Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140707_OR006_04 C20140707_OR006_04 TB450301.[MT7]-GVDIYPENLNSK[MT7].3b4_1.heavy 546.298 / 529.31 50542.0 31.524599075317383 50 20 10 10 10 19.124286318341092 5.228953297153645 0.0 3 0.9972446834095071 23.505898012794034 50542.0 41.661203646742734 0.0 - - - - - - - 600.4 101 5 SYT4 synaptotagmin IV 3 1 C20140707_OR006_04 C20140707_OR006_04 TB450301.[MT7]-GVDIYPENLNSK[MT7].3b5_1.heavy 546.298 / 692.374 23269.0 31.524599075317383 50 20 10 10 10 19.124286318341092 5.228953297153645 0.0 3 0.9972446834095071 23.505898012794034 23269.0 57.697198507661554 0.0 - - - - - - - 719.375 46 8 SYT4 synaptotagmin IV 5 1 C20140707_OR006_04 C20140707_OR006_04 TB450301.[MT7]-GVDIYPENLNSK[MT7].3y4_1.heavy 546.298 / 605.374 6005.0 31.524599075317383 50 20 10 10 10 19.124286318341092 5.228953297153645 0.0 3 0.9972446834095071 23.505898012794034 6005.0 8.710344902832915 0.0 - - - - - - - 1179.5714285714287 12 7 SYT4 synaptotagmin IV 7 1 C20140707_OR006_04 C20140707_OR006_04 TB450301.[MT7]-GVDIYPENLNSK[MT7].3y5_1.heavy 546.298 / 719.417 7381.0 31.524599075317383 50 20 10 10 10 19.124286318341092 5.228953297153645 0.0 3 0.9972446834095071 23.505898012794034 7381.0 23.619200000000003 0.0 - - - - - - - 152.77777777777777 14 9 SYT4 synaptotagmin IV 9 2 C20140707_OR006_04 C20140707_OR006_04 TB411798.[MT7]-QLQEFEK[MT7].3y3_1.heavy 403.895 / 567.326 8189.0 27.480899810791016 45 20 10 5 10 26.206451092363867 3.815854334780125 0.0447998046875 3 0.9990812786154797 40.713384043364655 8189.0 31.196190476190473 0.0 - - - - - - - 126.0 16 2 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 11 2 C20140707_OR006_04 C20140707_OR006_04 TB411798.[MT7]-QLQEFEK[MT7].3b4_1.heavy 403.895 / 643.353 7307.0 27.480899810791016 45 20 10 5 10 26.206451092363867 3.815854334780125 0.0447998046875 3 0.9990812786154797 40.713384043364655 7307.0 37.11492063492064 0.0 - - - - - - - 216.0 14 7 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 13 2 C20140707_OR006_04 C20140707_OR006_04 TB411798.[MT7]-QLQEFEK[MT7].3y4_1.heavy 403.895 / 696.369 1512.0 27.480899810791016 45 20 10 5 10 26.206451092363867 3.815854334780125 0.0447998046875 3 0.9990812786154797 40.713384043364655 1512.0 15.420000000000002 0.0 - - - - - - - 210.0 3 6 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 15 2 C20140707_OR006_04 C20140707_OR006_04 TB411798.[MT7]-QLQEFEK[MT7].3b3_1.heavy 403.895 / 514.311 8567.0 27.480899810791016 45 20 10 5 10 26.206451092363867 3.815854334780125 0.0447998046875 3 0.9990812786154797 40.713384043364655 8567.0 86.57656084656085 0.0 - - - - - - - 210.0 17 6 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 17 3 C20140707_OR006_04 C20140707_OR006_04 TB411921.[MT7]-QC[CAM]C[CAM]DEIMK[MT7].2y4_1.heavy 686.319 / 664.382 1934.0 23.313499450683594 46 16 10 10 10 1.7192795906423364 40.20490301798307 0.0 3 0.9605172381152832 6.190407253841478 1934.0 3.2744871019569817 1.0 - - - - - - - 284.5 6 8 RTKN rhotekin 19 3 C20140707_OR006_04 C20140707_OR006_04 TB411921.[MT7]-QC[CAM]C[CAM]DEIMK[MT7].2b4_1.heavy 686.319 / 708.256 2730.0 23.313499450683594 46 16 10 10 10 1.7192795906423364 40.20490301798307 0.0 3 0.9605172381152832 6.190407253841478 2730.0 6.755276381909548 0.0 - - - - - - - 250.6 5 5 RTKN rhotekin 21 3 C20140707_OR006_04 C20140707_OR006_04 TB411921.[MT7]-QC[CAM]C[CAM]DEIMK[MT7].2b5_1.heavy 686.319 / 837.299 2048.0 23.313499450683594 46 16 10 10 10 1.7192795906423364 40.20490301798307 0.0 3 0.9605172381152832 6.190407253841478 2048.0 14.868414673046251 0.0 - - - - - - - 227.6 4 5 RTKN rhotekin 23 3 C20140707_OR006_04 C20140707_OR006_04 TB411921.[MT7]-QC[CAM]C[CAM]DEIMK[MT7].2y7_1.heavy 686.319 / 1099.47 3526.0 23.313499450683594 46 16 10 10 10 1.7192795906423364 40.20490301798307 0.0 3 0.9605172381152832 6.190407253841478 3526.0 5.947261862917399 1.0 - - - - - - - 186.45454545454547 7 11 RTKN rhotekin 25 4 C20140707_OR006_04 C20140707_OR006_04 TB450482.[MT7]-EAEESLQQQQQEQEEALK[MT7].3b6_1.heavy 811.738 / 803.39 1569.0 27.54782485961914 36 14 10 2 10 1.2773226121586627 45.55106967938567 0.0886993408203125 3 0.9343502208272955 4.790056819806048 1569.0 0.4165631469979295 2.0 - - - - - - - 316.875 3 8 GRIPAP1 GRIP1 associated protein 1 27 4 C20140707_OR006_04 C20140707_OR006_04 TB450482.