Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140707_OR006_02 C20140707_OR006_02 TB450304.[MT7]-EGGLFTVTLFRK[MT7].3y7_1.heavy 552.662 / 1008.63 8174.0 40.665401458740234 46 20 10 6 10 10.624684591215631 9.412044107424974 0.03459930419921875 3 0.9972930669621335 23.71513480143087 8174.0 -2.5206167400881085 0.0 - - - - - - - 128.125 16 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 3 1 C20140707_OR006_02 C20140707_OR006_02 TB450304.[MT7]-EGGLFTVTLFRK[MT7].3b4_1.heavy 552.662 / 501.279 13397.0 40.665401458740234 46 20 10 6 10 10.624684591215631 9.412044107424974 0.03459930419921875 3 0.9972930669621335 23.71513480143087 13397.0 -1.179313380281691 0.0 - - - - - - - 258.1818181818182 26 11 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 5 1 C20140707_OR006_02 C20140707_OR006_02 TB450304.[MT7]-EGGLFTVTLFRK[MT7].3b5_1.heavy 552.662 / 648.347 6017.0 40.665401458740234 46 20 10 6 10 10.624684591215631 9.412044107424974 0.03459930419921875 3 0.9972930669621335 23.71513480143087 6017.0 -0.17662426614481408 0.0 - - - - - - - 250.0 12 5 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 7 1 C20140707_OR006_02 C20140707_OR006_02 TB450304.[MT7]-EGGLFTVTLFRK[MT7].3y5_1.heavy 552.662 / 808.516 9083.0 40.665401458740234 46 20 10 6 10 10.624684591215631 9.412044107424974 0.03459930419921875 3 0.9972930669621335 23.71513480143087 9083.0 -1.6005286343612326 0.0 - - - - - - - 295.2 18 5 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 9 2 C20140707_OR006_02 C20140707_OR006_02 TB450207.[MT7]-GVHHIDYYK[MT7].3y3_1.heavy 473.926 / 617.341 1871.0 21.383399963378906 36 20 0 10 6 9.556921015305978 10.46362105952786 0.0 5 0.9921193628042985 13.893001414886415 1871.0 10.631189414252166 2.0 - - - - - - - 197.42857142857142 5 7 FGFR4 fibroblast growth factor receptor 4 11 2 C20140707_OR006_02 C20140707_OR006_02 TB450207.[MT7]-GVHHIDYYK[MT7].3b4_1.heavy 473.926 / 575.317 651.0 21.383399963378906 36 20 0 10 6 9.556921015305978 10.46362105952786 0.0 5 0.9921193628042985 13.893001414886415 651.0 4.0020491803278695 2.0 - - - - - - - 220.64285714285714 20 14 FGFR4 fibroblast growth factor receptor 4 13 2 C20140707_OR006_02 C20140707_OR006_02 TB450207.[MT7]-GVHHIDYYK[MT7].3y4_1.heavy 473.926 / 732.369 2197.0 21.383399963378906 36 20 0 10 6 9.556921015305978 10.46362105952786 0.0 5 0.9921193628042985 13.893001414886415 2197.0 11.233027003922357 0.0 - - - - - - - 108.33333333333333 4 9 FGFR4 fibroblast growth factor receptor 4 15 2 C20140707_OR006_02 C20140707_OR006_02 TB450207.[MT7]-GVHHIDYYK[MT7].3y5_1.heavy 473.926 / 845.453 570.0 21.383399963378906 36 20 0 10 6 9.556921015305978 10.46362105952786 0.0 5 0.9921193628042985 13.893001414886415 570.0 11.962962962962962 1.0 - - - - - - - 0.0 1 0 FGFR4 fibroblast growth factor receptor 4 17 3 C20140707_OR006_02 C20140707_OR006_02 TB450308.[MT7]-K[MT7]LHAVPAGNTVK[MT7].4b4_1.heavy 417.514 / 738.487 2090.0 20.057799339294434 33 7 10 6 10 1.9039938375318113 52.52117839290497 0.038799285888671875 3 0.7206867450181256 2.278486069596281 2090.0 24.341013824884794 0.0 - - - - - - - 173.75 4 4 FGFR4 fibroblast growth factor receptor 4 19 3 C20140707_OR006_02 C20140707_OR006_02 TB450308.[MT7]-K[MT7]LHAVPAGNTVK[MT7].4b5_2.heavy 417.514 / 419.281 19199.0 20.057799339294434 33 7 10 6 10 1.9039938375318113 52.52117839290497 0.038799285888671875 3 0.7206867450181256 2.278486069596281 19199.0 44.343052548338235 0.0 - - - - - - - 209.92857142857142 38 14 FGFR4 fibroblast growth factor receptor 4 21 3 C20140707_OR006_02 C20140707_OR006_02 TB450308.[MT7]-K[MT7]LHAVPAGNTVK[MT7].4b5_1.heavy 417.514 / 837.555 619.0 20.057799339294434 33 7 10 6 10 1.9039938375318113 52.52117839290497 0.038799285888671875 3 0.7206867450181256 2.278486069596281 619.0 15.836753246753247 0.0 - - - - - - - 0.0 1 0 FGFR4 fibroblast growth factor receptor 4 23 3 C20140707_OR006_02 C20140707_OR006_02 TB450308.[MT7]-K[MT7]LHAVPAGNTVK[MT7].4b3_1.heavy 417.514 / 667.449 1316.0 20.057799339294434 33 7 10 6 10 1.9039938375318113 52.52117839290497 0.038799285888671875 3 0.7206867450181256 2.278486069596281 1316.0 13.75432258064516 0.0 - - - - - - - 143.71428571428572 2 7 FGFR4 fibroblast growth factor receptor 4 25 4 C20140707_OR006_02 C20140707_OR006_02 TB450483.[MT7]-GTVLPQGPLLLSPSSLFSALHR.3y11_1.heavy 812.136 / 1201.63 114.0 43.55025100708008 26 14 2 6 4 3.556368217797607 22.25308113919758 0.03749847412109375 9 0.9457218356159052 5.273094520097195 114.0 0.0 40.0 - - - - - - - 0.0 1 0 LPIN1 lipin 1 27 4 C20140707_OR006_02 C20140707_OR006_02 TB450483.[MT7]-GTVLPQGPLLLSPSSLFSALHR.3b4_1.heavy 812.136 / 515.331 1249.0 43.55025100708008 26 14 2 6 4 3.556368217797607 22.25308113919758 0.03749847412109375 9 0.9457218356159052 5.273094520097195 1249.0 0.8795774647887324 4.0 - - - - - - - 340.8333333333333 7 12 LPIN1 lipin 1 29 4 C20140707_OR006_02 C20140707_OR006_02 TB450483.[MT7]-GTVLPQGPLLLSPSSLFSALHR.3b7_1.heavy 812.136 / 797.464 909.0 43.55025100708008 26 14 2 6 4 3.556368217797607 22.25308113919758 0.03749847412109375 9 0.9457218356159052 5.273094520097195 909.0 0.0 7.0 - - - - - - - 199.0 2 4 LPIN1 lipin 1 31 4 C20140707_OR006_02 C20140707_OR006_02 TB450483.[MT7]-GTVLPQGPLLLSPSSLFSALHR.3y10_1.heavy 812.136 / 1114.6 682.0 43.55025100708008 26 14 2 6 4 3.556368217797607 22.25308113919758 0.03749847412109375 9 0.9457218356159052 5.273094520097195 682.0 0.0 6.0 - - - - - - - 194.85714285714286 2 7 LPIN1 lipin 1 33 5 C20140707_OR006_02 C20140707_OR006_02 TB412075.[MT7]-EIEREREEMAR.2b3_1.heavy 796.403 / 516.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 35 5 C20140707_OR006_02 C20140707_OR006_02 TB412075.[MT7]-EIEREREEMAR.2y4_1.heavy 796.403 / 506.239 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 37 5 C20140707_OR006_02 C20140707_OR006_02 TB412075.[MT7]-EIEREREEMAR.2b6_1.heavy 796.403 / 957.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 39 5 C20140707_OR006_02 C20140707_OR006_02 TB412075.[MT7]-EIEREREEMAR.2b5_1.heavy 796.403 / 801.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 41 6 C20140707_OR006_02 C20140707_OR006_02 TB450307.[MT7]-VLLAVSEEYLDLR.2y8_1.heavy 832.473 / 1024.49 3014.0 47.712876319885254 35 10 10 5 10 0.7885850669903846 76.89018987828163 0.044300079345703125 3 0.8368624016233722 3.012979777926632 3014.0 -1.3986078886310898 0.0 - - - - - - - 312.4 6 10 FGFR4 fibroblast growth factor receptor 4 43 6 C20140707_OR006_02 C20140707_OR006_02 TB450307.[MT7]-VLLAVSEEYLDLR.2y9_1.heavy 832.473 / 1123.56 1615.0 47.712876319885254 35 10 10 5 10 0.7885850669903846 76.89018987828163 0.044300079345703125 3 0.8368624016233722 3.012979777926632 1615.0 9.203101421650384 1.0 - - - - - - - 323.2857142857143 3 7 FGFR4 fibroblast growth factor receptor 4 45 6 C20140707_OR006_02 C20140707_OR006_02 TB450307.[MT7]-VLLAVSEEYLDLR.2b4_1.heavy 832.473 / 541.383 5597.0 47.712876319885254 35 10 10 5 10 0.7885850669903846 76.89018987828163 0.044300079345703125 3 0.8368624016233722 3.012979777926632 5597.0 -1.386253869969039 0.0 - - - - - - - 161.66666666666666 11 6 FGFR4 fibroblast growth factor receptor 4 47 6 C20140707_OR006_02 C20140707_OR006_02 TB450307.[MT7]-VLLAVSEEYLDLR.2y10_1.heavy 832.473 / 1194.6 1937.0 47.712876319885254 35 10 10 5 10 0.7885850669903846 76.89018987828163 0.044300079345703125 3 0.8368624016233722 3.012979777926632 1937.0 -0.12861885790172645 0.0 - - - - - - - 197.5 3 6 FGFR4 fibroblast growth factor receptor 4 49 7 C20140707_OR006_02 C20140707_OR006_02 TB411925.[MT7]-AMLSYVWPK[MT7].3b6_1.heavy 461.596 / 809.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 51 7 C20140707_OR006_02 C20140707_OR006_02 TB411925.[MT7]-AMLSYVWPK[MT7].3y3_1.heavy 461.596 / 574.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 53 7 C20140707_OR006_02 C20140707_OR006_02 TB411925.[MT7]-AMLSYVWPK[MT7].3b4_1.heavy 461.596 / 547.303 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 55 7 C20140707_OR006_02 C20140707_OR006_02 TB411925.[MT7]-AMLSYVWPK[MT7].3b3_1.heavy 461.596 / 460.271 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 57 8 C20140707_OR006_02 C20140707_OR006_02 TB450480.[MT7]-EAVWAFLPDAFVTMTGGFRR.4y10_2.heavy 604.565 / 586.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT deoxynucleotidyltransferase, terminal 59 8 C20140707_OR006_02 C20140707_OR006_02 TB450480.[MT7]-EAVWAFLPDAFVTMTGGFRR.4b4_1.heavy 604.565 / 630.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT deoxynucleotidyltransferase, terminal 61 8 C20140707_OR006_02 C20140707_OR006_02 TB450480.[MT7]-EAVWAFLPDAFVTMTGGFRR.4b5_1.heavy 604.565 / 701.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT deoxynucleotidyltransferase, terminal 63 8 C20140707_OR006_02 C20140707_OR006_02 TB450480.[MT7]-EAVWAFLPDAFVTMTGGFRR.4b6_1.heavy 604.565 / 848.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT deoxynucleotidyltransferase, terminal 65 9 C20140707_OR006_02 C20140707_OR006_02 TB411651.[MT7]-TALLDISC[CAM]VK[MT7].3y3_1.heavy 469.942 / 550.314 2848.0 36.52539825439453 37 7 10 10 10 11.11493630117661 8.996902662358412 0.0 3 0.7356813109559458 2.3454807475036747 2848.0 4.418848954662908 1.0 - - - - - - - 292.90909090909093 6 11 ACSL4 acyl-CoA synthetase long-chain family member 4 67 9 C20140707_OR006_02 C20140707_OR006_02 TB411651.[MT7]-TALLDISC[CAM]VK[MT7].3b4_1.heavy 469.942 / 543.362 2477.0 36.52539825439453 37 7 10 10 10 11.11493630117661 8.996902662358412 0.0 3 0.7356813109559458 2.3454807475036747 2477.0 9.661026392961876 0.0 - - - - - - - 268.5 4 6 ACSL4 acyl-CoA synthetase long-chain family member 4 69 9 C20140707_OR006_02 C20140707_OR006_02 TB411651.[MT7]-TALLDISC[CAM]VK[MT7].3b5_1.heavy 469.942 / 658.389 2105.0 36.52539825439453 37 7 10 10 10 11.11493630117661 8.996902662358412 0.0 3 0.7356813109559458 2.3454807475036747 2105.0 22.068548387096776 0.0 - - - - - - - 248.0 4 1 ACSL4 acyl-CoA synthetase long-chain family member 4 71 9 C20140707_OR006_02 C20140707_OR006_02 TB411651.[MT7]-TALLDISC[CAM]VK[MT7].3y4_1.heavy 469.942 / 637.346 3344.0 36.52539825439453 37 7 10 10 10 11.11493630117661 8.996902662358412 0.0 3 0.7356813109559458 2.3454807475036747 3344.0 40.31677419354838 0.0 - - - - - - - 124.0 6 1 ACSL4 acyl-CoA synthetase long-chain family member 4 73 10 C20140707_OR006_02 C20140707_OR006_02 TB411653.[MT7]-IISTITR.2y5_1.heavy 474.304 / 577.33 6059.0 29.601999282836914 38 20 2 10 6 98.98778726863982 1.0102256324672978 0.0 5 0.9969061219581877 22.181899839074873 6059.0 23.655523853051275 2.0 - - - - - - - 252.33333333333334 16 6 CLSTN1 calsyntenin 1 75 10 C20140707_OR006_02 C20140707_OR006_02 TB411653.[MT7]-IISTITR.2b4_1.heavy 474.304 / 559.357 1010.0 29.601999282836914 38 20 2 10 6 98.98778726863982 1.0102256324672978 0.0 5 0.9969061219581877 22.181899839074873 1010.0 1.3966654458451564 10.0 - - - - - - - 216.28571428571428 49 7 CLSTN1 calsyntenin 1 77 10 C20140707_OR006_02 C20140707_OR006_02 TB411653.[MT7]-IISTITR.2y6_1.heavy 474.304 / 690.414 12119.0 29.601999282836914 38 20 2 10 6 98.98778726863982 1.0102256324672978 0.0 5 0.9969061219581877 22.181899839074873 12119.0 103.85681365456794 0.0 - - - - - - - 220.75 24 4 CLSTN1 calsyntenin 1 79 10 C20140707_OR006_02 C20140707_OR006_02 TB411653.[MT7]-IISTITR.2b5_1.heavy 474.304 / 672.441 1894.0 29.601999282836914 38 20 2 10 6 98.98778726863982 1.0102256324672978 0.0 5 0.9969061219581877 22.181899839074873 1894.0 5.99683377308707 1.0 - - - - - - - 240.9090909090909 5 11 CLSTN1 calsyntenin 1 81 11 C20140707_OR006_02 C20140707_OR006_02 TB450185.[MT7]-EGGLFTVTLFR.2b4_1.heavy 692.391 / 501.279 1523.0 45.90769958496094 39 15 4 10 10 1.8058527152227182 37.03487201034796 0.0 3 0.9588328144357832 6.061575475194788 1523.0 2.99887482419128 2.0 - - - - - - - 242.3846153846154 3 13 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 83 11 C20140707_OR006_02 C20140707_OR006_02 TB450185.[MT7]-EGGLFTVTLFR.2y10_1.heavy 692.391 / 1110.63 1015.0 45.90769958496094 39 15 4 10 10 1.8058527152227182 37.03487201034796 0.0 3 0.9588328144357832 6.061575475194788 1015.0 1.830054644808743 5.0 - - - - - - - 213.4 2 10 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 85 11 C20140707_OR006_02 C20140707_OR006_02 TB450185.[MT7]-EGGLFTVTLFR.2b5_1.heavy 692.391 / 648.347 812.0 45.90769958496094 39 15 4 10 10 1.8058527152227182 37.03487201034796 0.0 3 0.9588328144357832 6.061575475194788 812.0 0.5999999999999999 30.0 - - - - - - - 725.1428571428571 6 7 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 87 11 C20140707_OR006_02 C20140707_OR006_02 TB450185.[MT7]-EGGLFTVTLFR.2y7_1.heavy 692.391 / 883.504 1218.0 45.90769958496094 39 15 4 10 10 1.8058527152227182 37.03487201034796 0.0 3 0.9588328144357832 6.061575475194788 1218.0 15.90529411764706 0.0 - - - - - - - 169.44444444444446 2 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 89 12 C20140707_OR006_02 C20140707_OR006_02 TB450180.[MT7]-ISLSGVHHFAR.3b6_1.heavy 456.594 / 701.431 2785.0 27.602800369262695 48 18 10 10 10 6.779578709035636 14.750179073328367 0.0 3 0.9857108289053473 10.311939328025009 2785.0 12.146417445482868 0.0 - - - - - - - 181.9 5 10 CLSTN1 calsyntenin 1 91 12 C20140707_OR006_02 C20140707_OR006_02 TB450180.[MT7]-ISLSGVHHFAR.3b5_1.heavy 456.594 / 602.363 5141.0 27.602800369262695 48 18 10 10 10 6.779578709035636 14.750179073328367 0.0 3 0.9857108289053473 10.311939328025009 5141.0 34.43348909657321 0.0 - - - - - - - 205.76923076923077 10 13 CLSTN1 calsyntenin 1 93 12 C20140707_OR006_02 C20140707_OR006_02 TB450180.[MT7]-ISLSGVHHFAR.3y4_1.heavy 456.594 / 530.283 13603.0 27.602800369262695 48 18 10 10 10 6.779578709035636 14.750179073328367 0.0 3 0.9857108289053473 10.311939328025009 13603.0 59.085195273324516 0.0 - - - - - - - 249.66666666666666 27 9 CLSTN1 calsyntenin 1 95 12 C20140707_OR006_02 C20140707_OR006_02 TB450180.[MT7]-ISLSGVHHFAR.3y5_1.heavy 456.594 / 667.342 1928.0 27.602800369262695 48 18 10 10 10 6.779578709035636 14.750179073328367 0.0 3 0.9857108289053473 10.311939328025009 1928.0 3.302492696327088 0.0 - - - - - - - 225.88888888888889 3 9 CLSTN1 calsyntenin 1 97 13 C20140707_OR006_02 C20140707_OR006_02 TB450183.[MT7]-K[MT7]LILGNYK[MT7].3y3_1.heavy 460.969 / 568.321 1427.0 29.070199966430664 34 14 0 10 10 1.5018362936497116 43.80624135277478 0.0 3 0.938405713116397 4.9469483255566065 1427.0 0.6280283644989526 2.0 - - - - - - - 307.4166666666667 3 12 ACSL4 acyl-CoA synthetase long-chain family member 4 99 13 C20140707_OR006_02 C20140707_OR006_02 TB450183.[MT7]-K[MT7]LILGNYK[MT7].3b3_1.heavy 460.969 / 643.474 1071.0 29.070199966430664 34 14 0 10 10 1.5018362936497116 43.80624135277478 0.0 3 0.938405713116397 4.9469483255566065 1071.0 0.6999999999999998 4.0 - - - - - - - 238.0 49 7 ACSL4 acyl-CoA synthetase long-chain family member 4 101 13 C20140707_OR006_02 C20140707_OR006_02 TB450183.[MT7]-K[MT7]LILGNYK[MT7].3y4_1.heavy 460.969 / 625.343 5591.0 29.070199966430664 34 14 0 10 10 1.5018362936497116 43.80624135277478 0.0 3 0.938405713116397 4.9469483255566065 5591.0 28.894663865546217 0.0 - - - - - - - 185.11111111111111 11 9 ACSL4 acyl-CoA synthetase long-chain family member 4 103 13 C20140707_OR006_02 C20140707_OR006_02 TB450183.[MT7]-K[MT7]LILGNYK[MT7].3y5_1.heavy 460.969 / 738.427 1309.0 29.070199966430664 34 14 0 10 10 1.5018362936497116 43.80624135277478 0.0 3 0.938405713116397 4.9469483255566065 1309.0 15.564999999999998 0.0 - - - - - - - 171.88888888888889 2 9 ACSL4 acyl-CoA synthetase long-chain family member 4 105 14 C20140707_OR006_02 C20140707_OR006_02 TB450080.[MT7]-QLVEALDK[MT7].2y5_1.heavy 602.363 / 719.406 2918.0 30.963499069213867 30 18 0 10 2 4.6921211769751165 21.312322556952225 0.0 13 0.9883182376753119 11.407343028817747 2918.0 3.359591443660409 10.0 - - - - - - - 317.5 222 2 FGFR4 fibroblast growth factor receptor 4 107 14 C20140707_OR006_02 C20140707_OR006_02 TB450080.[MT7]-QLVEALDK[MT7].2y3_1.heavy 602.363 / 519.326 2791.0 30.963499069213867 30 18 0 10 2 4.6921211769751165 21.312322556952225 0.0 13 0.9883182376753119 11.407343028817747 2791.0 4.273910080293059 2.0 - - - - - - - 222.25 5 4 FGFR4 fibroblast growth factor receptor 4 109 14 C20140707_OR006_02 C20140707_OR006_02 TB450080.[MT7]-QLVEALDK[MT7].2y6_1.heavy 602.363 / 818.474 2157.0 30.963499069213867 30 18 0 10 2 4.6921211769751165 21.312322556952225 0.0 13 0.9883182376753119 11.407343028817747 2157.0 1.2806474095872376 20.0 - - - - - - - 317.5 370 2 FGFR4 fibroblast growth factor receptor 4 111 14 C20140707_OR006_02 C20140707_OR006_02 TB450080.[MT7]-QLVEALDK[MT7].2y7_1.heavy 602.363 / 931.558 3172.0 30.963499069213867 30 18 0 10 2 4.6921211769751165 21.312322556952225 0.0 13 0.9883182376753119 11.407343028817747 3172.0 29.971653543307085 6.0 - - - - - - - 211.66666666666666 64 3 FGFR4 fibroblast growth factor receptor 4 113 15 C20140707_OR006_02 C20140707_OR006_02 TB450081.[MT7]-LFDHAVSK[MT7].3y3_1.heavy 402.236 / 477.315 45322.0 26.894500732421875 46 16 10 10 10 3.4499416007639647 28.985997901487874 0.0 3 0.9622109073008215 6.32851668730662 45322.0 75.649053874891 0.0 - - - - - - - 714.2857142857143 90 7 ACSL4 acyl-CoA synthetase long-chain family member 4 115 15 C20140707_OR006_02 C20140707_OR006_02 TB450081.[MT7]-LFDHAVSK[MT7].3b4_1.heavy 402.236 / 657.348 3830.0 26.894500732421875 46 16 10 10 10 3.4499416007639647 28.985997901487874 0.0 3 0.9622109073008215 6.32851668730662 3830.0 9.350721543020105 2.0 - - - - - - - 266.0 10 4 ACSL4 acyl-CoA synthetase long-chain family member 4 117 15 C20140707_OR006_02 C20140707_OR006_02 TB450081.[MT7]-LFDHAVSK[MT7].3y4_1.heavy 402.236 / 548.352 13618.0 26.894500732421875 46 16 10 10 10 3.4499416007639647 28.985997901487874 0.0 3 0.9622109073008215 6.32851668730662 13618.0 106.49361076467154 0.0 - - - - - - - 212.66666666666666 27 6 ACSL4 acyl-CoA synthetase long-chain family member 4 119 15 C20140707_OR006_02 C20140707_OR006_02 TB450081.[MT7]-LFDHAVSK[MT7].3b3_1.heavy 402.236 / 520.289 64153.0 26.894500732421875 46 16 10 10 10 3.4499416007639647 28.985997901487874 0.0 3 0.9622109073008215 6.32851668730662 64153.0 287.425209901007 0.0 - - - - - - - 239.5 128 4 ACSL4 acyl-CoA synthetase long-chain family member 4 121 16 C20140707_OR006_02 C20140707_OR006_02 TB411794.[MT7]-EESK[MT7]PEQC[CAM]LAGK[MT7].3y4_1.heavy 603.324 / 532.357 4681.0 21.423500061035156 36 12 8 10 6 1.6087863481259803 41.646056912334195 0.0 5 0.8885208645174443 3.6613894158503455 4681.0 12.640269136858368 3.0 - - - - - - - 744.75 12 8 LPIN1 lipin 1 123 16 C20140707_OR006_02 C20140707_OR006_02 TB411794.[MT7]-EESK[MT7]PEQC[CAM]LAGK[MT7].3y8_1.heavy 603.324 / 1046.54 2043.0 21.423500061035156 36 12 8 10 6 1.6087863481259803 41.646056912334195 0.0 5 0.8885208645174443 3.6613894158503455 2043.0 10.215 0.0 - - - - - - - 238.0 4 5 LPIN1 lipin 1 125 16 C20140707_OR006_02 C20140707_OR006_02 TB411794.[MT7]-EESK[MT7]PEQC[CAM]LAGK[MT7].3y5_1.heavy 603.324 / 692.388 2468.0 21.423500061035156 36 12 8 10 6 1.6087863481259803 41.646056912334195 0.0 5 0.8885208645174443 3.6613894158503455 2468.0 42.24635294117647 0.0 - - - - - - - 133.57142857142858 4 7 LPIN1 lipin 1 127 16 C20140707_OR006_02 C20140707_OR006_02 TB411794.[MT7]-EESK[MT7]PEQC[CAM]LAGK[MT7].3b7_2.heavy 603.324 / 558.792 2213.0 21.423500061035156 36 12 8 10 6 1.6087863481259803 41.646056912334195 0.0 5 0.8885208645174443 3.6613894158503455 2213.0 6.055868325398044 2.0 - - - - - - - 226.66666666666666 4 12 LPIN1 lipin 1 129 17 C20140707_OR006_02 C20140707_OR006_02 TB450084.[MT7]-LIAAFEQK[MT7].3y3_1.heavy 403.248 / 548.316 5145.0 35.8351993560791 42 17 10 5 10 3.2299785403470214 24.489669951482526 0.044399261474609375 3 0.973354048025805 7.543582674106323 5145.0 79.76744186046511 0.0 - - - - - - - 129.0 10 1 CBX6 chromobox homolog 6 131 17 C20140707_OR006_02 C20140707_OR006_02 TB450084.[MT7]-LIAAFEQK[MT7].3b4_1.heavy 403.248 / 513.352 19552.0 35.8351993560791 42 17 10 5 10 3.2299785403470214 24.489669951482526 0.044399261474609375 3 0.973354048025805 7.543582674106323 19552.0 194.64044664015748 0.0 - - - - - - - 214.33333333333334 39 3 CBX6 chromobox homolog 6 133 17 C20140707_OR006_02 C20140707_OR006_02 TB450084.[MT7]-LIAAFEQK[MT7].3b5_1.heavy 403.248 / 660.42 1801.0 35.8351993560791 42 17 10 5 10 3.2299785403470214 24.489669951482526 0.044399261474609375 3 0.973354048025805 7.543582674106323 1801.0 13.3147859922179 0.0 - - - - - - - 257.0 3 3 CBX6 chromobox homolog 6 135 17 C20140707_OR006_02 C20140707_OR006_02 TB450084.[MT7]-LIAAFEQK[MT7].3b3_1.heavy 403.248 / 442.315 13763.0 35.8351993560791 42 17 10 5 10 3.2299785403470214 24.489669951482526 0.044399261474609375 3 0.973354048025805 7.543582674106323 13763.0 213.27315503875968 0.0 - - - - - - - 193.25 27 4 CBX6 chromobox homolog 6 137 18 C20140707_OR006_02 C20140707_OR006_02 TB411791.[MT7]-TYETASLK[MT7].2b3_1.heavy 600.839 / 538.263 2583.0 24.353249549865723 36 20 2 6 8 6.403407028786016 15.6166864843134 0.03650093078613281 4 0.9938906519975274 15.781329401438914 2583.0 12.72395781725529 0.0 - - - - - - - 262.57142857142856 5 14 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 139 18 C20140707_OR006_02 C20140707_OR006_02 TB411791.[MT7]-TYETASLK[MT7].2y4_1.heavy 600.839 / 562.368 2881.0 24.353249549865723 36 20 2 6 8 6.403407028786016 15.6166864843134 0.03650093078613281 4 0.9938906519975274 15.781329401438914 2881.0 1.1593561368209258 0.0 - - - - - - - 238.3 5 10 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 141 18 C20140707_OR006_02 C20140707_OR006_02 TB411791.[MT7]-TYETASLK[MT7].2y5_1.heavy 600.839 / 663.416 3378.0 24.353249549865723 36 20 2 6 8 6.403407028786016 15.6166864843134 0.03650093078613281 4 0.9938906519975274 15.781329401438914 3378.0 25.076122476361657 0.0 - - - - - - - 207.45454545454547 6 11 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 143 18 C20140707_OR006_02 C20140707_OR006_02 TB411791.[MT7]-TYETASLK[MT7].2y7_1.heavy 600.839 / 955.522 2981.0 24.353249549865723 36 20 2 6 8 6.403407028786016 15.6166864843134 0.03650093078613281 4 0.9938906519975274 15.781329401438914 2981.0 12.926855307423123 1.0 - - - - - - - 227.0 14 7 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 145 19 C20140707_OR006_02 C20140707_OR006_02 TB436898.[MT7]-ELYGPK[MT7].2b3_1.heavy 497.794 / 550.299 2034.0 23.19284963607788 40 17 10 3 10 2.5880415086509356 34.191731249919386 0.06679916381835938 3 0.9744035204327132 7.697354795052 2034.0 10.484536082474227 1.0 - - - - - - - 172.44444444444446 4 9 CBX6 chromobox homolog 6 147 19 C20140707_OR006_02 C20140707_OR006_02 TB436898.[MT7]-ELYGPK[MT7].2y4_1.heavy 497.794 / 608.352 3584.0 23.19284963607788 40 17 10 3 10 2.5880415086509356 34.191731249919386 0.06679916381835938 3 0.9744035204327132 7.697354795052 3584.0 23.65922467410752 0.0 - - - - - - - 280.9 7 10 CBX6 chromobox homolog 6 149 19 C20140707_OR006_02 C20140707_OR006_02 TB436898.[MT7]-ELYGPK[MT7].2y5_1.heavy 497.794 / 721.437 3681.0 23.19284963607788 40 17 10 3 10 2.5880415086509356 34.191731249919386 0.06679916381835938 3 0.9744035204327132 7.697354795052 3681.0 48.70051546391752 0.0 - - - - - - - 202.72727272727272 7 11 CBX6 chromobox homolog 6 151 19 C20140707_OR006_02 C20140707_OR006_02 TB436898.[MT7]-ELYGPK[MT7].2b4_1.heavy 497.794 / 607.321 872.0 23.19284963607788 40 17 10 3 10 2.5880415086509356 34.191731249919386 0.06679916381835938 3 0.9744035204327132 7.697354795052 872.0 0.0 4.0 - - - - - - - 0.0 1 0 CBX6 chromobox homolog 6 153 20 C20140707_OR006_02 C20140707_OR006_02 TB412083.[MT7]-NSVPVTSAFPTAK[MT7].3b4_1.heavy 536.306 / 542.305 4139.0 30.707449913024902 43 17 10 6 10 3.850385978976246 19.28955218443116 0.038600921630859375 3 0.9733718033181643 7.546108505882517 4139.0 24.968376282105623 0.0 - - - - - - - 238.1 8 10 NLGN1 neuroligin 1 155 20 C20140707_OR006_02 C20140707_OR006_02 TB412083.[MT7]-NSVPVTSAFPTAK[MT7].3b5_1.heavy 536.306 / 641.374 5268.0 30.707449913024902 43 17 10 6 10 3.850385978976246 19.28955218443116 0.038600921630859375 3 0.9733718033181643 7.546108505882517 5268.0 5.2 1.0 - - - - - - - 236.66666666666666 10 9 NLGN1 neuroligin 1 157 20 C20140707_OR006_02 C20140707_OR006_02 TB412083.[MT7]-NSVPVTSAFPTAK[MT7].3b3_1.heavy 536.306 / 445.253 25586.0 30.707449913024902 43 17 10 6 10 3.850385978976246 19.28955218443116 0.038600921630859375 3 0.9733718033181643 7.546108505882517 25586.0 62.520903054448866 0.0 - - - - - - - 229.66666666666666 51 6 NLGN1 neuroligin 1 159 20 C20140707_OR006_02 C20140707_OR006_02 TB412083.[MT7]-NSVPVTSAFPTAK[MT7].3y4_1.heavy 536.306 / 560.352 29098.0 30.707449913024902 43 17 10 6 10 3.850385978976246 19.28955218443116 0.038600921630859375 3 0.9733718033181643 7.546108505882517 29098.0 61.97410022779043 0.0 - - - - - - - 250.75 58 8 NLGN1 neuroligin 1 161 21 C20140707_OR006_02 C20140707_OR006_02 TB450472.[MT7]-GSIYLAGQNIQDVSLESLRR.3y15_2.heavy 788.432 / 843.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 163 21 C20140707_OR006_02 C20140707_OR006_02 TB450472.[MT7]-GSIYLAGQNIQDVSLESLRR.3b4_1.heavy 788.432 / 565.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 165 21 C20140707_OR006_02 C20140707_OR006_02 TB450472.[MT7]-GSIYLAGQNIQDVSLESLRR.3b5_1.heavy 788.432 / 678.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 167 21 C20140707_OR006_02 C20140707_OR006_02 TB450472.[MT7]-GSIYLAGQNIQDVSLESLRR.3b8_1.heavy 788.432 / 934.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 169 22 C20140707_OR006_02 C20140707_OR006_02 TB411934.[MT7]-GNSGQFLDAAK[MT7].3b6_1.heavy 465.921 / 735.354 4928.0 27.536049842834473 42 17 10 5 10 4.197968308806041 23.821046907436365 0.04509925842285156 3 0.9742055521518314 7.667632214015517 4928.0 43.09865557865558 0.0 - - - - - - - 280.5 9 6 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 171 22 C20140707_OR006_02 C20140707_OR006_02 TB411934.[MT7]-GNSGQFLDAAK[MT7].3b5_1.heavy 465.921 / 588.286 13581.0 27.536049842834473 42 17 10 5 10 4.197968308806041 23.821046907436365 0.04509925842285156 3 0.9742055521518314 7.667632214015517 13581.0 43.0459462299676 0.0 - - - - - - - 300.5 27 8 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 173 22 C20140707_OR006_02 C20140707_OR006_02 TB411934.[MT7]-GNSGQFLDAAK[MT7].3y4_1.heavy 465.921 / 548.316 12740.0 27.536049842834473 42 17 10 5 10 4.197968308806041 23.821046907436365 0.04509925842285156 3 0.9742055521518314 7.667632214015517 12740.0 39.25039046180544 0.0 - - - - - - - 320.6666666666667 25 9 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 175 22 C20140707_OR006_02 C20140707_OR006_02 TB411934.[MT7]-GNSGQFLDAAK[MT7].3y5_1.heavy 465.921 / 661.4 1683.0 27.536049842834473 42 17 10 5 10 4.197968308806041 23.821046907436365 0.04509925842285156 3 0.9742055521518314 7.667632214015517 1683.0 8.215 3.0 - - - - - - - 120.0 3 2 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 177 23 C20140707_OR006_02 C20140707_OR006_02 TB411643.[MT7]-NAVFGK[MT7].2b3_1.heavy 462.281 / 429.258 1924.0 24.206750869750977 30 16 2 6 6 2.3637708149712315 34.519572338679104 0.035900115966796875 6 0.9695562246464953 7.055131563430595 1924.0 1.208976660682226 0.0 - - - - - - - 274.11764705882354 3 17 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 179 23 C20140707_OR006_02 C20140707_OR006_02 TB411643.[MT7]-NAVFGK[MT7].2y4_1.heavy 462.281 / 594.373 1215.0 24.206750869750977 30 16 2 6 6 2.3637708149712315 34.519572338679104 0.035900115966796875 6 0.9695562246464953 7.055131563430595 1215.0 8.184396875810215 3.0 - - - - - - - 193.54545454545453 18 11 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 181 23 C20140707_OR006_02 C20140707_OR006_02 TB411643.[MT7]-NAVFGK[MT7].2y5_1.heavy 462.281 / 665.41 1013.0 24.206750869750977 30 16 2 6 6 2.3637708149712315 34.519572338679104 0.035900115966796875 6 0.9695562246464953 7.055131563430595 1013.0 2.4011851851851853 1.0 - - - - - - - 218.30769230769232 2 13 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 183 23 C20140707_OR006_02 C20140707_OR006_02 TB411643.[MT7]-NAVFGK[MT7].2y3_1.heavy 462.281 / 495.305 3443.0 24.206750869750977 30 16 2 6 6 2.3637708149712315 34.519572338679104 0.035900115966796875 6 0.9695562246464953 7.055131563430595 3443.0 -1.6994076999012833 1.0 - - - - - - - 152.0 8 6 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 185 24 C20140707_OR006_02 C20140707_OR006_02 TB412081.[MT7]-EFC[CAM]NPEDFEK[MT7].3y3_1.heavy 534.916 / 567.326 4028.0 31.090200424194336 48 18 10 10 10 3.943238738277728 25.359864476193643 0.0 3 0.9800352420908608 8.719772164642343 4028.0 13.564399525575997 1.0 - - - - - - - 660.875 8 8 CBX6 chromobox homolog 6 187 24 C20140707_OR006_02 C20140707_OR006_02 TB412081.[MT7]-EFC[CAM]NPEDFEK[MT7].3b4_1.heavy 534.916 / 695.294 5161.0 31.090200424194336 48 18 10 10 10 3.943238738277728 25.359864476193643 0.0 3 0.9800352420908608 8.719772164642343 5161.0 15.094283874697783 2.0 - - - - - - - 193.84615384615384 10 13 CBX6 chromobox homolog 6 189 24 C20140707_OR006_02 C20140707_OR006_02 TB412081.[MT7]-EFC[CAM]NPEDFEK[MT7].3b3_1.heavy 534.916 / 581.251 1511.0 31.090200424194336 48 18 10 10 10 3.943238738277728 25.359864476193643 0.0 3 0.9800352420908608 8.719772164642343 1511.0 5.689813001008653 2.0 - - - - - - - 273.0 4 6 CBX6 chromobox homolog 6 191 24 C20140707_OR006_02 C20140707_OR006_02 TB412081.[MT7]-EFC[CAM]NPEDFEK[MT7].3y4_1.heavy 534.916 / 682.353 4280.0 31.090200424194336 48 18 10 10 10 3.943238738277728 25.359864476193643 0.0 3 0.9800352420908608 8.719772164642343 4280.0 52.3111111111111 1.0 - - - - - - - 198.0 8 7 CBX6 chromobox homolog 6 193 25 C20140707_OR006_02 C20140707_OR006_02 TB450478.[MT7]-SLGDLPEGPEDQAVTEYVATR.2b3_1.heavy 1196.09 / 402.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK15 mitogen-activated protein kinase 15 195 25 C20140707_OR006_02 C20140707_OR006_02 TB450478.[MT7]-SLGDLPEGPEDQAVTEYVATR.2b4_1.heavy 1196.09 / 517.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK15 mitogen-activated protein kinase 15 197 25 C20140707_OR006_02 C20140707_OR006_02 TB450478.[MT7]-SLGDLPEGPEDQAVTEYVATR.2y10_1.heavy 1196.09 / 1137.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK15 mitogen-activated protein kinase 15 199 25 C20140707_OR006_02 C20140707_OR006_02 TB450478.[MT7]-SLGDLPEGPEDQAVTEYVATR.2b5_1.heavy 1196.09 / 630.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK15 mitogen-activated protein kinase 15 201 26 C20140707_OR006_02 C20140707_OR006_02 TB411649.[MT7]-DNASDK[MT7].2y4_1.heavy 469.245 / 564.311 994.0 12.595999717712402 45 17 10 10 8 2.2427260387133057 31.482094207364618 0.0 4 0.9783805596703311 8.378274646454216 994.0 10.385074626865672 0.0 - - - - - - - 0.0 1 0 FGFR4 fibroblast growth factor receptor 4 203 26 C20140707_OR006_02 C20140707_OR006_02 TB411649.[MT7]-DNASDK[MT7].2y5_1.heavy 469.245 / 678.354 1461.0 12.595999717712402 45 17 10 10 8 2.2427260387133057 31.482094207364618 0.0 4 0.9783805596703311 8.378274646454216 1461.0 23.836181163149767 0.0 - - - - - - - 61.483870967741936 2 31 FGFR4 fibroblast growth factor receptor 4 205 26 C20140707_OR006_02 C20140707_OR006_02 TB411649.[MT7]-DNASDK[MT7].2y3_1.heavy 469.245 / 493.274 1428.0 12.595999717712402 45 17 10 10 8 2.2427260387133057 31.482094207364618 0.0 4 0.9783805596703311 8.378274646454216 1428.0 8.007476635514019 0.0 - - - - - - - 50.43333333333333 2 30 FGFR4 fibroblast growth factor receptor 4 207 26 C20140707_OR006_02 C20140707_OR006_02 TB411649.[MT7]-DNASDK[MT7].2b5_1.heavy 469.245 / 647.275 1401.0 12.595999717712402 45 17 10 10 8 2.2427260387133057 31.482094207364618 0.0 4 0.9783805596703311 8.378274646454216 1401.0 17.578584905660378 1.0 - - - - - - - 109.16666666666667 3 36 FGFR4 fibroblast growth factor receptor 4 209 27 C20140707_OR006_02 C20140707_OR006_02 TB411786.[MT7]-LDC[CAM]ELQK[MT7].2y5_1.heavy 597.326 / 821.431 3423.0 26.263200759887695 41 11 10 10 10 3.0126999930436518 33.19281715102758 0.0 3 0.851407385396071 3.161063377956353 3423.0 43.96675236528177 0.0 - - - - - - - 147.0 6 6 CLSTN1 calsyntenin 1 211 27 C20140707_OR006_02 C20140707_OR006_02 TB411786.[MT7]-LDC[CAM]ELQK[MT7].2b4_1.heavy 597.326 / 662.294 1987.0 26.263200759887695 41 11 10 10 10 3.0126999930436518 33.19281715102758 0.0 3 0.851407385396071 3.161063377956353 1987.0 1.4492329068752134 1.0 - - - - - - - 231.7 5 10 CLSTN1 calsyntenin 1 213 27 C20140707_OR006_02 C20140707_OR006_02 TB411786.[MT7]-LDC[CAM]ELQK[MT7].2y3_1.heavy 597.326 / 532.357 2981.0 26.263200759887695 41 11 10 10 10 3.0126999930436518 33.19281715102758 0.0 3 0.851407385396071 3.161063377956353 2981.0 7.802820548669661 0.0 - - - - - - - 257.5 5 6 CLSTN1 calsyntenin 1 215 27 C20140707_OR006_02 C20140707_OR006_02 TB411786.[MT7]-LDC[CAM]ELQK[MT7].2y6_1.heavy 597.326 / 936.458 7619.0 26.263200759887695 41 11 10 10 10 3.0126999930436518 33.19281715102758 0.0 3 0.851407385396071 3.161063377956353 7619.0 68.56096179183136 0.0 - - - - - - - 220.66666666666666 15 9 CLSTN1 calsyntenin 1 217 28 C20140707_OR006_02 C20140707_OR006_02 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 140405.0 30.053499221801758 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 140405.0 877.7853461485622 0.0 - - - - - - - 251.42857142857142 280 7 219 28 C20140707_OR006_02 C20140707_OR006_02 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 54930.0 30.053499221801758 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 54930.0 156.1628230616302 0.0 - - - - - - - 226.2 109 5 221 28 C20140707_OR006_02 C20140707_OR006_02 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 63101.0 30.053499221801758 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 63101.0 94.25966462223067 1.0 - - - - - - - 282.625 132 8 223 29 C20140707_OR006_02 C20140707_OR006_02 TB436885.[MT7]-VIDC[CAM]LYTC[CAM]K[MT7].3b4_1.heavy 487.256 / 632.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLSTN1 calsyntenin 1 225 29 C20140707_OR006_02 C20140707_OR006_02 TB436885.[MT7]-VIDC[CAM]LYTC[CAM]K[MT7].3b5_1.heavy 487.256 / 745.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLSTN1 calsyntenin 1 227 29 C20140707_OR006_02 C20140707_OR006_02 TB436885.[MT7]-VIDC[CAM]LYTC[CAM]K[MT7].3b3_1.heavy 487.256 / 472.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLSTN1 calsyntenin 1 229 29 C20140707_OR006_02 C20140707_OR006_02 TB436885.[MT7]-VIDC[CAM]LYTC[CAM]K[MT7].3y4_1.heavy 487.256 / 715.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLSTN1 calsyntenin 1 231 30 C20140707_OR006_02 C20140707_OR006_02 TB436881.[MT7]-STGEGVIR.2b6_1.heavy 481.773 / 675.343 6460.0 20.018974781036377 44 18 10 6 10 2.974279781734021 30.18544625974495 0.03890037536621094 3 0.9811390023596827 8.972119812125662 6460.0 55.733333333333334 0.0 - - - - - - - 141.66666666666666 12 3 CLSTN1 calsyntenin 1 233 30 C20140707_OR006_02 C20140707_OR006_02 TB436881.[MT7]-STGEGVIR.2y6_1.heavy 481.773 / 630.357 3655.0 20.018974781036377 44 18 10 6 10 2.974279781734021 30.18544625974495 0.03890037536621094 3 0.9811390023596827 8.972119812125662 3655.0 21.807142857142857 0.0 - - - - - - - 170.0 7 7 CLSTN1 calsyntenin 1 235 30 C20140707_OR006_02 C20140707_OR006_02 TB436881.[MT7]-STGEGVIR.2b5_1.heavy 481.773 / 576.275 6886.0 20.018974781036377 44 18 10 6 10 2.974279781734021 30.18544625974495 0.03890037536621094 3 0.9811390023596827 8.972119812125662 6886.0 43.54382352941177 0.0 - - - - - - - 224.64285714285714 13 14 CLSTN1 calsyntenin 1 237 30 C20140707_OR006_02 C20140707_OR006_02 TB436881.[MT7]-STGEGVIR.2y7_1.heavy 481.773 / 731.405 8756.0 20.018974781036377 44 18 10 6 10 2.974279781734021 30.18544625974495 0.03890037536621094 3 0.9811390023596827 8.972119812125662 8756.0 111.25270588235294 0.0 - - - - - - - 201.875 17 8 CLSTN1 calsyntenin 1 239 31 C20140707_OR006_02 C20140707_OR006_02 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 48995.0 16.010433197021484 24 -3 10 7 10 null 0.0 0.027500152587890625 3 0.0 0.0 48995.0 39.750612477883095 0.0 - - - - - - - 218.625 97 8 241 31 C20140707_OR006_02 C20140707_OR006_02 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 61624.0 16.010433197021484 24 -3 10 7 10 null 0.0 0.027500152587890625 3 0.0 0.0 61624.0 262.7762446561297 0.0 - - - - - - - 155.8 123 10 243 31 C20140707_OR006_02 C20140707_OR006_02 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 39409.0 16.010433197021484 24 -3 10 7 10 null 0.0 0.027500152587890625 3 0.0 0.0 39409.0 216.0729506437768 0.0 - - - - - - - 144.4 78 15 245 32 C20140707_OR006_02 C20140707_OR006_02 TB411632.[MT7]-TAISPK[MT7].2b3_1.heavy 452.789 / 430.278 1348.0 18.990349769592285 37 20 8 5 4 12.245362998262117 8.166356523215537 0.04049873352050781 7 0.9969093175291097 22.19337013657185 1348.0 23.724800000000002 6.0 - - - - - - - 183.33333333333334 3 9 FAM13C family with sequence similarity 13, member C 247 32 C20140707_OR006_02 C20140707_OR006_02 TB411632.[MT7]-TAISPK[MT7].2y4_1.heavy 452.789 / 588.384 1049.0 18.990349769592285 37 20 8 5 4 12.245362998262117 8.166356523215537 0.04049873352050781 7 0.9969093175291097 22.19337013657185 1049.0 14.825866666666666 2.0 - - - - - - - 177.27272727272728 2 11 FAM13C family with sequence similarity 13, member C 249 32 C20140707_OR006_02 C20140707_OR006_02 TB411632.[MT7]-TAISPK[MT7].2y5_1.heavy 452.789 / 659.421 1423.0 18.990349769592285 37 20 8 5 4 12.245362998262117 8.166356523215537 0.04049873352050781 7 0.9969093175291097 22.19337013657185 1423.0 4.6351726723864 1.0 - - - - - - - 187.5 2 6 FAM13C family with sequence similarity 13, member C 251 32 C20140707_OR006_02 C20140707_OR006_02 TB411632.[MT7]-TAISPK[MT7].2y3_1.heavy 452.789 / 475.3 3895.0 18.990349769592285 37 20 8 5 4 12.245362998262117 8.166356523215537 0.04049873352050781 7 0.9969093175291097 22.19337013657185 3895.0 73.74533333333332 1.0 - - - - - - - 180.0 11 10 FAM13C family with sequence similarity 13, member C 253 33 C20140707_OR006_02 C20140707_OR006_02 TB437313.[MT7]-AIRVDLVLC[CAM]PYER.3b6_1.heavy 583.326 / 812.511 2632.0 38.253700256347656 36 10 10 10 6 4.179001126143637 23.92916320945803 0.0 5 0.8433219460034204 3.076221654080805 2632.0 4.052749924035248 2.0 - - - - - - - 219.45454545454547 8 11 DNTT deoxynucleotidyltransferase, terminal 255 33 C20140707_OR006_02 C20140707_OR006_02 TB437313.[MT7]-AIRVDLVLC[CAM]PYER.3b5_1.heavy 583.326 / 699.427 1316.0 38.253700256347656 36 10 10 10 6 4.179001126143637 23.92916320945803 0.0 5 0.8433219460034204 3.076221654080805 1316.0 3.409343065693431 9.0 - - - - - - - 180.21428571428572 7 14 DNTT deoxynucleotidyltransferase, terminal 257 33 C20140707_OR006_02 C20140707_OR006_02 TB437313.[MT7]-AIRVDLVLC[CAM]PYER.3y4_1.heavy 583.326 / 564.278 6361.0 38.253700256347656 36 10 10 10 6 4.179001126143637 23.92916320945803 0.0 5 0.8433219460034204 3.076221654080805 6361.0 6.4358772421524675 1.0 - - - - - - - 657.8571428571429 13 7 DNTT deoxynucleotidyltransferase, terminal 259 33 C20140707_OR006_02 C20140707_OR006_02 TB437313.[MT7]-AIRVDLVLC[CAM]PYER.3y5_1.heavy 583.326 / 724.308 2742.0 38.253700256347656 36 10 10 10 6 4.179001126143637 23.92916320945803 0.0 5 0.8433219460034204 3.076221654080805 2742.0 6.210181019155522 1.0 - - - - - - - 219.35714285714286 5 14 DNTT deoxynucleotidyltransferase, terminal 261 34 C20140707_OR006_02 C20140707_OR006_02 TB450461.[MT7]-AIAQSGTALSSWAVSFQPAK[MT7].3b9_1.heavy 770.089 / 957.549 3489.0 41.826748847961426 42 16 10 6 10 1.8800932331109457 38.43354951820502 0.034999847412109375 3 0.9653980596612017 6.615334921296272 3489.0 10.421688311688312 1.0 - - - - - - - 228.0 6 9 NLGN1 neuroligin 1 263 34 C20140707_OR006_02 C20140707_OR006_02 TB450461.[MT7]-AIAQSGTALSSWAVSFQPAK[MT7].3y6_1.heavy 770.089 / 821.464 5643.0 41.826748847961426 42 16 10 6 10 1.8800932331109457 38.43354951820502 0.034999847412109375 3 0.9653980596612017 6.615334921296272 5643.0 0.0 0.0 - - - - - - - 260.46153846153845 11 13 NLGN1 neuroligin 1 265 34 C20140707_OR006_02 C20140707_OR006_02 TB450461.[MT7]-AIAQSGTALSSWAVSFQPAK[MT7].3b4_1.heavy 770.089 / 528.326 4515.0 41.826748847961426 42 16 10 6 10 1.8800932331109457 38.43354951820502 0.034999847412109375 3 0.9653980596612017 6.615334921296272 4515.0 0.9261538461538463 0.0 - - - - - - - 213.75 9 12 NLGN1 neuroligin 1 267 34 C20140707_OR006_02 C20140707_OR006_02 TB450461.[MT7]-AIAQSGTALSSWAVSFQPAK[MT7].3b8_1.heavy 770.089 / 844.464 4412.0 41.826748847961426 42 16 10 6 10 1.8800932331109457 38.43354951820502 0.034999847412109375 3 0.9653980596612017 6.615334921296272 4412.0 4.853590491238929 0.0 - - - - - - - 246.3 8 10 NLGN1 neuroligin 1 269 35 C20140707_OR006_02 C20140707_OR006_02 TB437310.[MT7]-GAGGGGAGQGAGALARPK[MT7].3y7_1.heavy 580.995 / 856.549 9638.0 19.74650001525879 38 16 4 10 8 2.3113665150072746 36.97702739301108 0.0 4 0.9684996488115223 6.93518410673463 9638.0 108.58000000000001 0.0 - - - - - - - 158.0 19 9 CBX6 chromobox homolog 6 271 35 C20140707_OR006_02 C20140707_OR006_02 TB437310.[MT7]-GAGGGGAGQGAGALARPK[MT7].3b6_1.heavy 580.995 / 501.254 11850.0 19.74650001525879 38 16 4 10 8 2.3113665150072746 36.97702739301108 0.0 4 0.9684996488115223 6.93518410673463 11850.0 58.5 0.0 - - - - - - - 226.46666666666667 23 15 CBX6 chromobox homolog 6 273 35 C20140707_OR006_02 C20140707_OR006_02 TB437310.[MT7]-GAGGGGAGQGAGALARPK[MT7].3b7_1.heavy 580.995 / 572.291 11455.0 19.74650001525879 38 16 4 10 8 2.3113665150072746 36.97702739301108 0.0 4 0.9684996488115223 6.93518410673463 11455.0 24.580952380952386 1.0 - - - - - - - 379.2 45 10 CBX6 chromobox homolog 6 275 35 C20140707_OR006_02 C20140707_OR006_02 TB437310.[MT7]-GAGGGGAGQGAGALARPK[MT7].3y9_1.heavy 580.995 / 984.607 12798.0 19.74650001525879 38 16 4 10 8 2.3113665150072746 36.97702739301108 0.0 4 0.9684996488115223 6.93518410673463 12798.0 158.67899999999997 0.0 - - - - - - - 126.4 25 5 CBX6 chromobox homolog 6 277 36 C20140707_OR006_02 C20140707_OR006_02 TB412157.[MT7]-AEWMIAAQTC[CAM]FK[MT7].3y3_1.heavy 581.965 / 598.314 9322.0 39.88105010986328 40 17 9 6 8 2.927914935882717 34.15399770480411 0.03749847412109375 4 0.9785090348939726 8.4033711145083 9322.0 36.564076432604324 1.0 - - - - - - - 280.6923076923077 31 13 ACSL4 acyl-CoA synthetase long-chain family member 4 279 36 C20140707_OR006_02 C20140707_OR006_02 TB412157.[MT7]-AEWMIAAQTC[CAM]FK[MT7].3b4_1.heavy 581.965 / 662.309 13172.0 39.88105010986328 40 17 9 6 8 2.927914935882717 34.15399770480411 0.03749847412109375 4 0.9785090348939726 8.4033711145083 13172.0 14.840164473684212 0.0 - - - - - - - 303.8333333333333 26 6 ACSL4 acyl-CoA synthetase long-chain family member 4 281 36 C20140707_OR006_02 C20140707_OR006_02 TB412157.[MT7]-AEWMIAAQTC[CAM]FK[MT7].3y4_1.heavy 581.965 / 699.362 6586.0 39.88105010986328 40 17 9 6 8 2.927914935882717 34.15399770480411 0.03749847412109375 4 0.9785090348939726 8.4033711145083 6586.0 15.282815139701103 0.0 - - - - - - - 267.7142857142857 13 14 ACSL4 acyl-CoA synthetase long-chain family member 4 283 36 C20140707_OR006_02 C20140707_OR006_02 TB412157.[MT7]-AEWMIAAQTC[CAM]FK[MT7].3b3_1.heavy 581.965 / 531.268 9727.0 39.88105010986328 40 17 9 6 8 2.927914935882717 34.15399770480411 0.03749847412109375 4 0.9785090348939726 8.4033711145083 9727.0 18.728413922217232 0.0 - - - - - - - 646.0 19 8 ACSL4 acyl-CoA synthetase long-chain family member 4 285 37 C20140707_OR006_02 C20140707_OR006_02 TB437514.[MT7]-GDC[CAM]TVLK[MT7]PTLMAAVPEIMDR.4y4_1.heavy 627.083 / 534.27 3017.0 42.79015064239502 41 20 10 3 8 10.159650508563436 9.84285826719249 0.07040023803710938 4 0.997746990713484 25.99556769298221 3017.0 1.1901960784313725 1.0 - - - - - - - 324.46666666666664 6 15 ACSL4 acyl-CoA synthetase long-chain family member 4 287 37 C20140707_OR006_02 C20140707_OR006_02 TB437514.[MT7]-GDC[CAM]TVLK[MT7]PTLMAAVPEIMDR.4b7_2.heavy 627.083 / 531.796 3504.0 42.79015064239502 41 20 10 3 8 10.159650508563436 9.84285826719249 0.07040023803710938 4 0.997746990713484 25.99556769298221 3504.0 3.298844672657253 0.0 - - - - - - - 750.8571428571429 7 7 ACSL4 acyl-CoA synthetase long-chain family member 4 289 37 C20140707_OR006_02 C20140707_OR006_02 TB437514.[MT7]-GDC[CAM]TVLK[MT7]PTLMAAVPEIMDR.4y6_1.heavy 627.083 / 760.366 8759.0 42.79015064239502 41 20 10 3 8 10.159650508563436 9.84285826719249 0.07040023803710938 4 0.997746990713484 25.99556769298221 8759.0 18.180718849448205 0.0 - - - - - - - 231.1875 17 16 ACSL4 acyl-CoA synthetase long-chain family member 4 291 37 C20140707_OR006_02 C20140707_OR006_02 TB437514.