423031 1602.0 14.971008569545152 3.0 - - - - - - - 277.375 3 8 MSH4 mutS homolog 4 (E. coli) 1949 248 C20140704_OR005_04 C20140704_OR005_04 TB450707.[MT7]-ILILPSVTR.2y8_1.heavy 578.383 / 898.572 40227.0 39.72480010986328 48 18 10 10 10 4.560582873649226 21.927021779999656 0.0 3 0.9820669756649396 9.20204682071587 40227.0 207.78210162938413 0.0 - - - - - - - 287.125 80 8 PSG8;PSG1;PSG3;PSG5;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1951 248 C20140704_OR005_04 C20140704_OR005_04 TB450707.[MT7]-ILILPSVTR.2y5_1.heavy 578.383 / 559.32 34863.0 39.72480010986328 48 18 10 10 10 4.560582873649226 21.927021779999656 0.0 3 0.9820669756649396 9.20204682071587 34863.0 153.67889340702723 0.0 - - - - - - - 255.2 69 5 PSG8;PSG1;PSG3;PSG5;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1953 248 C20140704_OR005_04 C20140704_OR005_04 TB450707.[MT7]-ILILPSVTR.2y6_1.heavy 578.383 / 672.404 22859.0 39.72480010986328 48 18 10 10 10 4.560582873649226 21.927021779999656 0.0 3 0.9820669756649396 9.20204682071587 22859.0 77.27919481587836 0.0 - - - - - - - 223.5 45 4 PSG8;PSG1;PSG3;PSG5;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1955 248 C20140704_OR005_04 C20140704_OR005_04 TB450707.[MT7]-ILILPSVTR.2y7_1.heavy 578.383 / 785.488 18773.0 39.72480010986328 48 18 10 10 10 4.560582873649226 21.927021779999656 0.0 3 0.9820669756649396 9.20204682071587 18773.0 210.74187898284313 0.0 - - - - - - - 207.5 37 8 PSG8;PSG1;PSG3;PSG5;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1957 249 C20140704_OR005_04 C20140704_OR005_04 TB413260.[MT7]-DISPAALPGEELLC[CAM]C[CAM]VC[CAM]R.2y8_1.heavy 1102.54 / 1109.49 528.0 43.36307430267334 35 14 10 5 6 2.295182889051578 33.725426200912 0.043498992919921875 5 0.9458651512809346 5.280134198549834 528.0 4.485379594026647 7.0 - - - - - - - 0.0 1 0 PHF1 PHD finger protein 1 1959 249 C20140704_OR005_04 C20140704_OR005_04 TB413260.[MT7]-DISPAALPGEELLC[CAM]C[CAM]VC[CAM]R.2b6_1.heavy 1102.54 / 699.379 2746.0 43.36307430267334 35 14 10 5 6 2.295182889051578 33.725426200912 0.043498992919921875 5 0.9458651512809346 5.280134198549834 2746.0 36.97265671107932 1.0 - - - - - - - 237.75 5 8 PHF1 PHD finger protein 1 1961 249 C20140704_OR005_04 C20140704_OR005_04 TB413260.[MT7]-DISPAALPGEELLC[CAM]C[CAM]VC[CAM]R.2b5_1.heavy 1102.54 / 628.342 1373.0 43.36307430267334 35 14 10 5 6 2.295182889051578 33.725426200912 0.043498992919921875 5 0.9458651512809346 5.280134198549834 1373.0 19.45993919341858 0.0 - - - - - - - 123.5 2 6 PHF1 PHD finger protein 1 1963 249 C20140704_OR005_04 C20140704_OR005_04 TB413260.[MT7]-DISPAALPGEELLC[CAM]C[CAM]VC[CAM]R.2y7_1.heavy 1102.54 / 980.447 739.0 43.36307430267334 35 14 10 5 6 2.295182889051578 33.725426200912 0.043498992919921875 5 0.9458651512809346 5.280134198549834 739.0 6.693886506575186 4.0 - - - - - - - 0.0 1 0 PHF1 PHD finger protein 1 1965 250 C20140704_OR005_04 C20140704_OR005_04 TB412883.[MT7]-ASAPESGLLSK[MT7]V.2y4_1.heavy 723.924 / 590.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 1967 250 C20140704_OR005_04 C20140704_OR005_04 TB412883.[MT7]-ASAPESGLLSK[MT7]V.2y9_1.heavy 723.924 / 1073.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 1969 250 C20140704_OR005_04 C20140704_OR005_04 TB412883.[MT7]-ASAPESGLLSK[MT7]V.2y6_1.heavy 723.924 / 760.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 1971 250 C20140704_OR005_04 C20140704_OR005_04 TB412883.