[MT7]-EAEESLQQQQQEQEEALK[MT7].3b7_1.heavy 811.738 / 931.449 2414.0 27.54782485961914 36 14 10 2 10 1.2773226121586627 45.55106967938567 0.0886993408203125 3 0.9343502208272955 4.790056819806048 2414.0 -0.5000517866390471 2.0 - - - - - - - 301.875 4 8 GRIPAP1 GRIP1 associated protein 1 29 4 C20140707_OR006_04 C20140707_OR006_04 TB450482.[MT7]-EAEESLQQQQQEQEEALK[MT7].3b4_1.heavy 811.738 / 603.274 3259.0 27.54782485961914 36 14 10 2 10 1.2773226121586627 45.55106967938567 0.0886993408203125 3 0.9343502208272955 4.790056819806048 3259.0 4.705493497007104 0.0 - - - - - - - 362.1666666666667 6 6 GRIPAP1 GRIP1 associated protein 1 31 4 C20140707_OR006_04 C20140707_OR006_04 TB450482.[MT7]-EAEESLQQQQQEQEEALK[MT7].3b5_1.heavy 811.738 / 690.306 2293.0 27.54782485961914 36 14 10 2 10 1.2773226121586627 45.55106967938567 0.0886993408203125 3 0.9343502208272955 4.790056819806048 2293.0 8.7855664209728 1.0 - - - - - - - 258.57142857142856 4 7 GRIPAP1 GRIP1 associated protein 1 33 5 C20140707_OR006_04 C20140707_OR006_04 TB450481.[MT7]-EAEESLQQQQQEQEEALK[MT7].4y4_1.heavy 609.055 / 604.379 5794.0 27.514474868774414 34 13 10 5 6 1.1112776638798645 58.834860302450295 0.04470062255859375 5 0.9215668015146812 4.377559843414682 5794.0 4.880361748770229 1.0 - - - - - - - 422.5 11 2 GRIPAP1 GRIP1 associated protein 1 35 5 C20140707_OR006_04 C20140707_OR006_04 TB450481.[MT7]-EAEESLQQQQQEQEEALK[MT7].4b4_1.heavy 609.055 / 603.274 4587.0 27.514474868774414 34 13 10 5 6 1.1112776638798645 58.834860302450295 0.04470062255859375 5 0.9215668015146812 4.377559843414682 4587.0 1.8182158962243284 3.0 - - - - - - - 362.0 10 1 GRIPAP1 GRIP1 associated protein 1 37 5 C20140707_OR006_04 C20140707_OR006_04 TB450481.[MT7]-EAEESLQQQQQEQEEALK[MT7].4b5_1.heavy 609.055 / 690.306 6639.0 27.514474868774414 34 13 10 5 6 1.1112776638798645 58.834860302450295 0.04470062255859375 5 0.9215668015146812 4.377559843414682 6639.0 19.93074534161491 0.0 - - - - - - - 793.1428571428571 13 7 GRIPAP1 GRIP1 associated protein 1 39 5 C20140707_OR006_04 C20140707_OR006_04 TB450481.[MT7]-EAEESLQQQQQEQEEALK[MT7].4b6_1.heavy 609.055 / 803.39 1569.0 27.514474868774414 34 13 10 5 6 1.1112776638798645 58.834860302450295 0.04470062255859375 5 0.9215668015146812 4.377559843414682 1569.0 1.3290755389867324 2.0 - - - - - - - 281.55555555555554 3 9 GRIPAP1 GRIP1 associated protein 1 41 6 C20140707_OR006_04 C20140707_OR006_04 TB450186.[MT7]-IDVSVAAGHTDR.3y7_1.heavy 462.248 / 727.348 3974.0 25.33049964904785 42 12 10 10 10 4.059770097050518 24.63193668839806 0.0 3 0.8848180521373418 3.60089664372134 3974.0 65.8597094017094 0.0 - - - - - - - 136.5 7 6 GRIPAP1 GRIP1 associated protein 1 43 6 C20140707_OR006_04 C20140707_OR006_04 TB450186.[MT7]-IDVSVAAGHTDR.3y6_1.heavy 462.248 / 656.311 4442.0 25.33049964904785 42 12 10 10 10 4.059770097050518 24.63193668839806 0.0 3 0.8848180521373418 3.60089664372134 4442.0 37.79307231969103 1.0 - - - - - - - 195.0 10 3 GRIPAP1 GRIP1 associated protein 1 45 6 C20140707_OR006_04 C20140707_OR006_04 TB450186.[MT7]-IDVSVAAGHTDR.3b4_1.heavy 462.248 / 559.321 2104.0 25.33049964904785 42 12 10 10 10 4.059770097050518 24.63193668839806 0.0 3 0.8848180521373418 3.60089664372134 2104.0 17.423247863247862 1.0 - - - - - - - 117.0 4 2 GRIPAP1 GRIP1 associated protein 1 47 6 C20140707_OR006_04 C20140707_OR006_04 TB450186.[MT7]-IDVSVAAGHTDR.3y5_1.heavy 462.248 / 585.274 7130.0 25.33049964904785 42 12 10 10 10 4.059770097050518 24.63193668839806 0.0 3 0.8848180521373418 3.60089664372134 7130.0 76.78461538461538 0.0 - - - - - - - 217.28571428571428 14 7 GRIPAP1 GRIP1 associated protein 1 49 7 C20140707_OR006_04 C20140707_OR006_04 TB450489.[MT7]-TDAERVVNQYQELVQNEAK[MT7].4y5_1.heavy 631.333 / 733.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM48A family with sequence similarity 48, member A 51 7 C20140707_OR006_04 C20140707_OR006_04 TB450489.[MT7]-TDAERVVNQYQELVQNEAK[MT7].4y4_1.heavy 631.333 / 605.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM48A family with sequence similarity 48, member A 53 7 C20140707_OR006_04 C20140707_OR006_04 TB450489.[MT7]-TDAERVVNQYQELVQNEAK[MT7].4b12_2.heavy 631.333 / 789.387 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM48A family with sequence similarity 48, member A 55 7 C20140707_OR006_04 C20140707_OR006_04 TB450489.[MT7]-TDAERVVNQYQELVQNEAK[MT7].4b9_2.heavy 631.333 / 579.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM48A family with sequence similarity 48, member A 57 8 C20140707_OR006_04 C20140707_OR006_04 TB412177.