[MT7]-GDC[CAM]TVLK[MT7]PTLMAAVPEIMDR.4b10_2.heavy 627.083 / 687.389 3504.0 42.79015064239502 41 20 10 3 8 10.159650508563436 9.84285826719249 0.07040023803710938 4 0.997746990713484 25.99556769298221 3504.0 4.116299559471366 1.0 - - - - - - - 272.5 7 10 ACSL4 acyl-CoA synthetase long-chain family member 4 293 38 C20140707_OR006_02 C20140707_OR006_02 TB437512.[MT7]-SVTHFDSLAVIDIPGADTLDK[MT7].4y4_1.heavy 626.339 / 620.374 13316.0 41.664798736572266 40 10 10 10 10 1.6050930008936368 56.55388526300837 0.0 3 0.8360331579986118 3.005130185659601 13316.0 16.590781758957654 1.0 - - - - - - - 1154.4444444444443 26 9 ACSL4 acyl-CoA synthetase long-chain family member 4 295 38 C20140707_OR006_02 C20140707_OR006_02 TB437512.[MT7]-SVTHFDSLAVIDIPGADTLDK[MT7].4b4_1.heavy 626.339 / 569.316 5005.0 41.664798736572266 40 10 10 10 10 1.6050930008936368 56.55388526300837 0.0 3 0.8360331579986118 3.005130185659601 5005.0 18.858998129287052 0.0 - - - - - - - 688.2857142857143 10 7 ACSL4 acyl-CoA synthetase long-chain family member 4 297 38 C20140707_OR006_02 C20140707_OR006_02 TB437512.[MT7]-SVTHFDSLAVIDIPGADTLDK[MT7].4y7_1.heavy 626.339 / 863.459 9255.0 41.664798736572266 40 10 10 10 10 1.6050930008936368 56.55388526300837 0.0 3 0.8360331579986118 3.005130185659601 9255.0 21.066720697356097 0.0 - - - - - - - 283.2307692307692 18 13 ACSL4 acyl-CoA synthetase long-chain family member 4 299 38 C20140707_OR006_02 C20140707_OR006_02 TB437512.[MT7]-SVTHFDSLAVIDIPGADTLDK[MT7].4b9_2.heavy 626.339 / 551.786 61385.0 41.664798736572266 40 10 10 10 10 1.6050930008936368 56.55388526300837 0.0 3 0.8360331579986118 3.005130185659601 61385.0 113.99367147206279 0.0 - - - - - - - 321.0 122 10 ACSL4 acyl-CoA synthetase long-chain family member 4 301 39 C20140707_OR006_02 C20140707_OR006_02 TB412299.[MT7]-LSTVVDADEIIVLDQGK[MT7].3b9_1.heavy 701.731 / 1074.54 10351.0 42.71900177001953 44 14 10 10 10 2.145664904890945 37.18087440212031 0.0 3 0.9310350209862099 4.672184331146573 10351.0 65.76038199035197 0.0 - - - - - - - 267.7692307692308 20 13 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 303 39 C20140707_OR006_02 C20140707_OR006_02 TB412299.[MT7]-LSTVVDADEIIVLDQGK[MT7].3b6_1.heavy 701.731 / 759.437 2805.0 42.71900177001953 44 14 10 10 10 2.145664904890945 37.18087440212031 0.0 3 0.9310350209862099 4.672184331146573 2805.0 8.294619559544934 0.0 - - - - - - - 305.15384615384613 5 13 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 305 39 C20140707_OR006_02 C20140707_OR006_02 TB412299.[MT7]-LSTVVDADEIIVLDQGK[MT7].3b5_1.heavy 701.731 / 644.41 5514.0 42.71900177001953 44 14 10 10 10 2.145664904890945 37.18087440212031 0.0 3 0.9310350209862099 4.672184331146573 5514.0 17.41257131159943 0.0 - - - - - - - 299.0 11 11 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 307 39 C20140707_OR006_02 C20140707_OR006_02 TB412299.[MT7]-LSTVVDADEIIVLDQGK[MT7].3y4_1.heavy 701.731 / 591.322 9481.0 42.71900177001953 44 14 10 10 10 2.145664904890945 37.18087440212031 0.0 3 0.9310350209862099 4.672184331146573 9481.0 12.475000000000001 0.0 - - - - - - - 241.7 18 10 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 309 40 C20140707_OR006_02 C20140707_OR006_02 TB412396.[MT7]-YFNNERYEAQRYDGFLK[MT7].4y5_1.heavy 626.067 / 723.416 1015.0 33.49945068359375 32 13 10 5 4 2.657305182817603 37.63210964499292 0.04129791259765625 7 0.9162509874199228 4.234419706711953 1015.0 3.649737532808399 18.0 - - - - - - - 691.0 14 9 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 311 40 C20140707_OR006_02 C20140707_OR006_02 TB412396.[MT7]-YFNNERYEAQRYDGFLK[MT7].4y4_1.heavy 626.067 / 608.389 8883.0 33.49945068359375 32 13 10 5 4 2.657305182817603 37.63210964499292 0.04129791259765625 7 0.9162509874199228 4.234419706711953 8883.0 9.222129310344828 0.0 - - - - - - - 1110.25 17 8 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 313 40 C20140707_OR006_02 C20140707_OR006_02 TB412396.[MT7]-YFNNERYEAQRYDGFLK[MT7].4b9_2.heavy 626.067 / 666.31 2030.0 33.49945068359375 32 13 10 5 4 2.657305182817603 37.63210964499292 0.04129791259765625 7 0.9162509874199228 4.234419706711953 2030.0 4.541102362204725 4.0 - - - - - - - 308.42857142857144 12 7 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 315 40 C20140707_OR006_02 C20140707_OR006_02 TB412396.[MT7]-YFNNERYEAQRYDGFLK[MT7].4b3_1.heavy 626.067 / 569.284 2538.0 33.49945068359375 32 13 10 5 4 2.657305182817603 37.63210964499292 0.04129791259765625 7 0.9162509874199228 4.234419706711953 2538.0 4.880309801987281 5.0 - - - - - - - 244.92857142857142 15 14 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 317 41 C20140707_OR006_02 C20140707_OR006_02 TB436876.[MT7]-LIFLFR.2b3_1.heavy 476.809 / 518.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLSTN1 calsyntenin 1 319 41 C20140707_OR006_02 C20140707_OR006_02 TB436876.[MT7]-LIFLFR.2y4_1.heavy 476.809 / 582.34 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLSTN1 calsyntenin 1 321 41 C20140707_OR006_02 C20140707_OR006_02 TB436876.[MT7]-LIFLFR.2y5_1.heavy 476.809 / 695.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLSTN1 calsyntenin 1 323 41 C20140707_OR006_02 C20140707_OR006_02 TB436876.[MT7]-LIFLFR.2b4_1.heavy 476.809 / 631.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLSTN1 calsyntenin 1 325 42 C20140707_OR006_02 C20140707_OR006_02 TB436874.[MT7]-ALLGGNVR.2y5_1.heavy 472.294 / 502.273 6484.0 26.83899974822998 24 11 0 5 8 2.042825566419522 40.1404928098804 0.045200347900390625 4 0.8609567010479966 3.2705573316300454 6484.0 35.75251784149242 0.0 - - - - - - - 234.5 12 12 ACSL4 acyl-CoA synthetase long-chain family member 4 327 42 C20140707_OR006_02 C20140707_OR006_02 TB436874.[MT7]-ALLGGNVR.2y3_1.heavy 472.294 / 388.23 612.0 26.83899974822998 24 11 0 5 8 2.042825566419522 40.1404928098804 0.045200347900390625 4 0.8609567010479966 3.2705573316300454 612.0 1.6945111178799879 40.0 - - - - - - - 339.77777777777777 5 9 ACSL4 acyl-CoA synthetase long-chain family member 4 329 42 C20140707_OR006_02 C20140707_OR006_02 TB436874.[MT7]-ALLGGNVR.2y6_1.heavy 472.294 / 615.357 2936.0 26.83899974822998 24 11 0 5 8 2.042825566419522 40.1404928098804 0.045200347900390625 4 0.8609567010479966 3.2705573316300454 2936.0 0.23999999999999994 1.0 - - - - - - - 326.0 7 6 ACSL4 acyl-CoA synthetase long-chain family member 4 331 42 C20140707_OR006_02 C20140707_OR006_02 TB436874.[MT7]-ALLGGNVR.2y7_1.heavy 472.294 / 728.441 4649.0 26.83899974822998 24 11 0 5 8 2.042825566419522 40.1404928098804 0.045200347900390625 4 0.8609567010479966 3.2705573316300454 4649.0 22.97933182869666 1.0 - - - - - - - 213.75 79 4 ACSL4 acyl-CoA synthetase long-chain family member 4 333 43 C20140707_OR006_02 C20140707_OR006_02 TB437114.[MT7]-EMVQNLMVLR.3b4_1.heavy 459.589 / 632.319 495.0 39.58365058898926 39 13 10 6 10 2.1538679852493483 35.915273152127654 0.036899566650390625 3 0.9172221935050818 4.259543456940562 495.0 1.0 5.0 - - - - - - - 0.0 0 0 G6PD glucose-6-phosphate dehydrogenase 335 43 C20140707_OR006_02 C20140707_OR006_02 TB437114.[MT7]-EMVQNLMVLR.3b5_1.heavy 459.589 / 746.362 892.0 39.58365058898926 39 13 10 6 10 2.1538679852493483 35.915273152127654 0.036899566650390625 3 0.9172221935050818 4.259543456940562 892.0 11.112457912457913 0.0 - - - - - - - 0.0 1 0 G6PD glucose-6-phosphate dehydrogenase 337 43 C20140707_OR006_02 C20140707_OR006_02 TB437114.[MT7]-EMVQNLMVLR.3b3_1.heavy 459.589 / 504.261 1684.0 39.58365058898926 39 13 10 6 10 2.1538679852493483 35.915273152127654 0.036899566650390625 3 0.9172221935050818 4.259543456940562 1684.0 20.403616161616164 0.0 - - - - - - - 235.125 3 8 G6PD glucose-6-phosphate dehydrogenase 339 43 C20140707_OR006_02 C20140707_OR006_02 TB437114.[MT7]-EMVQNLMVLR.3y4_1.heavy 459.589 / 518.312 3567.0 39.58365058898926 39 13 10 6 10 2.1538679852493483 35.915273152127654 0.036899566650390625 3 0.9172221935050818 4.259543456940562 3567.0 69.97084848484849 0.0 - - - - - - - 113.14285714285714 7 7 G6PD glucose-6-phosphate dehydrogenase 341 44 C20140707_OR006_02 C20140707_OR006_02 TB411918.[MT7]-VDALDHFQK[MT7].2y4_1.heavy 680.877 / 703.401 1651.0 29.176366170247395 26 11 6 5 4 1.4866126156238952 67.2670196317636 0.04549980163574219 8 0.8753359013897076 3.458383213824247 1651.0 17.29 0.0 - - - - - - - 254.0 3 8 DNTT deoxynucleotidyltransferase, terminal 343 44 C20140707_OR006_02 C20140707_OR006_02 TB411918.[MT7]-VDALDHFQK[MT7].2y8_2.heavy 680.877 / 559.292 N/A 29.176366170247395 26 11 6 5 4 1.4866126156238952 67.2670196317636 0.04549980163574219 8 0.8753359013897076 3.458383213824247 2921.0 0.47277777777777763 1.0 - - - - - - - 232.83333333333334 11 6 DNTT deoxynucleotidyltransferase, terminal 345 44 C20140707_OR006_02 C20140707_OR006_02 TB411918.[MT7]-VDALDHFQK[MT7].2y3_1.heavy 680.877 / 566.342 762.0 29.176366170247395 26 11 6 5 4 1.4866126156238952 67.2670196317636 0.04549980163574219 8 0.8753359013897076 3.458383213824247 762.0 3.03 11.0 - - - - - - - 272.14285714285717 4 7 DNTT deoxynucleotidyltransferase, terminal 347 44 C20140707_OR006_02 C20140707_OR006_02 TB411918.[MT7]-VDALDHFQK[MT7].2b5_1.heavy 680.877 / 658.353 3937.0 29.176366170247395 26 11 6 5 4 1.4866126156238952 67.2670196317636 0.04549980163574219 8 0.8753359013897076 3.458383213824247 3937.0 5.1519047619047615 0.0 - - - - - - - 689.4285714285714 7 7 DNTT deoxynucleotidyltransferase, terminal 349 45 C20140707_OR006_02 C20140707_OR006_02 TB437115.[MT7]-GPTEADELMK[MT7].3y3_1.heavy 460.242 / 535.339 1998.0 28.42365026473999 27 14 0 5 8 1.3120815001074875 50.60171853135914 0.04260063171386719 4 0.9419513876660025 5.097331482020616 1998.0 7.837026923076923 1.0 - - - - - - - 249.88888888888889 3 9 G6PD glucose-6-phosphate dehydrogenase 351 45 C20140707_OR006_02 C20140707_OR006_02 TB437115.[MT7]-GPTEADELMK[MT7].3b6_1.heavy 460.242 / 715.338 1748.0 28.42365026473999 27 14 0 5 8 1.3120815001074875 50.60171853135914 0.04260063171386719 4 0.9419513876660025 5.097331482020616 1748.0 11.152239999999999 0.0 - - - - - - - 229.16666666666666 3 6 G6PD glucose-6-phosphate dehydrogenase 353 45 C20140707_OR006_02 C20140707_OR006_02 TB437115.[MT7]-GPTEADELMK[MT7].3b4_1.heavy 460.242 / 529.274 2123.0 28.42365026473999 27 14 0 5 8 1.3120815001074875 50.60171853135914 0.04260063171386719 4 0.9419513876660025 5.097331482020616 2123.0 8.275318007117438 2.0 - - - - - - - 272.6363636363636 20 11 G6PD glucose-6-phosphate dehydrogenase 355 45 C20140707_OR006_02 C20140707_OR006_02 TB437115.[MT7]-GPTEADELMK[MT7].3b7_1.heavy 460.242 / 844.38 999.0 28.42365026473999 27 14 0 5 8 1.3120815001074875 50.60171853135914 0.04260063171386719 4 0.9419513876660025 5.097331482020616 999.0 5.115392307692307 0.0 - - - - - - - 0.0 1 0 G6PD glucose-6-phosphate dehydrogenase 357 46 C20140707_OR006_02 C20140707_OR006_02 TB437306.[MT7]-QTGALMASSPQDIK[MT7].3b6_1.heavy 578.981 / 746.399 N/A 28.934200286865234 41 17 4 10 10 2.7446825219181212 36.43408634748583 0.0 3 0.973687711005263 7.591474782806112 26217.0 15.355611882273372 3.0 - - - - - - - 228.0 329 5 DNTT deoxynucleotidyltransferase, terminal 359 46 C20140707_OR006_02 C20140707_OR006_02 TB437306.[MT7]-QTGALMASSPQDIK[MT7].3b4_1.heavy 578.981 / 502.274 63200.0 28.934200286865234 41 17 4 10 10 2.7446825219181212 36.43408634748583 0.0 3 0.973687711005263 7.591474782806112 63200.0 154.93007958155354 0.0 - - - - - - - 651.5714285714286 126 7 DNTT deoxynucleotidyltransferase, terminal 361 46 C20140707_OR006_02 C20140707_OR006_02 TB437306.[MT7]-QTGALMASSPQDIK[MT7].3b5_1.heavy 578.981 / 615.358 95370.0 28.934200286865234 41 17 4 10 10 2.7446825219181212 36.43408634748583 0.0 3 0.973687711005263 7.591474782806112 95370.0 339.78566503870735 0.0 - - - - - - - 316.5 190 4 DNTT deoxynucleotidyltransferase, terminal 363 46 C20140707_OR006_02 C20140707_OR006_02 TB437306.[MT7]-QTGALMASSPQDIK[MT7].3y5_1.heavy 578.981 / 744.437 50915.0 28.934200286865234 41 17 4 10 10 2.7446825219181212 36.43408634748583 0.0 3 0.973687711005263 7.591474782806112 50915.0 139.31742289224246 0.0 - - - - - - - 295.6666666666667 101 6 DNTT deoxynucleotidyltransferase, terminal 365 47 C20140707_OR006_02 C20140707_OR006_02 TB449930.[MT7]-VDALDHFQK[MT7].3y3_1.heavy 454.254 / 566.342 18970.0 29.172574520111084 40 17 10 5 8 3.7794316571955306 20.0238635886433 0.04549980163574219 4 0.9739966258873427 7.636632743178909 18970.0 87.8418112644005 0.0 - - - - - - - 249.2 37 10 DNTT deoxynucleotidyltransferase, terminal 367 47 C20140707_OR006_02 C20140707_OR006_02 TB449930.[MT7]-VDALDHFQK[MT7].3b4_1.heavy 454.254 / 543.326 5098.0 29.172574520111084 40 17 10 5 8 3.7794316571955306 20.0238635886433 0.04549980163574219 4 0.9739966258873427 7.636632743178909 5098.0 14.837925587550965 1.0 - - - - - - - 355.6 13 5 DNTT deoxynucleotidyltransferase, terminal 369 47 C20140707_OR006_02 C20140707_OR006_02 TB449930.[MT7]-VDALDHFQK[MT7].3b5_1.heavy 454.254 / 658.353 17903.0 29.172574520111084 40 17 10 5 8 3.7794316571955306 20.0238635886433 0.04549980163574219 4 0.9739966258873427 7.636632743178909 17903.0 185.17459493909925 0.0 - - - - - - - 166.4 35 5 DNTT deoxynucleotidyltransferase, terminal 371 47 C20140707_OR006_02 C20140707_OR006_02 TB449930.[MT7]-VDALDHFQK[MT7].3y4_1.heavy 454.254 / 703.401 1186.0 29.172574520111084 40 17 10 5 8 3.7794316571955306 20.0238635886433 0.04549980163574219 4 0.9739966258873427 7.636632743178909 1186.0 12.267054102539891 0.0 - - - - - - - 190.0 2 5 DNTT deoxynucleotidyltransferase, terminal 373 48 C20140707_OR006_02 C20140707_OR006_02 TB450451.[MT7]-LQFHDVAGDIFHQQC[CAM]K[MT7].4y4_1.heavy 558.537 / 707.363 23106.0 35.587501525878906 42 12 10 10 10 1.073466411697877 55.80439433773375 0.0 3 0.8960345879990154 3.793861322217197 23106.0 69.13606299212599 0.0 - - - - - - - 238.125 46 8 G6PD glucose-6-phosphate dehydrogenase 375 48 C20140707_OR006_02 C20140707_OR006_02 TB450451.[MT7]-LQFHDVAGDIFHQQC[CAM]K[MT7].4b5_1.heavy 558.537 / 785.406 8760.0 35.587501525878906 42 12 10 10 10 1.073466411697877 55.80439433773375 0.0 3 0.8960345879990154 3.793861322217197 8760.0 52.76692913385827 0.0 - - - - - - - 254.0 17 10 G6PD glucose-6-phosphate dehydrogenase 377 48 C20140707_OR006_02 C20140707_OR006_02 TB450451.[MT7]-LQFHDVAGDIFHQQC[CAM]K[MT7].4b9_2.heavy 558.537 / 564.284 39991.0 35.587501525878906 42 12 10 10 10 1.073466411697877 55.80439433773375 0.0 3 0.8960345879990154 3.793861322217197 39991.0 58.37858545313414 1.0 - - - - - - - 235.85714285714286 83 7 G6PD glucose-6-phosphate dehydrogenase 379 48 C20140707_OR006_02 C20140707_OR006_02 TB450451.[MT7]-LQFHDVAGDIFHQQC[CAM]K[MT7].4b3_1.heavy 558.537 / 533.32 38975.0 35.587501525878906 42 12 10 10 10 1.073466411697877 55.80439433773375 0.0 3 0.8960345879990154 3.793861322217197 38975.0 181.06496062992127 0.0 - - - - - - - 242.45454545454547 77 11 G6PD glucose-6-phosphate dehydrogenase 381 49 C20140707_OR006_02 C20140707_OR006_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 295158.0 18.888999938964844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 295158.0 1209.6831433264888 0.0 - - - - - - - 239.8 590 5 383 49 C20140707_OR006_02 C20140707_OR006_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 160389.0 18.888999938964844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 160389.0 2337.6707456875833 0.0 - - - - - - - 265.72727272727275 320 11 385 49 C20140707_OR006_02 C20140707_OR006_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 169304.0 18.888999938964844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 169304.0 1121.9898836921552 0.0 - - - - - - - 247.4 338 10 387 50 C20140707_OR006_02 C20140707_OR006_02 TB450194.[MT7]-AEAEAVSVLVK[MT7].3b6_1.heavy 468.616 / 715.374 884.0 33.540300369262695 38 13 10 5 10 0.9402991788689553 65.57256842789793 0.040401458740234375 3 0.9094394373335244 4.069672882609419 884.0 7.0148731289823925 1.0 - - - - - - - 266.6666666666667 2 9 DNTT deoxynucleotidyltransferase, terminal 389 50 C20140707_OR006_02 C20140707_OR006_02 TB450194.[MT7]-AEAEAVSVLVK[MT7].3y3_1.heavy 468.616 / 503.367 6441.0 33.540300369262695 38 13 10 5 10 0.9402991788689553 65.57256842789793 0.040401458740234375 3 0.9094394373335244 4.069672882609419 6441.0 51.878241395568125 0.0 - - - - - - - 584.0 12 8 DNTT deoxynucleotidyltransferase, terminal 391 50 C20140707_OR006_02 C20140707_OR006_02 TB450194.[MT7]-AEAEAVSVLVK[MT7].3b4_1.heavy 468.616 / 545.269 4420.0 33.540300369262695 38 13 10 5 10 0.9402991788689553 65.57256842789793 0.040401458740234375 3 0.9094394373335244 4.069672882609419 4420.0 37.77460317460317 0.0 - - - - - - - 157.75 8 8 DNTT deoxynucleotidyltransferase, terminal 393 50 C20140707_OR006_02 C20140707_OR006_02 TB450194.[MT7]-AEAEAVSVLVK[MT7].3b5_1.heavy 468.616 / 616.306 7199.0 33.540300369262695 38 13 10 5 10 0.9402991788689553 65.57256842789793 0.040401458740234375 3 0.9094394373335244 4.069672882609419 7199.0 59.79116681325124 0.0 - - - - - - - 189.33333333333334 14 6 DNTT deoxynucleotidyltransferase, terminal 395 51 C20140707_OR006_02 C20140707_OR006_02 TB450191.[MT7]-LHAVPAGNTVK[MT7].3y7_1.heavy 465.617 / 830.485 1118.0 22.311199188232422 48 18 10 10 10 5.899396256450944 16.950887116736865 0.0 3 0.9892494037500821 11.892036888389763 1118.0 25.09 0.0 - - - - - - - 103.2 2 5 FGFR4 fibroblast growth factor receptor 4 397 51 C20140707_OR006_02 C20140707_OR006_02 TB450191.[MT7]-LHAVPAGNTVK[MT7].3y3_1.heavy 465.617 / 491.331 3697.0 22.311199188232422 48 18 10 10 10 5.899396256450944 16.950887116736865 0.0 3 0.9892494037500821 11.892036888389763 3697.0 34.60563953488372 0.0 - - - - - - - 181.55555555555554 7 9 FGFR4 fibroblast growth factor receptor 4 399 51 C20140707_OR006_02 C20140707_OR006_02 TB450191.[MT7]-LHAVPAGNTVK[MT7].3b4_1.heavy 465.617 / 565.358 6965.0 22.311199188232422 48 18 10 10 10 5.899396256450944 16.950887116736865 0.0 3 0.9892494037500821 11.892036888389763 6965.0 38.13202519379845 0.0 - - - - - - - 250.1818181818182 13 11 FGFR4 fibroblast growth factor receptor 4 401 51 C20140707_OR006_02 C20140707_OR006_02 TB450191.[MT7]-LHAVPAGNTVK[MT7].3y4_1.heavy 465.617 / 605.374 1720.0 22.311199188232422 48 18 10 10 10 5.899396256450944 16.950887116736865 0.0 3 0.9892494037500821 11.892036888389763 1720.0 9.8 1.0 - - - - - - - 227.28571428571428 3 14 FGFR4 fibroblast growth factor receptor 4 403 52 C20140707_OR006_02 C20140707_OR006_02 TB437308.[MT7]-MAQSVVEVMEDSK[MT7].3b5_1.heavy 580.963 / 661.346 42586.0 39.413700103759766 46 16 10 10 10 2.1904033686065723 31.91797459882578 0.0 3 0.9632221179686244 6.415476365365059 42586.0 229.4687081008771 0.0 - - - - - - - 237.9090909090909 85 11 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 405 52 C20140707_OR006_02 C20140707_OR006_02 TB437308.[MT7]-MAQSVVEVMEDSK[MT7].3y4_1.heavy 580.963 / 622.316 51270.0 39.413700103759766 46 16 10 10 10 2.1904033686065723 31.91797459882578 0.0 3 0.9632221179686244 6.415476365365059 51270.0 303.4416699348969 0.0 - - - - - - - 235.625 102 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 407 52 C20140707_OR006_02 C20140707_OR006_02 TB437308.[MT7]-MAQSVVEVMEDSK[MT7].3y5_1.heavy 580.963 / 753.357 34529.0 39.413700103759766 46 16 10 10 10 2.1904033686065723 31.91797459882578 0.0 3 0.9632221179686244 6.415476365365059 34529.0 177.25618016812854 0.0 - - - - - - - 233.69230769230768 69 13 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 409 52 C20140707_OR006_02 C20140707_OR006_02 TB437308.[MT7]-MAQSVVEVMEDSK[MT7].3b7_1.heavy 580.963 / 889.457 29297.0 39.413700103759766 46 16 10 10 10 2.1904033686065723 31.91797459882578 0.0 3 0.9632221179686244 6.415476365365059 29297.0 196.7898201459387 0.0 - - - - - - - 261.8 58 10 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 411 53 C20140707_OR006_02 C20140707_OR006_02 TB450198.[MT7]-EPFTISVWMR.2y8_1.heavy 705.372 / 1039.54 1810.0 44.49400043487549 42 20 10 2 10 8.363603871195084 11.956568189989001 0.08800125122070312 3 0.9994265964001904 51.53608311138314 1810.0 10.351281133564598 1.0 - - - - - - - 247.8 3 10 CLSTN1 calsyntenin 1 413 53 C20140707_OR006_02 C20140707_OR006_02 TB450198.[MT7]-EPFTISVWMR.2y5_1.heavy 705.372 / 678.339 1810.0 44.49400043487549 42 20 10 2 10 8.363603871195084 11.956568189989001 0.08800125122070312 3 0.9994265964001904 51.53608311138314 1810.0 11.034993575977827 0.0 - - - - - - - 190.54545454545453 3 11 CLSTN1 calsyntenin 1 415 53 C20140707_OR006_02 C20140707_OR006_02 TB450198.[MT7]-EPFTISVWMR.2y9_1.heavy 705.372 / 1136.59 12098.0 44.49400043487549 42 20 10 2 10 8.363603871195084 11.956568189989001 0.08800125122070312 3 0.9994265964001904 51.53608311138314 12098.0 43.85183661493888 0.0 - - - - - - - 285.9 24 10 CLSTN1 calsyntenin 1 417 53 C20140707_OR006_02 C20140707_OR006_02 TB450198.[MT7]-EPFTISVWMR.2y7_1.heavy 705.372 / 892.471 1905.0 44.49400043487549 42 20 10 2 10 8.363603871195084 11.956568189989001 0.08800125122070312 3 0.9994265964001904 51.53608311138314 1905.0 7.483928571428571 0.0 - - - - - - - 266.6666666666667 3 15 CLSTN1 calsyntenin 1 419 54 C20140707_OR006_02 C20140707_OR006_02 TB412167.[MT7]-RQLGQGAYGIVWK[MT7].4b7_1.heavy 441.759 / 855.492 1413.0 33.73743184407552 35 10 10 5 10 0.9951249572708071 72.00347639264521 0.041500091552734375 3 0.8299155602843488 2.94898825204161 1413.0 13.246875 0.0 - - - - - - - 192.25 2 4 MAPK15 mitogen-activated protein kinase 15 421 54 C20140707_OR006_02 C20140707_OR006_02 TB412167.[MT7]-RQLGQGAYGIVWK[MT7].4b9_1.heavy 441.759 / 1075.58 N/A 33.73743184407552 35 10 10 5 10 0.9951249572708071 72.00347639264521 0.041500091552734375 3 0.8299155602843488 2.94898825204161 0.0 0.0 5.0 - - - - - - - 0.0 0 0 MAPK15 mitogen-activated protein kinase 15 423 54 C20140707_OR006_02 C20140707_OR006_02 TB412167.[MT7]-RQLGQGAYGIVWK[MT7].4b6_1.heavy 441.759 / 784.455 514.0 33.73743184407552 35 10 10 5 10 0.9951249572708071 72.00347639264521 0.041500091552734375 3 0.8299155602843488 2.94898825204161 514.0 7.71 0.0 - - - - - - - 0.0 1 0 MAPK15 mitogen-activated protein kinase 15 425 54 C20140707_OR006_02 C20140707_OR006_02 TB412167.[MT7]-RQLGQGAYGIVWK[MT7].4b9_2.heavy 441.759 / 538.292 4754.0 33.73743184407552 35 10 10 5 10 0.9951249572708071 72.00347639264521 0.041500091552734375 3 0.8299155602843488 2.94898825204161 4754.0 59.425000000000004 0.0 - - - - - - - 128.0 9 5 MAPK15 mitogen-activated protein kinase 15 427 55 C20140707_OR006_02 C20140707_OR006_02 TB450195.[MT7]-AEAEAVSVLVK[MT7].2y5_1.heavy 702.421 / 689.468 2021.0 33.52009963989258 47 17 10 10 10 3.712182661775342 26.938329578904735 0.0 3 0.9724858508347081 7.423068947495539 2021.0 0.20308364872232632 1.0 - - - - - - - 685.5714285714286 5 7 DNTT deoxynucleotidyltransferase, terminal 429 55 C20140707_OR006_02 C20140707_OR006_02 TB450195.[MT7]-AEAEAVSVLVK[MT7].2b4_1.heavy 702.421 / 545.269 2021.0 33.52009963989258 47 17 10 10 10 3.712182661775342 26.938329578904735 0.0 3 0.9724858508347081 7.423068947495539 2021.0 1.9197678183827507 2.0 - - - - - - - 631.3333333333334 4 9 DNTT deoxynucleotidyltransferase, terminal 431 55 C20140707_OR006_02 C20140707_OR006_02 TB450195.[MT7]-AEAEAVSVLVK[MT7].2b6_1.heavy 702.421 / 715.374 631.0 33.52009963989258 47 17 10 10 10 3.712182661775342 26.938329578904735 0.0 3 0.9724858508347081 7.423068947495539 631.0 1.1989445910290237 10.0 - - - - - - - 252.625 2 8 DNTT deoxynucleotidyltransferase, terminal 433 55 C20140707_OR006_02 C20140707_OR006_02 TB450195.[MT7]-AEAEAVSVLVK[MT7].2b5_1.heavy 702.421 / 616.306 3663.0 33.52009963989258 47 17 10 10 10 3.712182661775342 26.938329578904735 0.0 3 0.9724858508347081 7.423068947495539 3663.0 10.539151179497898 0.0 - - - - - - - 667.5714285714286 7 7 DNTT deoxynucleotidyltransferase, terminal 435 56 C20140707_OR006_02 C20140707_OR006_02 TB450053.[MT7]-TLSDIVSK[MT7].2y4_1.heavy 575.85 / 590.399 8510.0 30.523300170898438 47 17 10 10 10 4.961383713667676 20.15566740474414 0.0 3 0.9798917962363723 8.688509755752854 8510.0 26.691469816272967 0.0 - - - - - - - 239.88888888888889 17 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 437 56 C20140707_OR006_02 C20140707_OR006_02 TB450053.[MT7]-TLSDIVSK[MT7].2b4_1.heavy 575.85 / 561.3 12320.0 30.523300170898438 47 17 10 10 10 4.961383713667676 20.15566740474414 0.0 3 0.9798917962363723 8.688509755752854 12320.0 29.829921259842518 0.0 - - - - - - - 650.875 24 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 439 56 C20140707_OR006_02 C20140707_OR006_02 TB450053.[MT7]-TLSDIVSK[MT7].2y6_1.heavy 575.85 / 792.458 4827.0 30.523300170898438 47 17 10 10 10 4.961383713667676 20.15566740474414 0.0 3 0.9798917962363723 8.688509755752854 4827.0 9.121889763779528 0.0 - - - - - - - 290.2857142857143 9 7 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 441 56 C20140707_OR006_02 C20140707_OR006_02 TB450053.[MT7]-TLSDIVSK[MT7].2y7_1.heavy 575.85 / 905.542 7367.0 30.523300170898438 47 17 10 10 10 4.961383713667676 20.15566740474414 0.0 3 0.9798917962363723 8.688509755752854 7367.0 38.2851968503937 0.0 - - - - - - - 268.1111111111111 14 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 443 57 C20140707_OR006_02 C20140707_OR006_02 TB450051.[MT7]-TPPIAVQK[MT7].2y4_1.heavy 571.363 / 589.379 10784.0 25.591899871826172 36 11 10 5 10 1.6455277428071098 55.62578737616831 0.041400909423828125 3 0.8671305209484131 3.347491048352139 10784.0 41.24715779795425 0.0 - - - - - - - 205.4 21 10 DNTT deoxynucleotidyltransferase, terminal 445 57 C20140707_OR006_02 C20140707_OR006_02 TB450051.[MT7]-TPPIAVQK[MT7].2y3_1.heavy 571.363 / 518.342 6162.0 25.591899871826172 36 11 10 5 10 1.6455277428071098 55.62578737616831 0.041400909423828125 3 0.8671305209484131 3.347491048352139 6162.0 21.28963503649635 0.0 - - - - - - - 242.8181818181818 12 11 DNTT deoxynucleotidyltransferase, terminal 447 57 C20140707_OR006_02 C20140707_OR006_02 TB450051.[MT7]-TPPIAVQK[MT7].2y6_1.heavy 571.363 / 799.516 12017.0 25.591899871826172 36 11 10 5 10 1.6455277428071098 55.62578737616831 0.041400909423828125 3 0.8671305209484131 3.347491048352139 12017.0 128.37321068338937 0.0 - - - - - - - 220.0 24 7 DNTT deoxynucleotidyltransferase, terminal 449 57 C20140707_OR006_02 C20140707_OR006_02 TB450051.[MT7]-TPPIAVQK[MT7].2y7_1.heavy 571.363 / 896.569 43240.0 25.591899871826172 36 11 10 5 10 1.6455277428071098 55.62578737616831 0.041400909423828125 3 0.8671305209484131 3.347491048352139 43240.0 207.1101824245793 0.0 - - - - - - - 159.88888888888889 86 9 DNTT deoxynucleotidyltransferase, terminal 451 58 C20140707_OR006_02 C20140707_OR006_02 TB411966.[MT7]-SSIFDADEEK[MT7].2y5_1.heavy 714.858 / 735.364 3559.0 29.296899795532227 44 14 10 10 10 2.042418625826842 35.23549472467536 0.0 3 0.9417908003882804 5.090225771363317 3559.0 25.221259842519686 0.0 - - - - - - - 279.4 7 5 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 453 58 C20140707_OR006_02 C20140707_OR006_02 TB411966.[MT7]-SSIFDADEEK[MT7].2y3_1.heavy 714.858 / 549.3 4321.0 29.296899795532227 44 14 10 10 10 2.042418625826842 35.23549472467536 0.0 3 0.9417908003882804 5.090225771363317 4321.0 8.613371998224991 0.0 - - - - - - - 211.66666666666666 8 6 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 455 58 C20140707_OR006_02 C20140707_OR006_02 TB411966.[MT7]-SSIFDADEEK[MT7].2b5_1.heavy 714.858 / 694.353 7498.0 29.296899795532227 44 14 10 10 10 2.042418625826842 35.23549472467536 0.0 3 0.9417908003882804 5.090225771363317 7498.0 17.704073229378437 0.0 - - - - - - - 242.45454545454547 14 11 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 457 58 C20140707_OR006_02 C20140707_OR006_02 TB411966.[MT7]-SSIFDADEEK[MT7].2y7_1.heavy 714.858 / 997.459 5465.0 29.296899795532227 44 14 10 10 10 2.042418625826842 35.23549472467536 0.0 3 0.9417908003882804 5.090225771363317 5465.0 20.781994286264677 0.0 - - - - - - - 254.0 10 5 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 459 59 C20140707_OR006_02 C20140707_OR006_02 TB437539.[MT7]-GLGAPLTLC[CAM]MLGC[CAM]LLQAGHVLSQK[MT7].4y4_1.heavy 707.141 / 619.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 461 59 C20140707_OR006_02 C20140707_OR006_02 TB437539.[MT7]-GLGAPLTLC[CAM]MLGC[CAM]LLQAGHVLSQK[MT7].4y7_1.heavy 707.141 / 912.538 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 463 59 C20140707_OR006_02 C20140707_OR006_02 TB437539.[MT7]-GLGAPLTLC[CAM]MLGC[CAM]LLQAGHVLSQK[MT7].4y3_1.heavy 707.141 / 506.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 465 59 C20140707_OR006_02 C20140707_OR006_02 TB437539.[MT7]-GLGAPLTLC[CAM]MLGC[CAM]LLQAGHVLSQK[MT7].4b6_1.heavy 707.141 / 653.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 467 60 C20140707_OR006_02 C20140707_OR006_02 TB411964.[MT7]-LK[MT7]LEDFFAR.3y7_1.heavy 476.281 / 897.446 1345.0 40.90884971618652 42 16 10 6 10 3.8402950326543466 26.039666002140912 0.033100128173828125 3 0.9646727682667685 6.546673300837155 1345.0 16.8125 0.0 - - - - - - - 336.5 2 2 G6PD glucose-6-phosphate dehydrogenase 469 60 C20140707_OR006_02 C20140707_OR006_02 TB411964.[MT7]-LK[MT7]LEDFFAR.3y6_1.heavy 476.281 / 784.362 481.0 40.90884971618652 42 16 10 6 10 3.8402950326543466 26.039666002140912 0.033100128173828125 3 0.9646727682667685 6.546673300837155 481.0 4.709791666666667 1.0 - - - - - - - 0.0 1 0 G6PD glucose-6-phosphate dehydrogenase 471 60 C20140707_OR006_02 C20140707_OR006_02 TB411964.[MT7]-LK[MT7]LEDFFAR.3y4_1.heavy 476.281 / 540.293 7400.0 40.90884971618652 42 16 10 6 10 3.8402950326543466 26.039666002140912 0.033100128173828125 3 0.9646727682667685 6.546673300837155 7400.0 72.7866358689152 2.0 - - - - - - - 216.125 16 8 G6PD glucose-6-phosphate dehydrogenase 473 60 C20140707_OR006_02 C20140707_OR006_02 TB411964.[MT7]-LK[MT7]LEDFFAR.3y5_1.heavy 476.281 / 655.32 2403.0 40.90884971618652 42 16 10 6 10 3.8402950326543466 26.039666002140912 0.033100128173828125 3 0.9646727682667685 6.546673300837155 2403.0 25.03125 1.0 - - - - - - - 320.3333333333333 4 3 G6PD glucose-6-phosphate dehydrogenase 475 61 C20140707_OR006_02 C20140707_OR006_02 TB450245.[MT7]-QLAQIEMDLK[MT7].2y4_1.heavy 738.92 / 650.366 4843.0 37.602699279785156 47 17 10 10 10 2.569993013488327 30.907676427127264 0.0 3 0.9751418641671793 7.811317977610743 4843.0 38.10394935927127 0.0 - - - - - - - 297.1666666666667 9 6 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 477 61 C20140707_OR006_02 C20140707_OR006_02 TB450245.[MT7]-QLAQIEMDLK[MT7].2y8_1.heavy 738.92 / 1091.59 8284.0 37.602699279785156 47 17 10 10 10 2.569993013488327 30.907676427127264 0.0 3 0.9751418641671793 7.811317977610743 8284.0 112.19275590551183 0.0 - - - - - - - 178.1 16 10 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 479 61 C20140707_OR006_02 C20140707_OR006_02 TB450245.[MT7]-QLAQIEMDLK[MT7].2y5_1.heavy 738.92 / 779.409 4843.0 37.602699279785156 47 17 10 10 10 2.569993013488327 30.907676427127264 0.0 3 0.9751418641671793 7.811317977610743 4843.0 18.248214522807377 0.0 - - - - - - - 254.66666666666666 9 6 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 481 61 C20140707_OR006_02 C20140707_OR006_02 TB450245.[MT7]-QLAQIEMDLK[MT7].2b4_1.heavy 738.92 / 585.348 9940.0 37.602699279785156 47 17 10 10 10 2.569993013488327 30.907676427127264 0.0 3 0.9751418641671793 7.811317977610743 9940.0 71.84873402277516 1.0 - - - - - - - 198.0 25 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 483 62 C20140707_OR006_02 C20140707_OR006_02 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 309574.0 38.037601470947266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 309574.0 1346.5886841865731 0.0 - - - - - - - 239.25 619 4 485 62 C20140707_OR006_02 C20140707_OR006_02 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 190757.0 38.037601470947266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 190757.0 214.90626016260163 0.0 - - - - - - - 255.33333333333334 381 6 487 62 C20140707_OR006_02 C20140707_OR006_02 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 275709.0 38.037601470947266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 275709.0 772.2540840603706 0.0 - - - - - - - 383.0 551 1 489 63 C20140707_OR006_02 C20140707_OR006_02 TB437125.[MT7]-GNSGQFLDAAK[MT7].2b8_1.heavy 698.377 / 963.465 4727.0 27.536049842834473 37 12 10 5 10 0.978888556600683 65.0633826882364 0.04509925842285156 3 0.8818903213123203 3.5550801883807277 4727.0 23.797059985469076 0.0 - - - - - - - 242.33333333333334 9 6 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 491 63 C20140707_OR006_02 C20140707_OR006_02 TB437125.[MT7]-GNSGQFLDAAK[MT7].2y4_1.heavy 698.377 / 548.316 2303.0 27.536049842834473 37 12 10 5 10 0.978888556600683 65.0633826882364 0.04509925842285156 3 0.8818903213123203 3.5550801883807277 2303.0 11.593955816910363 0.0 - - - - - - - 242.33333333333334 4 6 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 493 63 C20140707_OR006_02 C20140707_OR006_02 TB437125.[MT7]-GNSGQFLDAAK[MT7].2b6_1.heavy 698.377 / 735.354 1939.0 27.536049842834473 37 12 10 5 10 0.978888556600683 65.0633826882364 0.04509925842285156 3 0.8818903213123203 3.5550801883807277 1939.0 6.809711169804891 0.0 - - - - - - - 181.625 3 8 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 495 63 C20140707_OR006_02 C20140707_OR006_02 TB437125.[MT7]-GNSGQFLDAAK[MT7].2b5_1.heavy 698.377 / 588.286 2545.0 27.536049842834473 37 12 10 5 10 0.978888556600683 65.0633826882364 0.04509925842285156 3 0.8818903213123203 3.5550801883807277 2545.0 10.31653542414681 0.0 - - - - - - - 202.0 5 3 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 497 64 C20140707_OR006_02 C20140707_OR006_02 TB450046.[MT7]-ARAQAEALR.2b8_1.heavy 565.332 / 955.544 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBX6 chromobox homolog 6 499 64 C20140707_OR006_02 C20140707_OR006_02 TB450046.[MT7]-ARAQAEALR.2b6_1.heavy 565.332 / 771.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBX6 chromobox homolog 6 501 64 C20140707_OR006_02 C20140707_OR006_02 TB450046.[MT7]-ARAQAEALR.2b7_1.heavy 565.332 / 842.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBX6 chromobox homolog 6 503 64 C20140707_OR006_02 C20140707_OR006_02 TB450046.[MT7]-ARAQAEALR.2y7_1.heavy 565.332 / 758.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - CBX6 chromobox homolog 6 505 65 C20140707_OR006_02 C20140707_OR006_02 TB450343.[MT7]-DLADLVSEMEVMK[MT7].2y8_1.heavy 884.459 / 1096.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 507 65 C20140707_OR006_02 C20140707_OR006_02 TB450343.[MT7]-DLADLVSEMEVMK[MT7].2b4_1.heavy 884.459 / 559.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 509 65 C20140707_OR006_02 C20140707_OR006_02 TB450343.[MT7]-DLADLVSEMEVMK[MT7].2b5_1.heavy 884.459 / 672.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 511 65 C20140707_OR006_02 C20140707_OR006_02 TB450343.[MT7]-DLADLVSEMEVMK[MT7].2y7_1.heavy 884.459 / 997.482 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 513 66 C20140707_OR006_02 C20140707_OR006_02 TB437020.[MT7]-SNLSYNTK[MT7].2y4_1.heavy 607.835 / 669.369 5744.0 20.72527503967285 42 16 10 6 10 2.3228866963755843 33.802729000620815 0.03730010986328125 3 0.969914417433447 7.097219997022766 5744.0 28.2101775147929 0.0 - - - - - - - 168.64285714285714 11 14 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 515 66 C20140707_OR006_02 C20140707_OR006_02 TB437020.[MT7]-SNLSYNTK[MT7].2y5_1.heavy 607.835 / 756.401 15374.0 20.72527503967285 42 16 10 6 10 2.3228866963755843 33.802729000620815 0.03730010986328125 3 0.969914417433447 7.097219997022766 15374.0 49.048214990138064 0.0 - - - - - - - 221.5625 30 16 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 517 66 C20140707_OR006_02 C20140707_OR006_02 TB437020.[MT7]-SNLSYNTK[MT7].2y3_1.heavy 607.835 / 506.306 6336.0 20.72527503967285 42 16 10 6 10 2.3228866963755843 33.802729000620815 0.03730010986328125 3 0.969914417433447 7.097219997022766 6336.0 45.48923076923077 0.0 - - - - - - - 225.16666666666666 12 12 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 519 66 C20140707_OR006_02 C20140707_OR006_02 TB437020.[MT7]-SNLSYNTK[MT7].2y7_1.heavy 607.835 / 983.528 7518.0 20.72527503967285 42 16 10 6 10 2.3228866963755843 33.802729000620815 0.03730010986328125 3 0.969914417433447 7.097219997022766 7518.0 78.2198224852071 0.0 - - - - - - - 204.0 15 12 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 521 67 C20140707_OR006_02 C20140707_OR006_02 TB437128.[MT7]-GMQYLESRK[MT7].3y6_1.heavy 467.258 / 939.538 211.0 25.770150661468506 35 15 9 5 6 21.338813920365297 4.686296078741386 0.04220008850097656 5 0.9562969560027608 5.881824101723408 211.0 2.4114285714285715 3.0 - - - - - - - 0.0 0 0 FGFR4 fibroblast growth factor receptor 4 523 67 C20140707_OR006_02 C20140707_OR006_02 TB437128.[MT7]-GMQYLESRK[MT7].3y5_1.heavy 467.258 / 776.475 843.0 25.770150661468506 35 15 9 5 6 21.338813920365297 4.686296078741386 0.04220008850097656 5 0.9562969560027608 5.881824101723408 843.0 8.340466955814584 0.0 - - - - - - - 0.0 1 0 FGFR4 fibroblast growth factor receptor 4 525 67 C20140707_OR006_02 C20140707_OR006_02 TB437128.[MT7]-GMQYLESRK[MT7].3b4_1.heavy 467.258 / 624.293 2423.0 25.770150661468506 35 15 9 5 6 21.338813920365297 4.686296078741386 0.04220008850097656 5 0.9562969560027608 5.881824101723408 2423.0 27.189401012017708 0.0 - - - - - - - 223.875 4 8 FGFR4 fibroblast growth factor receptor 4 527 67 C20140707_OR006_02 C20140707_OR006_02 TB437128.[MT7]-GMQYLESRK[MT7].3y4_1.heavy 467.258 / 663.391 737.0 25.770150661468506 35 15 9 5 6 21.338813920365297 4.686296078741386 0.04220008850097656 5 0.9562969560027608 5.881824101723408 737.0 0.9078322784810127 7.0 - - - - - - - 287.09090909090907 5 11 FGFR4 fibroblast growth factor receptor 4 529 68 C20140707_OR006_02 C20140707_OR006_02 TB437436.[MT7]-LFYLALPPTVYEAVTK[MT7].3b6_1.heavy 705.078 / 865.53 18890.0 50.504899978637695 43 18 10 5 10 3.9198749338692638 25.511018001100137 0.040798187255859375 3 0.9834141290592494 9.569541553361713 18890.0 242.30648373983738 0.0 - - - - - - - 154.0 37 4 G6PD glucose-6-phosphate dehydrogenase 531 68 C20140707_OR006_02 C20140707_OR006_02 TB437436.[MT7]-LFYLALPPTVYEAVTK[MT7].3b5_1.heavy 705.078 / 752.446 57109.0 50.504899978637695 43 18 10 5 10 3.9198749338692638 25.511018001100137 0.040798187255859375 3 0.9834141290592494 9.569541553361713 57109.0 538.6417045454546 0.0 - - - - - - - 228.6 114 5 G6PD glucose-6-phosphate dehydrogenase 533 68 C20140707_OR006_02 C20140707_OR006_02 TB437436.[MT7]-LFYLALPPTVYEAVTK[MT7].3y4_1.heavy 705.078 / 562.368 23019.0 50.504899978637695 43 18 10 5 10 3.9198749338692638 25.511018001100137 0.040798187255859375 3 0.9834141290592494 9.569541553361713 23019.0 84.36143620558231 0.0 - - - - - - - 238.42857142857142 46 7 G6PD glucose-6-phosphate dehydrogenase 535 68 C20140707_OR006_02 C20140707_OR006_02 TB437436.[MT7]-LFYLALPPTVYEAVTK[MT7].3b3_1.heavy 705.078 / 568.325 33562.0 50.504899978637695 43 18 10 5 10 3.9198749338692638 25.511018001100137 0.040798187255859375 3 0.9834141290592494 9.569541553361713 33562.0 146.78596810933942 0.0 - - - - - - - 238.71428571428572 67 7 G6PD glucose-6-phosphate dehydrogenase 537 69 C20140707_OR006_02 C20140707_OR006_02 TB450044.[MT7]-FAIPDFK[MT7].2y4_1.heavy 563.331 / 650.363 137085.0 38.824798583984375 50 20 10 10 10 6.160934852094765 16.231302943578317 0.0 3 0.9931530059364817 14.906108615997915 137085.0 885.0431707317073 0.0 - - - - - - - 246.2 274 10 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 539 69 C20140707_OR006_02 C20140707_OR006_02 TB450044.[MT7]-FAIPDFK[MT7].2y5_1.heavy 563.331 / 763.447 19707.0 38.824798583984375 50 20 10 10 10 6.160934852094765 16.231302943578317 0.0 3 0.9931530059364817 14.906108615997915 19707.0 232.31829268292682 0.0 - - - - - - - 230.75 39 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 541 69 C20140707_OR006_02 C20140707_OR006_02 TB450044.[MT7]-FAIPDFK[MT7].2y3_1.heavy 563.331 / 553.31 14657.0 38.824798583984375 50 20 10 10 10 6.160934852094765 16.231302943578317 0.0 3 0.9931530059364817 14.906108615997915 14657.0 34.71024352113171 0.0 - - - - - - - 331.7692307692308 29 13 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 543 69 C20140707_OR006_02 C20140707_OR006_02 TB450044.[MT7]-FAIPDFK[MT7].2y6_1.heavy 563.331 / 834.484 24141.0 38.824798583984375 50 20 10 10 10 6.160934852094765 16.231302943578317 0.0 3 0.9931530059364817 14.906108615997915 24141.0 108.96072972972974 0.0 - - - - - - - 287.3333333333333 48 12 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 545 70 C20140707_OR006_02 C20140707_OR006_02 TB450449.[MT7]-SVFVGNIPYEATEEQLK[MT7].3b6_1.heavy 738.063 / 748.411 26776.0 38.88385009765625 44 18 10 6 10 11.3907665909532 8.779040392191183 0.03929901123046875 3 0.9878858473370664 11.201506772721693 26776.0 142.73335483870966 0.0 - - - - - - - 299.6666666666667 53 12 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 547 70 C20140707_OR006_02 C20140707_OR006_02 TB450449.[MT7]-SVFVGNIPYEATEEQLK[MT7].3b4_1.heavy 738.063 / 577.347 12024.0 38.88385009765625 44 18 10 6 10 11.3907665909532 8.779040392191183 0.03929901123046875 3 0.9878858473370664 11.201506772721693 12024.0 39.11032258064516 0.0 - - - - - - - 275.55555555555554 24 9 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 549 70 C20140707_OR006_02 C20140707_OR006_02 TB450449.[MT7]-SVFVGNIPYEATEEQLK[MT7].3b5_1.heavy 738.063 / 634.368 6198.0 38.88385009765625 44 18 10 6 10 11.3907665909532 8.779040392191183 0.03929901123046875 3 0.9878858473370664 11.201506772721693 6198.0 20.410080645161287 0.0 - - - - - - - 304.3636363636364 12 11 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 551 70 C20140707_OR006_02 C20140707_OR006_02 TB450449.[MT7]-SVFVGNIPYEATEEQLK[MT7].3b7_1.heavy 738.063 / 861.495 12272.0 38.88385009765625 44 18 10 6 10 11.3907665909532 8.779040392191183 0.03929901123046875 3 0.9878858473370664 11.201506772721693 12272.0 108.86451612903227 0.0 - - - - - - - 221.42857142857142 24 14 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 553 71 C20140707_OR006_02 C20140707_OR006_02 TB437530.[MT7]-AESEEEIFAHLGLDYIEPWER.3b6_1.heavy 893.102 / 819.349 12756.0 48.466800689697266 43 13 10 10 10 2.44987733041779 40.818370274460435 0.0 3 0.9286145842846708 4.591341604846659 12756.0 71.49380530973451 0.0 - - - - - - - 267.09090909090907 25 11 DNTT deoxynucleotidyltransferase, terminal 555 71 C20140707_OR006_02 C20140707_OR006_02 TB437530.[MT7]-AESEEEIFAHLGLDYIEPWER.3b5_1.heavy 893.102 / 690.306 4177.0 48.466800689697266 43 13 10 10 10 2.44987733041779 40.818370274460435 0.0 3 0.9286145842846708 4.591341604846659 4177.0 33.812701693586654 1.0 - - - - - - - 207.16666666666666 8 6 DNTT deoxynucleotidyltransferase, terminal 557 71 C20140707_OR006_02 C20140707_OR006_02 TB437530.[MT7]-AESEEEIFAHLGLDYIEPWER.3y4_1.heavy 893.102 / 587.294 10837.0 48.466800689697266 43 13 10 10 10 2.44987733041779 40.818370274460435 0.0 3 0.9286145842846708 4.591341604846659 10837.0 67.61137168141593 0.0 - - - - - - - 282.5 21 12 DNTT deoxynucleotidyltransferase, terminal 559 71 C20140707_OR006_02 C20140707_OR006_02 TB437530.[MT7]-AESEEEIFAHLGLDYIEPWER.3b7_1.heavy 893.102 / 932.433 10837.0 48.466800689697266 43 13 10 10 10 2.44987733041779 40.818370274460435 0.0 3 0.9286145842846708 4.591341604846659 10837.0 23.597723014789747 0.0 - - - - - - - 271.2 21 10 DNTT deoxynucleotidyltransferase, terminal 561 72 C20140707_OR006_02 C20140707_OR006_02 TB411892.[MT7]-AFALLGWTGSR.2b8_1.heavy 661.87 / 1004.57 2329.0 43.76280117034912 29 17 0 6 6 4.4644058277542955 22.399397334875005 0.036800384521484375 5 0.9786955777302067 8.440213391551238 2329.0 0.0029362964558361754 3.0 - - - - - - - 304.0 1522 1 DNTT deoxynucleotidyltransferase, terminal 563 72 C20140707_OR006_02 C20140707_OR006_02 TB411892.[MT7]-AFALLGWTGSR.2y8_1.heavy 661.87 / 889.489 3139.0 43.76280117034912 29 17 0 6 6 4.4644058277542955 22.399397334875005 0.036800384521484375 5 0.9786955777302067 8.440213391551238 3139.0 7.4072465805756655 1.0 - - - - - - - 228.0 33 8 DNTT deoxynucleotidyltransferase, terminal 565 72 C20140707_OR006_02 C20140707_OR006_02 TB411892.