[MT7]-ASAPESGLLSK[MT7]V.2y7_1.heavy 723.924 / 847.537 N/A N/A - - - - - - - - - 0.0 - - - - - - - ISOC1 isochorismatase domain containing 1 1973 251 C20140704_OR005_04 C20140704_OR005_04 TB427151.[MT7]-TMWVIGLGLK[MT7].3b6_1.heavy 469.288 / 832.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLB poly(A) polymerase beta (testis specific) 1975 251 C20140704_OR005_04 C20140704_OR005_04 TB427151.[MT7]-TMWVIGLGLK[MT7].3b4_1.heavy 469.288 / 662.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLB poly(A) polymerase beta (testis specific) 1977 251 C20140704_OR005_04 C20140704_OR005_04 TB427151.[MT7]-TMWVIGLGLK[MT7].3b3_1.heavy 469.288 / 563.277 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLB poly(A) polymerase beta (testis specific) 1979 251 C20140704_OR005_04 C20140704_OR005_04 TB427151.[MT7]-TMWVIGLGLK[MT7].3y5_1.heavy 469.288 / 631.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - PAPOLB poly(A) polymerase beta (testis specific) 1981 252 C20140704_OR005_04 C20140704_OR005_04 TB427018.[MT7]-SHSQELLK[MT7].2y4_1.heavy 615.358 / 646.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 1983 252 C20140704_OR005_04 C20140704_OR005_04 TB427018.[MT7]-SHSQELLK[MT7].2y3_1.heavy 615.358 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 1985 252 C20140704_OR005_04 C20140704_OR005_04 TB427018.[MT7]-SHSQELLK[MT7].2y6_1.heavy 615.358 / 861.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 1987 252 C20140704_OR005_04 C20140704_OR005_04 TB427018.[MT7]-SHSQELLK[MT7].2b5_1.heavy 615.358 / 713.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - PLAGL2 pleiomorphic adenoma gene-like 2 1989 253 C20140704_OR005_04 C20140704_OR005_04 TB426936.[MT7]-SETVVPGNR.2y8_1.heavy 551.802 / 871.463 2451.0 19.72257423400879 44 17 10 7 10 15.55163590040672 6.430191694327457 0.0251007080078125 3 0.9718044610035337 7.332404621011463 2451.0 10.498777173913043 1.0 - - - - - - - 164.07692307692307 4 13 PHF1 PHD finger protein 1 1991 253 C20140704_OR005_04 C20140704_OR005_04 TB426936.[MT7]-SETVVPGNR.2y5_1.heavy 551.802 / 542.305 2078.0 19.72257423400879 44 17 10 7 10 15.55163590040672 6.430191694327457 0.0251007080078125 3 0.9718044610035337 7.332404621011463 2078.0 2.685581251577335 0.0 - - - - - - - 208.22727272727272 4 22 PHF1 PHD finger protein 1 1993 253 C20140704_OR005_04 C20140704_OR005_04 TB426936.[MT7]-SETVVPGNR.2b4_1.heavy 551.802 / 561.3 1865.0 19.72257423400879 44 17 10 7 10 15.55163590040672 6.430191694327457 0.0251007080078125 3 0.9718044610035337 7.332404621011463 1865.0 15.976542289865744 1.0 - - - - - - - 148.35714285714286 3 14 PHF1 PHD finger protein 1 1995 253 C20140704_OR005_04 C20140704_OR005_04 TB426936.[MT7]-SETVVPGNR.2y7_1.heavy 551.802 / 742.421 1172.0 19.72257423400879 44 17 10 7 10 15.55163590040672 6.430191694327457 0.0251007080078125 3 0.9718044610035337 7.332404621011463 1172.0 17.521446268616078 1.0 - - - - - - - 199.91666666666666 2 12 PHF1 PHD finger protein 1 1997 254 C20140704_OR005_04 C20140704_OR005_04 TB413266.[MT7]-GLGEFTPLYPMLFGGGQER.3y7_1.heavy 738.378 / 750.353 16415.0 50.47079849243164 46 16 10 10 10 11.656942277412696 8.57857898067892 0.0 3 0.9692776801755048 7.022911131163838 16415.0 181.7308380681818 0.0 - - - - - - - 192.33333333333334 32 12 SCLY selenocysteine lyase 1999 254 C20140704_OR005_04 C20140704_OR005_04 TB413266.