[MT7]-LHILEDLNMLYIR.3b6_1.heavy 596.338 / 865.49 14026.0 47.03100109100342 42 16 10 6 10 3.600598806310986 27.773158127121516 0.035999298095703125 3 0.9685993376770565 6.946242457490641 14026.0 63.02290996093159 0.0 - - - - - - - 195.45454545454547 28 11 RTKN rhotekin 59 8 C20140707_OR006_04 C20140707_OR006_04 TB412177.[MT7]-LHILEDLNMLYIR.3y6_1.heavy 596.338 / 809.434 20705.0 47.03100109100342 42 16 10 6 10 3.600598806310986 27.773158127121516 0.035999298095703125 3 0.9685993376770565 6.946242457490641 20705.0 280.3334358310406 0.0 - - - - - - - 241.125 41 8 RTKN rhotekin 61 8 C20140707_OR006_04 C20140707_OR006_04 TB412177.[MT7]-LHILEDLNMLYIR.3y4_1.heavy 596.338 / 564.35 37255.0 47.03100109100342 42 16 10 6 10 3.600598806310986 27.773158127121516 0.035999298095703125 3 0.9685993376770565 6.946242457490641 37255.0 259.3345012207136 0.0 - - - - - - - 222.5 74 12 RTKN rhotekin 63 8 C20140707_OR006_04 C20140707_OR006_04 TB412177.[MT7]-LHILEDLNMLYIR.3b3_1.heavy 596.338 / 508.336 32802.0 47.03100109100342 42 16 10 6 10 3.600598806310986 27.773158127121516 0.035999298095703125 3 0.9685993376770565 6.946242457490641 32802.0 141.3956813417191 0.0 - - - - - - - 275.57142857142856 65 7 RTKN rhotekin 65 9 C20140707_OR006_04 C20140707_OR006_04 TB449906.[MT7]-LSEAAGR.2b3_1.heavy 424.241 / 474.268 1671.0 18.729999542236328 43 18 9 10 6 6.694088022970715 14.938554685395639 0.0 5 0.9835690619120946 9.614677803282504 1671.0 12.449967121826958 2.0 - - - - - - - 199.0 11 10 PEX19 peroxisomal biogenesis factor 19 67 9 C20140707_OR006_04 C20140707_OR006_04 TB449906.[MT7]-LSEAAGR.2y5_1.heavy 424.241 / 503.257 1512.0 18.729999542236328 43 18 9 10 6 6.694088022970715 14.938554685395639 0.0 5 0.9835690619120946 9.614677803282504 1512.0 20.280263736263734 2.0 - - - - - - - 159.25 5 8 PEX19 peroxisomal biogenesis factor 19 69 9 C20140707_OR006_04 C20140707_OR006_04 TB449906.[MT7]-LSEAAGR.2b4_1.heavy 424.241 / 545.305 1910.0 18.729999542236328 43 18 9 10 6 6.694088022970715 14.938554685395639 0.0 5 0.9835690619120946 9.614677803282504 1910.0 4.00440251572327 1.0 - - - - - - - 218.875 3 16 PEX19 peroxisomal biogenesis factor 19 71 9 C20140707_OR006_04 C20140707_OR006_04 TB449906.[MT7]-LSEAAGR.2y6_1.heavy 424.241 / 590.289 5093.0 18.729999542236328 43 18 9 10 6 6.694088022970715 14.938554685395639 0.0 5 0.9835690619120946 9.614677803282504 5093.0 18.68286432160804 0.0 - - - - - - - 191.0 10 10 PEX19 peroxisomal biogenesis factor 19 73 10 C20140707_OR006_04 C20140707_OR006_04 TB412278.[MT7]-IETPAPRK[MT7]PPQALAK[MT7].4y4_1.heavy 513.069 / 546.373 2289.0 24.723775386810303 35 16 9 6 4 2.82877984224964 35.350930640283806 0.03989982604980469 8 0.9607088430614248 6.205583324039197 2289.0 4.463946042589253 3.0 - - - - - - - 240.71428571428572 4 7 RTKN rhotekin 75 10 C20140707_OR006_04 C20140707_OR006_04 TB412278.[MT7]-IETPAPRK[MT7]PPQALAK[MT7].4b5_1.heavy 513.069 / 656.374 723.0 24.723775386810303 35 16 9 6 4 2.82877984224964 35.350930640283806 0.03989982604980469 8 0.9607088430614248 6.205583324039197 723.0 0.7715302491103201 5.0 - - - - - - - 0.0 1 0 RTKN rhotekin 77 10 C20140707_OR006_04 C20140707_OR006_04 TB412278.[MT7]-IETPAPRK[MT7]PPQALAK[MT7].4y7_1.heavy 513.069 / 868.537 723.0 24.723775386810303 35 16 9 6 4 2.82877984224964 35.350930640283806 0.03989982604980469 8 0.9607088430614248 6.205583324039197 723.0 -0.20000000000000007 3.0 - - - - - - - 228.6 2 10 RTKN rhotekin 79 10 C20140707_OR006_04 C20140707_OR006_04 TB412278.[MT7]-IETPAPRK[MT7]PPQALAK[MT7].4y6_1.heavy 513.069 / 771.484 723.0 24.723775386810303 35 16 9 6 4 2.82877984224964 35.350930640283806 0.03989982604980469 8 0.9607088430614248 6.205583324039197 723.0 5.743 5.0 - - - - - - - 160.33333333333334 6 3 RTKN rhotekin 81 11 C20140707_OR006_04 C20140707_OR006_04 TB411790.[MT7]-SGVSTFWK[MT7].3y3_1.heavy 400.56 / 624.363 1181.0 33.72017478942871 45 20 10 5 10 11.555295489270735 8.654040919408033 0.04470062255859375 3 0.9976949865739752 25.70053615888026 1181.0 7.512340805261066 0.0 - - - - - - - 196.5 2 2 KLHL1 kelch-like 1 (Drosophila) 83 11 C20140707_OR006_04 C20140707_OR006_04 TB411790.[MT7]-SGVSTFWK[MT7].3b4_1.heavy 400.56 / 475.263 2099.0 33.72017478942871 45 20 10 5 10 11.555295489270735 8.654040919408033 0.04470062255859375 3 0.9976949865739752 25.70053615888026 2099.0 9.867910838144688 0.0 - - - - - - - 236.0 4 5 KLHL1 kelch-like 1 (Drosophila) 85 11 C20140707_OR006_04 C20140707_OR006_04 TB411790.