[MT7]-AFALLGWTGSR.2y10_1.heavy 661.87 / 1107.59 4050.0 43.76280117034912 29 17 0 6 6 4.4644058277542955 22.399397334875005 0.036800384521484375 5 0.9786955777302067 8.440213391551238 4050.0 14.539473684210526 1.0 - - - - - - - 168.77777777777777 8 9 DNTT deoxynucleotidyltransferase, terminal 567 72 C20140707_OR006_02 C20140707_OR006_02 TB411892.[MT7]-AFALLGWTGSR.2y7_1.heavy 661.87 / 776.405 6683.0 43.76280117034912 29 17 0 6 6 4.4644058277542955 22.399397334875005 0.036800384521484375 5 0.9786955777302067 8.440213391551238 6683.0 3.024432908431563 1.0 - - - - - - - 270.3333333333333 38 3 DNTT deoxynucleotidyltransferase, terminal 569 73 C20140707_OR006_02 C20140707_OR006_02 TB411893.[MT7]-WAAAAAAFEK[MT7].3y3_1.heavy 441.915 / 567.326 6206.0 36.52539825439453 38 10 10 10 8 0.8710012849896818 71.13663998703584 0.0 4 0.8464021456082528 3.107759397565043 6206.0 32.173210526315785 0.0 - - - - - - - 253.33333333333334 12 3 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 571 73 C20140707_OR006_02 C20140707_OR006_02 TB411893.[MT7]-WAAAAAAFEK[MT7].3b4_1.heavy 441.915 / 544.3 2280.0 36.52539825439453 38 10 10 10 8 0.8710012849896818 71.13663998703584 0.0 4 0.8464021456082528 3.107759397565043 2280.0 25.077090660110173 0.0 - - - - - - - 232.16666666666666 4 6 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 573 73 C20140707_OR006_02 C20140707_OR006_02 TB411893.[MT7]-WAAAAAAFEK[MT7].3b5_1.heavy 441.915 / 615.337 4813.0 36.52539825439453 38 10 10 10 8 0.8710012849896818 71.13663998703584 0.0 4 0.8464021456082528 3.107759397565043 4813.0 45.49711147948612 1.0 - - - - - - - 295.3333333333333 11 3 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 575 73 C20140707_OR006_02 C20140707_OR006_02 TB411893.[MT7]-WAAAAAAFEK[MT7].3b3_1.heavy 441.915 / 473.263 2406.0 36.52539825439453 38 10 10 10 8 0.8710012849896818 71.13663998703584 0.0 4 0.8464021456082528 3.107759397565043 2406.0 2.9837655016910936 0.0 - - - - - - - 221.5 4 4 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 577 74 C20140707_OR006_02 C20140707_OR006_02 TB450441.[MT7]-AASEFESSEGVFLFPELR.2y4_1.heavy 1080.04 / 514.298 2804.0 47.62507438659668 38 13 10 5 10 1.801122165954386 43.59273717254942 0.04309844970703125 3 0.9247692569843513 4.4709895244517455 2804.0 14.914088790777532 0.0 - - - - - - - 200.42857142857142 5 7 CLSTN1 calsyntenin 1 579 74 C20140707_OR006_02 C20140707_OR006_02 TB450441.[MT7]-AASEFESSEGVFLFPELR.2b4_1.heavy 1080.04 / 503.258 1510.0 47.62507438659668 38 13 10 5 10 1.801122165954386 43.59273717254942 0.04309844970703125 3 0.9247692569843513 4.4709895244517455 1510.0 6.622051581575391 0.0 - - - - - - - 323.75 3 4 CLSTN1 calsyntenin 1 581 74 C20140707_OR006_02 C20140707_OR006_02 TB450441.[MT7]-AASEFESSEGVFLFPELR.2b5_1.heavy 1080.04 / 650.327 971.0 47.62507438659668 38 13 10 5 10 1.801122165954386 43.59273717254942 0.04309844970703125 3 0.9247692569843513 4.4709895244517455 971.0 -0.9001158748551564 2.0 - - - - - - - 0.0 1 0 CLSTN1 calsyntenin 1 583 74 C20140707_OR006_02 C20140707_OR006_02 TB450441.[MT7]-AASEFESSEGVFLFPELR.2b10_1.heavy 1080.04 / 1139.5 755.0 47.62507438659668 38 13 10 5 10 1.801122165954386 43.59273717254942 0.04309844970703125 3 0.9247692569843513 4.4709895244517455 755.0 3.4958891637463063 7.0 - - - - - - - 0.0 1 0 CLSTN1 calsyntenin 1 585 75 C20140707_OR006_02 C20140707_OR006_02 TB411889.[MT7]-RATEDVLVK[MT7].2b8_1.heavy 659.9 / 1028.59 1379.0 23.504974842071533 29 13 8 6 2 1.3097241913633917 50.66558344388125 0.03470039367675781 11 0.9278267785009576 4.565906590401362 1379.0 7.454054054054055 2.0 - - - - - - - 177.6 3 15 CLSTN1 calsyntenin 1 587 75 C20140707_OR006_02 C20140707_OR006_02 TB411889.[MT7]-RATEDVLVK[MT7].2b6_1.heavy 659.9 / 816.433 296.0 23.504974842071533 29 13 8 6 2 1.3097241913633917 50.66558344388125 0.03470039367675781 11 0.9278267785009576 4.565906590401362 296.0 0.601015228426396 11.0 - - - - - - - 0.0 0 0 CLSTN1 calsyntenin 1 589 75 C20140707_OR006_02 C20140707_OR006_02 TB411889.[MT7]-RATEDVLVK[MT7].2y3_1.heavy 659.9 / 503.367 591.0 23.504974842071533 29 13 8 6 2 1.3097241913633917 50.66558344388125 0.03470039367675781 11 0.9278267785009576 4.565906590401362 591.0 2.7972972972972974 10.0 - - - - - - - 0.0 1 0 CLSTN1 calsyntenin 1 591 75 C20140707_OR006_02 C20140707_OR006_02 TB411889.[MT7]-RATEDVLVK[MT7].2b7_1.heavy 659.9 / 929.517 1379.0 23.504974842071533 29 13 8 6 2 1.3097241913633917 50.66558344388125 0.03470039367675781 11 0.9278267785009576 4.565906590401362 1379.0 16.33050505050505 0.0 - - - - - - - 212.46153846153845 2 13 CLSTN1 calsyntenin 1 593 76 C20140707_OR006_02 C20140707_OR006_02 TB450236.[MT7]-AYQQIPESLK[MT7].2b3_1.heavy 732.919 / 507.268 3007.0 30.397650718688965 37 14 9 6 8 2.221264041162536 45.01941153635356 0.038600921630859375 4 0.9472222334568078 5.348204675812584 3007.0 6.483402645153229 0.0 - - - - - - - 698.0 6 7 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 595 76 C20140707_OR006_02 C20140707_OR006_02 TB450236.[MT7]-AYQQIPESLK[MT7].2y5_1.heavy 732.919 / 717.426 6515.0 30.397650718688965 37 14 9 6 8 2.221264041162536 45.01941153635356 0.038600921630859375 4 0.9472222334568078 5.348204675812584 6515.0 24.139243027888444 2.0 - - - - - - - 271.8333333333333 14 6 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 597 76 C20140707_OR006_02 C20140707_OR006_02 TB450236.[MT7]-AYQQIPESLK[MT7].2b4_1.heavy 732.919 / 635.327 6264.0 30.397650718688965 37 14 9 6 8 2.221264041162536 45.01941153635356 0.038600921630859375 4 0.9472222334568078 5.348204675812584 6264.0 16.576276595744684 1.0 - - - - - - - 146.0 12 6 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 599 76 C20140707_OR006_02 C20140707_OR006_02 TB450236.[MT7]-AYQQIPESLK[MT7].2b5_1.heavy 732.919 / 748.411 3759.0 30.397650718688965 37 14 9 6 8 2.221264041162536 45.01941153635356 0.038600921630859375 4 0.9472222334568078 5.348204675812584 3759.0 1.3329787234042554 1.0 - - - - - - - 214.85714285714286 7 7 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 601 77 C20140707_OR006_02 C20140707_OR006_02 TB437527.[MT7]-GLDPSTPAQVIAPSETPSSSSVVK[MT7].3b9_1.heavy 881.476 / 1011.52 3850.0 33.09749984741211 38 13 10 5 10 1.8534390738477247 37.62283600446551 0.04119873046875 3 0.9282540979559624 4.579651214515584 3850.0 14.349317738791424 0.0 - - - - - - - 199.44444444444446 7 9 LPIN1 lipin 1 603 77 C20140707_OR006_02 C20140707_OR006_02 TB437527.[MT7]-GLDPSTPAQVIAPSETPSSSSVVK[MT7].3b6_1.heavy 881.476 / 715.374 2952.0 33.09749984741211 38 13 10 5 10 1.8534390738477247 37.62283600446551 0.04119873046875 3 0.9282540979559624 4.579651214515584 2952.0 13.740218181818182 0.0 - - - - - - - 293.2857142857143 5 7 LPIN1 lipin 1 605 77 C20140707_OR006_02 C20140707_OR006_02 TB437527.[MT7]-GLDPSTPAQVIAPSETPSSSSVVK[MT7].3b4_1.heavy 881.476 / 527.295 898.0 33.09749984741211 38 13 10 5 10 1.8534390738477247 37.62283600446551 0.04119873046875 3 0.9282540979559624 4.579651214515584 898.0 1.2502923976608187 5.0 - - - - - - - 160.25 2 4 LPIN1 lipin 1 607 77 C20140707_OR006_02 C20140707_OR006_02 TB437527.[MT7]-GLDPSTPAQVIAPSETPSSSSVVK[MT7].3y8_1.heavy 881.476 / 934.533 4620.0 33.09749984741211 38 13 10 5 10 1.8534390738477247 37.62283600446551 0.04119873046875 3 0.9282540979559624 4.579651214515584 4620.0 8.0 0.0 - - - - - - - 224.625 9 8 LPIN1 lipin 1 609 78 C20140707_OR006_02 C20140707_OR006_02 TB411974.[MT7]-VQPNEAVYTK[MT7].2y4_1.heavy 718.903 / 654.394 2210.0 24.489900588989258 40 14 10 6 10 3.6929229694426815 27.078820984747352 0.03639984130859375 3 0.9431084987729199 5.14941486414001 2210.0 26.465024875621893 0.0 - - - - - - - 140.2 4 5 G6PD glucose-6-phosphate dehydrogenase 611 78 C20140707_OR006_02 C20140707_OR006_02 TB411974.[MT7]-VQPNEAVYTK[MT7].2y8_1.heavy 718.903 / 1065.57 20892.0 24.489900588989258 40 14 10 6 10 3.6929229694426815 27.078820984747352 0.03639984130859375 3 0.9431084987729199 5.14941486414001 20892.0 100.41173831837489 0.0 - - - - - - - 213.25 41 8 G6PD glucose-6-phosphate dehydrogenase 613 78 C20140707_OR006_02 C20140707_OR006_02 TB411974.[MT7]-VQPNEAVYTK[MT7].2y5_1.heavy 718.903 / 725.431 1607.0 24.489900588989258 40 14 10 6 10 3.6929229694426815 27.078820984747352 0.03639984130859375 3 0.9431084987729199 5.14941486414001 1607.0 15.266499999999999 1.0 - - - - - - - 120.2 4 5 G6PD glucose-6-phosphate dehydrogenase 615 78 C20140707_OR006_02 C20140707_OR006_02 TB411974.[MT7]-VQPNEAVYTK[MT7].2y3_1.heavy 718.903 / 555.326 7031.0 24.489900588989258 40 14 10 6 10 3.6929229694426815 27.078820984747352 0.03639984130859375 3 0.9431084987729199 5.14941486414001 7031.0 94.44451965174129 0.0 - - - - - - - 150.5 14 4 G6PD glucose-6-phosphate dehydrogenase 617 79 C20140707_OR006_02 C20140707_OR006_02 TB411977.[MT7]-VQEMNYIQK[MT7].3y3_1.heavy 480.93 / 532.357 N/A 28.934200286865234 38 12 10 10 6 0.9931832797806704 58.143713707107594 0.0 5 0.8990237891430595 3.8506033505405117 20289.0 69.64279761904761 0.0 - - - - - - - 297.8181818181818 40 11 ACSL4 acyl-CoA synthetase long-chain family member 4 619 79 C20140707_OR006_02 C20140707_OR006_02 TB411977.[MT7]-VQEMNYIQK[MT7].3b4_1.heavy 480.93 / 632.319 4285.0 28.934200286865234 38 12 10 10 6 0.9931832797806704 58.143713707107594 0.0 5 0.8990237891430595 3.8506033505405117 4285.0 14.910590828924162 2.0 - - - - - - - 210.0 12 6 ACSL4 acyl-CoA synthetase long-chain family member 4 621 79 C20140707_OR006_02 C20140707_OR006_02 TB411977.[MT7]-VQEMNYIQK[MT7].3b5_1.heavy 480.93 / 746.362 2772.0 28.934200286865234 38 12 10 10 6 0.9931832797806704 58.143713707107594 0.0 5 0.8990237891430595 3.8506033505405117 2772.0 27.72 0.0 - - - - - - - 201.6 5 5 ACSL4 acyl-CoA synthetase long-chain family member 4 623 79 C20140707_OR006_02 C20140707_OR006_02 TB411977.[MT7]-VQEMNYIQK[MT7].3b3_1.heavy 480.93 / 501.279 8191.0 28.934200286865234 38 12 10 10 6 0.9931832797806704 58.143713707107594 0.0 5 0.8990237891430595 3.8506033505405117 8191.0 13.326626984126984 2.0 - - - - - - - 189.0 16 6 ACSL4 acyl-CoA synthetase long-chain family member 4 625 80 C20140707_OR006_02 C20140707_OR006_02 TB411886.[MT7]-FAGEIC[CAM]GFK[MT7].3y3_1.heavy 439.569 / 495.305 17340.0 34.29090118408203 46 16 10 10 10 4.114946225832252 24.301654143675933 0.0 3 0.9692137970386205 7.015583100768541 17340.0 162.77861746108948 0.0 - - - - - - - 153.8 34 5 CLSTN1 calsyntenin 1 627 80 C20140707_OR006_02 C20140707_OR006_02 TB411886.[MT7]-FAGEIC[CAM]GFK[MT7].3b4_1.heavy 439.569 / 549.279 18239.0 34.29090118408203 46 16 10 10 10 4.114946225832252 24.301654143675933 0.0 3 0.9692137970386205 7.015583100768541 18239.0 208.83144911235405 0.0 - - - - - - - 171.0 36 6 CLSTN1 calsyntenin 1 629 80 C20140707_OR006_02 C20140707_OR006_02 TB411886.[MT7]-FAGEIC[CAM]GFK[MT7].3b5_1.heavy 439.569 / 662.363 2440.0 34.29090118408203 46 16 10 10 10 4.114946225832252 24.301654143675933 0.0 3 0.9692137970386205 7.015583100768541 2440.0 23.813271103896106 0.0 - - - - - - - 228.22222222222223 4 9 CLSTN1 calsyntenin 1 631 80 C20140707_OR006_02 C20140707_OR006_02 TB411886.[MT7]-FAGEIC[CAM]GFK[MT7].3y4_1.heavy 439.569 / 655.335 3468.0 34.29090118408203 46 16 10 10 10 4.114946225832252 24.301654143675933 0.0 3 0.9692137970386205 7.015583100768541 3468.0 31.81143604085603 0.0 - - - - - - - 231.0 6 5 CLSTN1 calsyntenin 1 633 81 C20140707_OR006_02 C20140707_OR006_02 TB411687.[MT7]-ATVIEGK[MT7].2y4_1.heavy 503.313 / 590.363 15339.0 21.872900009155273 50 20 10 10 10 10.993748167495053 9.096078832846796 0.0 3 0.9957704640349904 18.969802868760382 15339.0 164.65593220338985 1.0 - - - - - - - 157.44444444444446 30 9 CLSTN1 calsyntenin 1 635 81 C20140707_OR006_02 C20140707_OR006_02 TB411687.[MT7]-ATVIEGK[MT7].2y5_1.heavy 503.313 / 689.431 6118.0 21.872900009155273 50 20 10 10 10 10.993748167495053 9.096078832846796 0.0 3 0.9957704640349904 18.969802868760382 6118.0 51.315254428264495 0.0 - - - - - - - 217.72727272727272 12 11 CLSTN1 calsyntenin 1 637 81 C20140707_OR006_02 C20140707_OR006_02 TB411687.[MT7]-ATVIEGK[MT7].2b4_1.heavy 503.313 / 529.347 5497.0 21.872900009155273 50 20 10 10 10 10.993748167495053 9.096078832846796 0.0 3 0.9957704640349904 18.969802868760382 5497.0 27.903906125358542 0.0 - - - - - - - 238.6153846153846 10 13 CLSTN1 calsyntenin 1 639 81 C20140707_OR006_02 C20140707_OR006_02 TB411687.[MT7]-ATVIEGK[MT7].2y6_1.heavy 503.313 / 790.479 9310.0 21.872900009155273 50 20 10 10 10 10.993748167495053 9.096078832846796 0.0 3 0.9957704640349904 18.969802868760382 9310.0 146.7212975306291 0.0 - - - - - - - 206.88888888888889 18 9 CLSTN1 calsyntenin 1 641 82 C20140707_OR006_02 C20140707_OR006_02 TB450136.[MT7]-IFDAFRDK[MT7].3y7_1.heavy 433.915 / 1042.54 N/A 34.11090087890625 50 20 10 10 10 5.564971870516159 17.969542762616854 0.0 3 0.9915793849197005 13.439565808590594 126.0 -0.0010000000000000009 4.0 - - - - - - - 0.0 0 0 MAPK15 mitogen-activated protein kinase 15 643 82 C20140707_OR006_02 C20140707_OR006_02 TB450136.[MT7]-IFDAFRDK[MT7].3b4_1.heavy 433.915 / 591.326 10987.0 34.11090087890625 50 20 10 10 10 5.564971870516159 17.969542762616854 0.0 3 0.9915793849197005 13.439565808590594 10987.0 122.79121933621934 0.0 - - - - - - - 189.5 21 2 MAPK15 mitogen-activated protein kinase 15 645 82 C20140707_OR006_02 C20140707_OR006_02 TB450136.[MT7]-IFDAFRDK[MT7].3y7_2.heavy 433.915 / 521.776 28035.0 34.11090087890625 50 20 10 10 10 5.564971870516159 17.969542762616854 0.0 3 0.9915793849197005 13.439565808590594 28035.0 -0.3171380090497742 0.0 - - - - - - - 210.66666666666666 56 3 MAPK15 mitogen-activated protein kinase 15 647 82 C20140707_OR006_02 C20140707_OR006_02 TB450136.[MT7]-IFDAFRDK[MT7].3b3_1.heavy 433.915 / 520.289 36875.0 34.11090087890625 50 20 10 10 10 5.564971870516159 17.969542762616854 0.0 3 0.9915793849197005 13.439565808590594 36875.0 94.58957373359098 0.0 - - - - - - - 205.25 73 8 MAPK15 mitogen-activated protein kinase 15 649 83 C20140707_OR006_02 C20140707_OR006_02 TB437037.[MT7]-TNLENLEK[MT7].2y4_1.heavy 624.856 / 647.385 13559.0 26.760000228881836 46 16 10 10 10 3.415411192666549 23.43221489157403 0.0 3 0.9669687111913423 6.771686782082546 13559.0 17.404468926703654 1.0 - - - - - - - 244.88888888888889 35 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 651 83 C20140707_OR006_02 C20140707_OR006_02 TB437037.[MT7]-TNLENLEK[MT7].2y5_1.heavy 624.856 / 776.427 17151.0 26.760000228881836 46 16 10 10 10 3.415411192666549 23.43221489157403 0.0 3 0.9669687111913423 6.771686782082546 17151.0 212.16969827586206 0.0 - - - - - - - 203.0 34 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 653 83 C20140707_OR006_02 C20140707_OR006_02 TB437037.[MT7]-TNLENLEK[MT7].2b4_1.heavy 624.856 / 602.327 18079.0 26.760000228881836 46 16 10 10 10 3.415411192666549 23.43221489157403 0.0 3 0.9669687111913423 6.771686782082546 18079.0 41.54916276687388 0.0 - - - - - - - 270.6666666666667 36 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 655 83 C20140707_OR006_02 C20140707_OR006_02 TB437037.[MT7]-TNLENLEK[MT7].2y7_1.heavy 624.856 / 1003.55 21903.0 26.760000228881836 46 16 10 10 10 3.415411192666549 23.43221489157403 0.0 3 0.9669687111913423 6.771686782082546 21903.0 135.47760775862068 0.0 - - - - - - - 262.93333333333334 43 15 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 657 84 C20140707_OR006_02 C20140707_OR006_02 TB450235.[MT7]-LDTFAESLIRR.3y10_2.heavy 488.948 / 604.325 6410.0 39.77109909057617 37 13 10 6 8 1.2681590937410407 46.31086141110869 0.03639984130859375 4 0.9206744242240499 4.352534040329291 6410.0 21.190082644628102 1.0 - - - - - - - 242.0 12 6 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 659 84 C20140707_OR006_02 C20140707_OR006_02 TB450235.[MT7]-LDTFAESLIRR.3b4_1.heavy 488.948 / 621.336 4112.0 39.77109909057617 37 13 10 6 8 1.2681590937410407 46.31086141110869 0.03639984130859375 4 0.9206744242240499 4.352534040329291 4112.0 32.284297520661156 0.0 - - - - - - - 181.5 8 2 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 661 84 C20140707_OR006_02 C20140707_OR006_02 TB450235.[MT7]-LDTFAESLIRR.3b5_1.heavy 488.948 / 692.374 3024.0 39.77109909057617 37 13 10 6 8 1.2681590937410407 46.31086141110869 0.03639984130859375 4 0.9206744242240499 4.352534040329291 3024.0 29.9900826446281 2.0 - - - - - - - 262.1666666666667 15 6 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 663 84 C20140707_OR006_02 C20140707_OR006_02 TB450235.[MT7]-LDTFAESLIRR.3y9_2.heavy 488.948 / 546.812 8708.0 39.77109909057617 37 13 10 6 8 1.2681590937410407 46.31086141110869 0.03639984130859375 4 0.9206744242240499 4.352534040329291 8708.0 44.6195041322314 1.0 - - - - - - - 242.0 19 1 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 665 85 C20140707_OR006_02 C20140707_OR006_02 TB437135.[MT7]-TALLDISC[CAM]VK[MT7].2y4_1.heavy 704.41 / 637.346 4262.0 36.52539825439453 47 17 10 10 10 2.276964195344661 30.9253931358079 0.0 3 0.9725859250088896 7.436668088626538 4262.0 11.007905331532575 0.0 - - - - - - - 243.66666666666666 8 9 ACSL4 acyl-CoA synthetase long-chain family member 4 667 85 C20140707_OR006_02 C20140707_OR006_02 TB437135.[MT7]-TALLDISC[CAM]VK[MT7].2y5_1.heavy 704.41 / 750.43 2557.0 36.52539825439453 47 17 10 10 10 2.276964195344661 30.9253931358079 0.0 3 0.9725859250088896 7.436668088626538 2557.0 10.998602739726028 0.0 - - - - - - - 294.3333333333333 5 12 ACSL4 acyl-CoA synthetase long-chain family member 4 669 85 C20140707_OR006_02 C20140707_OR006_02 TB437135.[MT7]-TALLDISC[CAM]VK[MT7].2y6_1.heavy 704.41 / 865.457 3044.0 36.52539825439453 47 17 10 10 10 2.276964195344661 30.9253931358079 0.0 3 0.9725859250088896 7.436668088626538 3044.0 36.17868852459016 0.0 - - - - - - - 189.66666666666666 6 9 ACSL4 acyl-CoA synthetase long-chain family member 4 671 85 C20140707_OR006_02 C20140707_OR006_02 TB437135.[MT7]-TALLDISC[CAM]VK[MT7].2b5_1.heavy 704.41 / 658.389 2679.0 36.52539825439453 47 17 10 10 10 2.276964195344661 30.9253931358079 0.0 3 0.9725859250088896 7.436668088626538 2679.0 9.813093092803395 0.0 - - - - - - - 253.75 5 12 ACSL4 acyl-CoA synthetase long-chain family member 4 673 86 C20140707_OR006_02 C20140707_OR006_02 TB437034.[MT7]-GGLLQDVHVR.3b6_1.heavy 413.243 / 728.406 8316.0 30.61014986038208 42 16 10 6 10 4.310546539743484 23.198914355289823 0.03859901428222656 3 0.9676599324287678 6.844070589754459 8316.0 66.0 0.0 - - - - - - - 226.8 16 5 MAPK15 mitogen-activated protein kinase 15 675 86 C20140707_OR006_02 C20140707_OR006_02 TB437034.[MT7]-GGLLQDVHVR.3b4_1.heavy 413.243 / 485.32 25703.0 30.61014986038208 42 16 10 6 10 4.310546539743484 23.198914355289823 0.03859901428222656 3 0.9676599324287678 6.844070589754459 25703.0 99.95611111111111 0.0 - - - - - - - 263.45454545454544 51 11 MAPK15 mitogen-activated protein kinase 15 677 86 C20140707_OR006_02 C20140707_OR006_02 TB437034.[MT7]-GGLLQDVHVR.3y4_1.heavy 413.243 / 510.315 14741.0 30.61014986038208 42 16 10 6 10 4.310546539743484 23.198914355289823 0.03859901428222656 3 0.9676599324287678 6.844070589754459 14741.0 120.50182539682541 0.0 - - - - - - - 252.0 29 5 MAPK15 mitogen-activated protein kinase 15 679 86 C20140707_OR006_02 C20140707_OR006_02 TB437034.[MT7]-GGLLQDVHVR.3y5_1.heavy 413.243 / 625.342 16127.0 30.61014986038208 42 16 10 6 10 4.310546539743484 23.198914355289823 0.03859901428222656 3 0.9676599324287678 6.844070589754459 16127.0 121.59246031746032 0.0 - - - - - - - 252.0 32 2 MAPK15 mitogen-activated protein kinase 15 681 87 C20140707_OR006_02 C20140707_OR006_02 TB437139.[MT7]-VLQEMLSMYR.2y8_1.heavy 707.371 / 1057.48 15749.0 46.48699951171875 43 13 10 10 10 1.7887039390987876 44.63911005305195 0.0 3 0.9284827064405053 4.587054663849943 15749.0 99.74366666666666 0.0 - - - - - - - 287.3333333333333 31 9 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 683 87 C20140707_OR006_02 C20140707_OR006_02 TB437139.[MT7]-VLQEMLSMYR.2y9_1.heavy 707.371 / 1170.56 11249.0 46.48699951171875 43 13 10 10 10 1.7887039390987876 44.63911005305195 0.0 3 0.9284827064405053 4.587054663849943 11249.0 126.45885942136498 0.0 - - - - - - - 258.5 22 10 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 685 87 C20140707_OR006_02 C20140707_OR006_02 TB437139.[MT7]-VLQEMLSMYR.2y6_1.heavy 707.371 / 800.379 6525.0 46.48699951171875 43 13 10 10 10 1.7887039390987876 44.63911005305195 0.0 3 0.9284827064405053 4.587054663849943 6525.0 27.9125 0.0 - - - - - - - 187.11111111111111 13 9 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 687 87 C20140707_OR006_02 C20140707_OR006_02 TB437139.[MT7]-VLQEMLSMYR.2y7_1.heavy 707.371 / 929.422 10237.0 46.48699951171875 43 13 10 10 10 1.7887039390987876 44.63911005305195 0.0 3 0.9284827064405053 4.587054663849943 10237.0 102.67250413065581 0.0 - - - - - - - 149.66666666666666 20 6 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 689 88 C20140707_OR006_02 C20140707_OR006_02 TB412045.[MT7]-TYESLSDMVVPR.3y7_1.heavy 514.265 / 803.408 4170.0 37.18349838256836 48 18 10 10 10 16.242101864700846 6.156838618118213 0.0 3 0.986035731393384 10.431495863583871 4170.0 21.64320652173913 0.0 - - - - - - - 269.8 8 5 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 691 88 C20140707_OR006_02 C20140707_OR006_02 TB412045.[MT7]-TYESLSDMVVPR.3b4_1.heavy 514.265 / 625.295 13246.0 37.18349838256836 48 18 10 10 10 16.242101864700846 6.156838618118213 0.0 3 0.986035731393384 10.431495863583871 13246.0 55.746271318515895 0.0 - - - - - - - 276.0 26 12 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 693 88 C20140707_OR006_02 C20140707_OR006_02 TB412045.[MT7]-TYESLSDMVVPR.3b7_1.heavy 514.265 / 940.438 7236.0 37.18349838256836 48 18 10 10 10 16.242101864700846 6.156838618118213 0.0 3 0.986035731393384 10.431495863583871 7236.0 112.95219512195122 0.0 - - - - - - - 204.33333333333334 14 3 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 695 88 C20140707_OR006_02 C20140707_OR006_02 TB412045.[MT7]-TYESLSDMVVPR.3y5_1.heavy 514.265 / 601.349 12142.0 37.18349838256836 48 18 10 10 10 16.242101864700846 6.156838618118213 0.0 3 0.986035731393384 10.431495863583871 12142.0 92.25929602392648 0.0 - - - - - - - 163.66666666666666 24 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 697 89 C20140707_OR006_02 C20140707_OR006_02 TB412415.[MT7]-EITLLQEFGDHPNIISLLDVIR.3y7_1.heavy 893.833 / 815.498 3635.0 54.668800354003906 48 18 10 10 10 3.415838143971709 29.275391802881693 0.0 3 0.9815080313515071 9.061482756705447 3635.0 42.14492753623188 0.0 - - - - - - - 103.94736842105263 7 19 MAPK15 mitogen-activated protein kinase 15 699 89 C20140707_OR006_02 C20140707_OR006_02 TB412415.[MT7]-EITLLQEFGDHPNIISLLDVIR.3b4_1.heavy 893.833 / 601.368 N/A 54.668800354003906 48 18 10 10 10 3.415838143971709 29.275391802881693 0.0 3 0.9815080313515071 9.061482756705447 4293.0 12.443478260869567 1.0 - - - - - - - 135.0952380952381 9 21 MAPK15 mitogen-activated protein kinase 15 701 89 C20140707_OR006_02 C20140707_OR006_02 TB412415.[MT7]-EITLLQEFGDHPNIISLLDVIR.3y8_1.heavy 893.833 / 928.583 3497.0 54.668800354003906 48 18 10 10 10 3.415838143971709 29.275391802881693 0.0 3 0.9815080313515071 9.061482756705447 3497.0 137.53418633540372 0.0 - - - - - - - 75.34782608695652 6 23 MAPK15 mitogen-activated protein kinase 15 703 89 C20140707_OR006_02 C20140707_OR006_02 TB412415.[MT7]-EITLLQEFGDHPNIISLLDVIR.3y10_1.heavy 893.833 / 1155.71 1904.0 54.668800354003906 48 18 10 10 10 3.415838143971709 29.275391802881693 0.0 3 0.9815080313515071 9.061482756705447 1904.0 48.61631768953069 0.0 - - - - - - - 147.56521739130434 3 23 MAPK15 mitogen-activated protein kinase 15 705 90 C20140707_OR006_02 C20140707_OR006_02 TB412416.[MT7]-EITLLQEFGDHPNIISLLDVIR.4y4_1.heavy 670.626 / 502.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK15 mitogen-activated protein kinase 15 707 90 C20140707_OR006_02 C20140707_OR006_02 TB412416.[MT7]-EITLLQEFGDHPNIISLLDVIR.4b7_1.heavy 670.626 / 971.553 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK15 mitogen-activated protein kinase 15 709 90 C20140707_OR006_02 C20140707_OR006_02 TB412416.[MT7]-EITLLQEFGDHPNIISLLDVIR.4b4_1.heavy 670.626 / 601.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK15 mitogen-activated protein kinase 15 711 90 C20140707_OR006_02 C20140707_OR006_02 TB412416.[MT7]-EITLLQEFGDHPNIISLLDVIR.4y7_1.heavy 670.626 / 815.498 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK15 mitogen-activated protein kinase 15 713 91 C20140707_OR006_02 C20140707_OR006_02 TB412044.[MT7]-TAC[CAM]PPDYTLAMR.2y8_1.heavy 770.374 / 966.471 1385.0 31.565900802612305 45 17 10 10 8 3.913358519588496 25.55349822906473 0.0 4 0.9762484572413509 7.991956161315475 1385.0 10.992063492063494 2.0 - - - - - - - 234.0 2 7 NLGN1 neuroligin 1 715 91 C20140707_OR006_02 C20140707_OR006_02 TB412044.[MT7]-TAC[CAM]PPDYTLAMR.2y9_1.heavy 770.374 / 1063.52 8059.0 31.565900802612305 45 17 10 10 8 3.913358519588496 25.55349822906473 0.0 4 0.9762484572413509 7.991956161315475 8059.0 72.06195767195767 0.0 - - - - - - - 201.6 16 5 NLGN1 neuroligin 1 717 91 C20140707_OR006_02 C20140707_OR006_02 TB412044.[MT7]-TAC[CAM]PPDYTLAMR.2y6_1.heavy 770.374 / 754.392 3778.0 31.565900802612305 45 17 10 10 8 3.913358519588496 25.55349822906473 0.0 4 0.9762484572413509 7.991956161315475 3778.0 37.58010582010582 0.0 - - - - - - - 226.8 7 5 NLGN1 neuroligin 1 719 91 C20140707_OR006_02 C20140707_OR006_02 TB412044.[MT7]-TAC[CAM]PPDYTLAMR.2y10_1.heavy 770.374 / 1223.55 630.0 31.565900802612305 45 17 10 10 8 3.913358519588496 25.55349822906473 0.0 4 0.9762484572413509 7.991956161315475 630.0 3.333333333333333 4.0 - - - - - - - 0.0 1 0 NLGN1 neuroligin 1 721 92 C20140707_OR006_02 C20140707_OR006_02 TB436906.[MT7]-EAANAMK[MT7].2y4_1.heavy 511.781 / 607.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL4 acyl-CoA synthetase long-chain family member 4 723 92 C20140707_OR006_02 C20140707_OR006_02 TB436906.[MT7]-EAANAMK[MT7].2b4_1.heavy 511.781 / 530.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL4 acyl-CoA synthetase long-chain family member 4 725 92 C20140707_OR006_02 C20140707_OR006_02 TB436906.[MT7]-EAANAMK[MT7].2y6_1.heavy 511.781 / 749.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL4 acyl-CoA synthetase long-chain family member 4 727 92 C20140707_OR006_02 C20140707_OR006_02 TB436906.[MT7]-EAANAMK[MT7].2b5_1.heavy 511.781 / 601.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL4 acyl-CoA synthetase long-chain family member 4 729 93 C20140707_OR006_02 C20140707_OR006_02 TB450033.[MT7]-AIGMADMTR.2y8_1.heavy 555.282 / 894.417 8847.0 28.891799926757812 48 18 10 10 10 7.426121575087364 13.46597937952875 0.0 3 0.9895964969611528 12.089137996615408 8847.0 56.72292094269366 0.0 - - - - - - - 218.0 17 5 LPIN1;LPIN2 lipin 1;lipin 2 731 93 C20140707_OR006_02 C20140707_OR006_02 TB450033.[MT7]-AIGMADMTR.2y5_1.heavy 555.282 / 593.271 5090.0 28.891799926757812 48 18 10 10 10 7.426121575087364 13.46597937952875 0.0 3 0.9895964969611528 12.089137996615408 5090.0 14.866831683168316 0.0 - - - - - - - 424.25 10 4 LPIN1;LPIN2 lipin 1;lipin 2 733 93 C20140707_OR006_02 C20140707_OR006_02 TB450033.[MT7]-AIGMADMTR.2b6_1.heavy 555.282 / 703.357 8363.0 28.891799926757812 48 18 10 10 10 7.426121575087364 13.46597937952875 0.0 3 0.9895964969611528 12.089137996615408 8363.0 24.150577557755774 0.0 - - - - - - - 302.9166666666667 16 12 LPIN1;LPIN2 lipin 1;lipin 2 735 93 C20140707_OR006_02 C20140707_OR006_02 TB450033.[MT7]-AIGMADMTR.2y7_1.heavy 555.282 / 781.333 11271.0 28.891799926757812 48 18 10 10 10 7.426121575087364 13.46597937952875 0.0 3 0.9895964969611528 12.089137996615408 11271.0 75.99045159386068 0.0 - - - - - - - 218.0 22 5 LPIN1;LPIN2 lipin 1;lipin 2 737 94 C20140707_OR006_02 C20140707_OR006_02 TB436900.[MT7]-IILNLK[MT7].2y4_1.heavy 501.352 / 631.426 6132.0 36.08290100097656 48 18 10 10 10 5.667380958686652 17.64483466507143 0.0 3 0.9892947291630585 11.91723053903313 6132.0 40.274916149068325 0.0 - - - - - - - 318.8 12 5 CBX6 chromobox homolog 6 739 94 C20140707_OR006_02 C20140707_OR006_02 TB436900.[MT7]-IILNLK[MT7].2y5_1.heavy 501.352 / 744.51 7604.0 36.08290100097656 48 18 10 10 10 5.667380958686652 17.64483466507143 0.0 3 0.9892947291630585 11.91723053903313 7604.0 37.225118250966375 0.0 - - - - - - - 204.66666666666666 15 6 CBX6 chromobox homolog 6 741 94 C20140707_OR006_02 C20140707_OR006_02 TB436900.[MT7]-IILNLK[MT7].2b4_1.heavy 501.352 / 598.404 859.0 36.08290100097656 48 18 10 10 10 5.667380958686652 17.64483466507143 0.0 3 0.9892947291630585 11.91723053903313 859.0 2.604897959183673 5.0 - - - - - - - 286.1666666666667 6 6 CBX6 chromobox homolog 6 743 94 C20140707_OR006_02 C20140707_OR006_02 TB436900.[MT7]-IILNLK[MT7].2y3_1.heavy 501.352 / 518.342 6500.0 36.08290100097656 48 18 10 10 10 5.667380958686652 17.64483466507143 0.0 3 0.9892947291630585 11.91723053903313 6500.0 45.89795918367347 0.0 - - - - - - - 214.83333333333334 13 12 CBX6 chromobox homolog 6 745 95 C20140707_OR006_02 C20140707_OR006_02 TB436903.[MT7]-EVPPGTK[MT7].2y6_1.heavy 508.305 / 742.458 597.0 17.811049938201904 33 16 10 1 6 4.645152721664905 21.527817488885105 0.09280014038085938 5 0.967437348640721 6.820510930962147 597.0 0.5359603984231589 7.0 - - - - - - - 238.64705882352942 3 17 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 747 95 C20140707_OR006_02 C20140707_OR006_02 TB436903.[MT7]-EVPPGTK[MT7].2y4_1.heavy 508.305 / 546.337 1970.0 17.811049938201904 33 16 10 1 6 4.645152721664905 21.527817488885105 0.09280014038085938 5 0.967437348640721 6.820510930962147 1970.0 31.77421964843108 1.0 - - - - - - - 256.6 4 10 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 749 95 C20140707_OR006_02 C20140707_OR006_02 TB436903.[MT7]-EVPPGTK[MT7].2y5_1.heavy 508.305 / 643.39 4536.0 17.811049938201904 33 16 10 1 6 4.645152721664905 21.527817488885105 0.09280014038085938 5 0.967437348640721 6.820510930962147 4536.0 39.63724504877328 0.0 - - - - - - - 298.0 9 4 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 751 95 C20140707_OR006_02 C20140707_OR006_02 TB436903.[MT7]-EVPPGTK[MT7].2y3_1.heavy 508.305 / 449.284 895.0 17.811049938201904 33 16 10 1 6 4.645152721664905 21.527817488885105 0.09280014038085938 5 0.967437348640721 6.820510930962147 895.0 0.5305025989051787 3.0 - - - - - - - 271.09090909090907 2 11 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 753 96 C20140707_OR006_02 C20140707_OR006_02 TB450434.[MT7]-LFYLALPPTVYEAVTK[MT7].4y4_1.heavy 529.06 / 562.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - G6PD glucose-6-phosphate dehydrogenase 755 96 C20140707_OR006_02 C20140707_OR006_02 TB450434.[MT7]-LFYLALPPTVYEAVTK[MT7].4b5_1.heavy 529.06 / 752.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - G6PD glucose-6-phosphate dehydrogenase 757 96 C20140707_OR006_02 C20140707_OR006_02 TB450434.[MT7]-LFYLALPPTVYEAVTK[MT7].4b6_1.heavy 529.06 / 865.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - G6PD glucose-6-phosphate dehydrogenase 759 96 C20140707_OR006_02 C20140707_OR006_02 TB450434.[MT7]-LFYLALPPTVYEAVTK[MT7].4b3_1.heavy 529.06 / 568.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - G6PD glucose-6-phosphate dehydrogenase 761 97 C20140707_OR006_02 C20140707_OR006_02 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1712260.0 35.058799743652344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1712260.0 1496.7820706917287 0.0 - - - - - - - 208.9090909090909 3424 11 763 97 C20140707_OR006_02 C20140707_OR006_02 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 299896.0 35.058799743652344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 299896.0 306.7720639524865 0.0 - - - - - - - 669.625 599 8 765 97 C20140707_OR006_02 C20140707_OR006_02 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 476111.0 35.058799743652344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 476111.0 546.7351706567121 0.0 - - - - - - - 655.8571428571429 952 7 767 98 C20140707_OR006_02 C20140707_OR006_02 TB411688.[MT7]-LITEDK[MT7].2y4_1.heavy 503.805 / 636.332 48675.0 24.941499710083008 47 17 10 10 10 3.944384652540313 25.35249698215835 0.0 3 0.9741469674940394 7.658901860239893 48675.0 372.79651188380285 0.0 - - - - - - - 201.55555555555554 97 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 769 98 C20140707_OR006_02 C20140707_OR006_02 TB411688.[MT7]-LITEDK[MT7].2y5_1.heavy 503.805 / 749.416 30956.0 24.941499710083008 47 17 10 10 10 3.944384652540313 25.35249698215835 0.0 3 0.9741469674940394 7.658901860239893 30956.0 313.38258904777985 0.0 - - - - - - - 200.0 61 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 771 98 C20140707_OR006_02 C20140707_OR006_02 TB411688.[MT7]-LITEDK[MT7].2y3_1.heavy 503.805 / 535.284 12809.0 24.941499710083008 47 17 10 10 10 3.944384652540313 25.35249698215835 0.0 3 0.9741469674940394 7.658901860239893 12809.0 41.093357914155575 0.0 - - - - - - - 237.92307692307693 25 13 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 773 98 C20140707_OR006_02 C20140707_OR006_02 TB411688.[MT7]-LITEDK[MT7].2b5_1.heavy 503.805 / 716.395 12276.0 24.941499710083008 47 17 10 10 10 3.944384652540313 25.35249698215835 0.0 3 0.9741469674940394 7.658901860239893 12276.0 132.57241699314935 0.0 - - - - - - - 224.0 24 10 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 775 99 C20140707_OR006_02 C20140707_OR006_02 TB436996.[MT7]-SIFYQLLR.2y5_1.heavy 592.351 / 692.409 14295.0 45.77429962158203 48 18 10 10 10 3.9153232733029744 20.350143173648224 0.0 3 0.9862030694311824 10.494712240699032 14295.0 118.59080717488789 0.0 - - - - - - - 223.28571428571428 28 7 MAPK15 mitogen-activated protein kinase 15 777 99 C20140707_OR006_02 C20140707_OR006_02 TB436996.[MT7]-SIFYQLLR.2y6_1.heavy 592.351 / 839.477 23453.0 45.77429962158203 48 18 10 10 10 3.9153232733029744 20.350143173648224 0.0 3 0.9862030694311824 10.494712240699032 23453.0 248.7758798737616 0.0 - - - - - - - 174.0 46 9 MAPK15 mitogen-activated protein kinase 15 779 99 C20140707_OR006_02 C20140707_OR006_02 TB436996.[MT7]-SIFYQLLR.2b5_1.heavy 592.351 / 783.416 9716.0 45.77429962158203 48 18 10 10 10 3.9153232733029744 20.350143173648224 0.0 3 0.9862030694311824 10.494712240699032 9716.0 105.61488805970149 0.0 - - - - - - - 209.5 19 8 MAPK15 mitogen-activated protein kinase 15 781 99 C20140707_OR006_02 C20140707_OR006_02 TB436996.[MT7]-SIFYQLLR.2y7_1.heavy 592.351 / 952.562 23564.0 45.77429962158203 48 18 10 10 10 3.9153232733029744 20.350143173648224 0.0 3 0.9862030694311824 10.494712240699032 23564.0 165.0946737166187 0.0 - - - - - - - 223.42857142857142 47 7 MAPK15 mitogen-activated protein kinase 15 783 100 C20140707_OR006_02 C20140707_OR006_02 TB450231.[MT7]-LFTSVFGVGLK[MT7].2y5_1.heavy 728.444 / 617.41 7652.0 46.24100112915039 42 17 10 5 10 44.70915752544357 2.236678245236245 0.0447998046875 3 0.9727711554776114 7.462036386439239 7652.0 36.27765121357709 0.0 - - - - - - - 238.6153846153846 15 13 DNTT deoxynucleotidyltransferase, terminal 785 100 C20140707_OR006_02 C20140707_OR006_02 TB450231.[MT7]-LFTSVFGVGLK[MT7].2y9_1.heavy 728.444 / 1051.63 4963.0 46.24100112915039 42 17 10 5 10 44.70915752544357 2.236678245236245 0.0447998046875 3 0.9727711554776114 7.462036386439239 4963.0 20.590148730350663 0.0 - - - - - - - 206.7 9 10 DNTT deoxynucleotidyltransferase, terminal 787 100 C20140707_OR006_02 C20140707_OR006_02 TB450231.[MT7]-LFTSVFGVGLK[MT7].2y6_1.heavy 728.444 / 764.479 9100.0 46.24100112915039 42 17 10 5 10 44.70915752544357 2.236678245236245 0.0447998046875 3 0.9727711554776114 7.462036386439239 9100.0 45.5 0.0 - - - - - - - 206.55555555555554 18 9 DNTT deoxynucleotidyltransferase, terminal 789 100 C20140707_OR006_02 C20140707_OR006_02 TB450231.[MT7]-LFTSVFGVGLK[MT7].2y10_1.heavy 728.444 / 1198.7 1448.0 46.24100112915039 42 17 10 5 10 44.70915752544357 2.236678245236245 0.0447998046875 3 0.9727711554776114 7.462036386439239 1448.0 1.6145100069013107 1.0 - - - - - - - 215.33333333333334 2 12 DNTT deoxynucleotidyltransferase, terminal 791 101 C20140707_OR006_02 C20140707_OR006_02 TB437521.[MT7]-EALYALTVLEMC[CAM]MNHC[CAM]GEK[MT7].4y4_1.heavy 640.06 / 637.31 4543.0 47.70180130004883 46 16 10 10 10 3.2543138649979078 30.72844358239684 0.0 3 0.9635213767384175 6.441900695069903 4543.0 22.409164236520446 0.0 - - - - - - - 236.75 9 12 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 793 101 C20140707_OR006_02 C20140707_OR006_02 TB437521.[MT7]-EALYALTVLEMC[CAM]MNHC[CAM]GEK[MT7].4b4_1.heavy 640.06 / 621.336 4884.0 47.70180130004883 46 16 10 10 10 3.2543138649979078 30.72844358239684 0.0 3 0.9635213767384175 6.441900695069903 4884.0 4.778197064989519 1.0 - - - - - - - 227.28571428571428 14 14 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 795 101 C20140707_OR006_02 C20140707_OR006_02 TB437521.[MT7]-EALYALTVLEMC[CAM]MNHC[CAM]GEK[MT7].4b5_1.heavy 640.06 / 692.374 10562.0 47.70180130004883 46 16 10 10 10 3.2543138649979078 30.72844358239684 0.0 3 0.9635213767384175 6.441900695069903 10562.0 10.479532228446653 0.0 - - - - - - - 218.0 21 12 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 797 101 C20140707_OR006_02 C20140707_OR006_02 TB437521.[MT7]-EALYALTVLEMC[CAM]MNHC[CAM]GEK[MT7].4y6_1.heavy 640.06 / 888.411 4089.0 47.70180130004883 46 16 10 10 10 3.2543138649979078 30.72844358239684 0.0 3 0.9635213767384175 6.441900695069903 4089.0 5.458288040123729 0.0 - - - - - - - 227.33333333333334 8 12 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 799 102 C20140707_OR006_02 C20140707_OR006_02 TB450437.[MT7]-LTFNQGGQPFSEVGEVK[MT7].3b4_1.heavy 709.044 / 620.352 4970.0 37.47460174560547 44 17 9 10 8 6.827051392395212 14.647612014667413 0.0 4 0.9766311558496409 8.05738953295571 4970.0 18.970593466787705 4.0 - - - - - - - 255.0 45 1 LOC100293916;GGA2 ADP-ribosylation factor-binding protein GGA2-like;golgi-associated, gamma adaptin ear containing, ARF binding protein 2 801 102 C20140707_OR006_02 C20140707_OR006_02 TB450437.[MT7]-LTFNQGGQPFSEVGEVK[MT7].3y4_1.heavy 709.044 / 576.347 14018.0 37.47460174560547 44 17 9 10 8 6.827051392395212 14.647612014667413 0.0 4 0.9766311558496409 8.05738953295571 14018.0 14.630398967608711 1.0 - - - - - - - 710.1428571428571 39 7 LOC100293916;GGA2 ADP-ribosylation factor-binding protein GGA2-like;golgi-associated, gamma adaptin ear containing, ARF binding protein 2 803 102 C20140707_OR006_02 C20140707_OR006_02 TB450437.[MT7]-LTFNQGGQPFSEVGEVK[MT7].3b8_1.heavy 709.044 / 990.513 10577.0 37.47460174560547 44 17 9 10 8 6.827051392395212 14.647612014667413 0.0 4 0.9766311558496409 8.05738953295571 10577.0 1.944434468841918 1.0 - - - - - - - 297.1666666666667 21 6 LOC100293916;GGA2 ADP-ribosylation factor-binding protein GGA2-like;golgi-associated, gamma adaptin ear containing, ARF binding protein 2 805 102 C20140707_OR006_02 C20140707_OR006_02 TB450437.[MT7]-LTFNQGGQPFSEVGEVK[MT7].3y5_1.heavy 709.044 / 675.416 5352.0 37.47460174560547 44 17 9 10 8 6.827051392395212 14.647612014667413 0.0 4 0.9766311558496409 8.05738953295571 5352.0 6.60109441874919 1.0 - - - - - - - 254.66666666666666 12 6 LOC100293916;GGA2 ADP-ribosylation factor-binding protein GGA2-like;golgi-associated, gamma adaptin ear containing, ARF binding protein 2 807 103 C20140707_OR006_02 C20140707_OR006_02 TB437522.[MT7]-EALYALTVLEMC[CAM]MNHC[CAM]GEK[MT7].3y6_1.heavy 853.077 / 888.411 1249.0 47.69070053100586 41 16 10 5 10 2.4689029549327386 32.210053686846905 0.044403076171875 3 0.9671153668938158 6.786853800717667 1249.0 1.8329918482824548 0.0 - - - - - - - 227.27272727272728 2 11 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 809 103 C20140707_OR006_02 C20140707_OR006_02 TB437522.[MT7]-EALYALTVLEMC[CAM]MNHC[CAM]GEK[MT7].3b4_1.heavy 853.077 / 621.336 2385.0 47.69070053100586 41 16 10 5 10 2.4689029549327386 32.210053686846905 0.044403076171875 3 0.9671153668938158 6.786853800717667 2385.0 12.869208211143695 0.0 - - - - - - - 312.375 4 8 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 811 103 C20140707_OR006_02 C20140707_OR006_02 TB437522.[MT7]-EALYALTVLEMC[CAM]MNHC[CAM]GEK[MT7].3b5_1.heavy 853.077 / 692.374 1590.0 47.69070053100586 41 16 10 5 10 2.4689029549327386 32.210053686846905 0.044403076171875 3 0.9671153668938158 6.786853800717667 1590.0 4.929607231221497 0.0 - - - - - - - 255.625 3 8 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 813 103 C20140707_OR006_02 C20140707_OR006_02 TB437522.[MT7]-EALYALTVLEMC[CAM]MNHC[CAM]GEK[MT7].3y4_1.heavy 853.077 / 637.31 1249.0 47.69070053100586 41 16 10 5 10 2.4689029549327386 32.210053686846905 0.044403076171875 3 0.9671153668938158 6.786853800717667 1249.0 1.467388599261153 3.0 - - - - - - - 293.4166666666667 2 12 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 815 104 C20140707_OR006_02 C20140707_OR006_02 TB437523.[MT7]-NMLLQNPQLAYALLQAQVVMR.4b4_1.heavy 640.357 / 616.361 1729.0 51.736751556396484 43 18 10 5 10 5.708901895838883 17.516503493060238 0.0410003662109375 3 0.9858591742767636 10.36601610649528 1729.0 6.627394628775854 0.0 - - - - - - - 185.8181818181818 3 11 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 817 104 C20140707_OR006_02 C20140707_OR006_02 TB437523.[MT7]-NMLLQNPQLAYALLQAQVVMR.4y7_1.heavy 640.357 / 831.451 2201.0 51.736751556396484 43 18 10 5 10 5.708901895838883 17.516503493060238 0.0410003662109375 3 0.9858591742767636 10.36601610649528 2201.0 22.17751646334881 0.0 - - - - - - - 137.625 4 8 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 819 104 C20140707_OR006_02 C20140707_OR006_02 TB437523.[MT7]-NMLLQNPQLAYALLQAQVVMR.4b6_1.heavy 640.357 / 858.462 1415.0 51.736751556396484 43 18 10 5 10 5.708901895838883 17.516503493060238 0.0410003662109375 3 0.9858591742767636 10.36601610649528 1415.0 31.16582278481013 0.0 - - - - - - - 157.5 2 6 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 821 104 C20140707_OR006_02 C20140707_OR006_02 TB437523.[MT7]-NMLLQNPQLAYALLQAQVVMR.4b3_1.heavy 640.357 / 503.277 2672.0 51.736751556396484 43 18 10 5 10 5.708901895838883 17.516503493060238 0.0410003662109375 3 0.9858591742767636 10.36601610649528 2672.0 17.311894634567636 0.0 - - - - - - - 199.6153846153846 5 13 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 823 105 C20140707_OR006_02 C20140707_OR006_02 TB436994.[MT7]-DLADLVSEMEVMK[MT7].3y3_1.heavy 589.975 / 521.324 56380.0 48.67660140991211 44 14 10 10 10 2.1131480505685962 47.32276092680418 0.0 3 0.9343290451743665 4.789275818176252 56380.0 396.87241808261 0.0 - - - - - - - 277.6666666666667 112 9 FGFR4 fibroblast growth factor receptor 4 825 105 C20140707_OR006_02 C20140707_OR006_02 TB436994.[MT7]-DLADLVSEMEVMK[MT7].3b4_1.heavy 589.975 / 559.284 95705.0 48.67660140991211 44 14 10 10 10 2.1131480505685962 47.32276092680418 0.0 3 0.9343290451743665 4.789275818176252 95705.0 1297.0327770261702 0.0 - - - - - - - 145.0 191 6 FGFR4 fibroblast growth factor receptor 4 827 105 C20140707_OR006_02 C20140707_OR006_02 TB436994.[MT7]-DLADLVSEMEVMK[MT7].3b5_1.heavy 589.975 / 672.369 61486.0 48.67660140991211 44 14 10 10 10 2.1131480505685962 47.32276092680418 0.0 3 0.9343290451743665 4.789275818176252 61486.0 309.72457804416047 0.0 - - - - - - - 152.2 122 5 FGFR4 fibroblast growth factor receptor 4 829 105 C20140707_OR006_02 C20140707_OR006_02 TB436994.[MT7]-DLADLVSEMEVMK[MT7].3y4_1.heavy 589.975 / 650.366 28896.0 48.67660140991211 44 14 10 10 10 2.1131480505685962 47.32276092680418 0.0 3 0.9343290451743665 4.789275818176252 28896.0 130.50522590922958 0.0 - - - - - - - 260.8 57 5 FGFR4 fibroblast growth factor receptor 4 831 106 C20140707_OR006_02 C20140707_OR006_02 TB437281.[MT7]-K[MT7]LHAVPAGNTVK[MT7].3y7_1.heavy 556.349 / 830.485 12713.0 20.0674991607666 48 18 10 10 10 6.16191215785715 16.228728589142325 0.0 3 0.9814322904750638 9.042924730821394 12713.0 189.54623493975902 0.0 - - - - - - - 304.3333333333333 25 3 FGFR4 fibroblast growth factor receptor 4 833 106 C20140707_OR006_02 C20140707_OR006_02 TB437281.[MT7]-K[MT7]LHAVPAGNTVK[MT7].3y6_1.heavy 556.349 / 733.432 4404.0 20.0674991607666 48 18 10 10 10 6.16191215785715 16.228728589142325 0.0 3 0.9814322904750638 9.042924730821394 4404.0 42.95226506024096 0.0 - - - - - - - 166.0 8 7 FGFR4 fibroblast growth factor receptor 4 835 106 C20140707_OR006_02 C20140707_OR006_02 TB437281.