[MT7]-GLGEFTPLYPMLFGGGQER.3b6_1.heavy 738.378 / 749.395 14055.0 50.47079849243164 46 16 10 10 10 11.656942277412696 8.57857898067892 0.0 3 0.9692776801755048 7.022911131163838 14055.0 102.68831097863885 0.0 - - - - - - - 128.26666666666668 28 15 SCLY selenocysteine lyase 2001 254 C20140704_OR005_04 C20140704_OR005_04 TB413266.[MT7]-GLGEFTPLYPMLFGGGQER.3b4_1.heavy 738.378 / 501.279 9608.0 50.47079849243164 46 16 10 10 10 11.656942277412696 8.57857898067892 0.0 3 0.9692776801755048 7.022911131163838 9608.0 48.38957896850399 0.0 - - - - - - - 202.84615384615384 19 13 SCLY selenocysteine lyase 2003 254 C20140704_OR005_04 C20140704_OR005_04 TB413266.[MT7]-GLGEFTPLYPMLFGGGQER.3y10_1.heavy 738.378 / 1091.53 21192.0 50.47079849243164 46 16 10 10 10 11.656942277412696 8.57857898067892 0.0 3 0.9692776801755048 7.022911131163838 21192.0 402.40498971509635 0.0 - - - - - - - 164.8 42 10 SCLY selenocysteine lyase 2005 255 C20140704_OR005_04 C20140704_OR005_04 TB427014.[MT7]-DMFPGPYPR.2b3_1.heavy 612.304 / 538.245 38045.0 33.328125 44 18 10 6 10 2.8563468929829026 26.63824901681928 0.0399017333984375 3 0.9890407893665869 11.778101872843498 38045.0 40.51932835456181 0.0 - - - - - - - 289.2 76 5 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 2007 255 C20140704_OR005_04 C20140704_OR005_04 TB427014.[MT7]-DMFPGPYPR.2y8_1.heavy 612.304 / 964.471 27032.0 33.328125 44 18 10 6 10 2.8563468929829026 26.63824901681928 0.0399017333984375 3 0.9890407893665869 11.778101872843498 27032.0 63.655523318573216 0.0 - - - - - - - 234.55555555555554 54 9 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 2009 255 C20140704_OR005_04 C20140704_OR005_04 TB427014.[MT7]-DMFPGPYPR.2y6_1.heavy 612.304 / 686.362 93223.0 33.328125 44 18 10 6 10 2.8563468929829026 26.63824901681928 0.0399017333984375 3 0.9890407893665869 11.778101872843498 93223.0 106.87229030749316 0.0 - - - - - - - 311.4 186 5 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 2011 255 C20140704_OR005_04 C20140704_OR005_04 TB427014.[MT7]-DMFPGPYPR.2y7_1.heavy 612.304 / 833.43 13572.0 33.328125 44 18 10 6 10 2.8563468929829026 26.63824901681928 0.0399017333984375 3 0.9890407893665869 11.778101872843498 13572.0 126.48516003644093 0.0 - - - - - - - 252.72727272727272 27 11 NDUFB8 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa 2013 256 C20140704_OR005_04 C20140704_OR005_04 TB413265.[MT7]-NPQIILSQFADNTTYAK[MT7].4y4_1.heavy 553.802 / 626.363 2472.0 41.50149917602539 40 16 10 10 4 3.1398179075970525 24.48169247461879 0.0 7 0.9674518786083011 6.822041510357951 2472.0 1.60056657223796 3.0 - - - - - - - 166.91666666666666 5 12 MSH4 mutS homolog 4 (E. coli) 2015 256 C20140704_OR005_04 C20140704_OR005_04 TB413265.[MT7]-NPQIILSQFADNTTYAK[MT7].4b4_1.heavy 553.802 / 597.348 5650.0 41.50149917602539 40 16 10 10 4 3.1398179075970525 24.48169247461879 0.0 7 0.9674518786083011 6.822041510357951 5650.0 0.9385620915032679 1.0 - - - - - - - 336.2857142857143 11 7 MSH4 mutS homolog 4 (E. coli) 2017 256 C20140704_OR005_04 C20140704_OR005_04 TB413265.[MT7]-NPQIILSQFADNTTYAK[MT7].4b5_1.heavy 553.802 / 710.432 N/A 41.50149917602539 40 16 10 10 4 3.1398179075970525 24.48169247461879 0.0 7 0.9674518786083011 6.822041510357951 0.0 0.0 41.0 - - - - - - - 211.7 4 10 MSH4 mutS homolog 4 (E. coli) 2019 256 C20140704_OR005_04 C20140704_OR005_04 TB413265.[MT7]-NPQIILSQFADNTTYAK[MT7].4y3_1.heavy 553.802 / 525.315 5886.0 41.50149917602539 40 16 10 10 4 3.1398179075970525 24.48169247461879 0.0 7 0.9674518786083011 6.822041510357951 5886.0 8.029205368783359 1.0 - - - - - - - 294.25 12 8 MSH4 mutS homolog 4 (E. coli)