[MT7]-SGVSTFWK[MT7].3b5_1.heavy 400.56 / 576.311 1574.0 33.72017478942871 45 20 10 5 10 11.555295489270735 8.654040919408033 0.04470062255859375 3 0.9976949865739752 25.70053615888026 1574.0 23.30961832061069 0.0 - - - - - - - 243.57142857142858 3 7 KLHL1 kelch-like 1 (Drosophila) 87 11 C20140707_OR006_04 C20140707_OR006_04 TB411790.[MT7]-SGVSTFWK[MT7].3b3_1.heavy 400.56 / 388.231 5772.0 33.72017478942871 45 20 10 5 10 11.555295489270735 8.654040919408033 0.04470062255859375 3 0.9976949865739752 25.70053615888026 5772.0 29.11187348724632 0.0 - - - - - - - 361.0 11 4 KLHL1 kelch-like 1 (Drosophila) 89 12 C20140707_OR006_04 C20140707_OR006_04 TB436893.[MT7]-QIVVDK[MT7].2y4_1.heavy 495.315 / 604.379 3036.0 23.416900634765625 38 13 10 5 10 1.0405130413061017 64.3516111167106 0.04199981689453125 3 0.9205078485980802 4.347909113911117 3036.0 18.008410256410258 0.0 - - - - - - - 245.4 6 10 C6 complement component 6 91 12 C20140707_OR006_04 C20140707_OR006_04 TB436893.[MT7]-QIVVDK[MT7].2y5_1.heavy 495.315 / 717.463 1985.0 23.416900634765625 38 13 10 5 10 1.0405130413061017 64.3516111167106 0.04199981689453125 3 0.9205078485980802 4.347909113911117 1985.0 5.950749464668094 1.0 - - - - - - - 246.77777777777777 3 9 C6 complement component 6 93 12 C20140707_OR006_04 C20140707_OR006_04 TB436893.[MT7]-QIVVDK[MT7].2y3_1.heavy 495.315 / 505.31 2686.0 23.416900634765625 38 13 10 5 10 1.0405130413061017 64.3516111167106 0.04199981689453125 3 0.9205078485980802 4.347909113911117 2686.0 16.357665769871335 0.0 - - - - - - - 246.55555555555554 5 9 C6 complement component 6 95 12 C20140707_OR006_04 C20140707_OR006_04 TB436893.[MT7]-QIVVDK[MT7].2b5_1.heavy 495.315 / 699.416 2919.0 23.416900634765625 38 13 10 5 10 1.0405130413061017 64.3516111167106 0.04199981689453125 3 0.9205078485980802 4.347909113911117 2919.0 19.133884615384616 0.0 - - - - - - - 187.0 5 5 C6 complement component 6 97 13 C20140707_OR006_04 C20140707_OR006_04 TB412082.[MT7]-ATLILNSIGSLSK[MT7].2y8_1.heavy 802.995 / 949.544 4325.0 41.972599029541016 50 20 10 10 10 5.495491489910939 18.196734574803358 0.0 3 0.9906976108434773 12.785799138695126 4325.0 24.818340521667697 0.0 - - - - - - - 192.85714285714286 8 7 TCF19 transcription factor 19 99 13 C20140707_OR006_04 C20140707_OR006_04 TB412082.[MT7]-ATLILNSIGSLSK[MT7].2y5_1.heavy 802.995 / 635.385 6217.0 41.972599029541016 50 20 10 10 10 5.495491489910939 18.196734574803358 0.0 3 0.9906976108434773 12.785799138695126 6217.0 44.55516666666667 0.0 - - - - - - - 173.57142857142858 12 14 TCF19 transcription factor 19 101 13 C20140707_OR006_04 C20140707_OR006_04 TB412082.[MT7]-ATLILNSIGSLSK[MT7].2y9_1.heavy 802.995 / 1062.63 6397.0 41.972599029541016 50 20 10 10 10 5.495491489910939 18.196734574803358 0.0 3 0.9906976108434773 12.785799138695126 6397.0 15.88957708263258 0.0 - - - - - - - 225.0 12 8 TCF19 transcription factor 19 103 13 C20140707_OR006_04 C20140707_OR006_04 TB412082.[MT7]-ATLILNSIGSLSK[MT7].2b4_1.heavy 802.995 / 543.362 9640.0 41.972599029541016 50 20 10 10 10 5.495491489910939 18.196734574803358 0.0 3 0.9906976108434773 12.785799138695126 9640.0 39.259218164072536 0.0 - - - - - - - 174.0 19 15 TCF19 transcription factor 19 105 14 C20140707_OR006_04 C20140707_OR006_04 TB450178.[MT7]-NLLLIHNLK[MT7].3y3_1.heavy 455.966 / 518.342 21471.0 35.052799224853516 50 20 10 10 10 19.570731142095177 5.109671134611189 0.0 3 0.9989541904672069 38.15910809859085 21471.0 187.9044412270383 0.0 - - - - - - - 161.0 42 4 STAT4 signal transducer and activator of transcription 4 107 14 C20140707_OR006_04 C20140707_OR006_04 TB450178.[MT7]-NLLLIHNLK[MT7].3b4_1.heavy 455.966 / 598.404 21599.0 35.052799224853516 50 20 10 10 10 19.570731142095177 5.109671134611189 0.0 3 0.9989541904672069 38.15910809859085 21599.0 321.473488372093 0.0 - - - - - - - 171.83333333333334 43 6 STAT4 signal transducer and activator of transcription 4 109 14 C20140707_OR006_04 C20140707_OR006_04 TB450178.[MT7]-NLLLIHNLK[MT7].3y4_1.heavy 455.966 / 655.401 9000.0 35.052799224853516 50 20 10 10 10 19.570731142095177 5.109671134611189 0.0 3 0.9989541904672069 38.15910809859085 9000.0 104.43805990408107 0.0 - - - - - - - 129.0 18 3 STAT4 signal transducer and activator of transcription 4 111 14 C20140707_OR006_04 C20140707_OR006_04 TB450178.[MT7]-NLLLIHNLK[MT7].3b3_1.heavy 455.966 / 485.32 33299.0 35.052799224853516 50 20 10 10 10 19.570731142095177 5.109671134611189 0.0 3 0.9989541904672069 38.15910809859085 33299.0 170.73367005343385 0.0 - - - - - - - 225.0 66 8 STAT4 signal transducer and activator of transcription 4 113 15 C20140707_OR006_04 C20140707_OR006_04 TB450177.