[MT7]-K[MT7]LHAVPAGNTVK[MT7].3b4_1.heavy 556.349 / 738.487 3490.0 20.0674991607666 48 18 10 10 10 6.16191215785715 16.228728589142325 0.0 3 0.9814322904750638 9.042924730821394 3490.0 56.765060240963855 0.0 - - - - - - - 228.5 6 4 FGFR4 fibroblast growth factor receptor 4 837 106 C20140707_OR006_02 C20140707_OR006_02 TB437281.[MT7]-K[MT7]LHAVPAGNTVK[MT7].3y5_1.heavy 556.349 / 662.395 5318.0 20.0674991607666 48 18 10 10 10 6.16191215785715 16.228728589142325 0.0 3 0.9814322904750638 9.042924730821394 5318.0 34.70139762257587 0.0 - - - - - - - 238.875 10 8 FGFR4 fibroblast growth factor receptor 4 839 107 C20140707_OR006_02 C20140707_OR006_02 TB450225.[MT7]-VIISDIDGTITR.2y5_1.heavy 723.918 / 547.32 13636.0 37.1411018371582 42 12 10 10 10 1.7141033426059722 46.61834122635296 0.0 3 0.891641660850774 3.7147471887057213 13636.0 55.86078568551867 0.0 - - - - - - - 268.8888888888889 27 9 LPIN1 lipin 1 841 107 C20140707_OR006_02 C20140707_OR006_02 TB450225.[MT7]-VIISDIDGTITR.2y9_1.heavy 723.918 / 977.49 19244.0 37.1411018371582 42 12 10 10 10 1.7141033426059722 46.61834122635296 0.0 3 0.891641660850774 3.7147471887057213 19244.0 66.19487803160143 0.0 - - - - - - - 701.0 38 8 LPIN1 lipin 1 843 107 C20140707_OR006_02 C20140707_OR006_02 TB450225.[MT7]-VIISDIDGTITR.2y10_1.heavy 723.918 / 1090.57 12107.0 37.1411018371582 42 12 10 10 10 1.7141033426059722 46.61834122635296 0.0 3 0.891641660850774 3.7147471887057213 12107.0 76.08187491162971 1.0 - - - - - - - 190.83333333333334 26 6 LPIN1 lipin 1 845 107 C20140707_OR006_02 C20140707_OR006_02 TB450225.[MT7]-VIISDIDGTITR.2y11_1.heavy 723.918 / 1203.66 4078.0 37.1411018371582 42 12 10 10 10 1.7141033426059722 46.61834122635296 0.0 3 0.891641660850774 3.7147471887057213 4078.0 16.431731855045683 0.0 - - - - - - - 206.75 8 8 LPIN1 lipin 1 847 108 C20140707_OR006_02 C20140707_OR006_02 TB411671.[MT7]-FSESVLR.2b3_1.heavy 491.278 / 508.252 1264.0 29.895200729370117 37 13 10 10 4 1.1484311316140963 50.681507458021926 0.0 10 0.9226393814524958 4.40820772798673 1264.0 3.9020580474934032 3.0 - - - - - - - 284.25 2 8 CBX6 chromobox homolog 6 849 108 C20140707_OR006_02 C20140707_OR006_02 TB411671.[MT7]-FSESVLR.2y5_1.heavy 491.278 / 603.346 632.0 29.895200729370117 37 13 10 10 4 1.1484311316140963 50.681507458021926 0.0 10 0.9226393814524958 4.40820772798673 632.0 6.385820942342681 7.0 - - - - - - - 224.55555555555554 2 9 CBX6 chromobox homolog 6 851 108 C20140707_OR006_02 C20140707_OR006_02 TB411671.[MT7]-FSESVLR.2b4_1.heavy 491.278 / 595.284 506.0 29.895200729370117 37 13 10 10 4 1.1484311316140963 50.681507458021926 0.0 10 0.9226393814524958 4.40820772798673 506.0 -0.133509234828496 18.0 - - - - - - - 238.55555555555554 2 9 CBX6 chromobox homolog 6 853 108 C20140707_OR006_02 C20140707_OR006_02 TB411671.[MT7]-FSESVLR.2b6_1.heavy 491.278 / 807.437 253.0 29.895200729370117 37 13 10 10 4 1.1484311316140963 50.681507458021926 0.0 10 0.9226393814524958 4.40820772798673 253.0 2.6067201281568035 13.0 - - - - - - - 0.0 1 0 CBX6 chromobox homolog 6 855 109 C20140707_OR006_02 C20140707_OR006_02 TB450226.[MT7]-NPEMLWLWGELPQAAK[MT7].3b6_1.heavy 724.39 / 915.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - LPIN1 lipin 1 857 109 C20140707_OR006_02 C20140707_OR006_02 TB450226.[MT7]-NPEMLWLWGELPQAAK[MT7].3b4_1.heavy 724.39 / 616.288 N/A N/A - - - - - - - - - 0.0 - - - - - - - LPIN1 lipin 1 859 109 C20140707_OR006_02 C20140707_OR006_02 TB450226.[MT7]-NPEMLWLWGELPQAAK[MT7].3b5_1.heavy 724.39 / 729.372 N/A N/A - - - - - - - - - 0.0 - - - - - - - LPIN1 lipin 1 861 109 C20140707_OR006_02 C20140707_OR006_02 TB450226.[MT7]-NPEMLWLWGELPQAAK[MT7].3y5_1.heavy 724.39 / 658.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - LPIN1 lipin 1 863 110 C20140707_OR006_02 C20140707_OR006_02 TB412054.[MT7]-QPLVSVVDTIAK[MT7].3b4_1.heavy 519.987 / 582.373 15209.0 40.12105083465576 39 13 10 6 10 1.9294767514114273 35.44146377627944 0.034999847412109375 3 0.9031959268409032 3.9341254762906592 15209.0 229.5461443298969 0.0 - - - - - - - 129.33333333333334 30 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 865 110 C20140707_OR006_02 C20140707_OR006_02 TB412054.[MT7]-QPLVSVVDTIAK[MT7].3b5_1.heavy 519.987 / 669.405 21021.0 40.12105083465576 39 13 10 6 10 1.9294767514114273 35.44146377627944 0.034999847412109375 3 0.9031959268409032 3.9341254762906592 21021.0 199.67922700365813 0.0 - - - - - - - 249.28571428571428 42 7 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 867 110 C20140707_OR006_02 C20140707_OR006_02 TB412054.[MT7]-QPLVSVVDTIAK[MT7].3y4_1.heavy 519.987 / 576.384 26639.0 40.12105083465576 39 13 10 6 10 1.9294767514114273 35.44146377627944 0.034999847412109375 3 0.9031959268409032 3.9341254762906592 26639.0 112.39118582858566 0.0 - - - - - - - 203.5 53 10 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 869 110 C20140707_OR006_02 C20140707_OR006_02 TB412054.[MT7]-QPLVSVVDTIAK[MT7].3y5_1.heavy 519.987 / 691.411 31095.0 40.12105083465576 39 13 10 6 10 1.9294767514114273 35.44146377627944 0.034999847412109375 3 0.9031959268409032 3.9341254762906592 31095.0 356.9715048707348 0.0 - - - - - - - 263.0 62 7 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 871 111 C20140707_OR006_02 C20140707_OR006_02 TB412056.[MT7]-GGTLLSVTGEVEPR.3y7_1.heavy 520.29 / 787.394 1020.0 35.015499114990234 36 8 8 10 10 0.6580127842369567 90.64861659902105 0.0 3 0.7852760667226235 2.614120630148435 1020.0 0.028443449048152297 2.0 - - - - - - - 255.0 2 1 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 873 111 C20140707_OR006_02 C20140707_OR006_02 TB412056.[MT7]-GGTLLSVTGEVEPR.3y6_1.heavy 520.29 / 686.347 4335.0 35.015499114990234 36 8 8 10 10 0.6580127842369567 90.64861659902105 0.0 3 0.7852760667226235 2.614120630148435 4335.0 10.866240208877283 0.0 - - - - - - - 227.11111111111111 8 9 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 875 111 C20140707_OR006_02 C20140707_OR006_02 TB412056.[MT7]-GGTLLSVTGEVEPR.3b5_1.heavy 520.29 / 586.368 2295.0 35.015499114990234 36 8 8 10 10 0.6580127842369567 90.64861659902105 0.0 3 0.7852760667226235 2.614120630148435 2295.0 3.0299372713016206 2.0 - - - - - - - 234.16666666666666 4 6 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 877 111 C20140707_OR006_02 C20140707_OR006_02 TB412056.[MT7]-GGTLLSVTGEVEPR.3y4_1.heavy 520.29 / 500.283 N/A 35.015499114990234 36 8 8 10 10 0.6580127842369567 90.64861659902105 0.0 3 0.7852760667226235 2.614120630148435 2805.0 -0.046666666666666634 8.0 - - - - - - - 2725.5 11 8 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 879 112 C20140707_OR006_02 C20140707_OR006_02 TB437418.[MT7]-GIIEEIIEDGESSEVK[MT7].3b6_1.heavy 679.028 / 799.468 43951.0 47.181400299072266 48 18 10 10 10 4.9453673624509875 20.220944708633073 0.0 3 0.981224118263296 8.992497507638253 43951.0 91.62300217732542 0.0 - - - - - - - 298.25 87 8 DNTT deoxynucleotidyltransferase, terminal 881 112 C20140707_OR006_02 C20140707_OR006_02 TB437418.[MT7]-GIIEEIIEDGESSEVK[MT7].3b4_1.heavy 679.028 / 557.341 21805.0 47.181400299072266 48 18 10 10 10 4.9453673624509875 20.220944708633073 0.0 3 0.981224118263296 8.992497507638253 21805.0 67.66211636973132 0.0 - - - - - - - 284.0 43 8 DNTT deoxynucleotidyltransferase, terminal 883 112 C20140707_OR006_02 C20140707_OR006_02 TB437418.[MT7]-GIIEEIIEDGESSEVK[MT7].3b5_1.heavy 679.028 / 686.384 70754.0 47.181400299072266 48 18 10 10 10 4.9453673624509875 20.220944708633073 0.0 3 0.981224118263296 8.992497507638253 70754.0 113.03085157301932 0.0 - - - - - - - 369.0 141 4 DNTT deoxynucleotidyltransferase, terminal 885 112 C20140707_OR006_02 C20140707_OR006_02 TB437418.[MT7]-GIIEEIIEDGESSEVK[MT7].3y5_1.heavy 679.028 / 693.39 26575.0 47.181400299072266 48 18 10 10 10 4.9453673624509875 20.220944708633073 0.0 3 0.981224118263296 8.992497507638253 26575.0 75.82547608989887 0.0 - - - - - - - 258.27272727272725 53 11 DNTT deoxynucleotidyltransferase, terminal 887 113 C20140707_OR006_02 C20140707_OR006_02 TB437289.[MT7]-TGDPNQPVPQDTK[MT7].3y3_1.heavy 562.296 / 507.289 3459.0 19.465200424194336 50 20 10 10 10 90.3996402569862 1.1061990923384442 0.0 3 0.9997649708941238 80.49947336979331 3459.0 27.233755656108595 0.0 - - - - - - - 189.28571428571428 6 14 NLGN4Y;NLGN1;NLGN4X;NLGN2 neuroligin 4, Y-linked;neuroligin 1;neuroligin 4, X-linked;neuroligin 2 889 113 C20140707_OR006_02 C20140707_OR006_02 TB437289.[MT7]-TGDPNQPVPQDTK[MT7].3b6_1.heavy 562.296 / 757.36 8391.0 19.465200424194336 50 20 10 10 10 90.3996402569862 1.1061990923384442 0.0 3 0.9997649708941238 80.49947336979331 8391.0 30.23097536467898 0.0 - - - - - - - 193.25 16 8 NLGN4Y;NLGN1;NLGN4X;NLGN2 neuroligin 4, Y-linked;neuroligin 1;neuroligin 4, X-linked;neuroligin 2 891 113 C20140707_OR006_02 C20140707_OR006_02 TB437289.[MT7]-TGDPNQPVPQDTK[MT7].3b5_1.heavy 562.296 / 629.301 3754.0 19.465200424194336 50 20 10 10 10 90.3996402569862 1.1061990923384442 0.0 3 0.9997649708941238 80.49947336979331 3754.0 19.709385244220858 0.0 - - - - - - - 213.6 7 10 NLGN4Y;NLGN1;NLGN4X;NLGN2 neuroligin 4, Y-linked;neuroligin 1;neuroligin 4, X-linked;neuroligin 2 893 113 C20140707_OR006_02 C20140707_OR006_02 TB437289.[MT7]-TGDPNQPVPQDTK[MT7].3y5_1.heavy 562.296 / 732.401 14279.0 19.465200424194336 50 20 10 10 10 90.3996402569862 1.1061990923384442 0.0 3 0.9997649708941238 80.49947336979331 14279.0 368.93848648648645 0.0 - - - - - - - 154.0 28 11 NLGN4Y;NLGN1;NLGN4X;NLGN2 neuroligin 4, Y-linked;neuroligin 1;neuroligin 4, X-linked;neuroligin 2 895 114 C20140707_OR006_02 C20140707_OR006_02 TB437000.[MT7]-RVSAVEEVR.2y8_1.heavy 594.844 / 888.479 2281.0 20.42514991760254 39 13 10 6 10 1.7253590755834423 50.37925575896044 0.035900115966796875 3 0.9121133806582277 4.132070660692299 2281.0 40.35470773457312 0.0 - - - - - - - 151.8 4 5 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 897 114 C20140707_OR006_02 C20140707_OR006_02 TB437000.[MT7]-RVSAVEEVR.2b6_1.heavy 594.844 / 786.459 2112.0 20.42514991760254 39 13 10 6 10 1.7253590755834423 50.37925575896044 0.035900115966796875 3 0.9121133806582277 4.132070660692299 2112.0 33.18857142857143 0.0 - - - - - - - 168.625 4 8 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 899 114 C20140707_OR006_02 C20140707_OR006_02 TB437000.[MT7]-RVSAVEEVR.2b7_1.heavy 594.844 / 915.502 7011.0 20.42514991760254 39 13 10 6 10 1.7253590755834423 50.37925575896044 0.035900115966796875 3 0.9121133806582277 4.132070660692299 7011.0 80.89615384615385 0.0 - - - - - - - 132.42857142857142 14 7 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 901 114 C20140707_OR006_02 C20140707_OR006_02 TB437000.[MT7]-RVSAVEEVR.2y7_1.heavy 594.844 / 789.41 1183.0 20.42514991760254 39 13 10 6 10 1.7253590755834423 50.37925575896044 0.035900115966796875 3 0.9121133806582277 4.132070660692299 1183.0 12.675 0.0 - - - - - - - 145.54545454545453 2 11 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 903 115 C20140707_OR006_02 C20140707_OR006_02 TB450429.[MT7]-GLLLYYDLVESTFEK[MT7].3y3_1.heavy 693.382 / 567.326 192.0 51.54199981689453 38 16 2 10 10 3.1190013928859877 32.06154387365335 0.0 3 0.962384467413177 6.343192976179064 192.0 -1.2 29.0 - - - - - - - 201.7 9 10 DNTT deoxynucleotidyltransferase, terminal 905 115 C20140707_OR006_02 C20140707_OR006_02 TB450429.[MT7]-GLLLYYDLVESTFEK[MT7].3b4_1.heavy 693.382 / 541.383 1634.0 51.54199981689453 38 16 2 10 10 3.1190013928859877 32.06154387365335 0.0 3 0.962384467413177 6.343192976179064 1634.0 7.144503638253637 0.0 - - - - - - - 216.33333333333334 3 12 DNTT deoxynucleotidyltransferase, terminal 907 115 C20140707_OR006_02 C20140707_OR006_02 TB450429.[MT7]-GLLLYYDLVESTFEK[MT7].3b5_1.heavy 693.382 / 704.446 1442.0 51.54199981689453 38 16 2 10 10 3.1190013928859877 32.06154387365335 0.0 3 0.962384467413177 6.343192976179064 1442.0 -0.600833333333334 0.0 - - - - - - - 192.28571428571428 2 7 DNTT deoxynucleotidyltransferase, terminal 909 115 C20140707_OR006_02 C20140707_OR006_02 TB450429.[MT7]-GLLLYYDLVESTFEK[MT7].3b7_1.heavy 693.382 / 982.537 1730.0 51.54199981689453 38 16 2 10 10 3.1190013928859877 32.06154387365335 0.0 3 0.962384467413177 6.343192976179064 1730.0 -0.3604166666666657 0.0 - - - - - - - 180.125 3 8 DNTT deoxynucleotidyltransferase, terminal 911 116 C20140707_OR006_02 C20140707_OR006_02 TB411772.[MT7]-QSEPFFK[MT7].2b3_1.heavy 585.823 / 489.242 22050.0 30.359224796295166 42 16 10 6 10 3.5787115705642067 27.94301748778105 0.03790092468261719 3 0.9683320010329988 6.91670483472247 22050.0 224.0 0.0 - - - - - - - 252.0 44 7 G6PD glucose-6-phosphate dehydrogenase 913 116 C20140707_OR006_02 C20140707_OR006_02 TB411772.[MT7]-QSEPFFK[MT7].2y4_1.heavy 585.823 / 682.404 32760.0 30.359224796295166 42 16 10 6 10 3.5787115705642067 27.94301748778105 0.03790092468261719 3 0.9683320010329988 6.91670483472247 32760.0 66.3 0.0 - - - - - - - 277.2 65 10 G6PD glucose-6-phosphate dehydrogenase 915 116 C20140707_OR006_02 C20140707_OR006_02 TB411772.[MT7]-QSEPFFK[MT7].2y5_1.heavy 585.823 / 811.447 4536.0 30.359224796295166 42 16 10 6 10 3.5787115705642067 27.94301748778105 0.03790092468261719 3 0.9683320010329988 6.91670483472247 4536.0 36.599999999999994 0.0 - - - - - - - 220.5 9 8 G6PD glucose-6-phosphate dehydrogenase 917 116 C20140707_OR006_02 C20140707_OR006_02 TB411772.[MT7]-QSEPFFK[MT7].2y6_1.heavy 585.823 / 898.479 12222.0 30.359224796295166 42 16 10 6 10 3.5787115705642067 27.94301748778105 0.03790092468261719 3 0.9683320010329988 6.91670483472247 12222.0 38.8 0.0 - - - - - - - 168.0 24 9 G6PD glucose-6-phosphate dehydrogenase 919 117 C20140707_OR006_02 C20140707_OR006_02 TB437556.[MT7]-K[MT7]PGMFFNPEESELDLTYGNRYK[MT7].4y8_1.heavy 767.644 / 1158.64 2450.0 37.71269989013672 37 14 10 5 8 1.259635253110804 48.87097275863702 0.0428009033203125 4 0.941837310987602 5.092280767923678 2450.0 19.96836321150827 1.0 - - - - - - - 232.6 5 10 G6PD glucose-6-phosphate dehydrogenase 921 117 C20140707_OR006_02 C20140707_OR006_02 TB437556.[MT7]-K[MT7]PGMFFNPEESELDLTYGNRYK[MT7].4b4_1.heavy 767.644 / 702.421 3307.0 37.71269989013672 37 14 10 5 8 1.259635253110804 48.87097275863702 0.0428009033203125 4 0.941837310987602 5.092280767923678 3307.0 5.984095238095238 0.0 - - - - - - - 258.3333333333333 6 9 G6PD glucose-6-phosphate dehydrogenase 923 117 C20140707_OR006_02 C20140707_OR006_02 TB437556.[MT7]-K[MT7]PGMFFNPEESELDLTYGNRYK[MT7].4y7_1.heavy 767.644 / 1045.55 5144.0 37.71269989013672 37 14 10 5 8 1.259635253110804 48.87097275863702 0.0428009033203125 4 0.941837310987602 5.092280767923678 5144.0 8.96740762636713 0.0 - - - - - - - 244.7 10 10 G6PD glucose-6-phosphate dehydrogenase 925 117 C20140707_OR006_02 C20140707_OR006_02 TB437556.[MT7]-K[MT7]PGMFFNPEESELDLTYGNRYK[MT7].4y6_1.heavy 767.644 / 944.507 2450.0 37.71269989013672 37 14 10 5 8 1.259635253110804 48.87097275863702 0.0428009033203125 4 0.941837310987602 5.092280767923678 2450.0 9.600000000000001 0.0 - - - - - - - 244.625 4 8 G6PD glucose-6-phosphate dehydrogenase 927 118 C20140707_OR006_02 C20140707_OR006_02 TB437557.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGERR.4b4_1.heavy 774.426 / 615.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 929 118 C20140707_OR006_02 C20140707_OR006_02 TB437557.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGERR.4b5_1.heavy 774.426 / 744.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 931 118 C20140707_OR006_02 C20140707_OR006_02 TB437557.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGERR.4b3_1.heavy 774.426 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 933 118 C20140707_OR006_02 C20140707_OR006_02 TB437557.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGERR.4b6_1.heavy 774.426 / 857.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 935 119 C20140707_OR006_02 C20140707_OR006_02 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 21543.0 22.690766016642254 23 -3 10 6 10 null 0.0 0.03619956970214844 3 0.0 0.0 21543.0 150.801 0.0 - - - - - - - 248.42857142857142 43 14 937 119 C20140707_OR006_02 C20140707_OR006_02 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 25494.0 22.690766016642254 23 -3 10 6 10 null 0.0 0.03619956970214844 3 0.0 0.0 25494.0 343.53617021276597 0.0 - - - - - - - 178.6 50 10 939 119 C20140707_OR006_02 C20140707_OR006_02 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 104233.0 22.690766016642254 23 -3 10 6 10 null 0.0 0.03619956970214844 3 0.0 0.0 104233.0 1171.9944655022116 0.0 - - - - - - - 240.22222222222223 208 9 941 120 C20140707_OR006_02 C20140707_OR006_02 TB437552.[MT7]-EAVVHGLNESEASYLITSVELLESK[MT7].4b4_1.heavy 752.154 / 543.326 2457.0 48.87687397003174 36 11 10 5 10 6.351955585959283 15.7431831263187 0.043697357177734375 3 0.8585654137188291 3.2421097887849246 2457.0 7.032660953588527 2.0 - - - - - - - 279.125 5 8 ACSL4 acyl-CoA synthetase long-chain family member 4 943 120 C20140707_OR006_02 C20140707_OR006_02 TB437552.[MT7]-EAVVHGLNESEASYLITSVELLESK[MT7].4b13_2.heavy 752.154 / 734.363 5583.0 48.87687397003174 36 11 10 5 10 6.351955585959283 15.7431831263187 0.043697357177734375 3 0.8585654137188291 3.2421097887849246 5583.0 39.78312549360819 0.0 - - - - - - - 207.42857142857142 11 7 ACSL4 acyl-CoA synthetase long-chain family member 4 945 120 C20140707_OR006_02 C20140707_OR006_02 TB437552.[MT7]-EAVVHGLNESEASYLITSVELLESK[MT7].4y6_1.heavy 752.154 / 862.5 3350.0 48.87687397003174 36 11 10 5 10 6.351955585959283 15.7431831263187 0.043697357177734375 3 0.8585654137188291 3.2421097887849246 3350.0 11.200000000000001 0.0 - - - - - - - 287.0 6 7 ACSL4 acyl-CoA synthetase long-chain family member 4 947 120 C20140707_OR006_02 C20140707_OR006_02 TB437552.[MT7]-EAVVHGLNESEASYLITSVELLESK[MT7].4y3_1.heavy 752.154 / 507.289 7147.0 48.87687397003174 36 11 10 5 10 6.351955585959283 15.7431831263187 0.043697357177734375 3 0.8585654137188291 3.2421097887849246 7147.0 33.708238805970154 0.0 - - - - - - - 213.27272727272728 14 11 ACSL4 acyl-CoA synthetase long-chain family member 4 949 121 C20140707_OR006_02 C20140707_OR006_02 TB437014.[MT7]-QLVEALDK[MT7].3y3_1.heavy 401.911 / 519.326 3011.0 30.963499069213867 32 16 0 10 6 2.6030405741438667 38.41661209329775 0.0 5 0.9660112342465627 6.675085618033416 3011.0 33.68481274900398 1.0 - - - - - - - 209.0 43 3 FGFR4 fibroblast growth factor receptor 4 951 121 C20140707_OR006_02 C20140707_OR006_02 TB437014.[MT7]-QLVEALDK[MT7].3b4_1.heavy 401.911 / 614.363 3764.0 30.963499069213867 32 16 0 10 6 2.6030405741438667 38.41661209329775 0.0 5 0.9660112342465627 6.675085618033416 3764.0 18.383270925409974 0.0 - - - - - - - 225.6 7 5 FGFR4 fibroblast growth factor receptor 4 953 121 C20140707_OR006_02 C20140707_OR006_02 TB437014.[MT7]-QLVEALDK[MT7].3b5_1.heavy 401.911 / 685.4 2760.0 30.963499069213867 32 16 0 10 6 2.6030405741438667 38.41661209329775 0.0 5 0.9660112342465627 6.675085618033416 2760.0 42.371520000000004 0.0 - - - - - - - 208.66666666666666 5 3 FGFR4 fibroblast growth factor receptor 4 955 121 C20140707_OR006_02 C20140707_OR006_02 TB437014.[MT7]-QLVEALDK[MT7].3b3_1.heavy 401.911 / 485.32 4391.0 30.963499069213867 32 16 0 10 6 2.6030405741438667 38.41661209329775 0.0 5 0.9660112342465627 6.675085618033416 4391.0 15.211974991518439 1.0 - - - - - - - 229.83333333333334 13 6 FGFR4 fibroblast growth factor receptor 4 957 122 C20140707_OR006_02 C20140707_OR006_02 TB437155.[MT7]-IRDAYQMLK[MT7].2b3_1.heavy 713.41 / 529.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 959 122 C20140707_OR006_02 C20140707_OR006_02 TB437155.[MT7]-IRDAYQMLK[MT7].2b6_1.heavy 713.41 / 891.481 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 961 122 C20140707_OR006_02 C20140707_OR006_02 TB437155.[MT7]-IRDAYQMLK[MT7].2y3_1.heavy 713.41 / 535.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 963 122 C20140707_OR006_02 C20140707_OR006_02 TB437155.[MT7]-IRDAYQMLK[MT7].2b5_1.heavy 713.41 / 763.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 965 123 C20140707_OR006_02 C20140707_OR006_02 TB411662.[MT7]-ATPEEK[MT7].2y4_1.heavy 481.773 / 646.353 21492.0 15.338099956512451 44 17 10 7 10 5.216088490016091 19.171453895271533 0.026399612426757812 3 0.9784435875747152 8.390558573826526 21492.0 1085.7421658986175 0.0 - - - - - - - 96.22222222222223 42 18 FANCG;G6PD Fanconi anemia, complementation group G;glucose-6-phosphate dehydrogenase 967 123 C20140707_OR006_02 C20140707_OR006_02 TB411662.[MT7]-ATPEEK[MT7].2y5_1.heavy 481.773 / 747.401 4158.0 15.338099956512451 44 17 10 7 10 5.216088490016091 19.171453895271533 0.026399612426757812 3 0.9784435875747152 8.390558573826526 4158.0 102.84588906372935 0.0 - - - - - - - 70.26666666666667 8 15 FANCG;G6PD Fanconi anemia, complementation group G;glucose-6-phosphate dehydrogenase 969 123 C20140707_OR006_02 C20140707_OR006_02 TB411662.[MT7]-ATPEEK[MT7].2y3_1.heavy 481.773 / 549.3 2223.0 15.338099956512451 44 17 10 7 10 5.216088490016091 19.171453895271533 0.026399612426757812 3 0.9784435875747152 8.390558573826526 2223.0 27.233221535745805 0.0 - - - - - - - 93.5909090909091 4 22 FANCG;G6PD Fanconi anemia, complementation group G;glucose-6-phosphate dehydrogenase 971 123 C20140707_OR006_02 C20140707_OR006_02 TB411662.[MT7]-ATPEEK[MT7].2b5_1.heavy 481.773 / 672.332 1544.0 15.338099956512451 44 17 10 7 10 5.216088490016091 19.171453895271533 0.026399612426757812 3 0.9784435875747152 8.390558573826526 1544.0 67.0252534562212 0.0 - - - - - - - 84.47368421052632 3 19 FANCG;G6PD Fanconi anemia, complementation group G;glucose-6-phosphate dehydrogenase 973 124 C20140707_OR006_02 C20140707_OR006_02 TB437154.[MT7]-SLPFTIISMK[MT7].3y3_1.heavy 475.619 / 509.287 17576.0 43.937400817871094 50 20 10 10 10 11.662038601104426 8.574830132231746 0.0 3 0.9944288250651541 16.52673784649508 17576.0 132.60814999709757 0.0 - - - - - - - 160.5 35 2 DNTT deoxynucleotidyltransferase, terminal 975 124 C20140707_OR006_02 C20140707_OR006_02 TB437154.[MT7]-SLPFTIISMK[MT7].3b4_1.heavy 475.619 / 589.347 5573.0 43.937400817871094 50 20 10 10 10 11.662038601104426 8.574830132231746 0.0 3 0.9944288250651541 16.52673784649508 5573.0 31.497283791323753 0.0 - - - - - - - 187.375 11 8 DNTT deoxynucleotidyltransferase, terminal 977 124 C20140707_OR006_02 C20140707_OR006_02 TB437154.[MT7]-SLPFTIISMK[MT7].3b5_1.heavy 475.619 / 690.394 3215.0 43.937400817871094 50 20 10 10 10 11.662038601104426 8.574830132231746 0.0 3 0.9944288250651541 16.52673784649508 3215.0 15.023364485981308 0.0 - - - - - - - 160.5 6 2 DNTT deoxynucleotidyltransferase, terminal 979 124 C20140707_OR006_02 C20140707_OR006_02 TB437154.[MT7]-SLPFTIISMK[MT7].3y4_1.heavy 475.619 / 622.371 7181.0 43.937400817871094 50 20 10 10 10 11.662038601104426 8.574830132231746 0.0 3 0.9944288250651541 16.52673784649508 7181.0 99.99710280373831 0.0 - - - - - - - 107.0 14 3 DNTT deoxynucleotidyltransferase, terminal 981 125 C20140707_OR006_02 C20140707_OR006_02 TB450213.[MT7]-IRDAYQMLK[MT7].3b6_1.heavy 475.942 / 891.481 1265.0 31.219200134277344 37 11 10 10 6 1.5209259384488396 57.61859572087224 0.0 6 0.8719206431727519 3.410944082583802 1265.0 15.140157480314961 0.0 - - - - - - - 158.5 2 4 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 983 125 C20140707_OR006_02 C20140707_OR006_02 TB450213.[MT7]-IRDAYQMLK[MT7].3y3_1.heavy 475.942 / 535.339 7970.0 31.219200134277344 37 11 10 10 6 1.5209259384488396 57.61859572087224 0.0 6 0.8719206431727519 3.410944082583802 7970.0 31.18695652173913 0.0 - - - - - - - 211.16666666666666 15 6 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 985 125 C20140707_OR006_02 C20140707_OR006_02 TB450213.[MT7]-IRDAYQMLK[MT7].3b5_1.heavy 475.942 / 763.422 1518.0 31.219200134277344 37 11 10 10 6 1.5209259384488396 57.61859572087224 0.0 6 0.8719206431727519 3.410944082583802 1518.0 -0.01195275590551148 0.0 - - - - - - - 253.25 3 4 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 987 125 C20140707_OR006_02 C20140707_OR006_02 TB450213.[MT7]-IRDAYQMLK[MT7].3b3_1.heavy 475.942 / 529.321 1645.0 31.219200134277344 37 11 10 10 6 1.5209259384488396 57.61859572087224 0.0 6 0.8719206431727519 3.410944082583802 1645.0 -0.014229249011857709 4.0 - - - - - - - 190.0 4 4 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 989 126 C20140707_OR006_02 C20140707_OR006_02 TB411953.[MT7]-ILPPPSPWPK[MT7].3y3_1.heavy 473.958 / 574.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 991 126 C20140707_OR006_02 C20140707_OR006_02 TB411953.[MT7]-ILPPPSPWPK[MT7].3b3_1.heavy 473.958 / 468.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 993 126 C20140707_OR006_02 C20140707_OR006_02 TB411953.[MT7]-ILPPPSPWPK[MT7].3y4_1.heavy 473.958 / 671.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 995 126 C20140707_OR006_02 C20140707_OR006_02 TB411953.[MT7]-ILPPPSPWPK[MT7].3y5_1.heavy 473.958 / 758.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 997 127 C20140707_OR006_02 C20140707_OR006_02 TB437549.[MT7]-NIINLLGVC[CAM]TQEGPLYVIVEC[CAM]AAK[MT7].4b7_1.heavy 741.405 / 882.553 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 999 127 C20140707_OR006_02 C20140707_OR006_02 TB437549.[MT7]-NIINLLGVC[CAM]TQEGPLYVIVEC[CAM]AAK[MT7].4b4_1.heavy 741.405 / 599.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1001 127 C20140707_OR006_02 C20140707_OR006_02 TB437549.[MT7]-NIINLLGVC[CAM]TQEGPLYVIVEC[CAM]AAK[MT7].4b5_1.heavy 741.405 / 712.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1003 127 C20140707_OR006_02 C20140707_OR006_02 TB437549.[MT7]-NIINLLGVC[CAM]TQEGPLYVIVEC[CAM]AAK[MT7].4y6_1.heavy 741.405 / 821.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1005 128 C20140707_OR006_02 C20140707_OR006_02 TB437150.[MT7]-VAISLGFLGGAK[MT7].3b6_1.heavy 474.297 / 685.437 2778.0 42.479400634765625 34 14 0 10 10 1.4459360554138934 45.32205587704308 0.0 3 0.9431423168758976 5.1509608604341235 2778.0 30.020322580645164 0.0 - - - - - - - 176.11111111111111 5 9 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1007 128 C20140707_OR006_02 C20140707_OR006_02 TB437150.[MT7]-VAISLGFLGGAK[MT7].3b4_1.heavy 474.297 / 515.331 N/A 42.479400634765625 34 14 0 10 10 1.4459360554138934 45.32205587704308 0.0 3 0.9431423168758976 5.1509608604341235 2480.0 15.067686016089313 2.0 - - - - - - - 248.0 132 4 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1009 128 C20140707_OR006_02 C20140707_OR006_02 TB437150.[MT7]-VAISLGFLGGAK[MT7].3b3_1.heavy 474.297 / 428.299 2976.0 42.479400634765625 34 14 0 10 10 1.4459360554138934 45.32205587704308 0.0 3 0.9431423168758976 5.1509608604341235 2976.0 12.019190221543163 0.0 - - - - - - - 198.4 5 5 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1011 128 C20140707_OR006_02 C20140707_OR006_02 TB437150.[MT7]-VAISLGFLGGAK[MT7].3y4_1.heavy 474.297 / 476.295 7639.0 42.479400634765625 34 14 0 10 10 1.4459360554138934 45.32205587704308 0.0 3 0.9431423168758976 5.1509608604341235 7639.0 18.04648949521242 0.0 - - - - - - - 272.75 15 4 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1013 129 C20140707_OR006_02 C20140707_OR006_02 TB412062.[MT7]-DYSDSTNPGPPK[MT7].3b4_1.heavy 522.594 / 625.259 6928.0 20.560750484466553 43 17 10 6 10 3.4189193401107056 23.204078852343542 0.03539848327636719 3 0.9752083697953045 7.82183196663814 6928.0 96.03461306532662 1.0 - - - - - - - 226.84615384615384 13 13 DNTT deoxynucleotidyltransferase, terminal 1015 129 C20140707_OR006_02 C20140707_OR006_02 TB412062.[MT7]-DYSDSTNPGPPK[MT7].3y4_1.heavy 522.594 / 542.342 7326.0 20.560750484466553 43 17 10 6 10 3.4189193401107056 23.204078852343542 0.03539848327636719 3 0.9752083697953045 7.82183196663814 7326.0 24.477889988056873 0.0 - - - - - - - 239.0 14 11 DNTT deoxynucleotidyltransferase, terminal 1017 129 C20140707_OR006_02 C20140707_OR006_02 TB412062.[MT7]-DYSDSTNPGPPK[MT7].3b7_1.heavy 522.594 / 927.381 1752.0 20.560750484466553 43 17 10 6 10 3.4189193401107056 23.204078852343542 0.03539848327636719 3 0.9752083697953045 7.82183196663814 1752.0 10.797383142125723 0.0 - - - - - - - 159.375 3 8 DNTT deoxynucleotidyltransferase, terminal 1019 129 C20140707_OR006_02 C20140707_OR006_02 TB412062.[MT7]-DYSDSTNPGPPK[MT7].3y5_1.heavy 522.594 / 639.395 5255.0 20.560750484466553 43 17 10 6 10 3.4189193401107056 23.204078852343542 0.03539848327636719 3 0.9752083697953045 7.82183196663814 5255.0 30.227411491628043 0.0 - - - - - - - 170.85714285714286 10 14 DNTT deoxynucleotidyltransferase, terminal 1021 130 C20140707_OR006_02 C20140707_OR006_02 TB450018.[MT7]-SDTLGHILPTLGK[MT7].3b6_1.heavy 547.326 / 755.38 7804.0 36.277950286865234 39 14 10 5 10 2.3401922858446853 32.79546079161132 0.04470062255859375 3 0.946009291540152 5.287242545647822 7804.0 41.39778125 1.0 - - - - - - - 192.0 42 6 LPIN1 lipin 1 1023 130 C20140707_OR006_02 C20140707_OR006_02 TB450018.[MT7]-SDTLGHILPTLGK[MT7].3b5_1.heavy 547.326 / 618.321 17400.0 36.277950286865234 39 14 10 5 10 2.3401922858446853 32.79546079161132 0.04470062255859375 3 0.946009291540152 5.287242545647822 17400.0 99.57421875 0.0 - - - - - - - 256.0 34 12 LPIN1 lipin 1 1025 130 C20140707_OR006_02 C20140707_OR006_02 TB450018.[MT7]-SDTLGHILPTLGK[MT7].3y4_1.heavy 547.326 / 562.368 8316.0 36.277950286865234 39 14 10 5 10 2.3401922858446853 32.79546079161132 0.04470062255859375 3 0.946009291540152 5.287242545647822 8316.0 73.80449999999999 0.0 - - - - - - - 208.0 16 8 LPIN1 lipin 1 1027 130 C20140707_OR006_02 C20140707_OR006_02 TB450018.[MT7]-SDTLGHILPTLGK[MT7].3y5_1.heavy 547.326 / 659.421 25333.0 36.277950286865234 39 14 10 5 10 2.3401922858446853 32.79546079161132 0.04470062255859375 3 0.946009291540152 5.287242545647822 25333.0 95.98832031250001 0.0 - - - - - - - 256.0 50 6 LPIN1 lipin 1 1029 131 C20140707_OR006_02 C20140707_OR006_02 TB437157.[MT7]-SSIFDADEEK[MT7].3y3_1.heavy 476.908 / 549.3 5841.0 29.296899795532227 32 12 2 10 8 1.2002206827707513 54.49691835220442 0.0 4 0.88525768768212 3.607926501172607 5841.0 6.284116444579043 0.0 - - - - - - - 222.25 11 12 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1031 131 C20140707_OR006_02 C20140707_OR006_02 TB437157.[MT7]-SSIFDADEEK[MT7].3b4_1.heavy 476.908 / 579.326 2285.0 29.296899795532227 32 12 2 10 8 1.2002206827707513 54.49691835220442 0.0 4 0.88525768768212 3.607926501172607 2285.0 2.7416572928383953 0.0 - - - - - - - 211.66666666666666 4 9 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1033 131 C20140707_OR006_02 C20140707_OR006_02 TB437157.[MT7]-SSIFDADEEK[MT7].3b5_1.heavy 476.908 / 694.353 4571.0 29.296899795532227 32 12 2 10 8 1.2002206827707513 54.49691835220442 0.0 4 0.88525768768212 3.607926501172607 4571.0 41.390944881889766 0.0 - - - - - - - 225.77777777777777 9 9 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1035 131 C20140707_OR006_02 C20140707_OR006_02 TB437157.[MT7]-SSIFDADEEK[MT7].3y4_1.heavy 476.908 / 664.327 3809.0 29.296899795532227 32 12 2 10 8 1.2002206827707513 54.49691835220442 0.0 4 0.88525768768212 3.607926501172607 3809.0 26.992913385826775 1.0 - - - - - - - 254.0 24 8 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1037 132 C20140707_OR006_02 C20140707_OR006_02 TB437156.[MT7]-ELVDQDIQPAR.2y8_1.heavy 714.384 / 942.464 7714.0 27.66939926147461 39 14 10 5 10 1.3300057059705193 44.964935215455945 0.0447998046875 3 0.9388458704992394 4.964905571455458 7714.0 70.15169291760421 0.0 - - - - - - - 244.66666666666666 15 3 NLGN1 neuroligin 1 1039 132 C20140707_OR006_02 C20140707_OR006_02 TB437156.[MT7]-ELVDQDIQPAR.2y5_1.heavy 714.384 / 584.352 5877.0 27.66939926147461 39 14 10 5 10 1.3300057059705193 44.964935215455945 0.0447998046875 3 0.9388458704992394 4.964905571455458 5877.0 31.91116146458583 0.0 - - - - - - - 244.71428571428572 11 7 NLGN1 neuroligin 1 1041 132 C20140707_OR006_02 C20140707_OR006_02 TB437156.[MT7]-ELVDQDIQPAR.2y10_1.heavy 714.384 / 1154.62 2204.0 27.66939926147461 39 14 10 5 10 1.3300057059705193 44.964935215455945 0.0447998046875 3 0.9388458704992394 4.964905571455458 2204.0 16.600983606557374 1.0 - - - - - - - 214.0 4 8 NLGN1 neuroligin 1 1043 132 C20140707_OR006_02 C20140707_OR006_02 TB437156.[MT7]-ELVDQDIQPAR.2y7_1.heavy 714.384 / 827.437 3796.0 27.66939926147461 39 14 10 5 10 1.3300057059705193 44.964935215455945 0.0447998046875 3 0.9388458704992394 4.964905571455458 3796.0 44.59061759785881 0.0 - - - - - - - 198.75 7 8 NLGN1 neuroligin 1 1045 133 C20140707_OR006_02 C20140707_OR006_02 TB450010.[MT7]-SQLDSLK[MT7].2y4_1.heavy 539.821 / 606.358 6000.0 25.53059959411621 47 17 10 10 10 4.653450150008962 21.489431878798015 0.0 3 0.9794013098375702 8.584089644020398 6000.0 24.9 0.0 - - - - - - - 185.71428571428572 12 14 LPIN1 lipin 1 1047 133 C20140707_OR006_02 C20140707_OR006_02 TB450010.[MT7]-SQLDSLK[MT7].2y5_1.heavy 539.821 / 719.442 5200.0 25.53059959411621 47 17 10 10 10 4.653450150008962 21.489431878798015 0.0 3 0.9794013098375702 8.584089644020398 5200.0 5.777777777777777 0.0 - - - - - - - 211.11111111111111 10 9 LPIN1 lipin 1 1049 133 C20140707_OR006_02 C20140707_OR006_02 TB450010.[MT7]-SQLDSLK[MT7].2b4_1.heavy 539.821 / 588.311 10701.0 25.53059959411621 47 17 10 10 10 4.653450150008962 21.489431878798015 0.0 3 0.9794013098375702 8.584089644020398 10701.0 58.855500000000006 0.0 - - - - - - - 258.3333333333333 21 12 LPIN1 lipin 1 1051 133 C20140707_OR006_02 C20140707_OR006_02 TB450010.[MT7]-SQLDSLK[MT7].2y6_1.heavy 539.821 / 847.5 2600.0 25.53059959411621 47 17 10 10 10 4.653450150008962 21.489431878798015 0.0 3 0.9794013098375702 8.584089644020398 2600.0 11.910689655172414 1.0 - - - - - - - 200.0 5 9 LPIN1 lipin 1 1053 134 C20140707_OR006_02 C20140707_OR006_02 TB450352.[MT7]-LDDVDPLVATNFGK[MT7].3b6_1.heavy 597.996 / 799.395 10424.0 40.03355121612549 44 18 10 6 10 2.926824742744364 25.93056855654923 0.034999847412109375 3 0.9873610600309303 10.96600809433203 10424.0 26.590826793264593 0.0 - - - - - - - 195.72727272727272 20 11 NLGN1 neuroligin 1 1055 134 C20140707_OR006_02 C20140707_OR006_02 TB450352.[MT7]-LDDVDPLVATNFGK[MT7].3b4_1.heavy 597.996 / 587.316 13370.0 40.03355121612549 44 18 10 6 10 2.926824742744364 25.93056855654923 0.034999847412109375 3 0.9873610600309303 10.96600809433203 13370.0 35.413496683174245 0.0 - - - - - - - 264.4 26 15 NLGN1 neuroligin 1 1057 134 C20140707_OR006_02 C20140707_OR006_02 TB450352.[MT7]-LDDVDPLVATNFGK[MT7].3b5_1.heavy 597.996 / 702.343 60166.0 40.03355121612549 44 18 10 6 10 2.926824742744364 25.93056855654923 0.034999847412109375 3 0.9873610600309303 10.96600809433203 60166.0 179.2641300036343 0.0 - - - - - - - 226.54545454545453 120 11 NLGN1 neuroligin 1 1059 134 C20140707_OR006_02 C20140707_OR006_02 TB450352.[MT7]-LDDVDPLVATNFGK[MT7].3b7_1.heavy 597.996 / 912.479 23794.0 40.03355121612549 44 18 10 6 10 2.926824742744364 25.93056855654923 0.034999847412109375 3 0.9873610600309303 10.96600809433203 23794.0 239.9526984313036 0.0 - - - - - - - 294.6 47 10 NLGN1 neuroligin 1 1061 135 C20140707_OR006_02 C20140707_OR006_02 TB437545.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGER.3b6_1.heavy 980.198 / 857.448 3691.0 53.872100830078125 40 16 10 10 4 2.4668892868671226 34.26664836657307 0.0 8 0.9645592513494006 6.536117731758375 3691.0 0.32999552972731333 2.0 - - - - - - - 247.0 7 12 NLGN1 neuroligin 1 1063 135 C20140707_OR006_02 C20140707_OR006_02 TB437545.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGER.3b5_1.heavy 980.198 / 744.364 N/A 53.872100830078125 40 16 10 10 4 2.4668892868671226 34.26664836657307 0.0 8 0.9645592513494006 6.536117731758375 0.0 0.0 50.0 - - - - - - - 154.0 6 8 NLGN1 neuroligin 1 1065 135 C20140707_OR006_02 C20140707_OR006_02 TB437545.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGER.3b7_1.heavy 980.198 / 970.533 4026.0 53.872100830078125 40 16 10 10 4 2.4668892868671226 34.26664836657307 0.0 8 0.9645592513494006 6.536117731758375 4026.0 -0.38704095366275715 4.0 - - - - - - - 195.91666666666666 10 12 NLGN1 neuroligin 1 1067 135 C20140707_OR006_02 C20140707_OR006_02 TB437545.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGER.3y10_1.heavy 980.198 / 1058.53 12638.0 53.872100830078125 40 16 10 10 4 2.4668892868671226 34.26664836657307 0.0 8 0.9645592513494006 6.536117731758375 12638.0 19.72760975609756 2.0 - - - - - - - 316.6666666666667 26 3 NLGN1 neuroligin 1 1069 136 C20140707_OR006_02 C20140707_OR006_02 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 145227.0 32.374698638916016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 145227.0 311.4302005550208 0.0 - - - - - - - 236.875 290 8 1071 136 C20140707_OR006_02 C20140707_OR006_02 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 148261.0 32.374698638916016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 148261.0 417.25612223027633 0.0 - - - - - - - 252.5 296 6 1073 136 C20140707_OR006_02 C20140707_OR006_02 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 305117.0 32.374698638916016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 305117.0 1146.2517495677744 0.0 - - - - - - - 252.66666666666666 610 6 1075 137 C20140707_OR006_02 C20140707_OR006_02 TB437546.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGER.4y10_1.heavy 735.4 / 1058.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 1077 137 C20140707_OR006_02 C20140707_OR006_02 TB437546.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGER.4b5_1.heavy 735.4 / 744.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 1079 137 C20140707_OR006_02 C20140707_OR006_02 TB437546.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGER.4y6_1.heavy 735.4 / 656.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 1081 137 C20140707_OR006_02 C20140707_OR006_02 TB437546.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGER.4b6_1.heavy 735.4 / 857.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 1083 138 C20140707_OR006_02 C20140707_OR006_02 TB437548.[MT7]-NIINLLGVC[CAM]TQEGPLYVIVEC[CAM]AAK[MT7].3y8_1.heavy 988.204 / 1033.58 3252.0 52.81540012359619 39 13 10 6 10 1.3051082382462578 70.7234272335987 0.035999298095703125 3 0.9018719367174518 3.9070476505222755 3252.0 11.52 0.0 - - - - - - - 186.33333333333334 6 12 FGFR4 fibroblast growth factor receptor 4 1085 138 C20140707_OR006_02 C20140707_OR006_02 TB437548.[MT7]-NIINLLGVC[CAM]TQEGPLYVIVEC[CAM]AAK[MT7].3b7_1.heavy 988.204 / 882.553 1558.0 52.81540012359619 39 13 10 6 10 1.3051082382462578 70.7234272335987 0.035999298095703125 3 0.9018719367174518 3.9070476505222755 1558.0 -0.44236229415105055 2.0 - - - - - - - 213.53846153846155 3 13 FGFR4 fibroblast growth factor receptor 4 1087 138 C20140707_OR006_02 C20140707_OR006_02 TB437548.[MT7]-NIINLLGVC[CAM]TQEGPLYVIVEC[CAM]AAK[MT7].3b4_1.heavy 988.204 / 599.363 3455.0 52.81540012359619 39 13 10 6 10 1.3051082382462578 70.7234272335987 0.035999298095703125 3 0.9018719367174518 3.9070476505222755 3455.0 41.24714566677736 0.0 - - - - - - - 151.0 6 13 FGFR4 fibroblast growth factor receptor 4 1089 138 C20140707_OR006_02 C20140707_OR006_02 TB437548.[MT7]-NIINLLGVC[CAM]TQEGPLYVIVEC[CAM]AAK[MT7].3b5_1.heavy 988.204 / 712.447 3861.0 52.81540012359619 39 13 10 6 10 1.3051082382462578 70.7234272335987 0.035999298095703125 3 0.9018719367174518 3.9070476505222755 3861.0 0.0 0.0 - - - - - - - 172.0 7 13 FGFR4 fibroblast growth factor receptor 4 1091 139 C20140707_OR006_02 C20140707_OR006_02 TB450153.[MT7]-WAAAAAAFEK[MT7].2y4_1.heavy 662.369 / 638.363 1799.0 36.536648750305176 36 17 6 5 8 10.562388311275754 9.467555731997296 0.045001983642578125 4 0.9781519484009557 8.334165484541229 1799.0 1.7896626297577853 6.0 - - - - - - - 713.5555555555555 8 9 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1093 139 C20140707_OR006_02 C20140707_OR006_02 TB450153.[MT7]-WAAAAAAFEK[MT7].2y5_1.heavy 662.369 / 709.4 2441.0 36.536648750305176 36 17 6 5 8 10.562388311275754 9.467555731997296 0.045001983642578125 4 0.9781519484009557 8.334165484541229 2441.0 4.1809193061565875 2.0 - - - - - - - 240.75 5 8 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1095 139 C20140707_OR006_02 C20140707_OR006_02 TB450153.[MT7]-WAAAAAAFEK[MT7].2y9_1.heavy 662.369 / 993.549 1927.0 36.536648750305176 36 17 6 5 8 10.562388311275754 9.467555731997296 0.045001983642578125 4 0.9781519484009557 8.334165484541229 1927.0 18.755794439935066 0.0 - - - - - - - 192.4 3 10 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1097 139 C20140707_OR006_02 C20140707_OR006_02 TB450153.[MT7]-WAAAAAAFEK[MT7].2b4_1.heavy 662.369 / 544.3 2698.0 36.536648750305176 36 17 6 5 8 10.562388311275754 9.467555731997296 0.045001983642578125 4 0.9781519484009557 8.334165484541229 2698.0 1.1404428559306916 2.0 - - - - - - - 256.6666666666667 5 9 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1099 140 C20140707_OR006_02 C20140707_OR006_02 TB412434.[MT7]-YYNWTTAAPLLLAMQAFQK[MT7]PLPK[MT7].4b8_1.heavy 775.187 / 1115.53 1816.0 52.851399421691895 38 15 10 3 10 4.68387112279829 21.349861552180563 0.07199859619140625 3 0.9557025418564616 5.8419334735894966 1816.0 21.289702127659574 0.0 - - - - - - - 162.73333333333332 3 15 LPIN1 lipin 1 1101 140 C20140707_OR006_02 C20140707_OR006_02 TB412434.[MT7]-YYNWTTAAPLLLAMQAFQK[MT7]PLPK[MT7].4y4_1.heavy 775.187 / 598.404 2192.0 52.851399421691895 38 15 10 3 10 4.68387112279829 21.349861552180563 0.07199859619140625 3 0.9557025418564616 5.8419334735894966 2192.0 0.0 1.0 - - - - - - - 229.66666666666666 4 15 LPIN1 lipin 1 1103 140 C20140707_OR006_02 C20140707_OR006_02 TB412434.[MT7]-YYNWTTAAPLLLAMQAFQK[MT7]PLPK[MT7].4b4_1.heavy 775.187 / 771.358 1002.0 52.851399421691895 38 15 10 3 10 4.68387112279829 21.349861552180563 0.07199859619140625 3 0.9557025418564616 5.8419334735894966 1002.0 2.4451757188498404 2.0 - - - - - - - 226.46153846153845 2 13 LPIN1 lipin 1 1105 140 C20140707_OR006_02 C20140707_OR006_02 TB412434.[MT7]-YYNWTTAAPLLLAMQAFQK[MT7]PLPK[MT7].4b3_1.heavy 775.187 / 585.279 3319.0 52.851399421691895 38 15 10 3 10 4.68387112279829 21.349861552180563 0.07199859619140625 3 0.9557025418564616 5.8419334735894966 3319.0 15.934516518251648 0.0 - - - - - - - 183.15384615384616 6 13 LPIN1 lipin 1 1107 141 C20140707_OR006_02 C20140707_OR006_02 TB450505.[MT7]-AALIMQVLQLTADQIAMLPPEQR.3b4_1.heavy 898.832 / 513.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1109 141 C20140707_OR006_02 C20140707_OR006_02 TB450505.[MT7]-AALIMQVLQLTADQIAMLPPEQR.3y8_1.heavy 898.832 / 941.487 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1111 141 C20140707_OR006_02 C20140707_OR006_02 TB450505.[MT7]-AALIMQVLQLTADQIAMLPPEQR.3b7_1.heavy 898.832 / 871.519 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1113 141 C20140707_OR006_02 C20140707_OR006_02 TB450505.[MT7]-AALIMQVLQLTADQIAMLPPEQR.3y5_1.heavy 898.832 / 626.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1115 142 C20140707_OR006_02 C20140707_OR006_02 TB450271.[MT7]-NVLVTEDNVMK[MT7].3y3_1.heavy 517.288 / 521.324 7594.0 31.284449577331543 43 18 10 5 10 14.286481311116251 6.999624177731603 0.04409980773925781 3 0.9853803361561412 10.194434719449168 7594.0 28.189848484848483 0.0 - - - - - - - 253.28571428571428 15 7 FGFR1;FGFR3;FGFR4 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1117 142 C20140707_OR006_02 C20140707_OR006_02 TB450271.[MT7]-NVLVTEDNVMK[MT7].3b4_1.heavy 517.288 / 570.373 18985.0 31.284449577331543 43 18 10 5 10 14.286481311116251 6.999624177731603 0.04409980773925781 3 0.9853803361561412 10.194434719449168 18985.0 74.15625925002078 0.0 - - - - - - - 240.6 37 10 FGFR1;FGFR3;FGFR4 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1119 142 C20140707_OR006_02 C20140707_OR006_02 TB450271.[MT7]-NVLVTEDNVMK[MT7].3y4_1.heavy 517.288 / 635.367 4809.0 31.284449577331543 43 18 10 5 10 14.286481311116251 6.999624177731603 0.04409980773925781 3 0.9853803361561412 10.194434719449168 4809.0 8.852133216269758 0.0 - - - - - - - 221.75 9 8 FGFR1;FGFR3;FGFR4 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1121 142 C20140707_OR006_02 C20140707_OR006_02 TB450271.[MT7]-NVLVTEDNVMK[MT7].3b7_1.heavy 517.288 / 915.49 2784.0 31.284449577331543 43 18 10 5 10 14.286481311116251 6.999624177731603 0.04409980773925781 3 0.9853803361561412 10.194434719449168 2784.0 32.26497525753945 0.0 - - - - - - - 211.0 5 3 FGFR1;FGFR3;FGFR4 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1123 143 C20140707_OR006_02 C20140707_OR006_02 TB437574.