[MT7]-NSGLTEEEAK[MT7].3y3_1.heavy 455.908 / 491.295 1294.0 20.347750663757324 30 13 6 5 6 0.9929159496194466 59.63923751594627 0.043399810791015625 6 0.9117936321342609 4.124460889692013 1294.0 13.117399138268704 2.0 - - - - - - - 349.1111111111111 4 9 C6 complement component 6 115 15 C20140707_OR006_04 C20140707_OR006_04 TB450177.[MT7]-NSGLTEEEAK[MT7].3b4_1.heavy 455.908 / 516.29 1572.0 20.347750663757324 30 13 6 5 6 0.9929159496194466 59.63923751594627 0.043399810791015625 6 0.9117936321342609 4.124460889692013 1572.0 8.384081685145853 3.0 - - - - - - - 230.875 3 8 C6 complement component 6 117 15 C20140707_OR006_04 C20140707_OR006_04 TB450177.[MT7]-NSGLTEEEAK[MT7].3b5_1.heavy 455.908 / 617.338 647.0 20.347750663757324 30 13 6 5 6 0.9929159496194466 59.63923751594627 0.043399810791015625 6 0.9117936321342609 4.124460889692013 647.0 1.6345971964744528 2.0 - - - - - - - 0.0 1 0 C6 complement component 6 119 15 C20140707_OR006_04 C20140707_OR006_04 TB450177.[MT7]-NSGLTEEEAK[MT7].3y4_1.heavy 455.908 / 620.337 925.0 20.347750663757324 30 13 6 5 6 0.9929159496194466 59.63923751594627 0.043399810791015625 6 0.9117936321342609 4.124460889692013 925.0 0.4678700361010829 5.0 - - - - - - - 138.3 4 10 C6 complement component 6 121 16 C20140707_OR006_04 C20140707_OR006_04 TB449916.[MT7]-AASVLK[MT7].2y4_1.heavy 438.791 / 590.399 6248.0 22.17907476425171 44 20 10 6 8 9.763912974381233 10.241795503747541 0.03930091857910156 4 0.9973123962993795 23.800300419206177 6248.0 31.990810427866386 0.0 - - - - - - - 239.1818181818182 12 11 DNTT;POLM;PRKCI deoxynucleotidyltransferase, terminal;polymerase (DNA directed), mu;protein kinase C, iota 123 16 C20140707_OR006_04 C20140707_OR006_04 TB449916.[MT7]-AASVLK[MT7].2y5_1.heavy 438.791 / 661.437 11619.0 22.17907476425171 44 20 10 6 8 9.763912974381233 10.241795503747541 0.03930091857910156 4 0.9973123962993795 23.800300419206177 11619.0 150.7431407222914 0.0 - - - - - - - 219.25 23 4 DNTT;POLM;PRKCI deoxynucleotidyltransferase, terminal;polymerase (DNA directed), mu;protein kinase C, iota 125 16 C20140707_OR006_04 C20140707_OR006_04 TB449916.[MT7]-AASVLK[MT7].2y3_1.heavy 438.791 / 503.367 4384.0 22.17907476425171 44 20 10 6 8 9.763912974381233 10.241795503747541 0.03930091857910156 4 0.9973123962993795 23.800300419206177 4384.0 22.614554690427614 2.0 - - - - - - - 237.5 21 12 DNTT;POLM;PRKCI deoxynucleotidyltransferase, terminal;polymerase (DNA directed), mu;protein kinase C, iota 127 16 C20140707_OR006_04 C20140707_OR006_04 TB449916.[MT7]-AASVLK[MT7].2b5_1.heavy 438.791 / 586.368 1863.0 22.17907476425171 44 20 10 6 8 9.763912974381233 10.241795503747541 0.03930091857910156 4 0.9973123962993795 23.800300419206177 1863.0 11.335570637465128 2.0 - - - - - - - 239.1818181818182 14 11 DNTT;POLM;PRKCI deoxynucleotidyltransferase, terminal;polymerase (DNA directed), mu;protein kinase C, iota 129 17 C20140707_OR006_04 C20140707_OR006_04 TB412284.[MT7]-RSVLYFILLNALINK[MT7].3b6_1.heavy 689.097 / 910.527 234.0 52.409424781799316 34 8 10 6 10 1.5707654092817744 42.766822913899276 0.039897918701171875 3 0.7953847789467772 2.6803625403099955 234.0 -0.7986348122866894 16.0 - - - - - - - 0.0 0 0 C6 complement component 6 131 17 C20140707_OR006_04 C20140707_OR006_04 TB412284.[MT7]-RSVLYFILLNALINK[MT7].3y3_1.heavy 689.097 / 518.342 1112.0 52.409424781799316 34 8 10 6 10 1.5707654092817744 42.766822913899276 0.039897918701171875 3 0.7953847789467772 2.6803625403099955 1112.0 7.217409060412473 0.0 - - - - - - - 170.83333333333334 2 12 C6 complement component 6 133 17 C20140707_OR006_04 C20140707_OR006_04 TB412284.[MT7]-RSVLYFILLNALINK[MT7].3b7_1.heavy 689.097 / 1023.61 527.0 52.409424781799316 34 8 10 6 10 1.5707654092817744 42.766822913899276 0.039897918701171875 3 0.7953847789467772 2.6803625403099955 527.0 12.540966246559467 0.0 - - - - - - - 0.0 1 0 C6 complement component 6 135 17 C20140707_OR006_04 C20140707_OR006_04 TB412284.[MT7]-RSVLYFILLNALINK[MT7].3b5_1.heavy 689.097 / 763.458 644.0 52.409424781799316 34 8 10 6 10 1.5707654092817744 42.766822913899276 0.039897918701171875 3 0.7953847789467772 2.6803625403099955 644.0 10.151186440677964 2.0 - - - - - - - 0.0 1 0 C6 complement component 6 137 18 C20140707_OR006_04 C20140707_OR006_04 TB411644.