[MT7]-VMASPLQITPQTATVAFDNVHFEYIEGQK[MT7].4y8_1.heavy 881.46 / 1157.6 2062.0 45.50170135498047 41 20 10 1 10 9.57948372303808 10.438975929308803 0.091400146484375 3 0.9948496880748514 17.18933324475764 2062.0 14.877227106952024 1.0 - - - - - - - 262.4166666666667 4 12 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1125 143 C20140707_OR006_02 C20140707_OR006_02 TB437574.[MT7]-VMASPLQITPQTATVAFDNVHFEYIEGQK[MT7].4b7_1.heavy 881.46 / 871.483 2171.0 45.50170135498047 41 20 10 1 10 9.57948372303808 10.438975929308803 0.091400146484375 3 0.9948496880748514 17.18933324475764 2171.0 10.39524048815506 0.0 - - - - - - - 253.33333333333334 4 6 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1127 143 C20140707_OR006_02 C20140707_OR006_02 TB437574.[MT7]-VMASPLQITPQTATVAFDNVHFEYIEGQK[MT7].4b6_1.heavy 881.46 / 743.424 2605.0 45.50170135498047 41 20 10 1 10 9.57948372303808 10.438975929308803 0.091400146484375 3 0.9948496880748514 17.18933324475764 2605.0 14.993439849624059 0.0 - - - - - - - 271.5 5 8 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1129 143 C20140707_OR006_02 C20140707_OR006_02 TB437574.[MT7]-VMASPLQITPQTATVAFDNVHFEYIEGQK[MT7].4b4_1.heavy 881.46 / 533.287 7381.0 45.50170135498047 41 20 10 1 10 9.57948372303808 10.438975929308803 0.091400146484375 3 0.9948496880748514 17.18933324475764 7381.0 24.779071428571427 0.0 - - - - - - - 271.4 14 10 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1131 144 C20140707_OR006_02 C20140707_OR006_02 TB437577.[MT7]-VEAVDADC[CAM]SPQFSQIC[CAM]SYEIITPDVPFTVDK[MT7].4y9_1.heavy 955.465 / 1161.63 4928.0 45.364601135253906 42 12 10 10 10 0.8321225742885623 74.03518965158428 0.0 3 0.8932748801025837 3.743593241748446 4928.0 15.518773455987732 1.0 - - - - - - - 255.77777777777777 9 9 CLSTN1 calsyntenin 1 1133 144 C20140707_OR006_02 C20140707_OR006_02 TB437577.[MT7]-VEAVDADC[CAM]SPQFSQIC[CAM]SYEIITPDVPFTVDK[MT7].4b4_1.heavy 955.465 / 543.326 2300.0 45.364601135253906 42 12 10 10 10 0.8321225742885623 74.03518965158428 0.0 3 0.8932748801025837 3.743593241748446 2300.0 10.014169474567044 1.0 - - - - - - - 229.27272727272728 4 11 CLSTN1 calsyntenin 1 1135 144 C20140707_OR006_02 C20140707_OR006_02 TB437577.[MT7]-VEAVDADC[CAM]SPQFSQIC[CAM]SYEIITPDVPFTVDK[MT7].4b5_1.heavy 955.465 / 658.353 3176.0 45.364601135253906 42 12 10 10 10 0.8321225742885623 74.03518965158428 0.0 3 0.8932748801025837 3.743593241748446 3176.0 21.021059360730593 0.0 - - - - - - - 219.2 6 10 CLSTN1 calsyntenin 1 1137 144 C20140707_OR006_02 C20140707_OR006_02 TB437577.[MT7]-VEAVDADC[CAM]SPQFSQIC[CAM]SYEIITPDVPFTVDK[MT7].4y6_1.heavy 955.465 / 850.479 5585.0 45.364601135253906 42 12 10 10 10 0.8321225742885623 74.03518965158428 0.0 3 0.8932748801025837 3.743593241748446 5585.0 19.551750380517504 0.0 - - - - - - - 263.1 11 10 CLSTN1 calsyntenin 1 1139 145 C20140707_OR006_02 C20140707_OR006_02 TB412433.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGERR.3y7_1.heavy 1032.23 / 812.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 1141 145 C20140707_OR006_02 C20140707_OR006_02 TB412433.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGERR.3b6_1.heavy 1032.23 / 857.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 1143 145 C20140707_OR006_02 C20140707_OR006_02 TB412433.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGERR.3y11_1.heavy 1032.23 / 1214.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 1145 145 C20140707_OR006_02 C20140707_OR006_02 TB412433.[MT7]-ELNNEILGPVIQFLGVPYAAPPTGERR.3b5_1.heavy 1032.23 / 744.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - NLGN1 neuroligin 1 1147 146 C20140707_OR006_02 C20140707_OR006_02 TB411852.[MT7]-YLGSWATGK[MT7].2y4_1.heavy 635.855 / 520.321 N/A 34.02299880981445 38 20 0 10 8 4.751611797847642 21.045490299796256 0.0 4 0.990376664341899 12.570445124260365 2573.0 9.3371793893983 4.0 - - - - - - - 269.0 11 11 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1149 146 C20140707_OR006_02 C20140707_OR006_02 TB411852.[MT7]-YLGSWATGK[MT7].2y8_1.heavy 635.855 / 963.538 2573.0 34.02299880981445 38 20 0 10 8 4.751611797847642 21.045490299796256 0.0 4 0.990376664341899 12.570445124260365 2573.0 13.152349032683613 1.0 - - - - - - - 193.0 167 10 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1151 146 C20140707_OR006_02 C20140707_OR006_02 TB411852.[MT7]-YLGSWATGK[MT7].2y6_1.heavy 635.855 / 793.432 2573.0 34.02299880981445 38 20 0 10 8 4.751611797847642 21.045490299796256 0.0 4 0.990376664341899 12.570445124260365 2573.0 2.8972296728215094 1.0 - - - - - - - 257.2857142857143 5 7 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1153 146 C20140707_OR006_02 C20140707_OR006_02 TB411852.[MT7]-YLGSWATGK[MT7].2y7_1.heavy 635.855 / 850.454 3345.0 34.02299880981445 38 20 0 10 8 4.751611797847642 21.045490299796256 0.0 4 0.990376664341899 12.570445124260365 3345.0 7.74989645363782 0.0 - - - - - - - 698.4285714285714 6 7 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1155 147 C20140707_OR006_02 C20140707_OR006_02 TB411851.[MT7]-GLLGDAPNDPR.2b6_1.heavy 634.839 / 671.385 6534.0 28.45560073852539 38 8 10 10 10 0.6693542654194794 80.43804420525676 0.0 3 0.7689364796464472 2.5162601662993493 6534.0 20.919986737400528 0.0 - - - - - - - 209.55555555555554 13 9 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1157 147 C20140707_OR006_02 C20140707_OR006_02 TB411851.[MT7]-GLLGDAPNDPR.2y6_1.heavy 634.839 / 669.331 2388.0 28.45560073852539 38 8 10 10 10 0.6693542654194794 80.43804420525676 0.0 3 0.7689364796464472 2.5162601662993493 2388.0 -0.2869495534072336 2.0 - - - - - - - 194.36363636363637 6 11 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1159 147 C20140707_OR006_02 C20140707_OR006_02 TB411851.[MT7]-GLLGDAPNDPR.2b5_1.heavy 634.839 / 600.347 10053.0 28.45560073852539 38 8 10 10 10 0.6693542654194794 80.43804420525676 0.0 3 0.7689364796464472 2.5162601662993493 10053.0 111.42821997723394 0.0 - - - - - - - 321.1111111111111 20 9 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1161 147 C20140707_OR006_02 C20140707_OR006_02 TB411851.[MT7]-GLLGDAPNDPR.2b9_1.heavy 634.839 / 997.507 19477.0 28.45560073852539 38 8 10 10 10 0.6693542654194794 80.43804420525676 0.0 3 0.7689364796464472 2.5162601662993493 19477.0 96.61005305039788 0.0 - - - - - - - 223.44444444444446 38 9 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1163 148 C20140707_OR006_02 C20140707_OR006_02 TB437470.[MT7]-LLLAGLLC[CAM]GGGVWAARVNK[MT7].4y12_2.heavy 564.837 / 709.876 8027.0 48.5088005065918 50 20 10 10 10 14.789306620947801 6.7616422164348435 0.0 3 0.9974620956100958 24.49248488425668 8027.0 41.50323863636363 0.0 - - - - - - - 298.57142857142856 16 7 CLSTN1 calsyntenin 1 1165 148 C20140707_OR006_02 C20140707_OR006_02 TB437470.[MT7]-LLLAGLLC[CAM]GGGVWAARVNK[MT7].4y11_2.heavy 564.837 / 629.86 6927.0 48.5088005065918 50 20 10 10 10 14.789306620947801 6.7616422164348435 0.0 3 0.9974620956100958 24.49248488425668 6927.0 8.211075419164224 1.0 - - - - - - - 330.0 14 5 CLSTN1 calsyntenin 1 1167 148 C20140707_OR006_02 C20140707_OR006_02 TB437470.[MT7]-LLLAGLLC[CAM]GGGVWAARVNK[MT7].4b5_1.heavy 564.837 / 612.42 15944.0 48.5088005065918 50 20 10 10 10 14.789306620947801 6.7616422164348435 0.0 3 0.9974620956100958 24.49248488425668 15944.0 61.31192727272726 0.0 - - - - - - - 340.0 31 11 CLSTN1 calsyntenin 1 1169 148 C20140707_OR006_02 C20140707_OR006_02 TB437470.[MT7]-LLLAGLLC[CAM]GGGVWAARVNK[MT7].4b6_1.heavy 564.837 / 725.504 5718.0 48.5088005065918 50 20 10 10 10 14.789306620947801 6.7616422164348435 0.0 3 0.9974620956100958 24.49248488425668 5718.0 21.914274380165292 0.0 - - - - - - - 302.5 11 8 CLSTN1 calsyntenin 1 1171 149 C20140707_OR006_02 C20140707_OR006_02 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 287783.0 26.625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 287783.0 1208.126773047741 0.0 - - - - - - - 2640.0 575 1 1173 149 C20140707_OR006_02 C20140707_OR006_02 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 341067.0 26.625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 341067.0 357.415518158617 0.0 - - - - - - - 3000.0 682 2 1175 149 C20140707_OR006_02 C20140707_OR006_02 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 513135.0 26.625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 513135.0 383.1179404097518 0.0 - - - - - - - 3240.0 1026 1 1177 150 C20140707_OR006_02 C20140707_OR006_02 TB436939.[MT7]-M[OXI]NTVTSK[MT7].2y4_1.heavy 542.799 / 578.363 870.0 15.456799983978271 47 20 10 7 10 8.241572005274408 12.133607512741793 0.026399612426757812 3 0.9943240571576009 16.373356946752917 870.0 2.7625884016973132 1.0 - - - - - - - 0.0 1 0 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1179 150 C20140707_OR006_02 C20140707_OR006_02 TB436939.[MT7]-M[OXI]NTVTSK[MT7].2y5_1.heavy 542.799 / 679.411 674.0 15.456799983978271 47 20 10 7 10 8.241572005274408 12.133607512741793 0.026399612426757812 3 0.9943240571576009 16.373356946752917 674.0 12.998571428571429 0.0 - - - - - - - 0.0 1 0 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1181 150 C20140707_OR006_02 C20140707_OR006_02 TB436939.[MT7]-M[OXI]NTVTSK[MT7].2y3_1.heavy 542.799 / 479.295 1909.0 15.456799983978271 47 20 10 7 10 8.241572005274408 12.133607512741793 0.026399612426757812 3 0.9943240571576009 16.373356946752917 1909.0 12.262437722419929 0.0 - - - - - - - 129.85185185185185 3 27 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1183 150 C20140707_OR006_02 C20140707_OR006_02 TB436939.[MT7]-M[OXI]NTVTSK[MT7].2y6_1.heavy 542.799 / 793.454 1488.0 15.456799983978271 47 20 10 7 10 8.241572005274408 12.133607512741793 0.026399612426757812 3 0.9943240571576009 16.373356946752917 1488.0 27.732748368382886 0.0 - - - - - - - 91.88888888888889 2 18 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1185 151 C20140707_OR006_02 C20140707_OR006_02 TB450372.[MT7]-LC[CAM]EVVDHVFPLLK[MT7].3b4_1.heavy 619.69 / 646.335 2423.0 46.53099822998047 31 13 2 10 6 1.668959559783625 47.40756806093578 0.0 5 0.9130715199912955 4.1551232036325985 2423.0 -0.9596039603960396 2.0 - - - - - - - 303.0 22 6 LPIN1 lipin 1 1187 151 C20140707_OR006_02 C20140707_OR006_02 TB450372.[MT7]-LC[CAM]EVVDHVFPLLK[MT7].3b3_1.heavy 619.69 / 547.267 2726.0 46.53099822998047 31 13 2 10 6 1.668959559783625 47.40756806093578 0.0 5 0.9130715199912955 4.1551232036325985 2726.0 -0.45020644095788587 1.0 - - - - - - - 235.66666666666666 6 6 LPIN1 lipin 1 1189 151 C20140707_OR006_02 C20140707_OR006_02 TB450372.[MT7]-LC[CAM]EVVDHVFPLLK[MT7].3y4_1.heavy 619.69 / 614.436 8076.0 46.53099822998047 31 13 2 10 6 1.668959559783625 47.40756806093578 0.0 5 0.9130715199912955 4.1551232036325985 8076.0 -0.15992079207920717 0.0 - - - - - - - 227.25 16 4 LPIN1 lipin 1 1191 151 C20140707_OR006_02 C20140707_OR006_02 TB450372.[MT7]-LC[CAM]EVVDHVFPLLK[MT7].3y5_1.heavy 619.69 / 761.504 3937.0 46.53099822998047 31 13 2 10 6 1.668959559783625 47.40756806093578 0.0 5 0.9130715199912955 4.1551232036325985 3937.0 -0.6001524390243902 3.0 - - - - - - - 227.25 37 4 LPIN1 lipin 1 1193 152 C20140707_OR006_02 C20140707_OR006_02 TB437080.[MT7]-LILDVFC[CAM]GSQMHFVR.3b4_1.heavy 656.01 / 599.388 49594.0 45.81909942626953 47 17 10 10 10 4.133007107477103 24.19545802839005 0.0 3 0.9793952110606438 8.582814759560097 49594.0 117.86877244672178 0.0 - - - - - - - 701.2222222222222 99 9 G6PD glucose-6-phosphate dehydrogenase 1195 152 C20140707_OR006_02 C20140707_OR006_02 TB437080.[MT7]-LILDVFC[CAM]GSQMHFVR.3b5_1.heavy 656.01 / 698.457 28229.0 45.81909942626953 47 17 10 10 10 4.133007107477103 24.19545802839005 0.0 3 0.9793952110606438 8.582814759560097 28229.0 69.53591143853016 0.0 - - - - - - - 237.14285714285714 56 7 G6PD glucose-6-phosphate dehydrogenase 1197 152 C20140707_OR006_02 C20140707_OR006_02 TB437080.[MT7]-LILDVFC[CAM]GSQMHFVR.3y8_1.heavy 656.01 / 961.467 21255.0 45.81909942626953 47 17 10 10 10 4.133007107477103 24.19545802839005 0.0 3 0.9793952110606438 8.582814759560097 21255.0 64.46858655703238 0.0 - - - - - - - 231.63636363636363 42 11 G6PD glucose-6-phosphate dehydrogenase 1199 152 C20140707_OR006_02 C20140707_OR006_02 TB437080.[MT7]-LILDVFC[CAM]GSQMHFVR.3y9_1.heavy 656.01 / 1121.5 12398.0 45.81909942626953 47 17 10 10 10 4.133007107477103 24.19545802839005 0.0 3 0.9793952110606438 8.582814759560097 12398.0 47.576975169300226 0.0 - - - - - - - 246.0 24 9 G6PD glucose-6-phosphate dehydrogenase 1201 153 C20140707_OR006_02 C20140707_OR006_02 TB412333.[MT7]-RPGQAPPDQEALQVVYER.3y6_1.heavy 733.054 / 793.42 3409.0 32.094698905944824 34 14 6 6 8 2.8990271904933973 27.609851903368458 0.039997100830078125 4 0.9434114088094722 5.163311593482345 3409.0 34.49583333333334 0.0 - - - - - - - 229.27272727272728 6 11 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1203 153 C20140707_OR006_02 C20140707_OR006_02 TB412333.[MT7]-RPGQAPPDQEALQVVYER.3b5_1.heavy 733.054 / 654.38 4924.0 32.094698905944824 34 14 6 6 8 2.8990271904933973 27.609851903368458 0.039997100830078125 4 0.9434114088094722 5.163311593482345 4924.0 15.795801980198021 0.0 - - - - - - - 231.16666666666666 9 6 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1205 153 C20140707_OR006_02 C20140707_OR006_02 TB412333.[MT7]-RPGQAPPDQEALQVVYER.3y4_1.heavy 733.054 / 566.293 5176.0 32.094698905944824 34 14 6 6 8 2.8990271904933973 27.609851903368458 0.039997100830078125 4 0.9434114088094722 5.163311593482345 5176.0 18.853574967907036 1.0 - - - - - - - 217.9090909090909 15 11 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1207 153 C20140707_OR006_02 C20140707_OR006_02 TB412333.[MT7]-RPGQAPPDQEALQVVYER.3b8_1.heavy 733.054 / 963.513 2146.0 32.094698905944824 34 14 6 6 8 2.8990271904933973 27.609851903368458 0.039997100830078125 4 0.9434114088094722 5.163311593482345 2146.0 5.1339577836411605 5.0 - - - - - - - 189.125 13 8 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1209 154 C20140707_OR006_02 C20140707_OR006_02 TB437573.[MT7]-DAFLEQAVSYQQFVDNPAIIDDPNLVVK[MT7].4b7_1.heavy 859.952 / 919.464 14517.0 48.42399978637695 46 16 10 10 10 1.8322484309205822 38.96522000127401 0.0 3 0.9670244967421809 6.777444177890869 14517.0 137.43172707889124 0.0 - - - - - - - 139.75 29 8 LPIN1 lipin 1 1211 154 C20140707_OR006_02 C20140707_OR006_02 TB437573.[MT7]-DAFLEQAVSYQQFVDNPAIIDDPNLVVK[MT7].4b4_1.heavy 859.952 / 591.326 15745.0 48.42399978637695 46 16 10 10 10 1.8322484309205822 38.96522000127401 0.0 3 0.9670244967421809 6.777444177890869 15745.0 93.74066412716782 0.0 - - - - - - - 251.25 31 8 LPIN1 lipin 1 1213 154 C20140707_OR006_02 C20140707_OR006_02 TB437573.[MT7]-DAFLEQAVSYQQFVDNPAIIDDPNLVVK[MT7].4b5_1.heavy 859.952 / 720.369 13400.0 48.42399978637695 46 16 10 10 10 1.8322484309205822 38.96522000127401 0.0 3 0.9670244967421809 6.777444177890869 13400.0 45.97762863534676 0.0 - - - - - - - 265.125 26 8 LPIN1 lipin 1 1215 154 C20140707_OR006_02 C20140707_OR006_02 TB437573.[MT7]-DAFLEQAVSYQQFVDNPAIIDDPNLVVK[MT7].4b6_1.heavy 859.952 / 848.427 11055.0 48.42399978637695 46 16 10 10 10 1.8322484309205822 38.96522000127401 0.0 3 0.9670244967421809 6.777444177890869 11055.0 65.39330664820778 0.0 - - - - - - - 279.1 22 10 LPIN1 lipin 1 1217 155 C20140707_OR006_02 C20140707_OR006_02 TB450408.[MT7]-AVASLPPEQMFELMK[MT7].3y3_1.heavy 660.358 / 535.339 5211.0 44.94889831542969 48 18 10 10 10 15.232499702465462 6.564910681325301 0.0 3 0.9865241142094603 10.619273126595385 5211.0 1.6134810096907213 1.0 - - - - - - - 303.57142857142856 11 7 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1219 155 C20140707_OR006_02 C20140707_OR006_02 TB450408.[MT7]-AVASLPPEQMFELMK[MT7].3b5_1.heavy 660.358 / 586.368 7528.0 44.94889831542969 48 18 10 10 10 15.232499702465462 6.564910681325301 0.0 3 0.9865241142094603 10.619273126595385 7528.0 40.34764539087855 0.0 - - - - - - - 217.5 15 4 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1221 155 C20140707_OR006_02 C20140707_OR006_02 TB450408.[MT7]-AVASLPPEQMFELMK[MT7].3y4_1.heavy 660.358 / 664.382 3957.0 44.94889831542969 48 18 10 10 10 15.232499702465462 6.564910681325301 0.0 3 0.9865241142094603 10.619273126595385 3957.0 40.28162195093005 0.0 - - - - - - - 161.16666666666666 7 6 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1223 155 C20140707_OR006_02 C20140707_OR006_02 TB450408.[MT7]-AVASLPPEQMFELMK[MT7].3y5_1.heavy 660.358 / 811.45 3667.0 44.94889831542969 48 18 10 10 10 15.232499702465462 6.564910681325301 0.0 3 0.9865241142094603 10.619273126595385 3667.0 0.45379628774586744 2.0 - - - - - - - 344.85714285714283 7 7 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1225 156 C20140707_OR006_02 C20140707_OR006_02 TB437572.[MT7]-DAFLEQAVSYQQFVDNPAIIDDPNLVVK[MT7].3y6_1.heavy 1146.27 / 813.531 5827.0 48.42399978637695 46 16 10 10 10 3.0525520747367088 32.759473893209595 0.0 3 0.9683845687528108 6.9224834115434675 5827.0 90.52660714285715 0.0 - - - - - - - 149.33333333333334 11 9 LPIN1 lipin 1 1227 156 C20140707_OR006_02 C20140707_OR006_02 TB437572.[MT7]-DAFLEQAVSYQQFVDNPAIIDDPNLVVK[MT7].3b4_1.heavy 1146.27 / 591.326 2689.0 48.42399978637695 46 16 10 10 10 3.0525520747367088 32.759473893209595 0.0 3 0.9683845687528108 6.9224834115434675 2689.0 33.85258928571429 0.0 - - - - - - - 136.88888888888889 5 9 LPIN1 lipin 1 1229 156 C20140707_OR006_02 C20140707_OR006_02 TB437572.[MT7]-DAFLEQAVSYQQFVDNPAIIDDPNLVVK[MT7].3b7_1.heavy 1146.27 / 919.464 5155.0 48.42399978637695 46 16 10 10 10 3.0525520747367088 32.759473893209595 0.0 3 0.9683845687528108 6.9224834115434675 5155.0 59.52797619047619 0.0 - - - - - - - 149.33333333333334 10 3 LPIN1 lipin 1 1231 156 C20140707_OR006_02 C20140707_OR006_02 TB437572.[MT7]-DAFLEQAVSYQQFVDNPAIIDDPNLVVK[MT7].3y9_1.heavy 1146.27 / 1156.67 2129.0 48.42399978637695 46 16 10 10 10 3.0525520747367088 32.759473893209595 0.0 3 0.9683845687528108 6.9224834115434675 2129.0 22.55726190476191 0.0 - - - - - - - 224.0 4 11 LPIN1 lipin 1 1233 157 C20140707_OR006_02 C20140707_OR006_02 TB437371.[MT7]-RMAQSVVEVMEDSK[MT7].3b6_1.heavy 632.997 / 817.447 19697.0 35.058799743652344 43 13 10 10 10 2.141886302310628 40.41020805439992 0.0 3 0.9210154507752003 4.3620479314913965 19697.0 109.25679687499999 0.0 - - - - - - - 213.33333333333334 39 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1235 157 C20140707_OR006_02 C20140707_OR006_02 TB437371.[MT7]-RMAQSVVEVMEDSK[MT7].3b5_1.heavy 632.997 / 718.379 12662.0 35.058799743652344 43 13 10 10 10 2.141886302310628 40.41020805439992 0.0 3 0.9210154507752003 4.3620479314913965 12662.0 37.89007575757576 0.0 - - - - - - - 284.44444444444446 25 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1237 157 C20140707_OR006_02 C20140707_OR006_02 TB437371.[MT7]-RMAQSVVEVMEDSK[MT7].3b8_1.heavy 632.997 / 1045.56 29673.0 35.058799743652344 43 13 10 10 10 2.141886302310628 40.41020805439992 0.0 3 0.9210154507752003 4.3620479314913965 29673.0 340.775859375 0.0 - - - - - - - 213.33333333333334 59 6 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1239 157 C20140707_OR006_02 C20140707_OR006_02 TB437371.[MT7]-RMAQSVVEVMEDSK[MT7].3y5_1.heavy 632.997 / 753.357 43999.0 35.058799743652344 43 13 10 10 10 2.141886302310628 40.41020805439992 0.0 3 0.9210154507752003 4.3620479314913965 43999.0 148.1804077921322 0.0 - - - - - - - 676.1428571428571 87 7 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1241 158 C20140707_OR006_02 C20140707_OR006_02 TB450379.[MT7]-VGTLDSLVGLSDELGK[MT7].2y8_1.heavy 946.035 / 962.528 13236.0 44.40850067138672 41 11 10 10 10 1.5758719908584882 49.34379748035924 0.0 3 0.8680330650163739 3.3591841904447164 13236.0 50.38198636935089 0.0 - - - - - - - 257.1 26 10 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1243 158 C20140707_OR006_02 C20140707_OR006_02 TB450379.[MT7]-VGTLDSLVGLSDELGK[MT7].2b6_1.heavy 946.035 / 717.39 2476.0 44.40850067138672 41 11 10 10 10 1.5758719908584882 49.34379748035924 0.0 3 0.8680330650163739 3.3591841904447164 2476.0 7.275077863313157 0.0 - - - - - - - 247.6 4 10 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1245 158 C20140707_OR006_02 C20140707_OR006_02 TB450379.[MT7]-VGTLDSLVGLSDELGK[MT7].2b7_1.heavy 946.035 / 830.474 3618.0 44.40850067138672 41 11 10 10 10 1.5758719908584882 49.34379748035924 0.0 3 0.8680330650163739 3.3591841904447164 3618.0 17.73116249567524 0.0 - - - - - - - 217.57142857142858 7 7 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1247 158 C20140707_OR006_02 C20140707_OR006_02 TB450379.[MT7]-VGTLDSLVGLSDELGK[MT7].2b5_1.heavy 946.035 / 630.358 7523.0 44.40850067138672 41 11 10 10 10 1.5758719908584882 49.34379748035924 0.0 3 0.8680330650163739 3.3591841904447164 7523.0 60.627018034596986 0.0 - - - - - - - 256.3076923076923 15 13 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1249 159 C20140707_OR006_02 C20140707_OR006_02 TB437078.[MT7]-LDTFAESLIR.2y8_1.heavy 654.868 / 936.515 49987.0 42.925498962402344 48 18 10 10 10 4.6328268310894725 21.585093431278466 0.0 3 0.9806433287153202 8.856130176577137 49987.0 263.26486666666665 0.0 - - - - - - - 588.8888888888889 99 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1251 159 C20140707_OR006_02 C20140707_OR006_02 TB437078.[MT7]-LDTFAESLIR.2y9_1.heavy 654.868 / 1051.54 80179.0 42.925498962402344 48 18 10 10 10 4.6328268310894725 21.585093431278466 0.0 3 0.9806433287153202 8.856130176577137 80179.0 204.12237083333332 0.0 - - - - - - - 190.0 160 10 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1253 159 C20140707_OR006_02 C20140707_OR006_02 TB437078.[MT7]-LDTFAESLIR.2b6_1.heavy 654.868 / 821.416 12397.0 42.925498962402344 48 18 10 10 10 4.6328268310894725 21.585093431278466 0.0 3 0.9806433287153202 8.856130176577137 12397.0 66.9438 0.0 - - - - - - - 207.14285714285714 24 14 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1255 159 C20140707_OR006_02 C20140707_OR006_02 TB437078.[MT7]-LDTFAESLIR.2y7_1.heavy 654.868 / 835.467 20694.0 42.925498962402344 48 18 10 10 10 4.6328268310894725 21.585093431278466 0.0 3 0.9806433287153202 8.856130176577137 20694.0 40.87065 0.0 - - - - - - - 254.54545454545453 41 11 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1257 160 C20140707_OR006_02 C20140707_OR006_02 TB450377.[MT7]-YNFPLVTLYATLGK[MT7].3b5_1.heavy 630.032 / 779.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL4 acyl-CoA synthetase long-chain family member 4 1259 160 C20140707_OR006_02 C20140707_OR006_02 TB450377.[MT7]-YNFPLVTLYATLGK[MT7].3y4_1.heavy 630.032 / 562.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL4 acyl-CoA synthetase long-chain family member 4 1261 160 C20140707_OR006_02 C20140707_OR006_02 TB450377.[MT7]-YNFPLVTLYATLGK[MT7].3b3_1.heavy 630.032 / 569.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL4 acyl-CoA synthetase long-chain family member 4 1263 160 C20140707_OR006_02 C20140707_OR006_02 TB450377.[MT7]-YNFPLVTLYATLGK[MT7].3y5_1.heavy 630.032 / 633.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL4 acyl-CoA synthetase long-chain family member 4 1265 161 C20140707_OR006_02 C20140707_OR006_02 TB411713.[MT7]-GPDGTNVK[MT7].2y5_1.heavy 538.303 / 662.395 8473.0 17.433799743652344 42 12 10 10 10 2.0274355179357997 49.323393575453075 0.0 3 0.8840315328102498 3.588419225796904 8473.0 51.74767791411043 0.0 - - - - - - - 172.4 16 10 CLSTN1 calsyntenin 1 1267 161 C20140707_OR006_02 C20140707_OR006_02 TB411713.[MT7]-GPDGTNVK[MT7].2y3_1.heavy 538.303 / 504.326 978.0 17.433799743652344 42 12 10 10 10 2.0274355179357997 49.323393575453075 0.0 3 0.8840315328102498 3.588419225796904 978.0 5.783870967741935 1.0 - - - - - - - 0.0 1 0 CLSTN1 calsyntenin 1 1269 161 C20140707_OR006_02 C20140707_OR006_02 TB411713.[MT7]-GPDGTNVK[MT7].2b6_1.heavy 538.303 / 686.323 1257.0 17.433799743652344 42 12 10 10 10 2.0274355179357997 49.323393575453075 0.0 3 0.8840315328102498 3.588419225796904 1257.0 21.86620046082949 0.0 - - - - - - - 128.25 2 12 CLSTN1 calsyntenin 1 1271 161 C20140707_OR006_02 C20140707_OR006_02 TB411713.[MT7]-GPDGTNVK[MT7].2y7_1.heavy 538.303 / 874.475 1397.0 17.433799743652344 42 12 10 10 10 2.0274355179357997 49.323393575453075 0.0 3 0.8840315328102498 3.588419225796904 1397.0 0.24234419264603219 1.0 - - - - - - - 159.85714285714286 3 7 CLSTN1 calsyntenin 1 1273 162 C20140707_OR006_02 C20140707_OR006_02 TB437179.[MT7]-FRFLNELIK[MT7].3y3_1.heavy 489.969 / 517.383 3968.0 40.82359981536865 28 5 10 3 10 0.4272278472337988 111.7072813849768 0.07020187377929688 3 0.6252765816835198 1.9494123857532892 3968.0 19.951517088894214 0.0 - - - - - - - 817.1111111111111 7 9 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1275 162 C20140707_OR006_02 C20140707_OR006_02 TB437179.[MT7]-FRFLNELIK[MT7].3b6_1.heavy 489.969 / 951.517 581.0 40.82359981536865 28 5 10 3 10 0.4272278472337988 111.7072813849768 0.07020187377929688 3 0.6252765816835198 1.9494123857532892 581.0 4.7917525773195875 0.0 - - - - - - - 0.0 1 0 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1277 162 C20140707_OR006_02 C20140707_OR006_02 TB437179.[MT7]-FRFLNELIK[MT7].3b5_1.heavy 489.969 / 822.474 871.0 40.82359981536865 28 5 10 3 10 0.4272278472337988 111.7072813849768 0.07020187377929688 3 0.6252765816835198 1.9494123857532892 871.0 3.9896907216494846 1.0 - - - - - - - 0.0 1 0 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1279 162 C20140707_OR006_02 C20140707_OR006_02 TB437179.[MT7]-FRFLNELIK[MT7].3b7_2.heavy 489.969 / 532.804 3387.0 40.82359981536865 28 5 10 3 10 0.4272278472337988 111.7072813849768 0.07020187377929688 3 0.6252765816835198 1.9494123857532892 3387.0 37.1450231070032 0.0 - - - - - - - 290.3333333333333 6 6 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1281 163 C20140707_OR006_02 C20140707_OR006_02 TB437176.[MT7]-ALRVDNAASEK[MT7].3b6_1.heavy 487.947 / 813.47 1194.0 21.015600204467773 37 17 8 6 6 3.240327430784073 30.861078744688054 0.037799835205078125 6 0.970910685360086 7.218337563039097 1194.0 5.230859375 7.0 - - - - - - - 189.66666666666666 6 9 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1283 163 C20140707_OR006_02 C20140707_OR006_02 TB437176.[MT7]-ALRVDNAASEK[MT7].3y3_1.heavy 487.947 / 507.289 2558.0 21.015600204467773 37 17 8 6 6 3.240327430784073 30.861078744688054 0.037799835205078125 6 0.970910685360086 7.218337563039097 2558.0 31.08158088235294 0.0 - - - - - - - 158.42857142857142 5 7 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1285 163 C20140707_OR006_02 C20140707_OR006_02 TB437176.[MT7]-ALRVDNAASEK[MT7].3b5_1.heavy 487.947 / 699.427 767.0 21.015600204467773 37 17 8 6 6 3.240327430784073 30.861078744688054 0.037799835205078125 6 0.970910685360086 7.218337563039097 767.0 1.2603286384976524 5.0 - - - - - - - 230.2 2 10 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1287 163 C20140707_OR006_02 C20140707_OR006_02 TB437176.[MT7]-ALRVDNAASEK[MT7].3y4_1.heavy 487.947 / 578.327 2217.0 21.015600204467773 37 17 8 6 6 3.240327430784073 30.861078744688054 0.037799835205078125 6 0.970910685360086 7.218337563039097 2217.0 8.14379951584507 0.0 - - - - - - - 234.58333333333334 4 12 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1289 164 C20140707_OR006_02 C20140707_OR006_02 TB437376.[MT7]-QALIDMNTLFTLLK[MT7].3y3_1.heavy 637.041 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1291 164 C20140707_OR006_02 C20140707_OR006_02 TB437376.[MT7]-QALIDMNTLFTLLK[MT7].3b4_1.heavy 637.041 / 570.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1293 164 C20140707_OR006_02 C20140707_OR006_02 TB437376.[MT7]-QALIDMNTLFTLLK[MT7].3b5_1.heavy 637.041 / 685.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1295 164 C20140707_OR006_02 C20140707_OR006_02 TB437376.[MT7]-QALIDMNTLFTLLK[MT7].3y4_1.heavy 637.041 / 618.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1297 165 C20140707_OR006_02 C20140707_OR006_02 TB411853.[MT7]-LNSHMNALHLGSQANR.3y7_1.heavy 636.331 / 745.395 N/A 27.468299865722656 46 16 10 10 10 3.737247662385947 26.75765938834186 0.0 3 0.9637060924446084 6.4583734869991725 13839.0 2.1005117632154224 1.0 - - - - - - - 320.6666666666667 27 3 G6PD glucose-6-phosphate dehydrogenase 1299 165 C20140707_OR006_02 C20140707_OR006_02 TB411853.[MT7]-LNSHMNALHLGSQANR.3y6_1.heavy 636.331 / 632.311 12997.0 27.468299865722656 46 16 10 10 10 3.737247662385947 26.75765938834186 0.0 3 0.9637060924446084 6.4583734869991725 12997.0 22.35299474869457 0.0 - - - - - - - 240.7 25 10 G6PD glucose-6-phosphate dehydrogenase 1301 165 C20140707_OR006_02 C20140707_OR006_02 TB411853.[MT7]-LNSHMNALHLGSQANR.3b4_1.heavy 636.331 / 596.327 3971.0 27.468299865722656 46 16 10 10 10 3.737247662385947 26.75765938834186 0.0 3 0.9637060924446084 6.4583734869991725 3971.0 25.60900414937759 0.0 - - - - - - - 257.7857142857143 7 14 G6PD glucose-6-phosphate dehydrogenase 1303 165 C20140707_OR006_02 C20140707_OR006_02 TB411853.[MT7]-LNSHMNALHLGSQANR.3y8_1.heavy 636.331 / 882.454 6258.0 27.468299865722656 46 16 10 10 10 3.737247662385947 26.75765938834186 0.0 3 0.9637060924446084 6.4583734869991725 6258.0 14.994930747922437 0.0 - - - - - - - 320.77777777777777 12 9 G6PD glucose-6-phosphate dehydrogenase 1305 166 C20140707_OR006_02 C20140707_OR006_02 TB437173.[MT7]-LFTSVFGVGLK[MT7].3b4_1.heavy 485.965 / 593.341 5674.0 46.24100112915039 39 14 10 5 10 2.1286016067746325 37.06023860123604 0.0447998046875 3 0.9364702634640806 4.870206395533871 5674.0 52.667708861252976 0.0 - - - - - - - 198.25 11 4 DNTT deoxynucleotidyltransferase, terminal 1307 166 C20140707_OR006_02 C20140707_OR006_02 TB437173.[MT7]-LFTSVFGVGLK[MT7].3b5_1.heavy 485.965 / 692.41 2497.0 46.24100112915039 39 14 10 5 10 2.1286016067746325 37.06023860123604 0.0447998046875 3 0.9364702634640806 4.870206395533871 2497.0 24.247407079646017 0.0 - - - - - - - 226.66666666666666 4 3 DNTT deoxynucleotidyltransferase, terminal 1309 166 C20140707_OR006_02 C20140707_OR006_02 TB437173.[MT7]-LFTSVFGVGLK[MT7].3b3_1.heavy 485.965 / 506.31 4312.0 46.24100112915039 39 14 10 5 10 2.1286016067746325 37.06023860123604 0.0447998046875 3 0.9364702634640806 4.870206395533871 4312.0 29.141477066597567 0.0 - - - - - - - 226.5 8 4 DNTT deoxynucleotidyltransferase, terminal 1311 166 C20140707_OR006_02 C20140707_OR006_02 TB437173.[MT7]-LFTSVFGVGLK[MT7].3y5_1.heavy 485.965 / 617.41 9419.0 46.24100112915039 39 14 10 5 10 2.1286016067746325 37.06023860123604 0.0447998046875 3 0.9364702634640806 4.870206395533871 9419.0 33.04322984406685 0.0 - - - - - - - 226.75 18 4 DNTT deoxynucleotidyltransferase, terminal 1313 167 C20140707_OR006_02 C20140707_OR006_02 TB412438.[MT7]-HLGADGVYLDDLTDMDPEVAALYFPK[MT7].4b8_1.heavy 789.148 / 957.491 2381.0 47.915873527526855 40 18 10 2 10 3.01123434145755 26.149452522430455 0.08610153198242188 3 0.989104294730014 11.812438963535412 2381.0 4.001764705882352 1.0 - - - - - - - 243.0 4 7 LPIN1 lipin 1 1315 167 C20140707_OR006_02 C20140707_OR006_02 TB412438.[MT7]-HLGADGVYLDDLTDMDPEVAALYFPK[MT7].4b5_1.heavy 789.148 / 638.338 3287.0 47.915873527526855 40 18 10 2 10 3.01123434145755 26.149452522430455 0.08610153198242188 3 0.989104294730014 11.812438963535412 3287.0 9.547820958778138 0.0 - - - - - - - 264.3333333333333 6 12 LPIN1 lipin 1 1317 167 C20140707_OR006_02 C20140707_OR006_02 TB412438.[MT7]-HLGADGVYLDDLTDMDPEVAALYFPK[MT7].4b7_1.heavy 789.148 / 794.428 5441.0 47.915873527526855 40 18 10 2 10 3.01123434145755 26.149452522430455 0.08610153198242188 3 0.989104294730014 11.812438963535412 5441.0 21.280524898848427 0.0 - - - - - - - 272.0 10 10 LPIN1 lipin 1 1319 167 C20140707_OR006_02 C20140707_OR006_02 TB412438.[MT7]-HLGADGVYLDDLTDMDPEVAALYFPK[MT7].4b6_1.heavy 789.148 / 695.359 2721.0 47.915873527526855 40 18 10 2 10 3.01123434145755 26.149452522430455 0.08610153198242188 3 0.989104294730014 11.812438963535412 2721.0 23.716460176991152 0.0 - - - - - - - 113.0 5 4 LPIN1 lipin 1 1321 168 C20140707_OR006_02 C20140707_OR006_02 TB411857.[MT7]-DGQAFHGENR.2y5_1.heavy 637.803 / 612.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1323 168 C20140707_OR006_02 C20140707_OR006_02 TB411857.[MT7]-DGQAFHGENR.2y9_1.heavy 637.803 / 1015.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1325 168 C20140707_OR006_02 C20140707_OR006_02 TB411857.[MT7]-DGQAFHGENR.2b4_1.heavy 637.803 / 516.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1327 168 C20140707_OR006_02 C20140707_OR006_02 TB411857.[MT7]-DGQAFHGENR.2y7_1.heavy 637.803 / 830.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1329 169 C20140707_OR006_02 C20140707_OR006_02 TB437462.[MT7]-SVFVGNIPYEATEEQLK[MT7].2b3_1.heavy 1106.59 / 478.278 2969.0 38.87402534484863 37 11 10 6 10 0.8261967175397454 61.40513973401235 0.03929901123046875 3 0.8672933450533448 3.3495918078218265 2969.0 23.34119496855346 0.0 - - - - - - - 254.4 5 5 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1331 169 C20140707_OR006_02 C20140707_OR006_02 TB437462.[MT7]-SVFVGNIPYEATEEQLK[MT7].2b4_1.heavy 1106.59 / 577.347 3712.0 38.87402534484863 37 11 10 6 10 0.8261967175397454 61.40513973401235 0.03929901123046875 3 0.8672933450533448 3.3495918078218265 3712.0 15.670943396226415 0.0 - - - - - - - 247.33333333333334 7 3 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1333 169 C20140707_OR006_02 C20140707_OR006_02 TB437462.[MT7]-SVFVGNIPYEATEEQLK[MT7].2b6_1.heavy 1106.59 / 748.411 2333.0 38.87402534484863 37 11 10 6 10 0.8261967175397454 61.40513973401235 0.03929901123046875 3 0.8672933450533448 3.3495918078218265 2333.0 16.983946540880503 0.0 - - - - - - - 287.7142857142857 4 7 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1335 169 C20140707_OR006_02 C20140707_OR006_02 TB437462.[MT7]-SVFVGNIPYEATEEQLK[MT7].2b7_1.heavy 1106.59 / 861.495 3394.0 38.87402534484863 37 11 10 6 10 0.8261967175397454 61.40513973401235 0.03929901123046875 3 0.8672933450533448 3.3495918078218265 3394.0 27.69632075471698 0.0 - - - - - - - 212.0 6 7 CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 1337 170 C20140707_OR006_02 C20140707_OR006_02 TB412100.[MT7]-RVGFQYEGTYK[MT7].4b8_2.heavy 409.724 / 541.281 3483.0 27.23954963684082 35 10 10 5 10 1.0094295774789819 64.53440500016089 0.04380035400390625 3 0.8318961957208483 2.966832479186422 3483.0 20.717844827586205 1.0 - - - - - - - 298.2857142857143 6 7 G6PD glucose-6-phosphate dehydrogenase 1339 170 C20140707_OR006_02 C20140707_OR006_02 TB412100.[MT7]-RVGFQYEGTYK[MT7].4b7_2.heavy 409.724 / 512.77 2554.0 27.23954963684082 35 10 10 5 10 1.0094295774789819 64.53440500016089 0.04380035400390625 3 0.8318961957208483 2.966832479186422 2554.0 3.4545558467552 0.0 - - - - - - - 290.0 5 4 G6PD glucose-6-phosphate dehydrogenase 1341 170 C20140707_OR006_02 C20140707_OR006_02 TB412100.[MT7]-RVGFQYEGTYK[MT7].4b4_1.heavy 409.724 / 604.369 2322.0 27.23954963684082 35 10 10 5 10 1.0094295774789819 64.53440500016089 0.04380035400390625 3 0.8318961957208483 2.966832479186422 2322.0 35.430517241379306 0.0 - - - - - - - 208.8 4 5 G6PD glucose-6-phosphate dehydrogenase 1343 170 C20140707_OR006_02 C20140707_OR006_02 TB412100.[MT7]-RVGFQYEGTYK[MT7].4b5_1.heavy 409.724 / 732.427 3134.0 27.23954963684082 35 10 10 5 10 1.0094295774789819 64.53440500016089 0.04380035400390625 3 0.8318961957208483 2.966832479186422 3134.0 52.68362068965517 0.0 - - - - - - - 116.0 6 2 G6PD glucose-6-phosphate dehydrogenase 1345 171 C20140707_OR006_02 C20140707_OR006_02 TB437564.[MT7]-K[MT7]MGHDVDFLITSPGSTEDEEQLLQK[MT7].4b8_2.heavy 813.172 / 609.813 9368.0 37.05609893798828 39 9 10 10 10 0.8033681420166429 72.89755746323942 0.0 3 0.8116350876940134 2.7976717815605436 9368.0 30.149075674232314 0.0 - - - - - - - 250.0 18 6 DNTT deoxynucleotidyltransferase, terminal 1347 171 C20140707_OR006_02 C20140707_OR006_02 TB437564.[MT7]-K[MT7]MGHDVDFLITSPGSTEDEEQLLQK[MT7].4b7_2.heavy 813.172 / 536.278 6370.0 37.05609893798828 39 9 10 10 10 0.8033681420166429 72.89755746323942 0.0 3 0.8116350876940134 2.7976717815605436 6370.0 20.234011773016245 1.0 - - - - - - - 234.375 16 8 DNTT deoxynucleotidyltransferase, terminal 1349 171 C20140707_OR006_02 C20140707_OR006_02 TB437564.[MT7]-K[MT7]MGHDVDFLITSPGSTEDEEQLLQK[MT7].4b5_1.heavy 813.172 / 857.454 1749.0 37.05609893798828 39 9 10 10 10 0.8033681420166429 72.89755746323942 0.0 3 0.8116350876940134 2.7976717815605436 1749.0 17.210160000000002 0.0 - - - - - - - 200.0 3 5 DNTT deoxynucleotidyltransferase, terminal 1351 171 C20140707_OR006_02 C20140707_OR006_02 TB437564.[MT7]-K[MT7]MGHDVDFLITSPGSTEDEEQLLQK[MT7].4y3_1.heavy 813.172 / 532.357 7994.0 37.05609893798828 39 9 10 10 10 0.8033681420166429 72.89755746323942 0.0 3 0.8116350876940134 2.7976717815605436 7994.0 58.47876247139588 0.0 - - - - - - - 225.0 15 5 DNTT deoxynucleotidyltransferase, terminal 1353 172 C20140707_OR006_02 C20140707_OR006_02 TB412103.[MT7]-FQDLVVFILEK[MT7].2b3_1.heavy 819.989 / 535.263 9450.0 53.58549880981445 48 18 10 10 10 5.073051382828789 19.712002196247994 0.0 3 0.9820061081324517 9.186422952831954 9450.0 67.5 0.0 - - - - - - - 161.72222222222223 18 18 DNTT deoxynucleotidyltransferase, terminal 1355 172 C20140707_OR006_02 C20140707_OR006_02 TB412103.[MT7]-FQDLVVFILEK[MT7].2b4_1.heavy 819.989 / 648.347 5424.0 53.58549880981445 48 18 10 10 10 5.073051382828789 19.712002196247994 0.0 3 0.9820061081324517 9.186422952831954 5424.0 38.25857142857143 0.0 - - - - - - - 208.33333333333334 10 18 DNTT deoxynucleotidyltransferase, terminal 1357 172 C20140707_OR006_02 C20140707_OR006_02 TB412103.[MT7]-FQDLVVFILEK[MT7].2y6_1.heavy 819.989 / 892.562 3803.0 53.58549880981445 48 18 10 10 10 5.073051382828789 19.712002196247994 0.0 3 0.9820061081324517 9.186422952831954 3803.0 21.05232142857143 0.0 - - - - - - - 159.30769230769232 7 13 DNTT deoxynucleotidyltransferase, terminal 1359 172 C20140707_OR006_02 C20140707_OR006_02 TB412103.[MT7]-FQDLVVFILEK[MT7].2b5_1.heavy 819.989 / 747.416 4977.0 53.58549880981445 48 18 10 10 10 5.073051382828789 19.712002196247994 0.0 3 0.9820061081324517 9.186422952831954 4977.0 58.00575 0.0 - - - - - - - 224.0 9 13 DNTT deoxynucleotidyltransferase, terminal 1361 173 C20140707_OR006_02 C20140707_OR006_02 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 317469.0 37.69129943847656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 317469.0 168.833612817713 0.0 - - - - - - - 237.8181818181818 634 11 1363 173 C20140707_OR006_02 C20140707_OR006_02 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 789245.0 37.69129943847656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 789245.0 304.16119284377925 0.0 - - - - - - - 294.3 1578 10 1365 173 C20140707_OR006_02 C20140707_OR006_02 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 808035.0 37.69129943847656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 808035.0 148.30249925289905 0.0 - - - - - - - 327.0 1616 3 1367 174 C20140707_OR006_02 C20140707_OR006_02 TB437469.[MT7]-LLLAGLLC[CAM]GGGVWAARVNK[MT7].3y7_1.heavy 752.78 / 988.581 989.0 48.52980041503906 38 13 10 5 10 3.2951456800787673 30.347671911613208 0.04199981689453125 3 0.9008608878947683 3.8867341690226893 989.0 4.360846623228875 4.0 - - - - - - - 253.0 2 10 CLSTN1 calsyntenin 1 1369 174 C20140707_OR006_02 C20140707_OR006_02 TB437469.[MT7]-LLLAGLLC[CAM]GGGVWAARVNK[MT7].3b4_1.heavy 752.78 / 555.399 1758.0 48.52980041503906 38 13 10 5 10 3.2951456800787673 30.347671911613208 0.04199981689453125 3 0.9008608878947683 3.8867341690226893 1758.0 4.476073522106309 0.0 - - - - - - - 275.0 3 12 CLSTN1 calsyntenin 1 1371 174 C20140707_OR006_02 C20140707_OR006_02 TB437469.[MT7]-LLLAGLLC[CAM]GGGVWAARVNK[MT7].3b5_1.heavy 752.78 / 612.42 2967.0 48.52980041503906 38 13 10 5 10 3.2951456800787673 30.347671911613208 0.04199981689453125 3 0.9008608878947683 3.8867341690226893 2967.0 10.789090909090909 0.0 - - - - - - - 290.0 5 11 CLSTN1 calsyntenin 1 1373 174 C20140707_OR006_02 C20140707_OR006_02 TB437469.[MT7]-LLLAGLLC[CAM]GGGVWAARVNK[MT7].3y12_2.heavy 752.78 / 709.876 1209.0 48.52980041503906 38 13 10 5 10 3.2951456800787673 30.347671911613208 0.04199981689453125 3 0.9008608878947683 3.8867341690226893 1209.0 9.617983245423519 1.0 - - - - - - - 231.0 2 10 CLSTN1 calsyntenin 1 1375 175 C20140707_OR006_02 C20140707_OR006_02 TB437466.[MT7]-LQFHDVAGDIFHQQC[CAM]K[MT7].3b9_2.heavy 744.38 / 564.284 4457.0 35.60995101928711 41 16 10 5 10 3.1941013932690225 26.106543930725174 0.04489898681640625 3 0.9680133061415738 6.881976839091177 4457.0 14.825645878118513 0.0 - - - - - - - 563.8571428571429 8 7 G6PD glucose-6-phosphate dehydrogenase 1377 175 C20140707_OR006_02 C20140707_OR006_02 TB437466.[MT7]-LQFHDVAGDIFHQQC[CAM]K[MT7].3b9_1.heavy 744.38 / 1127.56 1910.0 35.60995101928711 41 16 10 5 10 3.1941013932690225 26.106543930725174 0.04489898681640625 3 0.9680133061415738 6.881976839091177 1910.0 16.531496062992126 0.0 - - - - - - - 254.625 3 8 G6PD glucose-6-phosphate dehydrogenase 1379 175 C20140707_OR006_02 C20140707_OR006_02 TB437466.[MT7]-LQFHDVAGDIFHQQC[CAM]K[MT7].3b5_1.heavy 744.38 / 785.406 4202.0 35.60995101928711 41 16 10 5 10 3.1941013932690225 26.106543930725174 0.04489898681640625 3 0.9680133061415738 6.881976839091177 4202.0 56.247244094488195 0.0 - - - - - - - 203.7 8 10 G6PD glucose-6-phosphate dehydrogenase 1381 175 C20140707_OR006_02 C20140707_OR006_02 TB437466.[MT7]-LQFHDVAGDIFHQQC[CAM]K[MT7].3b3_1.heavy 744.38 / 533.32 2674.0 35.60995101928711 41 16 10 5 10 3.1941013932690225 26.106543930725174 0.04489898681640625 3 0.9680133061415738 6.881976839091177 2674.0 15.162452482761278 0.0 - - - - - - - 270.625 5 8 G6PD glucose-6-phosphate dehydrogenase 1383 176 C20140707_OR006_02 C20140707_OR006_02 TB437560.[MT7]-VGTLDSLVGLSDELGK[MT7]LDTFAESLIRR.4b5_1.heavy 798.948 / 630.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1385 176 C20140707_OR006_02 C20140707_OR006_02 TB437560.[MT7]-VGTLDSLVGLSDELGK[MT7]LDTFAESLIRR.4b9_1.heavy 798.948 / 986.564 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1387 176 C20140707_OR006_02 C20140707_OR006_02 TB437560.[MT7]-VGTLDSLVGLSDELGK[MT7]LDTFAESLIRR.4y19_2.heavy 798.948 / 1132.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1389 176 C20140707_OR006_02 C20140707_OR006_02 TB437560.[MT7]-VGTLDSLVGLSDELGK[MT7]LDTFAESLIRR.4b6_1.heavy 798.948 / 717.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1391 177 C20140707_OR006_02 C20140707_OR006_02 TB436943.[MT7]-AFLMELAR.2y5_1.heavy 547.811 / 619.323 18132.0 41.19810104370117 47 17 10 10 10 4.492092612838128 22.26133978498263 0.0 3 0.9738653952310281 7.617351453023812 18132.0 90.18031746031745 0.0 - - - - - - - 258.0 36 15 DNTT deoxynucleotidyltransferase, terminal 1393 177 C20140707_OR006_02 C20140707_OR006_02 TB436943.[MT7]-AFLMELAR.2b4_1.heavy 547.811 / 607.339 5761.0 41.19810104370117 47 17 10 10 10 4.492092612838128 22.26133978498263 0.0 3 0.9738653952310281 7.617351453023812 5761.0 28.1775984818741 0.0 - - - - - - - 232.73333333333332 11 15 DNTT deoxynucleotidyltransferase, terminal 1395 177 C20140707_OR006_02 C20140707_OR006_02 TB436943.[MT7]-AFLMELAR.2b6_1.heavy 547.811 / 849.466 3305.0 41.19810104370117 47 17 10 10 10 4.492092612838128 22.26133978498263 0.0 3 0.9738653952310281 7.617351453023812 3305.0 38.442622987729365 0.0 - - - - - - - 160.5 6 10 DNTT deoxynucleotidyltransferase, terminal 1397 177 C20140707_OR006_02 C20140707_OR006_02 TB436943.[MT7]-AFLMELAR.2y7_1.heavy 547.811 / 879.476 23043.0 41.19810104370117 47 17 10 10 10 4.492092612838128 22.26133978498263 0.0 3 0.9738653952310281 7.617351453023812 23043.0 458.4086170212766 0.0 - - - - - - - 175.14285714285714 46 7 DNTT deoxynucleotidyltransferase, terminal 1399 178 C20140707_OR006_02 C20140707_OR006_02 TB412003.[MT7]-FRFLNELIK[MT7].2b8_1.heavy 734.45 / 1177.69 960.0 40.835366566975914 43 17 10 6 10 4.043609457068889 24.730380384580336 0.034702301025390625 3 0.9786721450791945 8.435558935963241 960.0 4.1499999999999995 2.0 - - - - - - - 0.0 1 0 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1401 178 C20140707_OR006_02 C20140707_OR006_02 TB412003.[MT7]-FRFLNELIK[MT7].2b6_1.heavy 734.45 / 951.517 1440.0 40.835366566975914 43 17 10 6 10 4.043609457068889 24.730380384580336 0.034702301025390625 3 0.9786721450791945 8.435558935963241 1440.0 3.0 0.0 - - - - - - - 202.66666666666666 2 18 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1403 178 C20140707_OR006_02 C20140707_OR006_02 TB412003.