[MT7]-SC[CAM]ANPNVGFQR.3y6_1.heavy 465.23 / 720.379 342.0 23.34447431564331 42 17 10 5 10 2.8141986166918063 35.53409464665066 0.04129981994628906 3 0.9702836873663018 7.141402867060324 342.0 4.5 12.0 - - - - - - - 0.0 1 0 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 139 18 C20140707_OR006_04 C20140707_OR006_04 TB411644.[MT7]-SC[CAM]ANPNVGFQR.3b4_1.heavy 465.23 / 577.252 1139.0 23.34447431564331 42 17 10 5 10 2.8141986166918063 35.53409464665066 0.04129981994628906 3 0.9702836873663018 7.141402867060324 1139.0 7.893070175438597 0.0 - - - - - - - 196.9090909090909 2 11 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 141 18 C20140707_OR006_04 C20140707_OR006_04 TB411644.[MT7]-SC[CAM]ANPNVGFQR.3y4_1.heavy 465.23 / 507.267 1139.0 23.34447431564331 42 17 10 5 10 2.8141986166918063 35.53409464665066 0.04129981994628906 3 0.9702836873663018 7.141402867060324 1139.0 10.990350877192983 0.0 - - - - - - - 171.0 2 10 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 143 18 C20140707_OR006_04 C20140707_OR006_04 TB411644.[MT7]-SC[CAM]ANPNVGFQR.3y5_1.heavy 465.23 / 606.336 1025.0 23.34447431564331 42 17 10 5 10 2.8141986166918063 35.53409464665066 0.04129981994628906 3 0.9702836873663018 7.141402867060324 1025.0 1.1988304093567248 0.0 - - - - - - - 209.0 2 6 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 145 19 C20140707_OR006_04 C20140707_OR006_04 TB450174.[MT7]-LSALPFADILR.2y8_1.heavy 680.409 / 944.556 755.0 48.496599197387695 35 17 6 6 6 2.4131647310507836 41.43935915906421 0.03679656982421875 6 0.9729803549656096 7.4909999845686315 755.0 1.3981481481481481 2.0 - - - - - - - 0.0 1 0 STAT4 signal transducer and activator of transcription 4 147 19 C20140707_OR006_04 C20140707_OR006_04 TB450174.[MT7]-LSALPFADILR.2b4_1.heavy 680.409 / 529.347 1813.0 48.496599197387695 35 17 6 6 6 2.4131647310507836 41.43935915906421 0.03679656982421875 6 0.9729803549656096 7.4909999845686315 1813.0 2.4013245033112582 4.0 - - - - - - - 273.2307692307692 14 13 STAT4 signal transducer and activator of transcription 4 149 19 C20140707_OR006_04 C20140707_OR006_04 TB450174.[MT7]-LSALPFADILR.2y10_1.heavy 680.409 / 1102.63 1889.0 48.496599197387695 35 17 6 6 6 2.4131647310507836 41.43935915906421 0.03679656982421875 6 0.9729803549656096 7.4909999845686315 1889.0 -0.7505960264900668 2.0 - - - - - - - 142.88888888888889 3 9 STAT4 signal transducer and activator of transcription 4 151 19 C20140707_OR006_04 C20140707_OR006_04 TB450174.[MT7]-LSALPFADILR.2y7_1.heavy 680.409 / 831.472 4532.0 48.496599197387695 35 17 6 6 6 2.4131647310507836 41.43935915906421 0.03679656982421875 6 0.9729803549656096 7.4909999845686315 4532.0 19.864933920704846 0.0 - - - - - - - 151.25 9 8 STAT4 signal transducer and activator of transcription 4 153 20 C20140707_OR006_04 C20140707_OR006_04 TB450475.[MT7]-EVLVQALEELLPSPNFGVK[MT7].4b4_1.heavy 593.344 / 585.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 155 20 C20140707_OR006_04 C20140707_OR006_04 TB450475.[MT7]-EVLVQALEELLPSPNFGVK[MT7].4b5_1.heavy 593.344 / 713.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 157 20 C20140707_OR006_04 C20140707_OR006_04 TB450475.[MT7]-EVLVQALEELLPSPNFGVK[MT7].4y6_1.heavy 593.344 / 805.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 159 20 C20140707_OR006_04 C20140707_OR006_04 TB450475.[MT7]-EVLVQALEELLPSPNFGVK[MT7].4b6_1.heavy 593.344 / 784.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 161 21 C20140707_OR006_04 C20140707_OR006_04 TB411648.[MT7]-TISSLK[MT7].2y4_1.heavy 468.802 / 578.363 15038.0 25.33049964904785 48 18 10 10 10 5.421617888856544 18.444678701082466 0.0 3 0.9869608157678592 10.796031001628585 15038.0 50.4422452715887 0.0 - - - - - - - 203.77777777777777 30 9 GRIPAP1 GRIP1 associated protein 1 163 21 C20140707_OR006_04 C20140707_OR006_04 TB411648.[MT7]-TISSLK[MT7].2y5_1.heavy 468.802 / 691.447 5379.0 25.33049964904785 48 18 10 10 10 5.421617888856544 18.444678701082466 0.0 3 0.9869608157678592 10.796031001628585 5379.0 52.893764589090715 0.0 - - - - - - - 244.5 10 2 GRIPAP1 GRIP1 associated protein 1 165 21 C20140707_OR006_04 C20140707_OR006_04 TB411648.[MT7]-TISSLK[MT7].2b4_1.heavy 468.802 / 533.305 2201.0 25.33049964904785 48 18 10 10 10 5.421617888856544 18.444678701082466 0.0 3 0.9869608157678592 10.796031001628585 2201.0 4.198092643051771 2.0 - - - - - - - 271.77777777777777 8 9 GRIPAP1 GRIP1 associated protein 1 167 21 C20140707_OR006_04 C20140707_OR006_04 TB411648.