[MT7]-FRFLNELIK[MT7].2b7_1.heavy 734.45 / 1064.6 1248.0 40.835366566975914 43 17 10 6 10 4.043609457068889 24.730380384580336 0.034702301025390625 3 0.9786721450791945 8.435558935963241 1248.0 2.6 1.0 - - - - - - - 186.35294117647058 2 17 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1405 178 C20140707_OR006_02 C20140707_OR006_02 TB412003.[MT7]-FRFLNELIK[MT7].2b5_1.heavy 734.45 / 822.474 N/A 40.835366566975914 43 17 10 6 10 4.043609457068889 24.730380384580336 0.034702301025390625 3 0.9786721450791945 8.435558935963241 384.0 0.6400000000000001 30.0 - - - - - - - 0.0 1 0 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 1407 179 C20140707_OR006_02 C20140707_OR006_02 TB437268.[MT7]-FQDLVVFILEK[MT7].3y3_1.heavy 546.995 / 533.341 71175.0 53.58549880981445 38 8 10 10 10 0.8684908560916942 65.96029932762417 0.0 3 0.7615759437356215 2.475451398303069 71175.0 613.1525974025974 0.0 - - - - - - - 195.6153846153846 142 13 DNTT deoxynucleotidyltransferase, terminal 1409 179 C20140707_OR006_02 C20140707_OR006_02 TB437268.[MT7]-FQDLVVFILEK[MT7].3b4_1.heavy 546.995 / 648.347 29545.0 53.58549880981445 38 8 10 10 10 0.8684908560916942 65.96029932762417 0.0 3 0.7615759437356215 2.475451398303069 29545.0 240.45281385281385 0.0 - - - - - - - 178.72727272727272 59 11 DNTT deoxynucleotidyltransferase, terminal 1411 179 C20140707_OR006_02 C20140707_OR006_02 TB437268.[MT7]-FQDLVVFILEK[MT7].3b5_1.heavy 546.995 / 747.416 33997.0 53.58549880981445 38 8 10 10 10 0.8684908560916942 65.96029932762417 0.0 3 0.7615759437356215 2.475451398303069 33997.0 265.3399234572217 0.0 - - - - - - - 218.33333333333334 67 9 DNTT deoxynucleotidyltransferase, terminal 1413 179 C20140707_OR006_02 C20140707_OR006_02 TB437268.[MT7]-FQDLVVFILEK[MT7].3b3_1.heavy 546.995 / 535.263 16363.0 53.58549880981445 38 8 10 10 10 0.8684908560916942 65.96029932762417 0.0 3 0.7615759437356215 2.475451398303069 16363.0 151.04793384081106 0.0 - - - - - - - 199.33333333333334 32 9 DNTT deoxynucleotidyltransferase, terminal 1415 180 C20140707_OR006_02 C20140707_OR006_02 TB437363.[MT7]-DAPLRFAGEIC[CAM]GFK[MT7].3b9_2.heavy 623.669 / 551.294 14147.0 37.30630111694336 35 13 4 10 8 1.49537311061043 46.86970282408952 0.0 4 0.9072675277671265 4.020978858688552 14147.0 16.541858388884474 0.0 - - - - - - - 244.0 28 7 CLSTN1 calsyntenin 1 1417 180 C20140707_OR006_02 C20140707_OR006_02 TB437363.[MT7]-DAPLRFAGEIC[CAM]GFK[MT7].3b9_1.heavy 623.669 / 1101.58 6464.0 37.30630111694336 35 13 4 10 8 1.49537311061043 46.86970282408952 0.0 4 0.9072675277671265 4.020978858688552 6464.0 19.515628415300547 3.0 - - - - - - - 305.0 52 10 CLSTN1 calsyntenin 1 1419 180 C20140707_OR006_02 C20140707_OR006_02 TB437363.[MT7]-DAPLRFAGEIC[CAM]GFK[MT7].3y4_1.heavy 623.669 / 655.335 10855.0 37.30630111694336 35 13 4 10 8 1.49537311061043 46.86970282408952 0.0 4 0.9072675277671265 4.020978858688552 10855.0 47.79600559893207 1.0 - - - - - - - 244.0 28 10 CLSTN1 calsyntenin 1 1421 180 C20140707_OR006_02 C20140707_OR006_02 TB437363.[MT7]-DAPLRFAGEIC[CAM]GFK[MT7].3y13_2.heavy 623.669 / 805.436 13416.0 37.30630111694336 35 13 4 10 8 1.49537311061043 46.86970282408952 0.0 4 0.9072675277671265 4.020978858688552 13416.0 64.2208524590164 0.0 - - - - - - - 264.3333333333333 26 6 CLSTN1 calsyntenin 1 1423 181 C20140707_OR006_02 C20140707_OR006_02 TB437364.[MT7]-VYSDAQPHIQWLK[MT7].4y5_1.heavy 469.011 / 831.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR3;FGFR4 fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1425 181 C20140707_OR006_02 C20140707_OR006_02 TB437364.[MT7]-VYSDAQPHIQWLK[MT7].4b4_1.heavy 469.011 / 609.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR3;FGFR4 fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1427 181 C20140707_OR006_02 C20140707_OR006_02 TB437364.[MT7]-VYSDAQPHIQWLK[MT7].4b5_1.heavy 469.011 / 680.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR3;FGFR4 fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1429 181 C20140707_OR006_02 C20140707_OR006_02 TB437364.[MT7]-VYSDAQPHIQWLK[MT7].4b6_1.heavy 469.011 / 808.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR3;FGFR4 fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1431 182 C20140707_OR006_02 C20140707_OR006_02 TB411702.[MT7]-LEDFFAR.2b3_1.heavy 521.278 / 502.263 18731.0 39.64917469024658 42 16 10 6 10 2.177209033040587 30.90872675554926 0.037097930908203125 3 0.9697062297720591 7.07266678637373 18731.0 63.98650603452345 0.0 - - - - - - - 260.93333333333334 37 15 G6PD glucose-6-phosphate dehydrogenase 1433 182 C20140707_OR006_02 C20140707_OR006_02 TB411702.[MT7]-LEDFFAR.2y4_1.heavy 521.278 / 540.293 11526.0 39.64917469024658 42 16 10 6 10 2.177209033040587 30.90872675554926 0.037097930908203125 3 0.9697062297720591 7.07266678637373 11526.0 58.19712700614227 0.0 - - - - - - - 154.5 23 4 G6PD glucose-6-phosphate dehydrogenase 1435 182 C20140707_OR006_02 C20140707_OR006_02 TB411702.[MT7]-LEDFFAR.2y5_1.heavy 521.278 / 655.32 4425.0 39.64917469024658 42 16 10 6 10 2.177209033040587 30.90872675554926 0.037097930908203125 3 0.9697062297720591 7.07266678637373 4425.0 50.8373786407767 0.0 - - - - - - - 180.25 8 8 G6PD glucose-6-phosphate dehydrogenase 1437 182 C20140707_OR006_02 C20140707_OR006_02 TB411702.[MT7]-LEDFFAR.2y6_1.heavy 521.278 / 784.362 12967.0 39.64917469024658 42 16 10 6 10 2.177209033040587 30.90872675554926 0.037097930908203125 3 0.9697062297720591 7.07266678637373 12967.0 98.19669902912621 0.0 - - - - - - - 250.14285714285714 25 7 G6PD glucose-6-phosphate dehydrogenase 1439 183 C20140707_OR006_02 C20140707_OR006_02 TB437367.[MT7]-YSTWEPEENILDSR.2y9_1.heavy 941.951 / 1072.53 7847.0 38.60479927062988 38 14 10 6 8 4.184519158982646 23.89760835132903 0.038997650146484375 4 0.9469523165672606 5.334458603149886 7847.0 20.22654092445157 0.0 - - - - - - - 270.3333333333333 15 9 CBX6 chromobox homolog 6 1441 183 C20140707_OR006_02 C20140707_OR006_02 TB437367.[MT7]-YSTWEPEENILDSR.2y6_1.heavy 941.951 / 717.389 774.0 38.60479927062988 38 14 10 6 8 4.184519158982646 23.89760835132903 0.038997650146484375 4 0.9469523165672606 5.334458603149886 774.0 9.204324324324325 2.0 - - - - - - - 0.0 1 0 CBX6 chromobox homolog 6 1443 183 C20140707_OR006_02 C20140707_OR006_02 TB437367.[MT7]-YSTWEPEENILDSR.2y10_1.heavy 941.951 / 1201.57 1105.0 38.60479927062988 38 14 10 6 8 4.184519158982646 23.89760835132903 0.038997650146484375 4 0.9469523165672606 5.334458603149886 1105.0 2.3578661844484627 6.0 - - - - - - - 241.36363636363637 2 11 CBX6 chromobox homolog 6 1445 183 C20140707_OR006_02 C20140707_OR006_02 TB437367.[MT7]-YSTWEPEENILDSR.2y7_1.heavy 941.951 / 846.432 663.0 38.60479927062988 38 14 10 6 8 4.184519158982646 23.89760835132903 0.038997650146484375 4 0.9469523165672606 5.334458603149886 663.0 4.174192771084337 2.0 - - - - - - - 0.0 1 0 CBX6 chromobox homolog 6 1447 184 C20140707_OR006_02 C20140707_OR006_02 TB437368.[MT7]-YNFPLVTLYATLGK[MT7].2b3_1.heavy 944.545 / 569.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL4 acyl-CoA synthetase long-chain family member 4 1449 184 C20140707_OR006_02 C20140707_OR006_02 TB437368.[MT7]-YNFPLVTLYATLGK[MT7].2y8_1.heavy 944.545 / 1010.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL4 acyl-CoA synthetase long-chain family member 4 1451 184 C20140707_OR006_02 C20140707_OR006_02 TB437368.[MT7]-YNFPLVTLYATLGK[MT7].2y9_1.heavy 944.545 / 1109.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL4 acyl-CoA synthetase long-chain family member 4 1453 184 C20140707_OR006_02 C20140707_OR006_02 TB437368.[MT7]-YNFPLVTLYATLGK[MT7].2y6_1.heavy 944.545 / 796.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - ACSL4 acyl-CoA synthetase long-chain family member 4 1455 185 C20140707_OR006_02 C20140707_OR006_02 TB437365.[MT7]-VYSDAQPHIQWLK[MT7].3b6_1.heavy 625.012 / 808.396 15316.0 34.832698822021484 37 17 2 10 8 4.780542681013768 20.9181272237473 0.0 4 0.9783208685765407 8.366690417443152 15316.0 24.09284308534137 1.0 - - - - - - - 255.25 78 4 FGFR3;FGFR4 fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1457 185 C20140707_OR006_02 C20140707_OR006_02 TB437365.[MT7]-VYSDAQPHIQWLK[MT7].3b4_1.heavy 625.012 / 609.3 16209.0 34.832698822021484 37 17 2 10 8 4.780542681013768 20.9181272237473 0.0 4 0.9783208685765407 8.366690417443152 16209.0 27.665190299256878 0.0 - - - - - - - 255.4 32 5 FGFR3;FGFR4 fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1459 185 C20140707_OR006_02 C20140707_OR006_02 TB437365.[MT7]-VYSDAQPHIQWLK[MT7].3b5_1.heavy 625.012 / 680.337 7147.0 34.832698822021484 37 17 2 10 8 4.780542681013768 20.9181272237473 0.0 4 0.9783208685765407 8.366690417443152 7147.0 23.70502705372096 0.0 - - - - - - - 212.88888888888889 14 9 FGFR3;FGFR4 fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1461 185 C20140707_OR006_02 C20140707_OR006_02 TB437365.[MT7]-VYSDAQPHIQWLK[MT7].3y5_1.heavy 625.012 / 831.521 8551.0 34.832698822021484 37 17 2 10 8 4.780542681013768 20.9181272237473 0.0 4 0.9783208685765407 8.366690417443152 8551.0 39.645530525628466 0.0 - - - - - - - 313.1818181818182 17 11 FGFR3;FGFR4 fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1463 186 C20140707_OR006_02 C20140707_OR006_02 TB437165.[MT7]-YNYLLDVLER.2b3_1.heavy 721.394 / 585.279 2839.0 46.64309883117676 44 20 9 5 10 6.257801039385289 12.654028413748627 0.044200897216796875 3 0.9932631256254345 15.027579285173706 2839.0 12.506607929515418 1.0 - - - - - - - 308.2857142857143 5 7 FGFR4 fibroblast growth factor receptor 4 1465 186 C20140707_OR006_02 C20140707_OR006_02 TB437165.[MT7]-YNYLLDVLER.2y4_1.heavy 721.394 / 516.314 4088.0 46.64309883117676 44 20 9 5 10 6.257801039385289 12.654028413748627 0.044200897216796875 3 0.9932631256254345 15.027579285173706 4088.0 17.964712752076686 0.0 - - - - - - - 299.45454545454544 8 11 FGFR4 fibroblast growth factor receptor 4 1467 186 C20140707_OR006_02 C20140707_OR006_02 TB437165.[MT7]-YNYLLDVLER.2y8_1.heavy 721.394 / 1020.57 1704.0 46.64309883117676 44 20 9 5 10 6.257801039385289 12.654028413748627 0.044200897216796875 3 0.9932631256254345 15.027579285173706 1704.0 13.551578947368423 2.0 - - - - - - - 284.0 9 10 FGFR4 fibroblast growth factor receptor 4 1469 186 C20140707_OR006_02 C20140707_OR006_02 TB437165.[MT7]-YNYLLDVLER.2y7_1.heavy 721.394 / 857.509 2271.0 46.64309883117676 44 20 9 5 10 6.257801039385289 12.654028413748627 0.044200897216796875 3 0.9932631256254345 15.027579285173706 2271.0 4.300954892349693 2.0 - - - - - - - 170.5 4 4 FGFR4 fibroblast growth factor receptor 4 1471 187 C20140707_OR006_02 C20140707_OR006_02 TB437160.[MT7]-VQPNEAVYTK[MT7].3b6_1.heavy 479.604 / 783.412 5367.0 24.471675395965576 40 14 10 6 10 3.46340722528107 28.87330120179113 0.03650093078613281 3 0.9397581905287601 5.002748321357144 5367.0 19.148925925925923 0.0 - - - - - - - 185.66666666666666 10 6 G6PD glucose-6-phosphate dehydrogenase 1473 187 C20140707_OR006_02 C20140707_OR006_02 TB437160.[MT7]-VQPNEAVYTK[MT7].3y3_1.heavy 479.604 / 555.326 33724.0 24.471675395965576 40 14 10 6 10 3.46340722528107 28.87330120179113 0.03650093078613281 3 0.9397581905287601 5.002748321357144 33724.0 128.19201283300845 0.0 - - - - - - - 273.5 67 10 G6PD glucose-6-phosphate dehydrogenase 1475 187 C20140707_OR006_02 C20140707_OR006_02 TB437160.[MT7]-VQPNEAVYTK[MT7].3b4_1.heavy 479.604 / 583.332 6178.0 24.471675395965576 40 14 10 6 10 3.46340722528107 28.87330120179113 0.03650093078613281 3 0.9397581905287601 5.002748321357144 6178.0 115.6081188118812 0.0 - - - - - - - 118.0 12 6 G6PD glucose-6-phosphate dehydrogenase 1477 187 C20140707_OR006_02 C20140707_OR006_02 TB437160.[MT7]-VQPNEAVYTK[MT7].3b5_1.heavy 479.604 / 712.375 11950.0 24.471675395965576 40 14 10 6 10 3.46340722528107 28.87330120179113 0.03650093078613281 3 0.9397581905287601 5.002748321357144 11950.0 69.32937878229936 0.0 - - - - - - - 177.25 23 8 G6PD glucose-6-phosphate dehydrogenase 1479 188 C20140707_OR006_02 C20140707_OR006_02 TB437369.[MT7]-VGTLDSLVGLSDELGK[MT7].3y6_1.heavy 631.026 / 792.422 54229.0 44.40850067138672 44 14 10 10 10 1.3242694436748719 50.21872259753746 0.0 3 0.9476991831586283 5.3727531646182625 54229.0 385.60291141812274 0.0 - - - - - - - 230.76923076923077 108 13 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1481 188 C20140707_OR006_02 C20140707_OR006_02 TB437369.[MT7]-VGTLDSLVGLSDELGK[MT7].3b6_1.heavy 631.026 / 717.39 56801.0 44.40850067138672 44 14 10 10 10 1.3242694436748719 50.21872259753746 0.0 3 0.9476991831586283 5.3727531646182625 56801.0 117.2930017548285 0.0 - - - - - - - 696.5 113 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1483 188 C20140707_OR006_02 C20140707_OR006_02 TB437369.[MT7]-VGTLDSLVGLSDELGK[MT7].3b5_1.heavy 631.026 / 630.358 43083.0 44.40850067138672 44 14 10 10 10 1.3242694436748719 50.21872259753746 0.0 3 0.9476991831586283 5.3727531646182625 43083.0 52.2406224383265 0.0 - - - - - - - 1214.6666666666667 86 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1485 188 C20140707_OR006_02 C20140707_OR006_02 TB437369.[MT7]-VGTLDSLVGLSDELGK[MT7].3b7_1.heavy 631.026 / 830.474 39975.0 44.40850067138672 44 14 10 10 10 1.3242694436748719 50.21872259753746 0.0 3 0.9476991831586283 5.3727531646182625 39975.0 229.0510966410372 0.0 - - - - - - - 187.41666666666666 79 12 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1487 189 C20140707_OR006_02 C20140707_OR006_02 TB437161.[MT7]-ATVESIMRDK[MT7].3y7_1.heavy 479.937 / 1022.54 N/A 29.296899795532227 38 10 10 10 8 0.6830774135389921 78.08876026393452 0.0 4 0.8221375486443756 2.881790114039617 126.0 1.4930434782608697 6.0 - - - - - - - 0.0 0 0 LPIN1 lipin 1 1489 189 C20140707_OR006_02 C20140707_OR006_02 TB437161.[MT7]-ATVESIMRDK[MT7].3y9_2.heavy 479.937 / 611.833 2778.0 29.296899795532227 38 10 10 10 8 0.6830774135389921 78.08876026393452 0.0 4 0.8221375486443756 2.881790114039617 2778.0 23.44019198193111 0.0 - - - - - - - 198.42857142857142 5 7 LPIN1 lipin 1 1491 189 C20140707_OR006_02 C20140707_OR006_02 TB437161.[MT7]-ATVESIMRDK[MT7].3b4_1.heavy 479.937 / 545.305 1263.0 29.296899795532227 38 10 10 10 8 0.6830774135389921 78.08876026393452 0.0 4 0.8221375486443756 2.881790114039617 1263.0 9.34076159621516 4.0 - - - - - - - 268.5 5 8 LPIN1 lipin 1 1493 189 C20140707_OR006_02 C20140707_OR006_02 TB437161.[MT7]-ATVESIMRDK[MT7].3b5_1.heavy 479.937 / 632.337 1894.0 29.296899795532227 38 10 10 10 8 0.6830774135389921 78.08876026393452 0.0 4 0.8221375486443756 2.881790114039617 1894.0 23.29920634920635 0.0 - - - - - - - 202.0 3 10 LPIN1 lipin 1 1495 190 C20140707_OR006_02 C20140707_OR006_02 TB411709.[MT7]-QFPTPGIR.2b4_1.heavy 530.307 / 618.337 1144.0 29.172574520111084 21 14 0 5 2 3.4233285137393734 29.21133615972132 0.04549980163574219 12 0.9441694929508726 5.198583264323814 1144.0 0.7502626391884499 12.0 - - - - - - - 571.625 6 8 CLSTN1 calsyntenin 1 1497 190 C20140707_OR006_02 C20140707_OR006_02 TB411709.[MT7]-QFPTPGIR.2b6_1.heavy 530.307 / 772.411 763.0 29.172574520111084 21 14 0 5 2 3.4233285137393734 29.21133615972132 0.04549980163574219 12 0.9441694929508726 5.198583264323814 763.0 0.6278615119461998 4.0 - - - - - - - 254.0 2 8 CLSTN1 calsyntenin 1 1499 190 C20140707_OR006_02 C20140707_OR006_02 TB411709.[MT7]-QFPTPGIR.2y6_1.heavy 530.307 / 640.378 3304.0 29.172574520111084 21 14 0 5 2 3.4233285137393734 29.21133615972132 0.04549980163574219 12 0.9441694929508726 5.198583264323814 3304.0 -0.03867850591412107 2.0 - - - - - - - 190.5 14 2 CLSTN1 calsyntenin 1 1501 190 C20140707_OR006_02 C20140707_OR006_02 TB411709.[MT7]-QFPTPGIR.2y7_1.heavy 530.307 / 787.446 6990.0 29.172574520111084 21 14 0 5 2 3.4233285137393734 29.21133615972132 0.04549980163574219 12 0.9441694929508726 5.198583264323814 6990.0 20.703519263164416 2.0 - - - - - - - 653.5714285714286 53 7 CLSTN1 calsyntenin 1 1503 191 C20140707_OR006_02 C20140707_OR006_02 TB450104.[MT7]-RPAPALAPAAR.2y8_1.heavy 617.879 / 766.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLSTN1 calsyntenin 1 1505 191 C20140707_OR006_02 C20140707_OR006_02 TB450104.[MT7]-RPAPALAPAAR.2b7_1.heavy 617.879 / 821.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLSTN1 calsyntenin 1 1507 191 C20140707_OR006_02 C20140707_OR006_02 TB450104.[MT7]-RPAPALAPAAR.2y10_1.heavy 617.879 / 934.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLSTN1 calsyntenin 1 1509 191 C20140707_OR006_02 C20140707_OR006_02 TB450104.[MT7]-RPAPALAPAAR.2b5_1.heavy 617.879 / 637.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - CLSTN1 calsyntenin 1 1511 192 C20140707_OR006_02 C20140707_OR006_02 TB450522.[MT7]-LSSSGPALLAGLVSLDLPLDPLWEFPRDR.3b10_1.heavy 1093.6 / 1041.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1513 192 C20140707_OR006_02 C20140707_OR006_02 TB450522.[MT7]-LSSSGPALLAGLVSLDLPLDPLWEFPRDR.3b8_1.heavy 1093.6 / 857.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1515 192 C20140707_OR006_02 C20140707_OR006_02 TB450522.[MT7]-LSSSGPALLAGLVSLDLPLDPLWEFPRDR.3b7_1.heavy 1093.6 / 744.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1517 192 C20140707_OR006_02 C20140707_OR006_02 TB450522.[MT7]-LSSSGPALLAGLVSLDLPLDPLWEFPRDR.3y9_1.heavy 1093.6 / 1215.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1519 193 C20140707_OR006_02 C20140707_OR006_02 TB450523.[MT7]-LSSSGPALLAGLVSLDLPLDPLWEFPRDR.4b8_1.heavy 820.453 / 857.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1521 193 C20140707_OR006_02 C20140707_OR006_02 TB450523.[MT7]-LSSSGPALLAGLVSLDLPLDPLWEFPRDR.4b7_1.heavy 820.453 / 744.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1523 193 C20140707_OR006_02 C20140707_OR006_02 TB450523.[MT7]-LSSSGPALLAGLVSLDLPLDPLWEFPRDR.4b10_1.heavy 820.453 / 1041.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1525 193 C20140707_OR006_02 C20140707_OR006_02 TB450523.[MT7]-LSSSGPALLAGLVSLDLPLDPLWEFPRDR.4b5_1.heavy 820.453 / 576.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1527 194 C20140707_OR006_02 C20140707_OR006_02 TB436917.[MT7]-RNELVIR.2y4_1.heavy 522.326 / 500.355 69734.0 24.001949310302734 20 2 10 6 2 0.31904636669905234 142.90397978926848 0.03459930419921875 11 0.4233153710681106 1.539505522016111 69734.0 61.39025535609248 0.0 - - - - - - - 305.3333333333333 139 6 G6PD glucose-6-phosphate dehydrogenase 1529 194 C20140707_OR006_02 C20140707_OR006_02 TB436917.[MT7]-RNELVIR.2b3_1.heavy 522.326 / 544.296 579.0 24.001949310302734 20 2 10 6 2 0.31904636669905234 142.90397978926848 0.03459930419921875 11 0.4233153710681106 1.539505522016111 579.0 0.0 16.0 - - - - - - - 199.71428571428572 3 14 G6PD glucose-6-phosphate dehydrogenase 1531 194 C20140707_OR006_02 C20140707_OR006_02 TB436917.[MT7]-RNELVIR.2b4_1.heavy 522.326 / 657.38 579.0 24.001949310302734 20 2 10 6 2 0.31904636669905234 142.90397978926848 0.03459930419921875 11 0.4233153710681106 1.539505522016111 579.0 1.0423875216819745 12.0 - - - - - - - 214.05555555555554 11 18 G6PD glucose-6-phosphate dehydrogenase 1533 194 C20140707_OR006_02 C20140707_OR006_02 TB436917.[MT7]-RNELVIR.2y6_1.heavy 522.326 / 743.441 3086.0 24.001949310302734 20 2 10 6 2 0.31904636669905234 142.90397978926848 0.03459930419921875 11 0.4233153710681106 1.539505522016111 3086.0 18.366505190311422 0.0 - - - - - - - 237.23076923076923 6 13 G6PD glucose-6-phosphate dehydrogenase 1535 195 C20140707_OR006_02 C20140707_OR006_02 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 197741.0 40.482601165771484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 197741.0 601.0721419885107 0.0 - - - - - - - 310.75 395 4 1537 195 C20140707_OR006_02 C20140707_OR006_02 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 288624.0 40.482601165771484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 288624.0 541.3018198746404 0.0 - - - - - - - 765.25 577 4 1539 195 C20140707_OR006_02 C20140707_OR006_02 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 394143.0 40.482601165771484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 394143.0 3377.231478973628 0.0 - - - - - - - 1207.625 788 8 1541 196 C20140707_OR006_02 C20140707_OR006_02 TB437394.[MT7]-QDLNEEEAAQVHGVK[MT7].3b4_1.heavy 652.341 / 615.322 1170.0 24.508100509643555 39 13 10 6 10 2.2983423669101155 37.576404924333616 0.03639984130859375 3 0.9196286767587784 4.323736715842328 1170.0 1.48 2.0 - - - - - - - 218.91666666666666 2 12 FAM13C family with sequence similarity 13, member C 1543 196 C20140707_OR006_02 C20140707_OR006_02 TB437394.[MT7]-QDLNEEEAAQVHGVK[MT7].3b5_1.heavy 652.341 / 744.364 2047.0 24.508100509643555 39 13 10 6 10 2.2983423669101155 37.576404924333616 0.03639984130859375 3 0.9196286767587784 4.323736715842328 2047.0 15.315758974358975 0.0 - - - - - - - 331.4 4 5 FAM13C family with sequence similarity 13, member C 1545 196 C20140707_OR006_02 C20140707_OR006_02 TB437394.[MT7]-QDLNEEEAAQVHGVK[MT7].3y4_1.heavy 652.341 / 584.364 5653.0 24.508100509643555 39 13 10 6 10 2.2983423669101155 37.576404924333616 0.03639984130859375 3 0.9196286767587784 4.323736715842328 5653.0 27.949699180544542 0.0 - - - - - - - 158.125 11 8 FAM13C family with sequence similarity 13, member C 1547 196 C20140707_OR006_02 C20140707_OR006_02 TB437394.[MT7]-QDLNEEEAAQVHGVK[MT7].3b7_1.heavy 652.341 / 1002.45 3119.0 24.508100509643555 39 13 10 6 10 2.2983423669101155 37.576404924333616 0.03639984130859375 3 0.9196286767587784 4.323736715842328 3119.0 60.12917525773196 0.0 - - - - - - - 146.0 6 6 FAM13C family with sequence similarity 13, member C 1549 197 C20140707_OR006_02 C20140707_OR006_02 TB437255.[MT7]-QLGQGAYGIVWK[MT7].3y3_1.heavy 536.643 / 576.363 27285.0 37.64699935913086 47 17 10 10 10 2.5843609904232507 30.96956274726977 0.0 3 0.979034136114939 8.508329009800155 27285.0 75.64383484440089 0.0 - - - - - - - 245.0 54 10 MAPK15 mitogen-activated protein kinase 15 1551 197 C20140707_OR006_02 C20140707_OR006_02 TB437255.[MT7]-QLGQGAYGIVWK[MT7].3b6_1.heavy 536.643 / 699.391 28335.0 37.64699935913086 47 17 10 10 10 2.5843609904232507 30.96956274726977 0.0 3 0.979034136114939 8.508329009800155 28335.0 65.62297172672822 0.0 - - - - - - - 326.2 56 10 MAPK15 mitogen-activated protein kinase 15 1553 197 C20140707_OR006_02 C20140707_OR006_02 TB437255.[MT7]-QLGQGAYGIVWK[MT7].3b5_1.heavy 536.643 / 628.354 24370.0 37.64699935913086 47 17 10 10 10 2.5843609904232507 30.96956274726977 0.0 3 0.979034136114939 8.508329009800155 24370.0 54.83135711982463 0.0 - - - - - - - 291.4 48 10 MAPK15 mitogen-activated protein kinase 15 1555 197 C20140707_OR006_02 C20140707_OR006_02 TB437255.[MT7]-QLGQGAYGIVWK[MT7].3b8_1.heavy 536.643 / 919.475 16674.0 37.64699935913086 47 17 10 10 10 2.5843609904232507 30.96956274726977 0.0 3 0.979034136114939 8.508329009800155 16674.0 140.90603433476394 0.0 - - - - - - - 204.0 33 8 MAPK15 mitogen-activated protein kinase 15 1557 198 C20140707_OR006_02 C20140707_OR006_02 TB437395.[MT7]-GLNPATLSGC[CAM]IDIIVIR.2y5_1.heavy 978.557 / 613.44 N/A N/A - - - - - - - - - 0.0 - - - - - - - LPIN1 lipin 1 1559 198 C20140707_OR006_02 C20140707_OR006_02 TB437395.[MT7]-GLNPATLSGC[CAM]IDIIVIR.2y9_1.heavy 978.557 / 1058.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - LPIN1 lipin 1 1561 198 C20140707_OR006_02 C20140707_OR006_02 TB437395.[MT7]-GLNPATLSGC[CAM]IDIIVIR.2b4_1.heavy 978.557 / 526.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - LPIN1 lipin 1 1563 198 C20140707_OR006_02 C20140707_OR006_02 TB437395.[MT7]-GLNPATLSGC[CAM]IDIIVIR.2y10_1.heavy 978.557 / 1145.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - LPIN1 lipin 1 1565 199 C20140707_OR006_02 C20140707_OR006_02 TB437056.[MT7]-GYLDDPTVPR.2y5_1.heavy 638.836 / 569.341 50690.0 29.296899795532227 47 17 10 10 10 4.192307085177696 23.85321446359681 0.0 3 0.9759597594743326 7.943630963023447 50690.0 89.01832446765509 0.0 - - - - - - - 190.5 101 4 G6PD glucose-6-phosphate dehydrogenase 1567 199 C20140707_OR006_02 C20140707_OR006_02 TB437056.[MT7]-GYLDDPTVPR.2b4_1.heavy 638.836 / 593.305 11053.0 29.296899795532227 47 17 10 10 10 4.192307085177696 23.85321446359681 0.0 3 0.9759597594743326 7.943630963023447 11053.0 60.051732283464574 0.0 - - - - - - - 279.4 22 10 G6PD glucose-6-phosphate dehydrogenase 1569 199 C20140707_OR006_02 C20140707_OR006_02 TB437056.[MT7]-GYLDDPTVPR.2y6_1.heavy 638.836 / 684.367 5463.0 29.296899795532227 47 17 10 10 10 4.192307085177696 23.85321446359681 0.0 3 0.9759597594743326 7.943630963023447 5463.0 45.70423228346457 0.0 - - - - - - - 190.5 10 6 G6PD glucose-6-phosphate dehydrogenase 1571 199 C20140707_OR006_02 C20140707_OR006_02 TB437056.[MT7]-GYLDDPTVPR.2b5_1.heavy 638.836 / 708.332 36969.0 29.296899795532227 47 17 10 10 10 4.192307085177696 23.85321446359681 0.0 3 0.9759597594743326 7.943630963023447 36969.0 112.20652896512934 0.0 - - - - - - - 228.6 73 5 G6PD glucose-6-phosphate dehydrogenase 1573 200 C20140707_OR006_02 C20140707_OR006_02 TB411732.[MT7]-FYEPQK[MT7].2y4_1.heavy 550.305 / 645.369 767.0 26.241150856018066 33 16 4 5 8 2.7507778452110916 36.35335371560189 0.04409980773925781 4 0.9626727866709361 6.367798721545594 767.0 2.3235359675785205 9.0 - - - - - - - 0.0 1 0 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1575 200 C20140707_OR006_02 C20140707_OR006_02 TB411732.[MT7]-FYEPQK[MT7].2b3_1.heavy 550.305 / 584.284 3947.0 26.241150856018066 33 16 4 5 8 2.7507778452110916 36.35335371560189 0.04409980773925781 4 0.9626727866709361 6.367798721545594 3947.0 25.48321569361667 0.0 - - - - - - - 297.57142857142856 7 7 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1577 200 C20140707_OR006_02 C20140707_OR006_02 TB411732.[MT7]-FYEPQK[MT7].2y5_1.heavy 550.305 / 808.432 1096.0 26.241150856018066 33 16 4 5 8 2.7507778452110916 36.35335371560189 0.04409980773925781 4 0.9626727866709361 6.367798721545594 1096.0 14.818065587380655 0.0 - - - - - - - 141.14285714285714 2 7 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1579 200 C20140707_OR006_02 C20140707_OR006_02 TB411732.[MT7]-FYEPQK[MT7].2y3_1.heavy 550.305 / 516.326 7017.0 26.241150856018066 33 16 4 5 8 2.7507778452110916 36.35335371560189 0.04409980773925781 4 0.9626727866709361 6.367798721545594 7017.0 20.986128404945237 1.0 - - - - - - - 267.5 27 16 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1581 201 C20140707_OR006_02 C20140707_OR006_02 TB437258.[MT7]-MILDNHALYDK[MT7].3y3_1.heavy 540.96 / 569.305 31319.0 32.094698905944824 42 16 10 6 10 2.30614155221604 29.79979276680978 0.039997100830078125 3 0.9680483582449746 6.885771045059815 31319.0 98.34193610722888 0.0 - - - - - - - 198.42857142857142 62 7 DNTT deoxynucleotidyltransferase, terminal 1583 201 C20140707_OR006_02 C20140707_OR006_02 TB437258.[MT7]-MILDNHALYDK[MT7].3b4_1.heavy 540.96 / 617.345 22479.0 32.094698905944824 42 16 10 6 10 2.30614155221604 29.79979276680978 0.039997100830078125 3 0.9680483582449746 6.885771045059815 22479.0 24.741238089027227 0.0 - - - - - - - 234.57142857142858 44 7 DNTT deoxynucleotidyltransferase, terminal 1585 201 C20140707_OR006_02 C20140707_OR006_02 TB437258.[MT7]-MILDNHALYDK[MT7].3b5_1.heavy 540.96 / 731.388 29045.0 32.094698905944824 42 16 10 6 10 2.30614155221604 29.79979276680978 0.039997100830078125 3 0.9680483582449746 6.885771045059815 29045.0 56.174529934150556 0.0 - - - - - - - 210.44444444444446 58 9 DNTT deoxynucleotidyltransferase, terminal 1587 201 C20140707_OR006_02 C20140707_OR006_02 TB437258.[MT7]-MILDNHALYDK[MT7].3y4_1.heavy 540.96 / 682.389 31066.0 32.094698905944824 42 16 10 6 10 2.30614155221604 29.79979276680978 0.039997100830078125 3 0.9680483582449746 6.885771045059815 31066.0 50.19768490856113 0.0 - - - - - - - 300.125 62 8 DNTT deoxynucleotidyltransferase, terminal 1589 202 C20140707_OR006_02 C20140707_OR006_02 TB412017.[MT7]-C[CAM]FLIFK[MT7]LPR.3y7_1.heavy 494.635 / 1030.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT deoxynucleotidyltransferase, terminal 1591 202 C20140707_OR006_02 C20140707_OR006_02 TB412017.[MT7]-C[CAM]FLIFK[MT7]LPR.3y6_1.heavy 494.635 / 917.605 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT deoxynucleotidyltransferase, terminal 1593 202 C20140707_OR006_02 C20140707_OR006_02 TB412017.[MT7]-C[CAM]FLIFK[MT7]LPR.3b3_1.heavy 494.635 / 565.292 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT deoxynucleotidyltransferase, terminal 1595 202 C20140707_OR006_02 C20140707_OR006_02 TB412017.[MT7]-C[CAM]FLIFK[MT7]LPR.3y5_1.heavy 494.635 / 804.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT deoxynucleotidyltransferase, terminal 1597 203 C20140707_OR006_02 C20140707_OR006_02 TB450119.[MT7]-VFAAESIIK[MT7].2y4_1.heavy 633.389 / 604.415 5513.0 35.86849880218506 41 18 10 5 8 4.749387381026221 21.055347137927622 0.044399261474609375 4 0.9805029987144369 8.824097614673454 5513.0 11.25354591819487 1.0 - - - - - - - 705.4 20 10 CBX6 chromobox homolog 6 1599 203 C20140707_OR006_02 C20140707_OR006_02 TB450119.[MT7]-VFAAESIIK[MT7].2y8_1.heavy 633.389 / 1022.6 12052.0 35.86849880218506 41 18 10 5 8 4.749387381026221 21.055347137927622 0.044399261474609375 4 0.9805029987144369 8.824097614673454 12052.0 56.47538402145644 0.0 - - - - - - - 256.22222222222223 24 9 CBX6 chromobox homolog 6 1601 203 C20140707_OR006_02 C20140707_OR006_02 TB450119.[MT7]-VFAAESIIK[MT7].2b4_1.heavy 633.389 / 533.32 4616.0 35.86849880218506 41 18 10 5 8 4.749387381026221 21.055347137927622 0.044399261474609375 4 0.9805029987144369 8.824097614673454 4616.0 19.813658244680852 1.0 - - - - - - - 240.25 9 8 CBX6 chromobox homolog 6 1603 203 C20140707_OR006_02 C20140707_OR006_02 TB450119.[MT7]-VFAAESIIK[MT7].2y6_1.heavy 633.389 / 804.495 5770.0 35.86849880218506 41 18 10 5 8 4.749387381026221 21.055347137927622 0.044399261474609375 4 0.9805029987144369 8.824097614673454 5770.0 60.85546875 1.0 - - - - - - - 201.28571428571428 11 7 CBX6 chromobox homolog 6 1605 204 C20140707_OR006_02 C20140707_OR006_02 TB411839.[MT7]-RAFLMELAR.3b4_1.heavy 417.577 / 632.4 14392.0 35.452598571777344 47 17 10 10 10 5.313604155016557 18.819617924604024 0.0 3 0.9784380498944155 8.38947714331738 14392.0 147.09748340280993 0.0 - - - - - - - 178.2 28 5 DNTT deoxynucleotidyltransferase, terminal 1607 204 C20140707_OR006_02 C20140707_OR006_02 TB411839.[MT7]-RAFLMELAR.3b3_1.heavy 417.577 / 519.316 11463.0 35.452598571777344 47 17 10 10 10 5.313604155016557 18.819617924604024 0.0 3 0.9784380498944155 8.38947714331738 11463.0 48.816774529065064 0.0 - - - - - - - 169.66666666666666 22 9 DNTT deoxynucleotidyltransferase, terminal 1609 204 C20140707_OR006_02 C20140707_OR006_02 TB411839.[MT7]-RAFLMELAR.3y4_1.heavy 417.577 / 488.283 34007.0 35.452598571777344 47 17 10 10 10 5.313604155016557 18.819617924604024 0.0 3 0.9784380498944155 8.38947714331738 34007.0 133.50878697592609 0.0 - - - - - - - 163.42857142857142 68 7 DNTT deoxynucleotidyltransferase, terminal 1611 204 C20140707_OR006_02 C20140707_OR006_02 TB411839.[MT7]-RAFLMELAR.3y5_1.heavy 417.577 / 619.323 18213.0 35.452598571777344 47 17 10 10 10 5.313604155016557 18.819617924604024 0.0 3 0.9784380498944155 8.38947714331738 18213.0 282.37320472440945 0.0 - - - - - - - 178.2 36 5 DNTT deoxynucleotidyltransferase, terminal 1613 205 C20140707_OR006_02 C20140707_OR006_02 TB411736.[MT7]-TGEVVAIK[MT7].2y4_1.heavy 552.847 / 574.404 7129.0 26.128400802612305 48 18 10 10 10 4.997854671624042 20.008584997031377 0.0 3 0.984717951676584 9.97050036099033 7129.0 62.92117391304348 0.0 - - - - - - - 239.58333333333334 14 12 MAPK15 mitogen-activated protein kinase 15 1615 205 C20140707_OR006_02 C20140707_OR006_02 TB411736.[MT7]-TGEVVAIK[MT7].2b4_1.heavy 552.847 / 531.289 8739.0 26.128400802612305 48 18 10 10 10 4.997854671624042 20.008584997031377 0.0 3 0.984717951676584 9.97050036099033 8739.0 10.322152173913043 0.0 - - - - - - - 324.09090909090907 17 11 MAPK15 mitogen-activated protein kinase 15 1617 205 C20140707_OR006_02 C20140707_OR006_02 TB411736.[MT7]-TGEVVAIK[MT7].2b6_1.heavy 552.847 / 701.395 3334.0 26.128400802612305 48 18 10 10 10 4.997854671624042 20.008584997031377 0.0 3 0.984717951676584 9.97050036099033 3334.0 8.794028985507246 1.0 - - - - - - - 312.14285714285717 7 7 MAPK15 mitogen-activated protein kinase 15 1619 205 C20140707_OR006_02 C20140707_OR006_02 TB411736.[MT7]-TGEVVAIK[MT7].2b5_1.heavy 552.847 / 630.358 6209.0 26.128400802612305 48 18 10 10 10 4.997854671624042 20.008584997031377 0.0 3 0.984717951676584 9.97050036099033 6209.0 17.997101449275362 0.0 - - - - - - - 230.0 12 5 MAPK15 mitogen-activated protein kinase 15 1621 206 C20140707_OR006_02 C20140707_OR006_02 TB412015.[MT7]-QLAQIEMDLK[MT7].3y3_1.heavy 492.949 / 519.326 18443.0 37.602699279785156 50 20 10 10 10 8.731552077363494 11.45271758262194 0.0 3 0.9924254444493543 14.171286508306386 18443.0 87.13499533146592 0.0 - - - - - - - 342.125 43 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1623 206 C20140707_OR006_02 C20140707_OR006_02 TB412015.[MT7]-QLAQIEMDLK[MT7].3b4_1.heavy 492.949 / 585.348 37956.0 37.602699279785156 50 20 10 10 10 8.731552077363494 11.45271758262194 0.0 3 0.9924254444493543 14.171286508306386 37956.0 200.41193277310924 0.0 - - - - - - - 277.6666666666667 75 6 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1625 206 C20140707_OR006_02 C20140707_OR006_02 TB412015.[MT7]-QLAQIEMDLK[MT7].3b5_1.heavy 492.949 / 698.432 5830.0 37.602699279785156 50 20 10 10 10 8.731552077363494 11.45271758262194 0.0 3 0.9924254444493543 14.171286508306386 5830.0 94.55378151260504 0.0 - - - - - - - 166.6 11 5 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1627 206 C20140707_OR006_02 C20140707_OR006_02 TB412015.[MT7]-QLAQIEMDLK[MT7].3y4_1.heavy 492.949 / 650.366 17967.0 37.602699279785156 50 20 10 10 10 8.731552077363494 11.45271758262194 0.0 3 0.9924254444493543 14.171286508306386 17967.0 83.5691974789916 0.0 - - - - - - - 238.0 35 6 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1629 207 C20140707_OR006_02 C20140707_OR006_02 TB437195.[MT7]-ALQVWPLIEK[MT7].3b4_1.heavy 495.641 / 556.357 16153.0 43.12929916381836 43 20 10 3 10 14.100221321173155 7.092087260349462 0.07080078125 3 0.9977635382404002 26.091596757457634 16153.0 123.36919093851132 0.0 - - - - - - - 226.6 32 5 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1631 207 C20140707_OR006_02 C20140707_OR006_02 TB437195.[MT7]-ALQVWPLIEK[MT7].3b5_1.heavy 495.641 / 742.437 1646.0 43.12929916381836 43 20 10 3 10 14.100221321173155 7.092087260349462 0.07080078125 3 0.9977635382404002 26.091596757457634 1646.0 31.961165048543688 0.0 - - - - - - - 206.0 3 3 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1633 207 C20140707_OR006_02 C20140707_OR006_02 TB437195.[MT7]-ALQVWPLIEK[MT7].3y4_1.heavy 495.641 / 646.426 5453.0 43.12929916381836 43 20 10 3 10 14.100221321173155 7.092087260349462 0.07080078125 3 0.9977635382404002 26.091596757457634 5453.0 73.32432038834952 0.0 - - - - - - - 218.875 10 8 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1635 207 C20140707_OR006_02 C20140707_OR006_02 TB437195.[MT7]-ALQVWPLIEK[MT7].3y5_1.heavy 495.641 / 743.478 9465.0 43.12929916381836 43 20 10 3 10 14.100221321173155 7.092087260349462 0.07080078125 3 0.9977635382404002 26.091596757457634 9465.0 112.56917475728156 0.0 - - - - - - - 185.4 18 5 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1637 208 C20140707_OR006_02 C20140707_OR006_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 211748.0 35.497501373291016 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 211748.0 695.6765044247787 0.0 - - - - - - - 254.25 423 8 1639 208 C20140707_OR006_02 C20140707_OR006_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 39229.0 35.497501373291016 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 39229.0 181.56430973451327 1.0 - - - - - - - 271.2 99 10 1641 208 C20140707_OR006_02 C20140707_OR006_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 42395.0 35.497501373291016 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 42395.0 231.95317477876105 0.0 - - - - - - - 251.11111111111111 84 9 1643 209 C20140707_OR006_02 C20140707_OR006_02 TB411835.[MT7]-TNLENLEK[MT7].3y6_2.heavy 416.906 / 445.259 25248.0 26.714799880981445 48 18 10 10 10 10.302663255937192 9.706228138862274 0.0 3 0.9843182681127014 9.842290470558176 25248.0 59.688438942428405 0.0 - - - - - - - 255.75 50 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1645 209 C20140707_OR006_02 C20140707_OR006_02 TB411835.[MT7]-TNLENLEK[MT7].3b4_1.heavy 416.906 / 602.327 24907.0 26.714799880981445 48 18 10 10 10 10.302663255937192 9.706228138862274 0.0 3 0.9843182681127014 9.842290470558176 24907.0 204.08378854625548 0.0 - - - - - - - 170.5 49 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1647 209 C20140707_OR006_02 C20140707_OR006_02 TB411835.[MT7]-TNLENLEK[MT7].3b5_1.heavy 416.906 / 716.37 15126.0 26.714799880981445 48 18 10 10 10 10.302663255937192 9.706228138862274 0.0 3 0.9843182681127014 9.842290470558176 15126.0 140.4857308226578 0.0 - - - - - - - 213.25 30 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1649 209 C20140707_OR006_02 C20140707_OR006_02 TB411835.[MT7]-TNLENLEK[MT7].3b3_1.heavy 416.906 / 473.284 45038.0 26.714799880981445 48 18 10 10 10 10.302663255937192 9.706228138862274 0.0 3 0.9843182681127014 9.842290470558176 45038.0 237.13669016890623 0.0 - - - - - - - 215.9 90 10 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1651 210 C20140707_OR006_02 C20140707_OR006_02 TB449991.[MT7]-VIEDFK[MT7].2y4_1.heavy 519.807 / 682.353 18413.0 30.465299606323242 43 17 10 6 10 2.244123176665767 30.48973768308489 0.038600921630859375 3 0.9752776565467696 7.832830657534894 18413.0 46.87824146981627 0.0 - - - - - - - 272.14285714285717 36 7 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1653 210 C20140707_OR006_02 C20140707_OR006_02 TB449991.[MT7]-VIEDFK[MT7].2y5_1.heavy 519.807 / 795.437 25270.0 30.465299606323242 43 17 10 6 10 2.244123176665767 30.48973768308489 0.038600921630859375 3 0.9752776565467696 7.832830657534894 25270.0 111.59258530183726 0.0 - - - - - - - 304.8 50 5 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1655 210 C20140707_OR006_02 C20140707_OR006_02 TB449991.[MT7]-VIEDFK[MT7].2b4_1.heavy 519.807 / 601.331 26667.0 30.465299606323242 43 17 10 6 10 2.244123176665767 30.48973768308489 0.038600921630859375 3 0.9752776565467696 7.832830657534894 26667.0 49.16946850393701 0.0 - - - - - - - 217.71428571428572 53 7 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1657 210 C20140707_OR006_02 C20140707_OR006_02 TB449991.[MT7]-VIEDFK[MT7].2y3_1.heavy 519.807 / 553.31 16254.0 30.465299606323242 43 17 10 6 10 2.244123176665767 30.48973768308489 0.038600921630859375 3 0.9752776565467696 7.832830657534894 16254.0 52.473543307086615 0.0 - - - - - - - 238.125 32 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1659 211 C20140707_OR006_02 C20140707_OR006_02 TB411834.[MT7]-IGYSSPLTLSDQSSK[MT7].3y6_1.heavy 624.338 / 795.396 4503.0 33.68299865722656 42 20 6 10 6 28.33362916554389 3.529374914019434 0.0 5 0.999049996068387 40.03734595060664 4503.0 19.24336515921324 0.0 - - - - - - - 202.28571428571428 9 7 ACSL4 acyl-CoA synthetase long-chain family member 4 1661 211 C20140707_OR006_02 C20140707_OR006_02 TB411834.[MT7]-IGYSSPLTLSDQSSK[MT7].3b5_1.heavy 624.338 / 652.342 4760.0 33.68299865722656 42 20 6 10 6 28.33362916554389 3.529374914019434 0.0 5 0.999049996068387 40.03734595060664 4760.0 5.614131608773918 0.0 - - - - - - - 312.42857142857144 9 7 ACSL4 acyl-CoA synthetase long-chain family member 4 1663 211 C20140707_OR006_02 C20140707_OR006_02 TB411834.[MT7]-IGYSSPLTLSDQSSK[MT7].3b7_1.heavy 624.338 / 862.479 2573.0 33.68299865722656 42 20 6 10 6 28.33362916554389 3.529374914019434 0.0 5 0.999049996068387 40.03734595060664 2573.0 3.7340937477336635 2.0 - - - - - - - 287.0 15 13 ACSL4 acyl-CoA synthetase long-chain family member 4 1665 211 C20140707_OR006_02 C20140707_OR006_02 TB411834.[MT7]-IGYSSPLTLSDQSSK[MT7].3y5_1.heavy 624.338 / 708.364 2444.0 33.68299865722656 42 20 6 10 6 28.33362916554389 3.529374914019434 0.0 5 0.999049996068387 40.03734595060664 2444.0 5.6730876704560105 1.0 - - - - - - - 280.6363636363636 6 11 ACSL4 acyl-CoA synthetase long-chain family member 4 1667 212 C20140707_OR006_02 C20140707_OR006_02 TB411986.[MT7]-LQAGEYVSLGK[MT7].3b6_1.heavy 484.948 / 806.417 1010.0 32.49610137939453 44 14 10 10 10 2.2788672936734886 34.277408606365725 0.0 3 0.9387423775071126 4.960665997777794 1010.0 -0.27867374831649344 3.0 - - - - - - - 236.875 3 8 ACSL3;ACSL4 acyl-CoA synthetase long-chain family member 3;acyl-CoA synthetase long-chain family member 4 1669 212 C20140707_OR006_02 C20140707_OR006_02 TB411986.[MT7]-LQAGEYVSLGK[MT7].3b4_1.heavy 484.948 / 514.311 2273.0 32.49610137939453 44 14 10 10 10 2.2788672936734886 34.277408606365725 0.0 3 0.9387423775071126 4.960665997777794 2273.0 7.824090348496021 0.0 - - - - - - - 234.42857142857142 4 7 ACSL3;ACSL4 acyl-CoA synthetase long-chain family member 3;acyl-CoA synthetase long-chain family member 4 1671 212 C20140707_OR006_02 C20140707_OR006_02 TB411986.[MT7]-LQAGEYVSLGK[MT7].3b5_1.heavy 484.948 / 643.353 5557.0 32.49610137939453 44 14 10 10 10 2.2788672936734886 34.277408606365725 0.0 3 0.9387423775071126 4.960665997777794 5557.0 28.790107489836696 0.0 - - - - - - - 238.66666666666666 11 9 ACSL3;ACSL4 acyl-CoA synthetase long-chain family member 3;acyl-CoA synthetase long-chain family member 4 1673 212 C20140707_OR006_02 C20140707_OR006_02 TB411986.[MT7]-LQAGEYVSLGK[MT7].3y4_1.heavy 484.948 / 548.352 6567.0 32.49610137939453 44 14 10 10 10 2.2788672936734886 34.277408606365725 0.0 3 0.9387423775071126 4.960665997777794 6567.0 20.49823963220411 0.0 - - - - - - - 266.77777777777777 13 9 ACSL3;ACSL4 acyl-CoA synthetase long-chain family member 3;acyl-CoA synthetase long-chain family member 4 1675 213 C20140707_OR006_02 C20140707_OR006_02 TB450255.[MT7]-SNHPEDLQAANR.3y7_1.heavy 499.251 / 787.406 4998.0 17.433799743652344 43 13 10 10 10 1.5540125733698067 45.487907508024676 0.0 3 0.917060003396731 4.255317301904706 4998.0 48.78048 0.0 - - - - - - - 108.3 9 10 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1677 213 C20140707_OR006_02 C20140707_OR006_02 TB450255.[MT7]-SNHPEDLQAANR.3y6_1.heavy 499.251 / 672.379 3582.0 17.433799743652344 43 13 10 10 10 1.5540125733698067 45.487907508024676 0.0 3 0.917060003396731 4.255317301904706 3582.0 92.49747428571429 0.0 - - - - - - - 128.8181818181818 7 11 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1679 213 C20140707_OR006_02 C20140707_OR006_02 TB450255.[MT7]-SNHPEDLQAANR.3y8_1.heavy 499.251 / 916.448 1958.0 17.433799743652344 43 13 10 10 10 1.5540125733698067 45.487907508024676 0.0 3 0.917060003396731 4.255317301904706 1958.0 68.34464716006885 0.0 - - - - - - - 225.0 3 5 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1681 213 C20140707_OR006_02 C20140707_OR006_02 TB450255.[MT7]-SNHPEDLQAANR.3y5_1.heavy 499.251 / 559.295 6831.0 17.433799743652344 43 13 10 10 10 1.5540125733698067 45.487907508024676 0.0 3 0.917060003396731 4.255317301904706 6831.0 59.38812341071282 0.0 - - - - - - - 170.16666666666666 13 12 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1683 214 C20140707_OR006_02 C20140707_OR006_02 TB437058.[MT7]-EFYYDEK[MT7].2y4_1.heavy 641.316 / 698.348 13976.0 28.498300552368164 43 13 10 10 10 1.5663509491854104 43.80037103096182 0.0 3 0.9242201243422249 4.454551066203584 13976.0 64.79439353099731 0.0 - - - - - - - 302.3333333333333 27 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1685 214 C20140707_OR006_02 C20140707_OR006_02 TB437058.[MT7]-EFYYDEK[MT7].2y3_1.heavy 641.316 / 535.284 9771.0 28.498300552368164 43 13 10 10 10 1.5663509491854104 43.80037103096182 0.0 3 0.9242201243422249 4.454551066203584 9771.0 11.039062937120084 0.0 - - - - - - - 688.7142857142857 19 7 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1687 214 C20140707_OR006_02 C20140707_OR006_02 TB437058.[MT7]-EFYYDEK[MT7].2y6_1.heavy 641.316 / 1008.48 24860.0 28.498300552368164 43 13 10 10 10 1.5663509491854104 43.80037103096182 0.0 3 0.9242201243422249 4.454551066203584 24860.0 161.03643724696357 0.0 - - - - - - - 229.71428571428572 49 7 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1689 214 C20140707_OR006_02 C20140707_OR006_02 TB437058.[MT7]-EFYYDEK[MT7].2b5_1.heavy 641.316 / 862.374 20408.0 28.498300552368164 43 13 10 10 10 1.5663509491854104 43.80037103096182 0.0 3 0.9242201243422249 4.454551066203584 20408.0 130.74998963300848 0.0 - - - - - - - 216.5 40 12 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1691 215 C20140707_OR006_02 C20140707_OR006_02 TB450517.[MT7]-VGTLDSLVGLSDELGK[MT7]LDTFAESLIR.4y8_1.heavy 759.923 / 936.515 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1693 215 C20140707_OR006_02 C20140707_OR006_02 TB450517.[MT7]-VGTLDSLVGLSDELGK[MT7]LDTFAESLIR.4b7_1.heavy 759.923 / 830.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1695 215 C20140707_OR006_02 C20140707_OR006_02 TB450517.[MT7]-VGTLDSLVGLSDELGK[MT7]LDTFAESLIR.4b5_1.heavy 759.923 / 630.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1697 215 C20140707_OR006_02 C20140707_OR006_02 TB450517.[MT7]-VGTLDSLVGLSDELGK[MT7]LDTFAESLIR.4b6_1.heavy 759.923 / 717.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1699 216 C20140707_OR006_02 C20140707_OR006_02 TB437440.[MT7]-LVLGK[MT7]PLGEGC[CAM]FGQVVR.3y7_1.heavy 706.41 / 865.435 351.0 36.99114990234375 19 8 2 5 4 0.824010273797264 79.27906678711788 0.04329681396484375 7 0.7608986461823171 2.471789755378627 351.0 2.4 26.0 - - - - - - - 210.6 2 10 FGFR4 fibroblast growth factor receptor 4 1701 216 C20140707_OR006_02 C20140707_OR006_02 TB437440.[MT7]-LVLGK[MT7]PLGEGC[CAM]FGQVVR.3y11_1.heavy 706.41 / 1221.6 585.0 36.99114990234375 19 8 2 5 4 0.824010273797264 79.27906678711788 0.04329681396484375 7 0.7608986461823171 2.471789755378627 585.0 2.5 9.0 - - - - - - - 0.0 1 0 FGFR4 fibroblast growth factor receptor 4 1703 216 C20140707_OR006_02 C20140707_OR006_02 TB437440.[MT7]-LVLGK[MT7]PLGEGC[CAM]FGQVVR.3y5_1.heavy 706.41 / 558.336 2107.0 36.99114990234375 19 8 2 5 4 0.824010273797264 79.27906678711788 0.04329681396484375 7 0.7608986461823171 2.471789755378627 2107.0 12.69602564102564 4.0 - - - - - - - 735.5714285714286 4 7 FGFR4 fibroblast growth factor receptor 4 1705 216 C20140707_OR006_02 C20140707_OR006_02 TB437440.[MT7]-LVLGK[MT7]PLGEGC[CAM]FGQVVR.3y10_1.heavy 706.41 / 1108.52 819.0 36.99114990234375 19 8 2 5 4 0.824010273797264 79.27906678711788 0.04329681396484375 7 0.7608986461823171 2.471789755378627 819.0 0.4999999999999999 12.0 - - - - - - - 307.125 9 8 FGFR4 fibroblast growth factor receptor 4 1707 217 C20140707_OR006_02 C20140707_OR006_02 TB412322.[MT7]-NPEMLWLWGELPQAAK[MT7].4y5_1.heavy 543.544 / 658.4 2982.0 49.08835029602051 33 8 10 5 10 0.4807797905940406 98.18762858534976 0.045902252197265625 3 0.7769086037633727 2.562682907475312 2982.0 5.856068303014791 0.0 - - - - - - - 167.71428571428572 5 7 LPIN1 lipin 1 1709 217 C20140707_OR006_02 C20140707_OR006_02 TB412322.[MT7]-NPEMLWLWGELPQAAK[MT7].4b4_1.heavy 543.544 / 616.288 533.0 49.08835029602051 33 8 10 5 10 0.4807797905940406 98.18762858534976 0.045902252197265625 3 0.7769086037633727 2.562682907475312 533.0 3.8285915492957745 0.0 - - - - - - - 0.0 1 0 LPIN1 lipin 1 1711 217 C20140707_OR006_02 C20140707_OR006_02 TB412322.[MT7]-NPEMLWLWGELPQAAK[MT7].4b5_1.heavy 543.544 / 729.372 1598.0 49.08835029602051 33 8 10 5 10 0.4807797905940406 98.18762858534976 0.045902252197265625 3 0.7769086037633727 2.562682907475312 1598.0 10.498597417840376 0.0 - - - - - - - 266.5 3 2 LPIN1 lipin 1 1713 217 C20140707_OR006_02 C20140707_OR006_02 TB412322.[MT7]-NPEMLWLWGELPQAAK[MT7].4b6_1.heavy 543.544 / 915.451 107.0 49.08835029602051 33 8 10 5 10 0.4807797905940406 98.18762858534976 0.045902252197265625 3 0.7769086037633727 2.562682907475312 107.0 0.7023474178403756 7.0 - - - - - - - 0.0 0 0 LPIN1 lipin 1 1715 218 C20140707_OR006_02 C20140707_OR006_02 TB436925.[MT7]-GNLAGLTLR.2y8_1.heavy 529.826 / 857.52 6285.0 32.86479949951172 42 15 9 10 8 9.76716154728955 10.238389066857467 0.0 4 0.9558782924334449 5.853644181928322 6285.0 22.52805194805195 0.0 - - - - - - - 208.5 12 8 CLSTN1 calsyntenin 1 1717 218 C20140707_OR006_02 C20140707_OR006_02 TB436925.[MT7]-GNLAGLTLR.2y5_1.heavy 529.826 / 559.356 5644.0 32.86479949951172 42 15 9 10 8 9.76716154728955 10.238389066857467 0.0 4 0.9558782924334449 5.853644181928322 5644.0 54.053211038961045 0.0 - - - - - - - 320.75 11 4 CLSTN1 calsyntenin 1 1719 218 C20140707_OR006_02 C20140707_OR006_02 TB436925.[MT7]-GNLAGLTLR.2y6_1.heavy 529.826 / 630.393 10775.0 32.86479949951172 42 15 9 10 8 9.76716154728955 10.238389066857467 0.0 4 0.9558782924334449 5.853644181928322 10775.0 13.951478590706088 1.0 - - - - - - - 304.75 25 8 CLSTN1 calsyntenin 1 1721 218 C20140707_OR006_02 C20140707_OR006_02 TB436925.[MT7]-GNLAGLTLR.2b5_1.heavy 529.826 / 557.316 4874.0 32.86479949951172 42 15 9 10 8 9.76716154728955 10.238389066857467 0.0 4 0.9558782924334449 5.853644181928322 4874.0 0.825943109987358 2.0 - - - - - - - 240.75 9 8 CLSTN1 calsyntenin 1 1723 219 C20140707_OR006_02 C20140707_OR006_02 TB436929.[MT7]-SMGNLFTR.2b4_1.heavy 535.283 / 534.246 17607.0 33.233001708984375 47 17 10 10 10 2.587939521032535 32.26021804726716 0.0 3 0.9741623639594597 7.6611933870027205 17607.0 40.769377691309984 0.0 - - - - - - - 257.375 35 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1725 219 C20140707_OR006_02 C20140707_OR006_02 TB436929.[MT7]-SMGNLFTR.2y6_1.heavy 535.283 / 707.383 12595.0 33.233001708984375 47 17 10 10 10 2.587939521032535 32.26021804726716 0.0 3 0.9741623639594597 7.6611933870027205 12595.0 78.63489082881394 0.0 - - - - - - - 206.0 25 5 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1727 219 C20140707_OR006_02 C20140707_OR006_02 TB436929.[MT7]-SMGNLFTR.2b5_1.heavy 535.283 / 647.33 16964.0 33.233001708984375 47 17 10 10 10 2.587939521032535 32.26021804726716 0.0 3 0.9741623639594597 7.6611933870027205 16964.0 124.09463035019456 0.0 - - - - - - - 214.33333333333334 33 3 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1729 219 C20140707_OR006_02 C20140707_OR006_02 TB436929.[MT7]-SMGNLFTR.2y7_1.heavy 535.283 / 838.424 22876.0 33.233001708984375 47 17 10 10 10 2.587939521032535 32.26021804726716 0.0 3 0.9741623639594597 7.6611933870027205 22876.0 160.22101167315174 0.0 - - - - - - - 193.0 45 4 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1731 220 C20140707_OR006_02 C20140707_OR006_02 TB436927.[MT7]-EIEREREEMAR.3b3_1.heavy 531.271 / 516.279 3204.0 19.8481502532959 37 14 10 5 8 1.2657177030336237 62.75181684531168 0.040500640869140625 4 0.9320012548950962 4.7056508113140225 3204.0 10.64642675306642 0.0 - - - - - - - 660.1428571428571 6 7 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1733 220 C20140707_OR006_02 C20140707_OR006_02 TB436927.[MT7]-EIEREREEMAR.3y4_1.heavy 531.271 / 506.239 1416.0 19.8481502532959 37 14 10 5 8 1.2657177030336237 62.75181684531168 0.040500640869140625 4 0.9320012548950962 4.7056508113140225 1416.0 11.833799137104506 0.0 - - - - - - - 215.55555555555554 2 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1735 220 C20140707_OR006_02 C20140707_OR006_02 TB436927.[MT7]-EIEREREEMAR.3y5_1.heavy 531.271 / 635.282 3800.0 19.8481502532959 37 14 10 5 8 1.2657177030336237 62.75181684531168 0.040500640869140625 4 0.9320012548950962 4.7056508113140225 3800.0 23.659266907589057 1.0 - - - - - - - 164.2 7 5 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1737 220 C20140707_OR006_02 C20140707_OR006_02 TB436927.[MT7]-EIEREREEMAR.3b8_2.heavy 531.271 / 608.308 1416.0 19.8481502532959 37 14 10 5 8 1.2657177030336237 62.75181684531168 0.040500640869140625 4 0.9320012548950962 4.7056508113140225 1416.0 12.259328859060403 1.0 - - - - - - - 186.4 3 10 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1739 221 C20140707_OR006_02 C20140707_OR006_02 TB437043.[MT7]-C[CAM]IHRDLAAR.2b8_1.heavy 628.344 / 1081.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR1;FGFR3;FGFR2;FGFR4;FLT1;FLT4;KDR fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor);fms-related tyrosine kinase 4;kinase insert domain receptor (a type III receptor tyrosine kinase) 1741 221 C20140707_OR006_02 C20140707_OR006_02 TB437043.[MT7]-C[CAM]IHRDLAAR.2b3_1.heavy 628.344 / 555.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR1;FGFR3;FGFR2;FGFR4;FLT1;FLT4;KDR fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor);fms-related tyrosine kinase 4;kinase insert domain receptor (a type III receptor tyrosine kinase) 1743 221 C20140707_OR006_02 C20140707_OR006_02 TB437043.[MT7]-C[CAM]IHRDLAAR.2y5_1.heavy 628.344 / 545.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR1;FGFR3;FGFR2;FGFR4;FLT1;FLT4;KDR fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor);fms-related tyrosine kinase 4;kinase insert domain receptor (a type III receptor tyrosine kinase) 1745 221 C20140707_OR006_02 C20140707_OR006_02 TB437043.[MT7]-C[CAM]IHRDLAAR.2b5_1.heavy 628.344 / 826.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR1;FGFR3;FGFR2;FGFR4;FLT1;FLT4;KDR fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor);fms-related tyrosine kinase 4;kinase insert domain receptor (a type III receptor tyrosine kinase) 1747 222 C20140707_OR006_02 C20140707_OR006_02 TB437244.[MT7]-AMNIVVPFMFK[MT7].3y3_1.heavy 528.968 / 569.324 8247.0 47.85204887390137 40 15 10 5 10 1.5502348894450155 43.00423575844907 0.041698455810546875 3 0.9538062366056105 5.719848785787547 8247.0 102.71263636363635 0.0 - - - - - - - 165.0 16 6 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1749 222 C20140707_OR006_02 C20140707_OR006_02 TB437244.[MT7]-AMNIVVPFMFK[MT7].3b5_1.heavy 528.968 / 673.382 10336.0 47.85204887390137 40 15 10 5 10 1.5502348894450155 43.00423575844907 0.041698455810546875 3 0.9538062366056105 5.719848785787547 10336.0 135.07272727272726 0.0 - - - - - - - 242.0 20 5 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1751 222 C20140707_OR006_02 C20140707_OR006_02 TB437244.[MT7]-AMNIVVPFMFK[MT7].3y4_1.heavy 528.968 / 716.392 4288.0 47.85204887390137 40 15 10 5 10 1.5502348894450155 43.00423575844907 0.041698455810546875 3 0.9538062366056105 5.719848785787547 4288.0 77.184 0.0 - - - - - - - 110.0 8 1 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1753 222 C20140707_OR006_02 C20140707_OR006_02 TB437244.[MT7]-AMNIVVPFMFK[MT7].3y5_1.heavy 528.968 / 813.445 5608.0 47.85204887390137 40 15 10 5 10 1.5502348894450155 43.00423575844907 0.041698455810546875 3 0.9538062366056105 5.719848785787547 5608.0 63.217454545454544 0.0 - - - - - - - 286.0 11 5 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1755 223 C20140707_OR006_02 C20140707_OR006_02 TB436921.[MT7]-ATVESIMR.2y4_1.heavy 525.79 / 506.276 7207.0 29.644100189208984 44 14 10 10 10 2.0849582064956955 38.96257299919772 0.0 3 0.9485987228185059 5.419975924411598 7207.0 17.56941091867921 0.0 - - - - - - - 632.375 14 8 LPIN1 lipin 1 1757 223 C20140707_OR006_02 C20140707_OR006_02 TB436921.[MT7]-ATVESIMR.2y5_1.heavy 525.79 / 635.318 3667.0 29.644100189208984 44 14 10 10 10 2.0849582064956955 38.96257299919772 0.0 3 0.9485987228185059 5.419975924411598 3667.0 6.868508512958731 1.0 - - - - - - - 189.5 9 8 LPIN1 lipin 1 1759 223 C20140707_OR006_02 C20140707_OR006_02 TB436921.[MT7]-ATVESIMR.2b4_1.heavy 525.79 / 545.305 5058.0 29.644100189208984 44 14 10 10 10 2.0849582064956955 38.96257299919772 0.0 3 0.9485987228185059 5.419975924411598 5058.0 16.211004202863787 0.0 - - - - - - - 206.63636363636363 10 11 LPIN1 lipin 1 1761 223 C20140707_OR006_02 C20140707_OR006_02 TB436921.[MT7]-ATVESIMR.2y7_1.heavy 525.79 / 835.434 6449.0 29.644100189208984 44 14 10 10 10 2.0849582064956955 38.96257299919772 0.0 3 0.9485987228185059 5.419975924411598 6449.0 6.597364953886694 1.0 - - - - - - - 224.66666666666666 12 9 LPIN1 lipin 1 1763 224 C20140707_OR006_02 C20140707_OR006_02 TB437382.[MT7]-IHGQNVPFDAVVVDK[MT7].4y4_1.heavy 482.273 / 604.379 10878.0 33.27510070800781 41 11 10 10 10 1.5171739431308822 52.16641147963617 0.0 3 0.8592663863165079 3.2503742810327494 10878.0 68.214125 0.0 - - - - - - - 227.55555555555554 21 9 CLSTN1 calsyntenin 1 1765 224 C20140707_OR006_02 C20140707_OR006_02 TB437382.[MT7]-IHGQNVPFDAVVVDK[MT7].4b5_1.heavy 482.273 / 694.375 7679.0 33.27510070800781 41 11 10 10 10 1.5171739431308822 52.16641147963617 0.0 3 0.8592663863165079 3.2503742810327494 7679.0 45.99401041666667 0.0 - - - - - - - 256.0 15 7 CLSTN1 calsyntenin 1 1767 224 C20140707_OR006_02 C20140707_OR006_02 TB437382.[MT7]-IHGQNVPFDAVVVDK[MT7].4y3_1.heavy 482.273 / 505.31 21885.0 33.27510070800781 41 11 10 10 10 1.5171739431308822 52.16641147963617 0.0 3 0.8592663863165079 3.2503742810327494 21885.0 111.24875 0.0 - - - - - - - 270.22222222222223 43 9 CLSTN1 calsyntenin 1 1769 224 C20140707_OR006_02 C20140707_OR006_02 TB437382.[MT7]-IHGQNVPFDAVVVDK[MT7].4b6_1.heavy 482.273 / 793.444 11646.0 33.27510070800781 41 11 10 10 10 1.5171739431308822 52.16641147963617 0.0 3 0.8592663863165079 3.2503742810327494 11646.0 131.01749999999998 0.0 - - - - - - - 170.66666666666666 23 6 CLSTN1 calsyntenin 1 1771 225 C20140707_OR006_02 C20140707_OR006_02 TB437248.[MT7]-VLSGISFEVPAGK[MT7].2b8_1.heavy 796.469 / 977.542 1592.0 39.55602550506592 33 14 10 3 6 1.1815581210477066 53.83172208388025 0.073699951171875 5 0.9410249190315455 5.0567357337696 1592.0 2.8 1.0 - - - - - - - 243.44444444444446 3 18 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1773 225 C20140707_OR006_02 C20140707_OR006_02 TB437248.[MT7]-VLSGISFEVPAGK[MT7].2y4_1.heavy 796.469 / 516.326 4479.0 39.55602550506592 33 14 10 3 6 1.1815581210477066 53.83172208388025 0.073699951171875 5 0.9410249190315455 5.0567357337696 4479.0 4.206609146832806 0.0 - - - - - - - 242.8125 8 16 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1775 225 C20140707_OR006_02 C20140707_OR006_02 TB437248.[MT7]-VLSGISFEVPAGK[MT7].2y8_1.heavy 796.469 / 978.538 2190.0 39.55602550506592 33 14 10 3 6 1.1815581210477066 53.83172208388025 0.073699951171875 5 0.9410249190315455 5.0567357337696 2190.0 5.752261306532663 3.0 - - - - - - - 253.54545454545453 7 11 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1777 225 C20140707_OR006_02 C20140707_OR006_02 TB437248.[MT7]-VLSGISFEVPAGK[MT7].2b4_1.heavy 796.469 / 501.315 896.0 39.55602550506592 33 14 10 3 6 1.1815581210477066 53.83172208388025 0.073699951171875 5 0.9410249190315455 5.0567357337696 896.0 2.1949748743718596 11.0 - - - - - - - 739.4285714285714 3 7 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1779 226 C20140707_OR006_02 C20140707_OR006_02 TB437249.[MT7]-VLSGISFEVPAGK[MT7].3b6_1.heavy 531.315 / 701.431 3588.0 39.47760136922201 36 13 10 3 10 1.917079198774565 52.162685852479115 0.07619857788085938 3 0.9203393931750145 4.343246687006701 3588.0 28.6486432160804 0.0 - - - - - - - 226.36363636363637 7 11 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1781 226 C20140707_OR006_02 C20140707_OR006_02 TB437249.[MT7]-VLSGISFEVPAGK[MT7].3b4_1.heavy 531.315 / 501.315 42858.0 39.47760136922201 36 13 10 3 10 1.917079198774565 52.162685852479115 0.07619857788085938 3 0.9203393931750145 4.343246687006701 42858.0 136.09923411371238 0.0 - - - - - - - 308.8 85 10 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1783 226 C20140707_OR006_02 C20140707_OR006_02 TB437249.[MT7]-VLSGISFEVPAGK[MT7].3b5_1.heavy 531.315 / 614.399 9070.0 39.47760136922201 36 13 10 3 10 1.917079198774565 52.162685852479115 0.07619857788085938 3 0.9203393931750145 4.343246687006701 9070.0 7.687562688064194 1.0 - - - - - - - 341.57142857142856 18 7 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1785 226 C20140707_OR006_02 C20140707_OR006_02 TB437249.[MT7]-VLSGISFEVPAGK[MT7].3y4_1.heavy 531.315 / 516.326 N/A 39.47760136922201 36 13 10 3 10 1.917079198774565 52.162685852479115 0.07619857788085938 3 0.9203393931750145 4.343246687006701 22226.0 140.1849961843602 0.0 - - - - - - - 257.4166666666667 44 12 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1787 227 C20140707_OR006_02 C20140707_OR006_02 TB411729.[MT7]-MEC[CAM]QLK[MT7].2b3_1.heavy 548.79 / 565.223 2578.0 22.98282527923584 42 16 10 6 10 28.492878632159588 3.509648894763871 0.037700653076171875 3 0.9616795992587432 6.284209279398516 2578.0 14.01086956521739 0.0 - - - - - - - 192.36363636363637 5 11 LPIN1 lipin 1 1789 227 C20140707_OR006_02 C20140707_OR006_02 TB411729.[MT7]-MEC[CAM]QLK[MT7].2y4_1.heavy 548.79 / 692.388 3223.0 22.98282527923584 42 16 10 6 10 28.492878632159588 3.509648894763871 0.037700653076171875 3 0.9616795992587432 6.284209279398516 3223.0 39.06135869565217 0.0 - - - - - - - 184.0 6 9 LPIN1 lipin 1 1791 227 C20140707_OR006_02 C20140707_OR006_02 TB411729.[MT7]-MEC[CAM]QLK[MT7].2y5_1.heavy 548.79 / 821.431 4512.0 22.98282527923584 42 16 10 6 10 28.492878632159588 3.509648894763871 0.037700653076171875 3 0.9616795992587432 6.284209279398516 4512.0 49.531693881566 0.0 - - - - - - - 249.71428571428572 9 7 LPIN1 lipin 1 1793 227 C20140707_OR006_02 C20140707_OR006_02 TB411729.[MT7]-MEC[CAM]QLK[MT7].2b4_1.heavy 548.79 / 693.282 1289.0 22.98282527923584 42 16 10 6 10 28.492878632159588 3.509648894763871 0.037700653076171875 3 0.9616795992587432 6.284209279398516 1289.0 12.188391634801492 2.0 - - - - - - - 119.6 2 10 LPIN1 lipin 1 1795 228 C20140707_OR006_02 C20140707_OR006_02 TB449980.[MT7]-LPDAYER.2y4_1.heavy 504.268 / 538.262 16924.0 26.386499404907227 45 20 10 5 10 11.613992555545064 8.610303435424136 0.0447998046875 3 0.9988764029947022 36.8142884272339 16924.0 48.67343145116908 0.0 - - - - - - - 208.71428571428572 33 7 G6PD glucose-6-phosphate dehydrogenase 1797 228 C20140707_OR006_02 C20140707_OR006_02 TB449980.[MT7]-LPDAYER.2y5_1.heavy 504.268 / 653.289 1880.0 26.386499404907227 45 20 10 5 10 11.613992555545064 8.610303435424136 0.0447998046875 3 0.9988764029947022 36.8142884272339 1880.0 9.908641894501208 0.0 - - - - - - - 240.2 3 10 G6PD glucose-6-phosphate dehydrogenase 1799 228 C20140707_OR006_02 C20140707_OR006_02 TB449980.[MT7]-LPDAYER.2b4_1.heavy 504.268 / 541.31 1254.0 26.386499404907227 45 20 10 5 10 11.613992555545064 8.610303435424136 0.0447998046875 3 0.9988764029947022 36.8142884272339 1254.0 2.99 3.0 - - - - - - - 355.2 2 5 G6PD glucose-6-phosphate dehydrogenase 1801 228 C20140707_OR006_02 C20140707_OR006_02 TB449980.[MT7]-LPDAYER.2y6_1.heavy 504.268 / 750.342 27266.0 26.386499404907227 45 20 10 5 10 11.613992555545064 8.610303435424136 0.0447998046875 3 0.9988764029947022 36.8142884272339 27266.0 261.7217733359745 1.0 - - - - - - - 161.27272727272728 57 11 G6PD glucose-6-phosphate dehydrogenase 1803 229 C20140707_OR006_02 C20140707_OR006_02 TB411598.[MT7]-VMNLWEK[MT7].3y3_1.heavy 403.23 / 606.337 2644.0 36.52539825439453 46 16 10 10 10 3.055663146412268 32.72612038974667 0.0 3 0.960356522934177 6.177762554921018 2644.0 13.63968253968254 0.0 - - - - - - - 220.5 5 4 DNTT deoxynucleotidyltransferase, terminal 1805 229 C20140707_OR006_02 C20140707_OR006_02 TB411598.[MT7]-VMNLWEK[MT7].3b4_1.heavy 403.23 / 602.345 3777.0 36.52539825439453 46 16 10 10 10 3.055663146412268 32.72612038974667 0.0 3 0.960356522934177 6.177762554921018 3777.0 14.356603560538321 1.0 - - - - - - - 189.0 8 4 DNTT deoxynucleotidyltransferase, terminal 1807 229 C20140707_OR006_02 C20140707_OR006_02 TB411598.[MT7]-VMNLWEK[MT7].3b3_1.heavy 403.23 / 489.261 6546.0 36.52539825439453 46 16 10 10 10 3.055663146412268 32.72612038974667 0.0 3 0.960356522934177 6.177762554921018 6546.0 37.53559523809523 0.0 - - - - - - - 147.0 13 6 DNTT deoxynucleotidyltransferase, terminal 1809 230 C20140707_OR006_02 C20140707_OR006_02 TB411999.[MT7]-DTEGIPC[CAM]LGSK[MT7].2y4_1.heavy 732.884 / 548.352 2277.0 29.833250045776367 38 13 10 5 10 1.2221679554220966 57.97113419282588 0.041900634765625 3 0.924985984647185 4.47752673844921 2277.0 3.5999999999999996 0.0 - - - - - - - 189.5 4 6 DNTT deoxynucleotidyltransferase, terminal 1811 230 C20140707_OR006_02 C20140707_OR006_02 TB411999.[MT7]-DTEGIPC[CAM]LGSK[MT7].2b4_1.heavy 732.884 / 547.248 5439.0 29.833250045776367 38 13 10 5 10 1.2221679554220966 57.97113419282588 0.041900634765625 3 0.924985984647185 4.47752673844921 5439.0 14.045611839978307 1.0 - - - - - - - 227.4 10 5 DNTT deoxynucleotidyltransferase, terminal 1813 230 C20140707_OR006_02 C20140707_OR006_02 TB411999.[MT7]-DTEGIPC[CAM]LGSK[MT7].2y6_1.heavy 732.884 / 805.436 6704.0 29.833250045776367 38 13 10 5 10 1.2221679554220966 57.97113419282588 0.041900634765625 3 0.924985984647185 4.47752673844921 6704.0 26.81613408234644 1.0 - - - - - - - 227.4 13 5 DNTT deoxynucleotidyltransferase, terminal 1815 230 C20140707_OR006_02 C20140707_OR006_02 TB411999.[MT7]-DTEGIPC[CAM]LGSK[MT7].2b5_1.heavy 732.884 / 660.332 5692.0 29.833250045776367 38 13 10 5 10 1.2221679554220966 57.97113419282588 0.041900634765625 3 0.924985984647185 4.47752673844921 5692.0 5.4690529432896 1.0 - - - - - - - 168.33333333333334 11 3 DNTT deoxynucleotidyltransferase, terminal 1817 231 C20140707_OR006_02 C20140707_OR006_02 TB450268.[MT7]-SSEGPLSFPVLVSC[CAM]AYQVAR.3b6_1.heavy 771.067 / 715.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1819 231 C20140707_OR006_02 C20140707_OR006_02 TB450268.[MT7]-SSEGPLSFPVLVSC[CAM]AYQVAR.3b4_1.heavy 771.067 / 505.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1821 231 C20140707_OR006_02 C20140707_OR006_02 TB450268.[MT7]-SSEGPLSFPVLVSC[CAM]AYQVAR.3y8_1.heavy 771.067 / 954.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1823 231 C20140707_OR006_02 C20140707_OR006_02 TB450268.[MT7]-SSEGPLSFPVLVSC[CAM]AYQVAR.3y9_1.heavy 771.067 / 1053.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGFR4 fibroblast growth factor receptor 4 1825 232 C20140707_OR006_02 C20140707_OR006_02 TB437049.[MT7]-GRIEYLVK[MT7].2b4_1.heavy 633.395 / 600.359 1719.0 27.862899780273438 39 16 10 5 8 4.014435718087971 19.86669355463341 0.04560089111328125 4 0.9640487386552912 6.489265190363867 1719.0 2.909224103632833 5.0 - - - - - - - 334.90909090909093 3 11 CBX6 chromobox homolog 6 1827 232 C20140707_OR006_02 C20140707_OR006_02 TB437049.[MT7]-GRIEYLVK[MT7].2b6_1.heavy 633.395 / 876.506 1105.0 27.862899780273438 39 16 10 5 8 4.014435718087971 19.86669355463341 0.04560089111328125 4 0.9640487386552912 6.489265190363867 1105.0 4.950704307978394 2.0 - - - - - - - 307.0 2 4 CBX6 chromobox homolog 6 1829 232 C20140707_OR006_02 C20140707_OR006_02 TB437049.[MT7]-GRIEYLVK[MT7].2b7_1.heavy 633.395 / 975.574 1474.0 27.862899780273438 39 16 10 5 8 4.014435718087971 19.86669355463341 0.04560089111328125 4 0.9640487386552912 6.489265190363867 1474.0 6.128315217391304 0.0 - - - - - - - 279.1818181818182 2 11 CBX6 chromobox homolog 6 1831 232 C20140707_OR006_02 C20140707_OR006_02 TB437049.[MT7]-GRIEYLVK[MT7].2b5_1.heavy 633.395 / 763.422 614.0 27.862899780273438 39 16 10 5 8 4.014435718087971 19.86669355463341 0.04560089111328125 4 0.9640487386552912 6.489265190363867 614.0 1.349796472184532 15.0 - - - - - - - 0.0 1 0 CBX6 chromobox homolog 6 1833 233 C20140707_OR006_02 C20140707_OR006_02 TB449979.[MT7]-IADFGLAR.2y5_1.heavy 503.794 / 563.33 30999.0 34.78770065307617 48 20 10 10 8 10.589474549635698 9.443339188481286 0.0 4 0.9966750327258632 21.396772751439556 30999.0 149.67925283171056 0.0 - - - - - - - 237.14285714285714 61 7 FGFR1;FGFR3;FGFR2;FGFR4;FGR;ICK;CDK20;FYN;HCK;LCK;LYN;MAK;BLK;YES1 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;intestinal cell (MAK-like) kinase;cyclin-dependent kinase 20;FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;lymphocyte-specific protein tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;male germ cell-associated kinase;B lymphoid tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 1835 233 C20140707_OR006_02 C20140707_OR006_02 TB449979.[MT7]-IADFGLAR.2y6_1.heavy 503.794 / 678.357 5485.0 34.78770065307617 48 20 10 10 8 10.589474549635698 9.443339188481286 0.0 4 0.9966750327258632 21.396772751439556 5485.0 16.45305030393077 0.0 - - - - - - - 255.2 10 5 FGFR1;FGFR3;FGFR2;FGFR4;FGR;ICK;CDK20;FYN;HCK;LCK;LYN;MAK;BLK;YES1 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;intestinal cell (MAK-like) kinase;cyclin-dependent kinase 20;FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;lymphocyte-specific protein tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;male germ cell-associated kinase;B lymphoid tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 1837 233 C20140707_OR006_02 C20140707_OR006_02 TB449979.[MT7]-IADFGLAR.2b5_1.heavy 503.794 / 648.347 5996.0 34.78770065307617 48 20 10 10 8 10.589474549635698 9.443339188481286 0.0 4 0.9966750327258632 21.396772751439556 5996.0 24.583565646561954 1.0 - - - - - - - 280.8 21 5 FGFR1;FGFR3;FGFR2;FGFR4;FGR;ICK;CDK20;FYN;HCK;LCK;LYN;MAK;BLK;YES1 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;intestinal cell (MAK-like) kinase;cyclin-dependent kinase 20;FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;lymphocyte-specific protein tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;male germ cell-associated kinase;B lymphoid tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 1839 233 C20140707_OR006_02 C20140707_OR006_02 TB449979.[MT7]-IADFGLAR.2y7_1.heavy 503.794 / 749.394 16967.0 34.78770065307617 48 20 10 10 8 10.589474549635698 9.443339188481286 0.0 4 0.9966750327258632 21.396772751439556 16967.0 9.33487881574793 1.0 - - - - - - - 383.0 37 1 FGFR1;FGFR3;FGFR2;FGFR4;FGR;ICK;CDK20;FYN;HCK;LCK;LYN;MAK;BLK;YES1 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 2;fibroblast growth factor receptor 4;Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog;intestinal cell (MAK-like) kinase;cyclin-dependent kinase 20;FYN oncogene related to SRC, FGR, YES;hemopoietic cell kinase;lymphocyte-specific protein tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral related oncogene homolog;male germ cell-associated kinase;B lymphoid tyrosine kinase;v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 1841 234 C20140707_OR006_02 C20140707_OR006_02 TB412233.[MT7]-IHGQNVPFDAVVVDK[MT7].3y3_1.heavy 642.694 / 505.31 61945.0 33.29570007324219 38 13 10 5 10 1.7002818296768176 40.87858144674195 0.04119873046875 3 0.9187971485794975 4.301234730641607 61945.0 132.615664216858 0.0 - - - - - - - 642.6666666666666 123 9 CLSTN1 calsyntenin 1 1843 234 C20140707_OR006_02 C20140707_OR006_02 TB412233.[MT7]-IHGQNVPFDAVVVDK[MT7].3b6_1.heavy 642.694 / 793.444 51278.0 33.29570007324219 38 13 10 5 10 1.7002818296768176 40.87858144674195 0.04119873046875 3 0.9187971485794975 4.301234730641607 51278.0 152.96939040207525 0.0 - - - - - - - 610.5 102 8 CLSTN1 calsyntenin 1 1845 234 C20140707_OR006_02 C20140707_OR006_02 TB412233.[MT7]-IHGQNVPFDAVVVDK[MT7].3b5_1.heavy 642.694 / 694.375 37270.0 33.29570007324219 38 13 10 5 10 1.7002818296768176 40.87858144674195 0.04119873046875 3 0.9187971485794975 4.301234730641607 37270.0 111.68431647211413 0.0 - - - - - - - 661.0 74 7 CLSTN1 calsyntenin 1 1847 234 C20140707_OR006_02 C20140707_OR006_02 TB412233.[MT7]-IHGQNVPFDAVVVDK[MT7].3y4_1.heavy 642.694 / 604.379 74668.0 33.29570007324219 38 13 10 5 10 1.7002818296768176 40.87858144674195 0.04119873046875 3 0.9187971485794975 4.301234730641607 74668.0 255.95175912492806 0.0 - - - - - - - 679.4285714285714 149 7 CLSTN1 calsyntenin 1 1849 235 C20140707_OR006_02 C20140707_OR006_02 TB412231.[MT7]-RNDFQLIGIQDGYLSLLQDSGEVR.3b5_1.heavy 960.837 / 805.407 451.0 46.964900970458984 40 10 10 10 10 1.259034039831969 49.125122767138876 0.0 3 0.8488598163154347 3.133604922777403 451.0 4.260375975284076 17.0 - - - - - - - 0.0 1 0 EIF5A eukaryotic translation initiation factor 5A 1851 235 C20140707_OR006_02 C20140707_OR006_02 TB412231.[MT7]-RNDFQLIGIQDGYLSLLQDSGEVR.3b3_1.heavy 960.837 / 530.28 2367.0 46.964900970458984 40 10 10 10 10 1.259034039831969 49.125122767138876 0.0 3 0.8488598163154347 3.133604922777403 2367.0 11.86799171597633 0.0 - - - - - - - 273.7142857142857 4 7 EIF5A eukaryotic translation initiation factor 5A 1853 235 C20140707_OR006_02 C20140707_OR006_02 TB412231.[MT7]-RNDFQLIGIQDGYLSLLQDSGEVR.3y5_1.heavy 960.837 / 547.284 2029.0 46.964900970458984 40 10 10 10 10 1.259034039831969 49.125122767138876 0.0 3 0.8488598163154347 3.133604922777403 2029.0 6.009051123586671 0.0 - - - - - - - 253.58333333333334 4 12 EIF5A eukaryotic translation initiation factor 5A 1855 235 C20140707_OR006_02 C20140707_OR006_02 TB412231.[MT7]-RNDFQLIGIQDGYLSLLQDSGEVR.3y10_1.heavy 960.837 / 1103.57 4621.0 46.964900970458984 40 10 10 10 10 1.259034039831969 49.125122767138876 0.0 3 0.8488598163154347 3.133604922777403 4621.0 24.363394608809994 0.0 - - - - - - - 242.53846153846155 9 13 EIF5A eukaryotic translation initiation factor 5A 1857 236 C20140707_OR006_02 C20140707_OR006_02 TB412378.[MT7]-EAVWAFLPDAFVTMTGGFRR.3b6_1.heavy 805.752 / 848.442 1701.0 53.948150634765625 40 13 10 7 10 1.0591697080626332 56.78457859986123 0.028900146484375 3 0.9210732275687684 4.36366585380843 1701.0 51.03 0.0 - - - - - - - 150.0 3 13 DNTT deoxynucleotidyltransferase, terminal 1859 236 C20140707_OR006_02 C20140707_OR006_02 TB412378.[MT7]-EAVWAFLPDAFVTMTGGFRR.3y11_2.heavy 805.752 / 621.824 2452.0 53.948150634765625 40 13 10 7 10 1.0591697080626332 56.78457859986123 0.028900146484375 3 0.9210732275687684 4.36366585380843 2452.0 43.87120518358532 1.0 - - - - - - - 143.75 4 8 DNTT deoxynucleotidyltransferase, terminal 1861 236 C20140707_OR006_02 C20140707_OR006_02 TB412378.[MT7]-EAVWAFLPDAFVTMTGGFRR.3b4_1.heavy 805.752 / 630.337 1351.0 53.948150634765625 40 13 10 7 10 1.0591697080626332 56.78457859986123 0.028900146484375 3 0.9210732275687684 4.36366585380843 1351.0 5.104110987791342 1.0 - - - - - - - 120.0 2 10 DNTT deoxynucleotidyltransferase, terminal 1863 236 C20140707_OR006_02 C20140707_OR006_02 TB412378.[MT7]-EAVWAFLPDAFVTMTGGFRR.3b5_1.heavy 805.752 / 701.374 2202.0 53.948150634765625 40 13 10 7 10 1.0591697080626332 56.78457859986123 0.028900146484375 3 0.9210732275687684 4.36366585380843 2202.0 34.2044 0.0 - - - - - - - 125.0 4 14 DNTT deoxynucleotidyltransferase, terminal 1865 237 C20140707_OR006_02 C20140707_OR006_02 TB412131.[MT7]-FRC[CAM]PAAGNPTPTIR.3y6_1.heavy 567.971 / 684.404 57705.0 26.128400802612305 45 15 10 10 10 2.1774828838166314 36.60103099646714 0.0 3 0.9553125325215737 5.816192730025564 57705.0 236.21377902177278 0.0 - - - - - - - 220.0 115 6 FGFR4 fibroblast growth factor receptor 4 1867 237 C20140707_OR006_02 C20140707_OR006_02 TB412131.[MT7]-FRC[CAM]PAAGNPTPTIR.3b8_1.heavy 567.971 / 1018.5 33258.0 26.128400802612305 45 15 10 10 10 2.1774828838166314 36.60103099646714 0.0 3 0.9553125325215737 5.816192730025564 33258.0 117.87019293418447 0.0 - - - - - - - 251.42857142857142 66 7 FGFR4 fibroblast growth factor receptor 4 1869 237 C20140707_OR006_02 C20140707_OR006_02 TB412131.[MT7]-FRC[CAM]PAAGNPTPTIR.3b7_1.heavy 567.971 / 904.458 11343.0 26.128400802612305 45 15 10 10 10 2.1774828838166314 36.60103099646714 0.0 3 0.9553125325215737 5.816192730025564 11343.0 27.29818181818182 1.0 - - - - - - - 233.75 22 8 FGFR4 fibroblast growth factor receptor 4 1871 237 C20140707_OR006_02 C20140707_OR006_02 TB412131.[MT7]-FRC[CAM]PAAGNPTPTIR.3b8_2.heavy 567.971 / 509.754 50987.0 26.128400802612305 45 15 10 10 10 2.1774828838166314 36.60103099646714 0.0 3 0.9553125325215737 5.816192730025564 50987.0 28.288588761542744 1.0 - - - - - - - 220.0 104 4 FGFR4 fibroblast growth factor receptor 4 1873 238 C20140707_OR006_02 C20140707_OR006_02 TB412138.[MT7]-K[MT7]LQEEIVNSVK[MT7].4y4_1.heavy 430.515 / 591.358 504.0 30.825466791788738 14 7 0 5 2 0.9127232778220531 66.17875574535088 0.04089927673339844 11 0.7291362840297053 2.3155670787453237 504.0 3.7199999999999998 6.0 - - - - - - - 189.0 2 4 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1875 238 C20140707_OR006_02 C20140707_OR006_02 TB412138.[MT7]-K[MT7]LQEEIVNSVK[MT7].4b5_2.heavy 430.515 / 458.771 1764.0 30.825466791788738 14 7 0 5 2 0.9127232778220531 66.17875574535088 0.04089927673339844 11 0.7291362840297053 2.3155670787453237 1764.0 7.242666666666667 5.0 - - - - - - - 210.0 30 3 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1877 238 C20140707_OR006_02 C20140707_OR006_02 TB412138.[MT7]-K[MT7]LQEEIVNSVK[MT7].4b5_1.heavy 430.515 / 916.534 N/A 30.825466791788738 14 7 0 5 2 0.9127232778220531 66.17875574535088 0.04089927673339844 11 0.7291362840297053 2.3155670787453237 0.0 0.0 7.0 - - - - - - - 0.0 0 0 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1879 238 C20140707_OR006_02 C20140707_OR006_02 TB412138.[MT7]-K[MT7]LQEEIVNSVK[MT7].4b6_2.heavy 430.515 / 515.313 4409.0 30.825466791788738 14 7 0 5 2 0.9127232778220531 66.17875574535088 0.04089927673339844 11 0.7291362840297053 2.3155670787453237 4409.0 19.24563492063492 2.0 - - - - - - - 283.5 274 8 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 1881 239 C20140707_OR006_02 C20140707_OR006_02 TB437230.[MT7]-NVLVTEDNVMK[MT7].2y4_1.heavy 775.429 / 635.367 2642.0 31.262399673461914 44 14 10 10 10 1.7765335802419948 40.66686945239184 0.0 3 0.9371987061662375 4.898674560647293 2642.0 37.74285714285715 0.0 - - - - - - - 176.4 5 5 FGFR1;FGFR3;FGFR4 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1883 239 C20140707_OR006_02 C20140707_OR006_02 TB437230.[MT7]-NVLVTEDNVMK[MT7].2y8_1.heavy 775.429 / 1079.55 6039.0 31.262399673461914 44 14 10 10 10 1.7765335802419948 40.66686945239184 0.0 3 0.9371987061662375 4.898674560647293 6039.0 22.451153081510935 0.0 - - - - - - - 220.25 12 4 FGFR1;FGFR3;FGFR4 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1885 239 C20140707_OR006_02 C20140707_OR006_02 TB437230.[MT7]-NVLVTEDNVMK[MT7].2b4_1.heavy 775.429 / 570.373 6290.0 31.262399673461914 44 14 10 10 10 1.7765335802419948 40.66686945239184 0.0 3 0.9371987061662375 4.898674560647293 6290.0 56.454014567807675 0.0 - - - - - - - 179.85714285714286 12 7 FGFR1;FGFR3;FGFR4 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1887 239 C20140707_OR006_02 C20140707_OR006_02 TB437230.[MT7]-NVLVTEDNVMK[MT7].2y7_1.heavy 775.429 / 980.484 5284.0 31.262399673461914 44 14 10 10 10 1.7765335802419948 40.66686945239184 0.0 3 0.9371987061662375 4.898674560647293 5284.0 33.36659014046261 1.0 - - - - - - - 176.4 11 5 FGFR1;FGFR3;FGFR4 fibroblast growth factor receptor 1;fibroblast growth factor receptor 3;fibroblast growth factor receptor 4 1889 240 C20140707_OR006_02 C20140707_OR006_02 TB437335.[MT7]-VPSTDITFRPTRK[MT7].4y4_1.heavy 452.267 / 645.416 1063.0 27.261399745941162 35 14 10 5 6 28.09945557385241 3.5587878112860563 0.04360008239746094 5 0.9405782137733837 5.037501088075675 1063.0 3.0778954802259886 3.0 - - - - - - - 206.5 2 8 NLGN1 neuroligin 1 1891 240 C20140707_OR006_02 C20140707_OR006_02 TB437335.[MT7]-VPSTDITFRPTRK[MT7].4y8_2.heavy 452.267 / 581.862 1417.0 27.261399745941162 35 14 10 5 6 28.09945557385241 3.5587878112860563 0.04360008239746094 5 0.9405782137733837 5.037501088075675 1417.0 3.7871677800474792 1.0 - - - - - - - 255.66666666666666 3 6 NLGN1 neuroligin 1 1893 240 C20140707_OR006_02 C20140707_OR006_02 TB437335.[MT7]-VPSTDITFRPTRK[MT7].4y10_2.heavy 452.267 / 689.9 1181.0 27.261399745941162 35 14 10 5 6 28.09945557385241 3.5587878112860563 0.04360008239746094 5 0.9405782137733837 5.037501088075675 1181.0 9.674741038001027 1.0 - - - - - - - 259.6 2 5 NLGN1 neuroligin 1 1895 240 C20140707_OR006_02 C20140707_OR006_02 TB437335.[MT7]-VPSTDITFRPTRK[MT7].4y11_2.heavy 452.267 / 733.416 3778.0 27.261399745941162 35 14 10 5 6 28.09945557385241 3.5587878112860563 0.04360008239746094 5 0.9405782137733837 5.037501088075675 3778.0 26.97427966101695 0.0 - - - - - - - 219.14285714285714 7 7 NLGN1 neuroligin 1 1897 241 C20140707_OR006_02 C20140707_OR006_02 TB412139.[MT7]-RDYSDSTNPGPPK[MT7].4b8_1.heavy 431.223 / 1083.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT deoxynucleotidyltransferase, terminal 1899 241 C20140707_OR006_02 C20140707_OR006_02 TB412139.[MT7]-RDYSDSTNPGPPK[MT7].4y8_1.heavy 431.223 / 941.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT deoxynucleotidyltransferase, terminal 1901 241 C20140707_OR006_02 C20140707_OR006_02 TB412139.[MT7]-RDYSDSTNPGPPK[MT7].4b5_1.heavy 431.223 / 781.36 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT deoxynucleotidyltransferase, terminal 1903 241 C20140707_OR006_02 C20140707_OR006_02 TB412139.[MT7]-RDYSDSTNPGPPK[MT7].4b6_2.heavy 431.223 / 434.699 N/A N/A - - - - - - - - - 0.0 - - - - - - - DNTT deoxynucleotidyltransferase, terminal 1905 242 C20140707_OR006_02 C20140707_OR006_02 TB437338.[MT7]-EESK[MT7]PEQC[CAM]LAGK[MT7].2y8_1.heavy 904.483 / 1046.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - LPIN1 lipin 1 1907 242 C20140707_OR006_02 C20140707_OR006_02 TB437338.[MT7]-EESK[MT7]PEQC[CAM]LAGK[MT7].2y5_1.heavy 904.483 / 692.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - LPIN1 lipin 1 1909 242 C20140707_OR006_02 C20140707_OR006_02 TB437338.[MT7]-EESK[MT7]PEQC[CAM]LAGK[MT7].2b4_1.heavy 904.483 / 762.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - LPIN1 lipin 1 1911 242 C20140707_OR006_02 C20140707_OR006_02 TB437338.[MT7]-EESK[MT7]PEQC[CAM]LAGK[MT7].2b11_2.heavy 904.483 / 759.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - LPIN1 lipin 1 1913 243 C20140707_OR006_02 C20140707_OR006_02 TB437238.[MT7]-DYSDSTNPGPPK[MT7].2y4_1.heavy 783.388 / 542.342 826.0 20.587524890899658 35 14 10 3 8 10.390107393288746 9.624539594710322 0.07169914245605469 4 0.9472437326083035 5.349304084159933 826.0 5.506666666666666 0.0 - - - - - - - 0.0 1 0 DNTT deoxynucleotidyltransferase, terminal 1915 243 C20140707_OR006_02 C20140707_OR006_02 TB437238.[MT7]-DYSDSTNPGPPK[MT7].2y5_1.heavy 783.388 / 639.395 1487.0 20.587524890899658 35 14 10 3 8 10.390107393288746 9.624539594710322 0.07169914245605469 4 0.9472437326083035 5.349304084159933 1487.0 11.531587350502605 0.0 - - - - - - - 165.375 2 8 DNTT deoxynucleotidyltransferase, terminal 1917 243 C20140707_OR006_02 C20140707_OR006_02 TB437238.[MT7]-DYSDSTNPGPPK[MT7].2b4_1.heavy 783.388 / 625.259 496.0 20.587524890899658 35 14 10 3 8 10.390107393288746 9.624539594710322 0.07169914245605469 4 0.9472437326083035 5.349304084159933 496.0 0.0 1.0 - - - - - - - 0.0 1 0 DNTT deoxynucleotidyltransferase, terminal 1919 243 C20140707_OR006_02 C20140707_OR006_02 TB437238.[MT7]-DYSDSTNPGPPK[MT7].2b7_1.heavy 783.388 / 927.381 661.0 20.587524890899658 35 14 10 3 8 10.390107393288746 9.624539594710322 0.07169914245605469 4 0.9472437326083035 5.349304084159933 661.0 8.163855421686748 2.0 - - - - - - - 314.0 2 5 DNTT deoxynucleotidyltransferase, terminal 1921 244 C20140707_OR006_02 C20140707_OR006_02 TB436974.[MT7]-LLSDK[MT7]K[MT7].2y4_1.heavy 568.374 / 765.471 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1923 244 C20140707_OR006_02 C20140707_OR006_02 TB436974.[MT7]-LLSDK[MT7]K[MT7].2y5_1.heavy 568.374 / 878.555 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1925 244 C20140707_OR006_02 C20140707_OR006_02 TB436974.[MT7]-LLSDK[MT7]K[MT7].2b4_1.heavy 568.374 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1927 244 C20140707_OR006_02 C20140707_OR006_02 TB436974.[MT7]-LLSDK[MT7]K[MT7].2y3_1.heavy 568.374 / 678.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 1929 245 C20140707_OR006_02 C20140707_OR006_02 TB411818.[MT7]-DFPDLAVLGAA.2b3_1.heavy 616.836 / 504.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100293916;GGA2 ADP-ribosylation factor-binding protein GGA2-like;golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1931 245 C20140707_OR006_02 C20140707_OR006_02 TB411818.[MT7]-DFPDLAVLGAA.2b6_1.heavy 616.836 / 803.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100293916;GGA2 ADP-ribosylation factor-binding protein GGA2-like;golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1933 245 C20140707_OR006_02 C20140707_OR006_02 TB411818.[MT7]-DFPDLAVLGAA.2b7_1.heavy 616.836 / 902.474 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100293916;GGA2 ADP-ribosylation factor-binding protein GGA2-like;golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1935 245 C20140707_OR006_02 C20140707_OR006_02 TB411818.[MT7]-DFPDLAVLGAA.2b5_1.heavy 616.836 / 732.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100293916;GGA2 ADP-ribosylation factor-binding protein GGA2-like;golgi-associated, gamma adaptin ear containing, ARF binding protein 2 1937 246 C20140707_OR006_02 C20140707_OR006_02 TB412246.[MT7]-NSYVAGQYDDAASYQR.3y6_1.heavy 651.302 / 695.347 10056.0 27.294099807739258 50 20 10 10 10 7.583242233988009 13.186971603228116 0.0 3 0.9964350953135636 20.663757939845727 10056.0 36.07991665831914 0.0 - - - - - - - 312.7 20 10 G6PD glucose-6-phosphate dehydrogenase 1939 246 C20140707_OR006_02 C20140707_OR006_02 TB412246.[MT7]-NSYVAGQYDDAASYQR.3b4_1.heavy 651.302 / 608.316 18213.0 27.294099807739258 50 20 10 10 10 7.583242233988009 13.186971603228116 0.0 3 0.9964350953135636 20.663757939845727 18213.0 60.949676273193845 0.0 - - - - - - - 323.9 36 10 G6PD glucose-6-phosphate dehydrogenase 1941 246 C20140707_OR006_02 C20140707_OR006_02 TB412246.[MT7]-NSYVAGQYDDAASYQR.3b3_1.heavy 651.302 / 509.248 16202.0 27.294099807739258 50 20 10 10 10 7.583242233988009 13.186971603228116 0.0 3 0.9964350953135636 20.663757939845727 16202.0 41.965287238998926 0.0 - - - - - - - 201.0 32 5 G6PD glucose-6-phosphate dehydrogenase 1943 246 C20140707_OR006_02 C20140707_OR006_02 TB412246.[MT7]-NSYVAGQYDDAASYQR.3y8_1.heavy 651.302 / 925.401 10839.0 27.294099807739258 50 20 10 10 10 7.583242233988009 13.186971603228116 0.0 3 0.9964350953135636 20.663757939845727 10839.0 45.52280700080162 0.0 - - - - - - - 290.6 21 5 G6PD glucose-6-phosphate dehydrogenase 1945 247 C20140707_OR006_02 C20140707_OR006_02 TB412247.[MT7]-GLNPATLSGC[CAM]IDIIVIR.3y6_1.heavy 652.707 / 728.466 4500.0 46.33024978637695 33 18 0 5 10 5.847499767462213 17.101326032784012 0.0438995361328125 3 0.9869396385064932 10.78725548725392 4500.0 17.05310834813499 0.0 - - - - - - - 235.45454545454547 9 11 LPIN1 lipin 1 1947 247 C20140707_OR006_02 C20140707_OR006_02 TB412247.[MT7]-GLNPATLSGC[CAM]IDIIVIR.3y12_2.heavy 652.707 / 680.387 4163.0 46.33024978637695 33 18 0 5 10 5.847499767462213 17.101326032784012 0.0438995361328125 3 0.9869396385064932 10.78725548725392 4163.0 41.104405899705014 0.0 - - - - - - - 237.88888888888889 8 9 LPIN1 lipin 1 1949 247 C20140707_OR006_02 C20140707_OR006_02 TB412247.[MT7]-GLNPATLSGC[CAM]IDIIVIR.3y5_1.heavy 652.707 / 613.44 2475.0 46.33024978637695 33 18 0 5 10 5.847499767462213 17.101326032784012 0.0438995361328125 3 0.9869396385064932 10.78725548725392 2475.0 1.5399999999999998 4.0 - - - - - - - 225.42857142857142 67 7 LPIN1 lipin 1 1951 247 C20140707_OR006_02 C20140707_OR006_02 TB412247.[MT7]-GLNPATLSGC[CAM]IDIIVIR.3y9_1.heavy 652.707 / 1058.6 2813.0 46.33024978637695 33 18 0 5 10 5.847499767462213 17.101326032784012 0.0438995361328125 3 0.9869396385064932 10.78725548725392 2813.0 9.810691415038484 0.0 - - - - - - - 225.33333333333334 5 6 LPIN1 lipin 1 1953 248 C20140707_OR006_02 C20140707_OR006_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 259832.0 44.01179885864258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 259832.0 601.3882742460682 0.0 - - - - - - - 296.54545454545456 519 11 1955 248 C20140707_OR006_02 C20140707_OR006_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 436245.0 44.01179885864258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 436245.0 456.65412280701753 0.0 - - - - - - - 289.5 872 4 1957 248 C20140707_OR006_02 C20140707_OR006_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 352720.0 44.01179885864258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 352720.0 802.6232188747381 0.0 - - - - - - - 263.0 705 8 1959 249 C20140707_OR006_02 C20140707_OR006_02 TB412141.[MT7]-MMLSGGAPLSPQTHR.3y6_1.heavy 576.3 / 725.369 9160.0 30.523300170898438 47 17 10 10 10 2.4386156061740816 27.759553383830493 0.0 3 0.9772641281316214 8.169214003716407 9160.0 74.30411233396585 0.0 - - - - - - - 196.85714285714286 18 7 ACSL4 acyl-CoA synthetase long-chain family member 4 1961 249 C20140707_OR006_02 C20140707_OR006_02 TB412141.[MT7]-MMLSGGAPLSPQTHR.3b6_1.heavy 576.3 / 721.349 7027.0 30.523300170898438 47 17 10 10 10 2.4386156061740816 27.759553383830493 0.0 3 0.9772641281316214 8.169214003716407 7027.0 12.451603898070664 0.0 - - - - - - - 250.625 14 8 ACSL4 acyl-CoA synthetase long-chain family member 4 1963 249 C20140707_OR006_02 C20140707_OR006_02 TB412141.