[MT7]-TISSLK[MT7].2y3_1.heavy 468.802 / 491.331 5624.0 25.33049964904785 48 18 10 10 10 5.421617888856544 18.444678701082466 0.0 3 0.9869608157678592 10.796031001628585 5624.0 20.23553200381137 0.0 - - - - - - - 314.57142857142856 11 7 GRIPAP1 GRIP1 associated protein 1 169 22 C20140707_OR006_04 C20140707_OR006_04 TB412181.[MT7]-NSATGEESSTSLTVK[MT7].3b6_1.heavy 600.314 / 704.333 8564.0 23.92977523803711 40 14 10 6 10 1.4565645084678682 45.76980029315147 0.0381011962890625 3 0.9396216619037584 4.997030823438281 8564.0 36.60316681159014 0.0 - - - - - - - 231.33333333333334 17 9 PSG2 pregnancy specific beta-1-glycoprotein 2 171 22 C20140707_OR006_04 C20140707_OR006_04 TB412181.[MT7]-NSATGEESSTSLTVK[MT7].3b5_1.heavy 600.314 / 575.291 4282.0 23.92977523803711 40 14 10 6 10 1.4565645084678682 45.76980029315147 0.0381011962890625 3 0.9396216619037584 4.997030823438281 4282.0 8.299720545384027 0.0 - - - - - - - 266.0 8 10 PSG2 pregnancy specific beta-1-glycoprotein 2 173 22 C20140707_OR006_04 C20140707_OR006_04 TB412181.[MT7]-NSATGEESSTSLTVK[MT7].3y5_1.heavy 600.314 / 691.447 9605.0 23.92977523803711 40 14 10 6 10 1.4565645084678682 45.76980029315147 0.0381011962890625 3 0.9396216619037584 4.997030823438281 9605.0 34.91721013069327 0.0 - - - - - - - 266.1 19 10 PSG2 pregnancy specific beta-1-glycoprotein 2 175 22 C20140707_OR006_04 C20140707_OR006_04 TB412181.[MT7]-NSATGEESSTSLTVK[MT7].3b7_1.heavy 600.314 / 833.376 8679.0 23.92977523803711 40 14 10 6 10 1.4565645084678682 45.76980029315147 0.0381011962890625 3 0.9396216619037584 4.997030823438281 8679.0 18.952020537013468 0.0 - - - - - - - 334.22222222222223 17 9 PSG2 pregnancy specific beta-1-glycoprotein 2 177 23 C20140707_OR006_04 C20140707_OR006_04 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 121582.0 30.02389907836914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 121582.0 887.5747475038557 1.0 - - - - - - - 201.6 291 5 179 23 C20140707_OR006_04 C20140707_OR006_04 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 62427.0 30.02389907836914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 62427.0 961.177619047619 0.0 - - - - - - - 201.6 124 5 181 23 C20140707_OR006_04 C20140707_OR006_04 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 60036.0 30.02389907836914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 60036.0 186.93973999710346 0.0 - - - - - - - 283.5 120 8 183 24 C20140707_OR006_04 C20140707_OR006_04 TB412288.[MT7]-LLAAC[CAM]SQREQALEATK[MT7].4y4_1.heavy 520.038 / 592.342 15144.0 29.07159996032715 48 18 10 10 10 6.484328940188766 15.421796291088357 0.0 3 0.9844521216259071 9.884677286954867 15144.0 63.28621059691483 0.0 - - - - - - - 264.9 30 10 RTKN rhotekin 185 24 C20140707_OR006_04 C20140707_OR006_04 TB412288.[MT7]-LLAAC[CAM]SQREQALEATK[MT7].4b11_2.heavy 520.038 / 686.86 18299.0 29.07159996032715 48 18 10 10 10 6.484328940188766 15.421796291088357 0.0 3 0.9844521216259071 9.884677286954867 18299.0 113.15690203961972 0.0 - - - - - - - 283.875 36 8 RTKN rhotekin 187 24 C20140707_OR006_04 C20140707_OR006_04 TB412288.[MT7]-LLAAC[CAM]SQREQALEATK[MT7].4b4_1.heavy 520.038 / 513.352 7193.0 29.07159996032715 48 18 10 10 10 6.484328940188766 15.421796291088357 0.0 3 0.9844521216259071 9.884677286954867 7193.0 11.22448700541145 1.0 - - - - - - - 303.0 17 10 RTKN rhotekin 189 24 C20140707_OR006_04 C20140707_OR006_04 TB412288.[MT7]-LLAAC[CAM]SQREQALEATK[MT7].4b10_2.heavy 520.038 / 651.341 22211.0 29.07159996032715 48 18 10 10 10 6.484328940188766 15.421796291088357 0.0 3 0.9844521216259071 9.884677286954867 22211.0 324.3511111111111 0.0 - - - - - - - 224.33333333333334 44 9 RTKN rhotekin 191 25 C20140707_OR006_04 C20140707_OR006_04 TB437107.[MT7]-SSTSLTSEEK[MT7].2y4_1.heavy 678.858 / 636.332 1196.0 20.011999130249023 41 11 10 10 10 1.265550080468033 51.27460074772447 0.0 3 0.8625711337171813 3.2901779404189226 1196.0 4.196491228070176 0.0 - - - - - - - 243.77777777777777 2 9 SYT4 synaptotagmin IV 193 25 C20140707_OR006_04 C20140707_OR006_04 TB437107.[MT7]-SSTSLTSEEK[MT7].2y5_1.heavy 678.858 / 737.38 3487.0 20.011999130249023 41 11 10 10 10 1.265550080468033 51.27460074772447 0.0 3 0.8625711337171813 3.2901779404189226 3487.0 29.661348370927314 0.0 - - - - - - - 166.33333333333334 6 6 SYT4 synaptotagmin IV 195 25 C20140707_OR006_04 C20140707_OR006_04 TB437107.