[MT7]-MMLSGGAPLSPQTHR.3b7_1.heavy 576.3 / 792.386 N/A 30.523300170898438 47 17 10 10 10 2.4386156061740816 27.759553383830493 0.0 3 0.9772641281316214 8.169214003716407 7404.0 3.1776824034334763 1.0 - - - - - - - 251.0 22 8 ACSL4 acyl-CoA synthetase long-chain family member 4 1965 249 C20140707_OR006_02 C20140707_OR006_02 TB412141.[MT7]-MMLSGGAPLSPQTHR.3y5_1.heavy 576.3 / 638.337 10541.0 30.523300170898438 47 17 10 10 10 2.4386156061740816 27.759553383830493 0.0 3 0.9772641281316214 8.169214003716407 10541.0 14.102672395251895 0.0 - - - - - - - 232.71428571428572 21 7 ACSL4 acyl-CoA synthetase long-chain family member 4 1967 250 C20140707_OR006_02 C20140707_OR006_02 TB411602.[MT7]-RPAPALAPAAR.3y6_1.heavy 412.255 / 598.367 5398.0 20.50602436065674 38 12 10 6 10 2.1351334980729684 46.835478947922205 0.035900115966796875 3 0.8955755794146738 3.785363402597461 5398.0 82.02825418514162 0.0 - - - - - - - 182.125 10 8 CLSTN1 calsyntenin 1 1969 250 C20140707_OR006_02 C20140707_OR006_02 TB411602.[MT7]-RPAPALAPAAR.3b5_1.heavy 412.255 / 637.39 19191.0 20.50602436065674 38 12 10 6 10 2.1351334980729684 46.835478947922205 0.035900115966796875 3 0.8955755794146738 3.785363402597461 19191.0 153.60521814740935 0.0 - - - - - - - 183.71428571428572 38 7 CLSTN1 calsyntenin 1 1971 250 C20140707_OR006_02 C20140707_OR006_02 TB411602.[MT7]-RPAPALAPAAR.3b3_1.heavy 412.255 / 469.3 7711.0 20.50602436065674 38 12 10 6 10 2.1351334980729684 46.835478947922205 0.035900115966796875 3 0.8955755794146738 3.785363402597461 7711.0 29.3239000623053 0.0 - - - - - - - 171.44444444444446 15 9 CLSTN1 calsyntenin 1 1973 250 C20140707_OR006_02 C20140707_OR006_02 TB411602.[MT7]-RPAPALAPAAR.3y4_1.heavy 412.255 / 414.246 60573.0 20.50602436065674 38 12 10 6 10 2.1351334980729684 46.835478947922205 0.035900115966796875 3 0.8955755794146738 3.785363402597461 60573.0 257.5767757009346 0.0 - - - - - - - 257.0 121 14 CLSTN1 calsyntenin 1 1975 251 C20140707_OR006_02 C20140707_OR006_02 TB437329.[MT7]-LDDVDPLVATNFGK[MT7].2y4_1.heavy 896.49 / 609.348 1933.0 40.03355121612549 31 8 9 6 8 0.46532501318003394 102.2206358855204 0.034999847412109375 4 0.7547449728493992 2.43920828570785 1933.0 6.0093264248704665 0.0 - - - - - - - 314.25 3 8 NLGN1 neuroligin 1 1977 251 C20140707_OR006_02 C20140707_OR006_02 TB437329.[MT7]-LDDVDPLVATNFGK[MT7].2y9_1.heavy 896.49 / 1090.64 9763.0 40.03355121612549 31 8 9 6 8 0.46532501318003394 102.2206358855204 0.034999847412109375 4 0.7547449728493992 2.43920828570785 9763.0 44.438482758620694 0.0 - - - - - - - 267.6923076923077 19 13 NLGN1 neuroligin 1 1979 251 C20140707_OR006_02 C20140707_OR006_02 TB437329.[MT7]-LDDVDPLVATNFGK[MT7].2y6_1.heavy 896.49 / 781.432 3577.0 40.03355121612549 31 8 9 6 8 0.46532501318003394 102.2206358855204 0.034999847412109375 4 0.7547449728493992 2.43920828570785 3577.0 9.966262068965516 2.0 - - - - - - - 290.0 21 8 NLGN1 neuroligin 1 1981 251 C20140707_OR006_02 C20140707_OR006_02 TB437329.[MT7]-LDDVDPLVATNFGK[MT7].2b5_1.heavy 896.49 / 702.343 9763.0 40.03355121612549 31 8 9 6 8 0.46532501318003394 102.2206358855204 0.034999847412109375 4 0.7547449728493992 2.43920828570785 9763.0 10.099655172413794 0.0 - - - - - - - 221.14285714285714 19 14 NLGN1 neuroligin 1 1983 252 C20140707_OR006_02 C20140707_OR006_02 TB412383.[MT7]-GTVLPQGPLLLSPSSLFSALHR.4y5_1.heavy 609.354 / 583.331 2069.0 49.66859817504883 44 14 10 10 10 4.111379094047411 24.3227388456548 0.0 3 0.9453002523143842 5.2525464426354835 2069.0 31.695319148936168 0.0 - - - - - - - 219.33333333333334 4 6 LPIN1 lipin 1 1985 252 C20140707_OR006_02 C20140707_OR006_02 TB412383.[MT7]-GTVLPQGPLLLSPSSLFSALHR.4y10_1.heavy 609.354 / 1114.6 2069.0 49.66859817504883 44 14 10 10 10 4.111379094047411 24.3227388456548 0.0 3 0.9453002523143842 5.2525464426354835 2069.0 31.14505319148936 0.0 - - - - - - - 131.6 4 5 LPIN1 lipin 1 1987 252 C20140707_OR006_02 C20140707_OR006_02 TB412383.[MT7]-GTVLPQGPLLLSPSSLFSALHR.4b4_1.heavy 609.354 / 515.331 10532.0 49.66859817504883 44 14 10 10 10 4.111379094047411 24.3227388456548 0.0 3 0.9453002523143842 5.2525464426354835 10532.0 26.26209542230819 0.0 - - - - - - - 188.0 21 8 LPIN1 lipin 1 1989 252 C20140707_OR006_02 C20140707_OR006_02 TB412383.[MT7]-GTVLPQGPLLLSPSSLFSALHR.4y6_1.heavy 609.354 / 730.399 3197.0 49.66859817504883 44 14 10 10 10 4.111379094047411 24.3227388456548 0.0 3 0.9453002523143842 5.2525464426354835 3197.0 2.3718446117750744 1.0 - - - - - - - 164.5 7 4 LPIN1 lipin 1 1991 253 C20140707_OR006_02 C20140707_OR006_02 TB436849.[MT7]-SSSSLVR.2y6_1.heavy 440.254 / 648.367 3063.0 18.675099849700928 37 20 6 1 10 5.355770244886157 18.671450683584283 0.09020042419433594 3 0.9908015520357323 12.857946845174196 3063.0 42.8115351124728 0.0 - - - - - - - 245.75 6 8 FGFR4 fibroblast growth factor receptor 4 1993 253 C20140707_OR006_02 C20140707_OR006_02 TB436849.[MT7]-SSSSLVR.2b5_1.heavy 440.254 / 606.321 1649.0 18.675099849700928 37 20 6 1 10 5.355770244886157 18.671450683584283 0.09020042419433594 3 0.9908015520357323 12.857946845174196 1649.0 5.151909353621137 1.0 - - - - - - - 282.8 3 10 FGFR4 fibroblast growth factor receptor 4 1995 253 C20140707_OR006_02 C20140707_OR006_02 TB436849.[MT7]-SSSSLVR.2b4_1.heavy 440.254 / 493.237 1728.0 18.675099849700928 37 20 6 1 10 5.355770244886157 18.671450683584283 0.09020042419433594 3 0.9908015520357323 12.857946845174196 1728.0 6.053503184713375 0.0 - - - - - - - 218.33333333333334 3 9 FGFR4 fibroblast growth factor receptor 4 1997 253 C20140707_OR006_02 C20140707_OR006_02 TB436849.[MT7]-SSSSLVR.2b6_1.heavy 440.254 / 705.39 1021.0 18.675099849700928 37 20 6 1 10 5.355770244886157 18.671450683584283 0.09020042419433594 3 0.9908015520357323 12.857946845174196 1021.0 11.950913430594293 2.0 - - - - - - - 144.33333333333334 8 12 FGFR4 fibroblast growth factor receptor 4 1999 254 C20140707_OR006_02 C20140707_OR006_02 TB411800.[MT7]-SNLSYNTK[MT7].3y3_1.heavy 405.559 / 506.306 14268.0 20.734600067138672 50 20 10 10 10 9.165076125244726 10.910984113329423 0.0 3 0.9936573574340059 15.488074734834958 14268.0 57.75961445783132 0.0 - - - - - - - 339.54545454545456 28 11 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 2001 254 C20140707_OR006_02 C20140707_OR006_02 TB411800.[MT7]-SNLSYNTK[MT7].3b4_1.heavy 405.559 / 546.3 11281.0 20.734600067138672 50 20 10 10 10 9.165076125244726 10.910984113329423 0.0 3 0.9936573574340059 15.488074734834958 11281.0 62.5212048192771 0.0 - - - - - - - 219.35714285714286 22 14 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 2003 254 C20140707_OR006_02 C20140707_OR006_02 TB411800.[MT7]-SNLSYNTK[MT7].3y4_1.heavy 405.559 / 669.369 1908.0 20.734600067138672 50 20 10 10 10 9.165076125244726 10.910984113329423 0.0 3 0.9936573574340059 15.488074734834958 1908.0 9.741144578313254 0.0 - - - - - - - 166.0 3 11 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 2005 254 C20140707_OR006_02 C20140707_OR006_02 TB411800.[MT7]-SNLSYNTK[MT7].3b3_1.heavy 405.559 / 459.268 16424.0 20.734600067138672 50 20 10 10 10 9.165076125244726 10.910984113329423 0.0 3 0.9936573574340059 15.488074734834958 16424.0 76.67831325301205 0.0 - - - - - - - 221.33333333333334 32 12 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 2007 255 C20140707_OR006_02 C20140707_OR006_02 TB437325.[MT7]-LLLAGLLC[CAM]GGGVWAAR.3b6_1.heavy 591.01 / 725.504 24710.0 52.14059829711914 48 18 10 10 10 7.242173263751711 13.808009882961061 0.0 3 0.9871443975383918 10.873010125711327 24710.0 121.80985915492958 0.0 - - - - - - - 234.3 49 10 CLSTN1 calsyntenin 1 2009 255 C20140707_OR006_02 C20140707_OR006_02 TB437325.[MT7]-LLLAGLLC[CAM]GGGVWAAR.3b5_1.heavy 591.01 / 612.42 44875.0 52.14059829711914 48 18 10 10 10 7.242173263751711 13.808009882961061 0.0 3 0.9871443975383918 10.873010125711327 44875.0 677.8653169014085 0.0 - - - - - - - 196.6153846153846 89 13 CLSTN1 calsyntenin 1 2011 255 C20140707_OR006_02 C20140707_OR006_02 TB437325.[MT7]-LLLAGLLC[CAM]GGGVWAAR.3y8_1.heavy 591.01 / 773.405 30958.0 52.14059829711914 48 18 10 10 10 7.242173263751711 13.808009882961061 0.0 3 0.9871443975383918 10.873010125711327 30958.0 187.12875586854457 0.0 - - - - - - - 174.27272727272728 61 11 CLSTN1 calsyntenin 1 2013 255 C20140707_OR006_02 C20140707_OR006_02 TB437325.[MT7]-LLLAGLLC[CAM]GGGVWAAR.3y9_1.heavy 591.01 / 933.436 26556.0 52.14059829711914 48 18 10 10 10 7.242173263751711 13.808009882961061 0.0 3 0.9871443975383918 10.873010125711327 26556.0 169.0919014084507 0.0 - - - - - - - 152.14285714285714 53 7 CLSTN1 calsyntenin 1 2015 256 C20140707_OR006_02 C20140707_OR006_02 TB436984.[MT7]-ISQYAC[CAM]QR.2y4_1.heavy 585.296 / 534.245 1615.0 22.732999801635742 44 20 10 6 8 10.856980116413382 9.210664376995759 0.03620147705078125 4 0.9917548270954596 13.581997031207733 1615.0 8.98859464650897 3.0 - - - - - - - 231.75 3 12 DNTT deoxynucleotidyltransferase, terminal 2017 256 C20140707_OR006_02 C20140707_OR006_02 TB436984.[MT7]-ISQYAC[CAM]QR.2y5_1.heavy 585.296 / 697.309 1974.0 22.732999801635742 44 20 10 6 8 10.856980116413382 9.210664376995759 0.03620147705078125 4 0.9917548270954596 13.581997031207733 1974.0 30.873310986964615 0.0 - - - - - - - 164.41666666666666 3 12 DNTT deoxynucleotidyltransferase, terminal 2019 256 C20140707_OR006_02 C20140707_OR006_02 TB436984.[MT7]-ISQYAC[CAM]QR.2y6_1.heavy 585.296 / 825.367 1256.0 22.732999801635742 44 20 10 6 8 10.856980116413382 9.210664376995759 0.03620147705078125 4 0.9917548270954596 13.581997031207733 1256.0 5.694693039468128 0.0 - - - - - - - 188.4 2 10 DNTT deoxynucleotidyltransferase, terminal 2021 256 C20140707_OR006_02 C20140707_OR006_02 TB436984.[MT7]-ISQYAC[CAM]QR.2y7_1.heavy 585.296 / 912.399 13459.0 22.732999801635742 44 20 10 6 8 10.856980116413382 9.210664376995759 0.03620147705078125 4 0.9917548270954596 13.581997031207733 13459.0 142.15061131763736 0.0 - - - - - - - 199.44444444444446 26 9 DNTT deoxynucleotidyltransferase, terminal 2023 257 C20140707_OR006_02 C20140707_OR006_02 TB411808.[MT7]-AGAAFFNEVR.2b8_1.heavy 613.326 / 952.464 2806.0 34.72114944458008 34 13 10 5 6 2.476543507489464 40.37885855733363 0.04489898681640625 5 0.9061862045390471 3.997365213966803 2806.0 17.41930054858934 0.0 - - - - - - - 191.625 5 8 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2025 257 C20140707_OR006_02 C20140707_OR006_02 TB411808.[MT7]-AGAAFFNEVR.2y9_1.heavy 613.326 / 1010.51 5485.0 34.72114944458008 34 13 10 5 6 2.476543507489464 40.37885855733363 0.04489898681640625 5 0.9061862045390471 3.997365213966803 5485.0 28.343380969942835 0.0 - - - - - - - 255.28571428571428 10 7 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2027 257 C20140707_OR006_02 C20140707_OR006_02 TB411808.[MT7]-AGAAFFNEVR.2b7_1.heavy 613.326 / 823.422 1276.0 34.72114944458008 34 13 10 5 6 2.476543507489464 40.37885855733363 0.04489898681640625 5 0.9061862045390471 3.997365213966803 1276.0 1.0363665107700415 5.0 - - - - - - - 242.5 4 10 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2029 257 C20140707_OR006_02 C20140707_OR006_02 TB411808.[MT7]-AGAAFFNEVR.2b5_1.heavy 613.326 / 562.311 1786.0 34.72114944458008 34 13 10 5 6 2.476543507489464 40.37885855733363 0.04489898681640625 5 0.9061862045390471 3.997365213966803 1786.0 3.8975323211834367 8.0 - - - - - - - 685.625 5 8 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2031 258 C20140707_OR006_02 C20140707_OR006_02 TB436982.[MT7]-FLNELIK[MT7].2y5_1.heavy 582.865 / 760.469 1689.0 39.56522560119629 26 15 2 3 6 1.7675556178820104 39.7265165695375 0.073699951171875 5 0.9597572201015504 6.1312790467871725 1689.0 1.757013422818792 3.0 - - - - - - - 262.94117647058823 3 17 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 2033 258 C20140707_OR006_02 C20140707_OR006_02 TB436982.[MT7]-FLNELIK[MT7].2b4_1.heavy 582.865 / 648.347 1291.0 39.56522560119629 26 15 2 3 6 1.7675556178820104 39.7265165695375 0.073699951171875 5 0.9597572201015504 6.1312790467871725 1291.0 3.1516566894496725 6.0 - - - - - - - 298.0 10 10 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 2035 258 C20140707_OR006_02 C20140707_OR006_02 TB436982.[MT7]-FLNELIK[MT7].2y3_1.heavy 582.865 / 517.383 1788.0 39.56522560119629 26 15 2 3 6 1.7675556178820104 39.7265165695375 0.073699951171875 5 0.9597572201015504 6.1312790467871725 1788.0 2.9399999999999995 13.0 - - - - - - - 831.75 4 8 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 2037 258 C20140707_OR006_02 C20140707_OR006_02 TB436982.[MT7]-FLNELIK[MT7].2y6_1.heavy 582.865 / 873.553 2086.0 39.56522560119629 26 15 2 3 6 1.7675556178820104 39.7265165695375 0.073699951171875 5 0.9597572201015504 6.1312790467871725 2086.0 9.62896725440806 1.0 - - - - - - - 198.57894736842104 12 19 GGA2;GGA3;GGA1 golgi-associated, gamma adaptin ear containing, ARF binding protein 2;golgi-associated, gamma adaptin ear containing, ARF binding protein 3;golgi-associated, gamma adaptin ear containing, ARF binding protein 1 2039 259 C20140707_OR006_02 C20140707_OR006_02 TB437225.[MT7]-TYESLSDMVVPR.2y5_1.heavy 770.893 / 601.349 14404.0 37.18349838256836 48 18 10 10 10 3.6645888900948225 21.586728581161115 0.0 3 0.983703516375913 9.654368200123324 14404.0 152.84244444444445 0.0 - - - - - - - 226.66666666666666 28 9 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 2041 259 C20140707_OR006_02 C20140707_OR006_02 TB437225.[MT7]-TYESLSDMVVPR.2y9_1.heavy 770.893 / 1003.52 14764.0 37.18349838256836 48 18 10 10 10 3.6645888900948225 21.586728581161115 0.0 3 0.983703516375913 9.654368200123324 14764.0 157.07255555555554 0.0 - - - - - - - 222.85714285714286 29 7 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 2043 259 C20140707_OR006_02 C20140707_OR006_02 TB437225.[MT7]-TYESLSDMVVPR.2y10_1.heavy 770.893 / 1132.57 6002.0 37.18349838256836 48 18 10 10 10 3.6645888900948225 21.586728581161115 0.0 3 0.983703516375913 9.654368200123324 6002.0 23.533927078766624 0.0 - - - - - - - 210.0 12 12 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 2045 259 C20140707_OR006_02 C20140707_OR006_02 TB437225.[MT7]-TYESLSDMVVPR.2b7_1.heavy 770.893 / 940.438 7922.0 37.18349838256836 48 18 10 10 10 3.6645888900948225 21.586728581161115 0.0 3 0.983703516375913 9.654368200123324 7922.0 29.90555 0.0 - - - - - - - 250.9090909090909 15 11 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 2047 260 C20140707_OR006_02 C20140707_OR006_02 TB437223.[MT7]-MPHGYDTQVGER.3y7_1.heavy 511.913 / 804.385 1375.0 23.442749977111816 39 15 10 6 8 2.925187226157099 34.18584598818067 0.03510093688964844 4 0.9552355786417817 5.811153423862116 1375.0 14.461956521739129 0.0 - - - - - - - 169.30769230769232 2 13 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2049 260 C20140707_OR006_02 C20140707_OR006_02 TB437223.[MT7]-MPHGYDTQVGER.3y6_1.heavy 511.913 / 689.358 1742.0 23.442749977111816 39 15 10 6 8 2.925187226157099 34.18584598818067 0.03510093688964844 4 0.9552355786417817 5.811153423862116 1742.0 23.703869090909095 0.0 - - - - - - - 198.66666666666666 3 6 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2051 260 C20140707_OR006_02 C20140707_OR006_02 TB437223.[MT7]-MPHGYDTQVGER.3y4_1.heavy 511.913 / 460.251 3392.0 23.442749977111816 39 15 10 6 8 2.925187226157099 34.18584598818067 0.03510093688964844 4 0.9552355786417817 5.811153423862116 3392.0 12.404479637496461 1.0 - - - - - - - 275.0833333333333 7 12 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2053 260 C20140707_OR006_02 C20140707_OR006_02 TB437223.[MT7]-MPHGYDTQVGER.3y5_1.heavy 511.913 / 588.31 1284.0 23.442749977111816 39 15 10 6 8 2.925187226157099 34.18584598818067 0.03510093688964844 4 0.9552355786417817 5.811153423862116 1284.0 0.0 8.0 - - - - - - - 254.66666666666666 2 9 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2055 261 C20140707_OR006_02 C20140707_OR006_02 TB436958.[MT7]-ENLQALER.2b3_1.heavy 558.81 / 501.279 18557.0 27.0310001373291 50 20 10 10 10 7.862337793293578 12.718863349435082 0.0 3 0.9900299259595636 12.349565776848157 18557.0 13.869630047277552 1.0 - - - - - - - 238.0 44 6 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 2057 261 C20140707_OR006_02 C20140707_OR006_02 TB436958.[MT7]-ENLQALER.2b4_1.heavy 558.81 / 629.338 22364.0 27.0310001373291 50 20 10 10 10 7.862337793293578 12.718863349435082 0.0 3 0.9900299259595636 12.349565776848157 22364.0 124.59942857142858 1.0 - - - - - - - 345.1 44 10 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 2059 261 C20140707_OR006_02 C20140707_OR006_02 TB436958.[MT7]-ENLQALER.2b5_1.heavy 558.81 / 700.375 21174.0 27.0310001373291 50 20 10 10 10 7.862337793293578 12.718863349435082 0.0 3 0.9900299259595636 12.349565776848157 21174.0 21.364556826870327 0.0 - - - - - - - 297.5 42 2 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 2061 261 C20140707_OR006_02 C20140707_OR006_02 TB436958.[MT7]-ENLQALER.2y7_1.heavy 558.81 / 843.468 48892.0 27.0310001373291 50 20 10 10 10 7.862337793293578 12.718863349435082 0.0 3 0.9900299259595636 12.349565776848157 48892.0 410.65171428571426 0.0 - - - - - - - 178.5 97 8 ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 2063 262 C20140707_OR006_02 C20140707_OR006_02 TB436957.[MT7]-C[CAM]FLIFK[MT7].2y4_1.heavy 558.33 / 664.451 1791.0 40.900574684143066 36 14 10 6 6 1.3826256510285786 49.35081064049583 0.033100128173828125 5 0.9421102950803956 5.104391848057809 1791.0 13.421000378931414 0.0 - - - - - - - 262.64285714285717 3 14 DNTT deoxynucleotidyltransferase, terminal 2065 262 C20140707_OR006_02 C20140707_OR006_02 TB436957.[MT7]-C[CAM]FLIFK[MT7].2b3_1.heavy 558.33 / 565.292 2640.0 40.900574684143066 36 14 10 6 6 1.3826256510285786 49.35081064049583 0.033100128173828125 5 0.9421102950803956 5.104391848057809 2640.0 -0.5 2.0 - - - - - - - 249.21428571428572 5 14 DNTT deoxynucleotidyltransferase, terminal 2067 262 C20140707_OR006_02 C20140707_OR006_02 TB436957.[MT7]-C[CAM]FLIFK[MT7].2y5_1.heavy 558.33 / 811.52 3677.0 40.900574684143066 36 14 10 6 6 1.3826256510285786 49.35081064049583 0.033100128173828125 5 0.9421102950803956 5.104391848057809 3677.0 4.551547303271442 0.0 - - - - - - - 197.0 7 11 DNTT deoxynucleotidyltransferase, terminal 2069 262 C20140707_OR006_02 C20140707_OR006_02 TB436957.[MT7]-C[CAM]FLIFK[MT7].2y3_1.heavy 558.33 / 551.367 3299.0 40.900574684143066 36 14 10 6 6 1.3826256510285786 49.35081064049583 0.033100128173828125 5 0.9421102950803956 5.104391848057809 3299.0 2.914826305249115 2.0 - - - - - - - 296.35714285714283 8 14 DNTT deoxynucleotidyltransferase, terminal 2071 263 C20140707_OR006_02 C20140707_OR006_02 TB450494.[MT7]-NMLLQNPQLAYALLQAQVVMR.3b6_1.heavy 853.474 / 858.462 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 2073 263 C20140707_OR006_02 C20140707_OR006_02 TB450494.[MT7]-NMLLQNPQLAYALLQAQVVMR.3b4_1.heavy 853.474 / 616.361 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 2075 263 C20140707_OR006_02 C20140707_OR006_02 TB450494.[MT7]-NMLLQNPQLAYALLQAQVVMR.3b5_1.heavy 853.474 / 744.419 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 2077 263 C20140707_OR006_02 C20140707_OR006_02 TB450494.[MT7]-NMLLQNPQLAYALLQAQVVMR.3b3_1.heavy 853.474 / 503.277 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSTF2;CSTF2T cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa;cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant 2079 264 C20140707_OR006_02 C20140707_OR006_02 TB412117.[MT7]-VLLAVSEEYLDLR.3y6_1.heavy 555.318 / 808.42 3069.0 47.72395133972168 43 18 10 5 10 5.08955984439748 19.648064480483253 0.044300079345703125 3 0.9875326994597041 11.041394161325908 3069.0 18.514229074889865 0.0 - - - - - - - 227.2 6 5 FGFR4 fibroblast growth factor receptor 4 2081 264 C20140707_OR006_02 C20140707_OR006_02 TB412117.[MT7]-VLLAVSEEYLDLR.3b4_1.heavy 555.318 / 541.383 8752.0 47.72395133972168 43 18 10 5 10 5.08955984439748 19.648064480483253 0.044300079345703125 3 0.9875326994597041 11.041394161325908 8752.0 39.543138579198256 0.0 - - - - - - - 204.4 17 5 FGFR4 fibroblast growth factor receptor 4 2083 264 C20140707_OR006_02 C20140707_OR006_02 TB412117.[MT7]-VLLAVSEEYLDLR.3y4_1.heavy 555.318 / 516.314 2842.0 47.72395133972168 43 18 10 5 10 5.08955984439748 19.648064480483253 0.044300079345703125 3 0.9875326994597041 11.041394161325908 2842.0 27.466653442651857 0.0 - - - - - - - 246.5 5 6 FGFR4 fibroblast growth factor receptor 4 2085 264 C20140707_OR006_02 C20140707_OR006_02 TB412117.[MT7]-VLLAVSEEYLDLR.3y5_1.heavy 555.318 / 679.377 2842.0 47.72395133972168 43 18 10 5 10 5.08955984439748 19.648064480483253 0.044300079345703125 3 0.9875326994597041 11.041394161325908 2842.0 13.39414547622163 1.0 - - - - - - - 243.57142857142858 8 7 FGFR4 fibroblast growth factor receptor 4 2087 265 C20140707_OR006_02 C20140707_OR006_02 TB449953.[MT7]-ITSTIK[MT7].2y4_1.heavy 475.81 / 592.379 4327.0 24.0542254447937 44 20 10 6 8 6.034150655371226 16.572340617811093 0.03610038757324219 4 0.9912760429021512 13.203509201662 4327.0 18.41276595744681 0.0 - - - - - - - 216.92307692307693 8 13 CLSTN1 calsyntenin 1 2089 265 C20140707_OR006_02 C20140707_OR006_02 TB449953.[MT7]-ITSTIK[MT7].2y5_1.heavy 475.81 / 693.426 14111.0 24.0542254447937 44 20 10 6 8 6.034150655371226 16.572340617811093 0.03610038757324219 4 0.9912760429021512 13.203509201662 14111.0 169.9324680851064 0.0 - - - - - - - 225.6 28 5 CLSTN1 calsyntenin 1 2091 265 C20140707_OR006_02 C20140707_OR006_02 TB449953.[MT7]-ITSTIK[MT7].2b4_2.heavy 475.81 / 274.164 564.0 24.0542254447937 44 20 10 6 8 6.034150655371226 16.572340617811093 0.03610038757324219 4 0.9912760429021512 13.203509201662 564.0 0.88 28.0 - - - - - - - 254.35294117647058 22 17 CLSTN1 calsyntenin 1 2093 265 C20140707_OR006_02 C20140707_OR006_02 TB449953.[MT7]-ITSTIK[MT7].2y3_1.heavy 475.81 / 505.347 1881.0 24.0542254447937 44 20 10 6 8 6.034150655371226 16.572340617811093 0.03610038757324219 4 0.9912760429021512 13.203509201662 1881.0 7.337234042553192 1.0 - - - - - - - 282.0 5 13 CLSTN1 calsyntenin 1 2095 266 C20140707_OR006_02 C20140707_OR006_02 TB437353.[MT7]-AK[MT7]PTSDK[MT7]PGSPYR.3y7_1.heavy 612.683 / 948.538 783.0 17.913850784301758 41 16 10 5 10 2.5838625974758958 32.09699455025667 0.0457000732421875 3 0.965442725431517 6.619633704267568 783.0 7.889078027235922 0.0 - - - - - - - 0.0 1 0 ACSL4 acyl-CoA synthetase long-chain family member 4 2097 266 C20140707_OR006_02 C20140707_OR006_02 TB437353.[MT7]-AK[MT7]PTSDK[MT7]PGSPYR.3b6_1.heavy 612.683 / 888.503 4069.0 17.913850784301758 41 16 10 5 10 2.5838625974758958 32.09699455025667 0.0457000732421875 3 0.965442725431517 6.619633704267568 4069.0 97.66297770700636 0.0 - - - - - - - 162.33333333333334 8 9 ACSL4 acyl-CoA synthetase long-chain family member 4 2099 266 C20140707_OR006_02 C20140707_OR006_02 TB437353.[MT7]-AK[MT7]PTSDK[MT7]PGSPYR.3y6_1.heavy 612.683 / 676.341 3652.0 17.913850784301758 41 16 10 5 10 2.5838625974758958 32.09699455025667 0.0457000732421875 3 0.965442725431517 6.619633704267568 3652.0 17.851629392971248 1.0 - - - - - - - 254.25 7 8 ACSL4 acyl-CoA synthetase long-chain family member 4 2101 266 C20140707_OR006_02 C20140707_OR006_02 TB437353.[MT7]-AK[MT7]PTSDK[MT7]PGSPYR.3y5_1.heavy 612.683 / 579.289 417.0 17.913850784301758 41 16 10 5 10 2.5838625974758958 32.09699455025667 0.0457000732421875 3 0.965442725431517 6.619633704267568 417.0 2.3269039709871087 10.0 - - - - - - - 0.0 1 0 ACSL4 acyl-CoA synthetase long-chain family member 4 2103 267 C20140707_OR006_02 C20140707_OR006_02 TB437216.[MT7]-GC[CAM]DRDTYSEK[MT7].3y7_2.heavy 506.908 / 521.768 1001.0 16.27050018310547 47 17 10 10 10 2.036527549332913 38.57834069691727 0.0 3 0.9729228411918693 7.4830038277960105 1001.0 11.109556061695837 0.0 - - - - - - - 144.13333333333333 2 15 CLSTN1 calsyntenin 1 2105 267 C20140707_OR006_02 C20140707_OR006_02 TB437216.[MT7]-GC[CAM]DRDTYSEK[MT7].3b3_1.heavy 506.908 / 477.188 1679.0 16.27050018310547 47 17 10 10 10 2.036527549332913 38.57834069691727 0.0 3 0.9729228411918693 7.4830038277960105 1679.0 13.84742268041237 0.0 - - - - - - - 123.75 3 24 CLSTN1 calsyntenin 1 2107 267 C20140707_OR006_02 C20140707_OR006_02 TB437216.[MT7]-GC[CAM]DRDTYSEK[MT7].3y4_1.heavy 506.908 / 670.353 775.0 16.27050018310547 47 17 10 10 10 2.036527549332913 38.57834069691727 0.0 3 0.9729228411918693 7.4830038277960105 775.0 7.682013190753666 0.0 - - - - - - - 0.0 1 0 CLSTN1 calsyntenin 1 2109 267 C20140707_OR006_02 C20140707_OR006_02 TB437216.[MT7]-GC[CAM]DRDTYSEK[MT7].3y5_1.heavy 506.908 / 771.401 613.0 16.27050018310547 47 17 10 10 10 2.036527549332913 38.57834069691727 0.0 3 0.9729228411918693 7.4830038277960105 613.0 22.9875 0.0 - - - - - - - 0.0 1 0 CLSTN1 calsyntenin 1 2111 268 C20140707_OR006_02 C20140707_OR006_02 TB436951.[MT7]-LSRFPLAR.2b3_1.heavy 552.344 / 501.327 1641.0 29.993599891662598 27 17 2 6 2 4.236423771821509 23.60481514270316 0.03940010070800781 12 0.9797852004290774 8.665493989922066 1641.0 3.261481329374681 11.0 - - - - - - - 268.125 8 8 FGFR4 fibroblast growth factor receptor 4 2113 268 C20140707_OR006_02 C20140707_OR006_02 TB436951.[MT7]-LSRFPLAR.2y5_1.heavy 552.344 / 603.361 2398.0 29.993599891662598 27 17 2 6 2 4.236423771821509 23.60481514270316 0.03940010070800781 12 0.9797852004290774 8.665493989922066 2398.0 1.4779196978436007 2.0 - - - - - - - 252.25 11 8 FGFR4 fibroblast growth factor receptor 4 2115 268 C20140707_OR006_02 C20140707_OR006_02 TB436951.[MT7]-LSRFPLAR.2b6_1.heavy 552.344 / 858.532 1010.0 29.993599891662598 27 17 2 6 2 4.236423771821509 23.60481514270316 0.03940010070800781 12 0.9797852004290774 8.665493989922066 1010.0 0.0 4.0 - - - - - - - 227.0 2 5 FGFR4 fibroblast growth factor receptor 4 2117 268 C20140707_OR006_02 C20140707_OR006_02 TB436951.[MT7]-LSRFPLAR.2b7_1.heavy 552.344 / 929.569 1894.0 29.993599891662598 27 17 2 6 2 4.236423771821509 23.60481514270316 0.03940010070800781 12 0.9797852004290774 8.665493989922066 1894.0 9.811251603652554 0.0 - - - - - - - 214.5 3 10 FGFR4 fibroblast growth factor receptor 4 2119 269 C20140707_OR006_02 C20140707_OR006_02 TB436952.[MT7]-IFTVNPK[MT7].2y5_1.heavy 553.844 / 702.427 2395.0 30.92099952697754 34 18 2 10 4 3.6715922591049224 21.766675475764195 0.0 8 0.9871672372544736 10.882702512327874 2395.0 4.181746031746032 0.0 - - - - - - - 199.5 4 12 LPIN1;LPIN2 lipin 1;lipin 2 2121 269 C20140707_OR006_02 C20140707_OR006_02 TB436952.[MT7]-IFTVNPK[MT7].2y3_1.heavy 553.844 / 502.311 4033.0 30.92099952697754 34 18 2 10 4 3.6715922591049224 21.766675475764195 0.0 8 0.9871672372544736 10.882702512327874 4033.0 10.097049062049063 2.0 - - - - - - - 721.6363636363636 15 11 LPIN1;LPIN2 lipin 1;lipin 2 2123 269 C20140707_OR006_02 C20140707_OR006_02 TB436952.[MT7]-IFTVNPK[MT7].2y6_1.heavy 553.844 / 849.495 3151.0 30.92099952697754 34 18 2 10 4 3.6715922591049224 21.766675475764195 0.0 8 0.9871672372544736 10.882702512327874 3151.0 23.315150277789886 4.0 - - - - - - - 273.0 17 6 LPIN1;LPIN2 lipin 1;lipin 2 2125 269 C20140707_OR006_02 C20140707_OR006_02 TB436952.[MT7]-IFTVNPK[MT7].2b5_1.heavy 553.844 / 719.421 3151.0 30.92099952697754 34 18 2 10 4 3.6715922591049224 21.766675475764195 0.0 8 0.9871672372544736 10.882702512327874 3151.0 24.371370851370855 3.0 - - - - - - - 252.0 8 7 LPIN1;LPIN2 lipin 1;lipin 2 2127 270 C20140707_OR006_02 C20140707_OR006_02 TB436954.[MT7]-LTSEQLK[MT7].2y5_1.heavy 553.837 / 748.432 3840.0 25.100200653076172 45 17 10 10 8 4.260194843138013 23.47310479497719 0.0 4 0.9776351841060712 8.236960000332141 3840.0 17.303044496487118 0.0 - - - - - - - 271.6363636363636 7 11 LPIN1 lipin 1 2129 270 C20140707_OR006_02 C20140707_OR006_02 TB436954.[MT7]-LTSEQLK[MT7].2b4_1.heavy 553.837 / 575.316 1920.0 25.100200653076172 45 17 10 10 8 4.260194843138013 23.47310479497719 0.0 4 0.9776351841060712 8.236960000332141 1920.0 2.419493908153702 1.0 - - - - - - - 238.07692307692307 4 13 LPIN1 lipin 1 2131 270 C20140707_OR006_02 C20140707_OR006_02 TB436954.[MT7]-LTSEQLK[MT7].2y6_1.heavy 553.837 / 849.48 6400.0 25.100200653076172 45 17 10 10 8 4.260194843138013 23.47310479497719 0.0 4 0.9776351841060712 8.236960000332141 6400.0 12.947881529646713 0.0 - - - - - - - 257.8333333333333 12 12 LPIN1 lipin 1 2133 270 C20140707_OR006_02 C20140707_OR006_02 TB436954.[MT7]-LTSEQLK[MT7].2b5_1.heavy 553.837 / 703.374 1387.0 25.100200653076172 45 17 10 10 8 4.260194843138013 23.47310479497719 0.0 4 0.9776351841060712 8.236960000332141 1387.0 5.8605633802816905 0.0 - - - - - - - 128.2 2 5 LPIN1 lipin 1 2135 271 C20140707_OR006_02 C20140707_OR006_02 TB437489.[MT7]-K[MT7]GLLLYYDLVESTFEK[MT7].4b8_2.heavy 588.337 / 627.87 8337.0 48.82374954223633 36 13 10 5 8 2.628348821644732 38.04670033767564 0.04070281982421875 4 0.9297736447201459 4.6295348523688675 8337.0 58.45914414414414 0.0 - - - - - - - 240.5 16 6 DNTT deoxynucleotidyltransferase, terminal 2137 271 C20140707_OR006_02 C20140707_OR006_02 TB437489.[MT7]-K[MT7]GLLLYYDLVESTFEK[MT7].4b4_1.heavy 588.337 / 700.496 1890.0 48.82374954223633 36 13 10 5 8 2.628348821644732 38.04670033767564 0.04070281982421875 4 0.9297736447201459 4.6295348523688675 1890.0 13.735135135135135 0.0 - - - - - - - 240.5 3 6 DNTT deoxynucleotidyltransferase, terminal 2139 271 C20140707_OR006_02 C20140707_OR006_02 TB437489.[MT7]-K[MT7]GLLLYYDLVESTFEK[MT7].4b5_1.heavy 588.337 / 813.58 1000.0 48.82374954223633 36 13 10 5 8 2.628348821644732 38.04670033767564 0.04070281982421875 4 0.9297736447201459 4.6295348523688675 1000.0 1.3789867656100006 1.0 - - - - - - - 155.4 2 5 DNTT deoxynucleotidyltransferase, terminal 2141 271 C20140707_OR006_02 C20140707_OR006_02 TB437489.[MT7]-K[MT7]GLLLYYDLVESTFEK[MT7].4b3_1.heavy 588.337 / 587.412 778.0 48.82374954223633 36 13 10 5 8 2.628348821644732 38.04670033767564 0.04070281982421875 4 0.9297736447201459 4.6295348523688675 778.0 3.0947027027027025 14.0 - - - - - - - 252.45454545454547 6 11 DNTT deoxynucleotidyltransferase, terminal 2143 272 C20140707_OR006_02 C20140707_OR006_02 TB450096.[MT7]-LAGLHDAILR.3y6_1.heavy 408.251 / 724.41 1386.0 32.41320037841797 45 17 10 10 8 2.8587631502953323 27.81405264728289 0.0 4 0.9736787717570862 7.590179850923764 1386.0 10.8625 0.0 - - - - - - - 220.5 2 4 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2145 272 C20140707_OR006_02 C20140707_OR006_02 TB450096.[MT7]-LAGLHDAILR.3b4_1.heavy 408.251 / 499.336 10459.0 32.41320037841797 45 17 10 10 8 2.8587631502953323 27.81405264728289 0.0 4 0.9736787717570862 7.590179850923764 10459.0 -1.660158730158729 2.0 - - - - - - - 252.0 36 2 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2147 272 C20140707_OR006_02 C20140707_OR006_02 TB450096.[MT7]-LAGLHDAILR.3y4_1.heavy 408.251 / 472.324 17137.0 32.41320037841797 45 17 10 10 8 2.8587631502953323 27.81405264728289 0.0 4 0.9736787717570862 7.590179850923764 17137.0 54.74319444444444 0.0 - - - - - - - 267.75 34 8 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2149 272 C20140707_OR006_02 C20140707_OR006_02 TB450096.[MT7]-LAGLHDAILR.3y5_1.heavy 408.251 / 587.351 14617.0 32.41320037841797 45 17 10 10 8 2.8587631502953323 27.81405264728289 0.0 4 0.9736787717570862 7.590179850923764 14617.0 112.52769841269841 0.0 - - - - - - - 220.5 29 4 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2151 273 C20140707_OR006_02 C20140707_OR006_02 TB437090.[MT7]-SIFY[MT7]QLLR.3y6_1.heavy 443.271 / 983.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK15 mitogen-activated protein kinase 15 2153 273 C20140707_OR006_02 C20140707_OR006_02 TB437090.[MT7]-SIFY[MT7]QLLR.3y7_2.heavy 443.271 / 548.835 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK15 mitogen-activated protein kinase 15 2155 273 C20140707_OR006_02 C20140707_OR006_02 TB437090.[MT7]-SIFY[MT7]QLLR.3b5_2.heavy 443.271 / 464.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK15 mitogen-activated protein kinase 15 2157 273 C20140707_OR006_02 C20140707_OR006_02 TB437090.[MT7]-SIFY[MT7]QLLR.3y5_1.heavy 443.271 / 836.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPK15 mitogen-activated protein kinase 15 2159 274 C20140707_OR006_02 C20140707_OR006_02 TB412364.[MT7]-ATVHIQVNDVNEYAPVFK[MT7].3b9_2.heavy 778.089 / 561.805 24819.0 36.47959899902344 46 16 10 10 10 2.3120327632013757 43.25198223468691 0.0 3 0.9610920394032973 6.236269236464618 24819.0 189.85051792828688 0.0 - - - - - - - 268.57142857142856 49 7 CLSTN1 calsyntenin 1 2161 274 C20140707_OR006_02 C20140707_OR006_02 TB412364.[MT7]-ATVHIQVNDVNEYAPVFK[MT7].3b9_1.heavy 778.089 / 1122.6 2758.0 36.47959899902344 46 16 10 10 10 2.3120327632013757 43.25198223468691 0.0 3 0.9610920394032973 6.236269236464618 2758.0 12.344793710451437 0.0 - - - - - - - 232.85714285714286 5 7 CLSTN1 calsyntenin 1 2163 274 C20140707_OR006_02 C20140707_OR006_02 TB412364.[MT7]-ATVHIQVNDVNEYAPVFK[MT7].3b4_1.heavy 778.089 / 553.321 27075.0 36.47959899902344 46 16 10 10 10 2.3120327632013757 43.25198223468691 0.0 3 0.9610920394032973 6.236269236464618 27075.0 52.09328831686758 0.0 - - - - - - - 313.375 54 8 CLSTN1 calsyntenin 1 2165 274 C20140707_OR006_02 C20140707_OR006_02 TB412364.[MT7]-ATVHIQVNDVNEYAPVFK[MT7].3y4_1.heavy 778.089 / 634.404 35975.0 36.47959899902344 46 16 10 10 10 2.3120327632013757 43.25198223468691 0.0 3 0.9610920394032973 6.236269236464618 35975.0 61.24040205445358 0.0 - - - - - - - 292.6666666666667 71 3 CLSTN1 calsyntenin 1 2167 275 C20140707_OR006_02 C20140707_OR006_02 TB437484.[MT7]-ATVHIQVNDVNEYAPVFK[MT7].4y4_1.heavy 583.819 / 634.404 75255.0 36.47959899902344 43 13 10 10 10 1.0163846235974487 56.476194062805526 0.0 3 0.9089549428142705 4.0586605562938605 75255.0 141.54966370752612 0.0 - - - - - - - 703.6 150 10 CLSTN1 calsyntenin 1 2169 275 C20140707_OR006_02 C20140707_OR006_02 TB437484.[MT7]-ATVHIQVNDVNEYAPVFK[MT7].4b4_1.heavy 583.819 / 553.321 29273.0 36.47959899902344 43 13 10 10 10 1.0163846235974487 56.476194062805526 0.0 3 0.9089549428142705 4.0586605562938605 29273.0 93.37077586206897 0.0 - - - - - - - 241.69230769230768 58 13 CLSTN1 calsyntenin 1 2171 275 C20140707_OR006_02 C20140707_OR006_02 TB437484.[MT7]-ATVHIQVNDVNEYAPVFK[MT7].4b5_1.heavy 583.819 / 666.406 10176.0 36.47959899902344 43 13 10 10 10 1.0163846235974487 56.476194062805526 0.0 3 0.9089549428142705 4.0586605562938605 10176.0 29.96116710875332 0.0 - - - - - - - 700.0 20 7 CLSTN1 calsyntenin 1 2173 275 C20140707_OR006_02 C20140707_OR006_02 TB437484.[MT7]-ATVHIQVNDVNEYAPVFK[MT7].4b9_2.heavy 583.819 / 561.805 72240.0 36.47959899902344 43 13 10 10 10 1.0163846235974487 56.476194062805526 0.0 3 0.9089549428142705 4.0586605562938605 72240.0 74.96072449764351 0.0 - - - - - - - 335.1666666666667 144 6 CLSTN1 calsyntenin 1 2175 276 C20140707_OR006_02 C20140707_OR006_02 TB436869.[MT7]-SITWQR.2b3_1.heavy 467.765 / 446.273 N/A 26.714799880981445 30 14 2 10 4 1.626788738291578 61.47079681963994 0.0 9 0.9311012282227725 4.674455085842217 1874.0 1.226759024620959 9.0 - - - - - - - 781.0 31 9 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2177 276 C20140707_OR006_02 C20140707_OR006_02 TB436869.[MT7]-SITWQR.2y4_1.heavy 467.765 / 590.305 5623.0 26.714799880981445 30 14 2 10 4 1.626788738291578 61.47079681963994 0.0 9 0.9311012282227725 4.674455085842217 5623.0 21.93173939888957 0.0 - - - - - - - 273.0 11 9 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2179 276 C20140707_OR006_02 C20140707_OR006_02 TB436869.[MT7]-SITWQR.2y5_1.heavy 467.765 / 703.389 5038.0 26.714799880981445 30 14 2 10 4 1.626788738291578 61.47079681963994 0.0 9 0.9311012282227725 4.674455085842217 5038.0 34.08903133903134 1.0 - - - - - - - 222.4 10 10 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2181 276 C20140707_OR006_02 C20140707_OR006_02 TB436869.[MT7]-SITWQR.2b4_1.heavy 467.765 / 632.352 469.0 26.714799880981445 30 14 2 10 4 1.626788738291578 61.47079681963994 0.0 9 0.9311012282227725 4.674455085842217 469.0 0.36006825938566545 15.0 - - - - - - - 307.5 8 8 ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 2183 277 C20140707_OR006_02 C20140707_OR006_02 TB436868.[MT7]-SSSPHK[MT7].2y4_1.heavy 465.766 / 612.359 106.0 12.39817500114441 45 18 10 7 10 3.7372318287472086 26.757772753295292 0.02550029754638672 3 0.9855014138042312 10.237016909667576 106.0 2.8266666666666667 2.0 - - - - - - - 0.0 0 0 LPIN1 lipin 1 2185 277 C20140707_OR006_02 C20140707_OR006_02 TB436868.[MT7]-SSSPHK[MT7].2b5_1.heavy 465.766 / 640.317 83.0 12.39817500114441 45 18 10 7 10 3.7372318287472086 26.757772753295292 0.02550029754638672 3 0.9855014138042312 10.237016909667576 83.0 2.88695652173913 10.0 - - - - - - - 0.0 0 0 LPIN1 lipin 1 2187 277 C20140707_OR006_02 C20140707_OR006_02 TB436868.[MT7]-SSSPHK[MT7].2y5_1.heavy 465.766 / 699.391 136.0 12.39817500114441 45 18 10 7 10 3.7372318287472086 26.757772753295292 0.02550029754638672 3 0.9855014138042312 10.237016909667576 136.0 5.9524637681159405 0.0 - - - - - - - 0.0 0 0 LPIN1 lipin 1 2189 277 C20140707_OR006_02 C20140707_OR006_02 TB436868.[MT7]-SSSPHK[MT7].2y3_1.heavy 465.766 / 525.326 439.0 12.39817500114441 45 18 10 7 10 3.7372318287472086 26.757772753295292 0.02550029754638672 3 0.9855014138042312 10.237016909667576 439.0 18.48421052631579 0.0 - - - - - - - 0.0 0 0 LPIN1 lipin 1 2191 278 C20140707_OR006_02 C20140707_OR006_02 TB437343.[MT7]-GYDAPLC[CAM]NLLLFK[MT7].3b5_1.heavy 604.67 / 648.311 1905.0 47.87289810180664 46 18 10 10 8 6.143256400350948 16.278011771458416 0.0 4 0.9879112247209676 11.213281820053556 1905.0 22.451785714285716 3.0 - - - - - - - 161.77777777777777 4 9 ACSL4 acyl-CoA synthetase long-chain family member 4 2193 278 C20140707_OR006_02 C20140707_OR006_02 TB437343.[MT7]-GYDAPLC[CAM]NLLLFK[MT7].3y4_1.heavy 604.67 / 664.451 2465.0 47.87289810180664 46 18 10 10 8 6.143256400350948 16.278011771458416 0.0 4 0.9879112247209676 11.213281820053556 2465.0 28.098065476190477 1.0 - - - - - - - 186.66666666666666 4 6 ACSL4 acyl-CoA synthetase long-chain family member 4 2195 278 C20140707_OR006_02 C20140707_OR006_02 TB437343.[MT7]-GYDAPLC[CAM]NLLLFK[MT7].3b8_1.heavy 604.67 / 1035.47 3025.0 47.87289810180664 46 18 10 10 8 6.143256400350948 16.278011771458416 0.0 4 0.9879112247209676 11.213281820053556 3025.0 53.99084821428572 0.0 - - - - - - - 140.0 6 4 ACSL4 acyl-CoA synthetase long-chain family member 4 2197 278 C20140707_OR006_02 C20140707_OR006_02 TB437343.[MT7]-GYDAPLC[CAM]NLLLFK[MT7].3b7_1.heavy 604.67 / 921.426 784.0 47.87289810180664 46 18 10 10 8 6.143256400350948 16.278011771458416 0.0 4 0.9879112247209676 11.213281820053556 784.0 0.20999999999999996 2.0 - - - - - - - 242.66666666666666 2 6 ACSL4 acyl-CoA synthetase long-chain family member 4 2199 279 C20140707_OR006_02 C20140707_OR006_02 TB437342.[MT7]-K[MT7]IYPTIWWLFR.3y8_1.heavy 604.359 / 1118.61 519.0 49.34602451324463 24 9 10 1 4 1.1926364417432833 65.39179772045708 0.09849929809570312 9 0.8036608089302609 2.7383095859759865 519.0 5.948538461538461 1.0 - - - - - - - 0.0 1 0 G6PD glucose-6-phosphate dehydrogenase 2201 279 C20140707_OR006_02 C20140707_OR006_02 TB437342.[MT7]-K[MT7]IYPTIWWLFR.3y5_1.heavy 604.359 / 807.43 1142.0 49.34602451324463 24 9 10 1 4 1.1926364417432833 65.39179772045708 0.09849929809570312 9 0.8036608089302609 2.7383095859759865 1142.0 16.80057692307692 2.0 - - - - - - - 173.0 3 3 G6PD glucose-6-phosphate dehydrogenase 2203 279 C20140707_OR006_02 C20140707_OR006_02 TB437342.[MT7]-K[MT7]IYPTIWWLFR.3y4_1.heavy 604.359 / 621.351 2699.0 49.34602451324463 24 9 10 1 4 1.1926364417432833 65.39179772045708 0.09849929809570312 9 0.8036608089302609 2.7383095859759865 2699.0 16.057707782245267 0.0 - - - - - - - 249.2 5 5 G6PD glucose-6-phosphate dehydrogenase 2205 279 C20140707_OR006_02 C20140707_OR006_02 TB437342.[MT7]-K[MT7]IYPTIWWLFR.3b3_1.heavy 604.359 / 693.454 623.0 49.34602451324463 24 9 10 1 4 1.1926364417432833 65.39179772045708 0.09849929809570312 9 0.8036608089302609 2.7383095859759865 623.0 4.798086198367549 7.0 - - - - - - - 0.0 1 0 G6PD glucose-6-phosphate dehydrogenase 2207 280 C20140707_OR006_02 C20140707_OR006_02 TB436961.[MT7]-IQSPQEK[MT7].2y6_1.heavy 559.326 / 860.459 2876.0 19.53220049540202 32 17 2 5 8 2.730245544366337 36.6267423112704 0.04020118713378906 4 0.9709141952461576 7.218775215172288 2876.0 18.635142778068207 2.0 - - - - - - - 199.71428571428572 6 7 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 2209 280 C20140707_OR006_02 C20140707_OR006_02 TB436961.[MT7]-IQSPQEK[MT7].2y4_1.heavy 559.326 / 645.369 4974.0 19.53220049540202 32 17 2 5 8 2.730245544366337 36.6267423112704 0.04020118713378906 4 0.9709141952461576 7.218775215172288 4974.0 12.38048625573876 0.0 - - - - - - - 275.45454545454544 9 11 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 2211 280 C20140707_OR006_02 C20140707_OR006_02 TB436961.[MT7]-IQSPQEK[MT7].2y5_1.heavy 559.326 / 732.401 3109.0 19.53220049540202 32 17 2 5 8 2.730245544366337 36.6267423112704 0.04020118713378906 4 0.9709141952461576 7.218775215172288 3109.0 10.519921594957129 0.0 - - - - - - - 254.36363636363637 6 11 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 2213 280 C20140707_OR006_02 C20140707_OR006_02 TB436961.[MT7]-IQSPQEK[MT7].2y3_1.heavy 559.326 / 548.316 N/A 19.53220049540202 32 17 2 5 8 2.730245544366337 36.6267423112704 0.04020118713378906 4 0.9709141952461576 7.218775215172288 855.0 0.769900669008841 10.0 - - - - - - - 279.8 22 10 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 2215 281 C20140707_OR006_02 C20140707_OR006_02 TB437340.[MT7]-DGLLPENTFIVGYAR.3y7_1.heavy 603.66 / 825.462 1262.0 42.25992679595947 44 18 10 6 10 6.589784809503058 15.175002354521665 0.035900115966796875 3 0.9877630651437251 11.145054059246217 1262.0 4.733274423171331 1.0 - - - - - - - 222.52941176470588 2 17 G6PD glucose-6-phosphate dehydrogenase 2217 281 C20140707_OR006_02 C20140707_OR006_02 TB437340.[MT7]-DGLLPENTFIVGYAR.3y6_1.heavy 603.66 / 678.393 5144.0 42.25992679595947 44 18 10 6 10 6.589784809503058 15.175002354521665 0.035900115966796875 3 0.9877630651437251 11.145054059246217 5144.0 20.505292096219932 0.0 - - - - - - - 226.33333333333334 10 15 G6PD glucose-6-phosphate dehydrogenase 2219 281 C20140707_OR006_02 C20140707_OR006_02 TB437340.[MT7]-DGLLPENTFIVGYAR.3b4_1.heavy 603.66 / 543.326 7959.0 42.25992679595947 44 18 10 6 10 6.589784809503058 15.175002354521665 0.035900115966796875 3 0.9877630651437251 11.145054059246217 7959.0 12.582302443504759 0.0 - - - - - - - 818.0 15 7 G6PD glucose-6-phosphate dehydrogenase 2221 281 C20140707_OR006_02 C20140707_OR006_02 TB437340.[MT7]-DGLLPENTFIVGYAR.3y5_1.heavy 603.66 / 565.309 6503.0 42.25992679595947 44 18 10 6 10 6.589784809503058 15.175002354521665 0.035900115966796875 3 0.9877630651437251 11.145054059246217 6503.0 12.248920736859894 0.0 - - - - - - - 282.9166666666667 13 12 G6PD glucose-6-phosphate dehydrogenase 2223 282 C20140707_OR006_02 C20140707_OR006_02 TB437207.[MT7]-SNHPEDLQAANR.2y6_1.heavy 748.372 / 672.379 768.0 17.412400245666504 45 20 10 5 10 3.9781373229994976 25.13739267416753 0.04279899597167969 3 0.9923008695163972 14.056024153672514 768.0 15.039266615737203 0.0 - - - - - - - 0.0 1 0 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 2225 282 C20140707_OR006_02 C20140707_OR006_02 TB437207.[MT7]-SNHPEDLQAANR.2y8_1.heavy 748.372 / 916.448 410.0 17.412400245666504 45 20 10 5 10 3.9781373229994976 25.13739267416753 0.04279899597167969 3 0.9923008695163972 14.056024153672514 410.0 16.070392156862745 0.0 - - - - - - - 0.0 0 0 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 2227 282 C20140707_OR006_02 C20140707_OR006_02 TB437207.[MT7]-SNHPEDLQAANR.2y10_1.heavy 748.372 / 1150.56 358.0 17.412400245666504 45 20 10 5 10 3.9781373229994976 25.13739267416753 0.04279899597167969 3 0.9923008695163972 14.056024153672514 358.0 13.688235294117646 0.0 - - - - - - - 0.0 0 0 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2 2229 282 C20140707_OR006_02 C20140707_OR006_02 TB437207.[MT7]-SNHPEDLQAANR.2y9_1.heavy 748.372 / 1013.5 2201.0 17.412400245666504 45 20 10 5 10 3.9781373229994976 25.13739267416753 0.04279899597167969 3 0.9923008695163972 14.056024153672514 2201.0 69.05098039215686 0.0 - - - - - - - 51.0 4 4 GGA2 golgi-associated, gamma adaptin ear containing, ARF binding protein 2