[MT7]-SSTSLTSEEK[MT7].2b4_1.heavy 678.858 / 507.253 797.0 20.011999130249023 41 11 10 10 10 1.265550080468033 51.27460074772447 0.0 3 0.8625711337171813 3.2901779404189226 797.0 1.421627647714604 3.0 - - - - - - - 0.0 1 0 SYT4 synaptotagmin IV 197 25 C20140707_OR006_04 C20140707_OR006_04 TB437107.[MT7]-SSTSLTSEEK[MT7].2y3_1.heavy 678.858 / 549.3 697.0 20.011999130249023 41 11 10 10 10 1.265550080468033 51.27460074772447 0.0 3 0.8625711337171813 3.2901779404189226 697.0 2.284762461216102 7.0 - - - - - - - 0.0 1 0 SYT4 synaptotagmin IV 199 26 C20140707_OR006_04 C20140707_OR006_04 TB436888.[MT7]-DVLAFTC[CAM]EPK[MT7].3y3_1.heavy 489.93 / 517.31 1340.0 34.61690139770508 38 18 2 10 8 4.866418281629752 20.548993985471846 0.0 4 0.9881800373525176 11.340327816680254 1340.0 1.0333333333333332 5.0 - - - - - - - 268.0 3 4 PSG3;PSG5;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 201 26 C20140707_OR006_04 C20140707_OR006_04 TB436888.[MT7]-DVLAFTC[CAM]EPK[MT7].3b4_1.heavy 489.93 / 543.326 15010.0 34.61690139770508 38 18 2 10 8 4.866418281629752 20.548993985471846 0.0 4 0.9881800373525176 11.340327816680254 15010.0 41.165485074626865 4.0 - - - - - - - 301.5 63 4 PSG3;PSG5;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 203 26 C20140707_OR006_04 C20140707_OR006_04 TB436888.[MT7]-DVLAFTC[CAM]EPK[MT7].3b5_1.heavy 489.93 / 690.394 4289.0 34.61690139770508 38 18 2 10 8 4.866418281629752 20.548993985471846 0.0 4 0.9881800373525176 11.340327816680254 4289.0 18.930127931769725 0.0 - - - - - - - 187.6 8 5 PSG3;PSG5;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 205 26 C20140707_OR006_04 C20140707_OR006_04 TB436888.[MT7]-DVLAFTC[CAM]EPK[MT7].3y4_1.heavy 489.93 / 677.341 3216.0 34.61690139770508 38 18 2 10 8 4.866418281629752 20.548993985471846 0.0 4 0.9881800373525176 11.340327816680254 3216.0 24.900000000000002 0.0 - - - - - - - 294.8 6 5 PSG3;PSG5;PSG6;PSG9 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 9 207 27 C20140707_OR006_04 C20140707_OR006_04 TB450324.[MT7]-RSENINHNSAFK[MT7].4y5_1.heavy 426.981 / 710.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 209 27 C20140707_OR006_04 C20140707_OR006_04 TB450324.[MT7]-RSENINHNSAFK[MT7].4b4_1.heavy 426.981 / 631.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 211 27 C20140707_OR006_04 C20140707_OR006_04 TB450324.[MT7]-RSENINHNSAFK[MT7].4y3_1.heavy 426.981 / 509.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 213 27 C20140707_OR006_04 C20140707_OR006_04 TB450324.[MT7]-RSENINHNSAFK[MT7].4b6_1.heavy 426.981 / 858.455 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 215 28 C20140707_OR006_04 C20140707_OR006_04 TB436887.[MT7]-DMEVLSQEIVR.3y7_1.heavy 488.261 / 844.489 255.0 37.11842441558838 36 11 10 5 10 0.7443943561509847 68.85959499878314 0.046100616455078125 3 0.8651435092720815 3.322159380407306 255.0 2.8373228346456694 11.0 - - - - - - - 0.0 1 0 GRIPAP1 GRIP1 associated protein 1 217 28 C20140707_OR006_04 C20140707_OR006_04 TB436887.[MT7]-DMEVLSQEIVR.3y6_1.heavy 488.261 / 731.405 2294.0 37.11842441558838 36 11 10 5 10 0.7443943561509847 68.85959499878314 0.046100616455078125 3 0.8651435092720815 3.322159380407306 2294.0 10.648365052634317 1.0 - - - - - - - 203.6 4 5 GRIPAP1 GRIP1 associated protein 1 219 28 C20140707_OR006_04 C20140707_OR006_04 TB436887.[MT7]-DMEVLSQEIVR.3b4_1.heavy 488.261 / 619.288 6883.0 37.11842441558838 36 11 10 5 10 0.7443943561509847 68.85959499878314 0.046100616455078125 3 0.8651435092720815 3.322159380407306 6883.0 54.11183572641655 0.0 - - - - - - - 272.85714285714283 13 7 GRIPAP1 GRIP1 associated protein 1 221 28 C20140707_OR006_04 C20140707_OR006_04 TB436887.[MT7]-DMEVLSQEIVR.3y5_1.heavy 488.261 / 644.373 3187.0 37.11842441558838 36 11 10 5 10 0.7443943561509847 68.85959499878314 0.046100616455078125 3 0.8651435092720815 3.322159380407306 3187.0 12.507854429730008 0.0 - - - - - - - 203.6 6 5 GRIPAP1 GRIP1 associated protein 1 223 29 C20140707_OR006_04 C20140707_OR006_04 TB437104.[MT7]-ILSYMGELQR.2y8_1.heavy 677.37 / 983.461 45386.0 39.94200134277344 43 13 10 10 10 1.810477776461177 43.06289669554056 0.0 3 0.9161965130760408 4.233023416633001 45386.0 461.9311166801637 0.0 - - - - - - - 200.5 90 8 RTKN rhotekin 225 29 C20140707_OR006_04 C20140707_OR006_04 TB437104.[MT7]-ILSYMGELQR.2y5_1.heavy 677.37 / 602.326 14630.0 39.94200134277344 43 13 10 10 10 1.810477776461177 43.06289669554056 0.0 3 0.9161965130760408 4.233023416633001 14630.0 47.49791053937239 0.0 - - - - - - - 242.72727272727272 29 11 RTKN rhotekin 227 29 C20140707_OR006_04 C20140707_OR006_04 TB437104.[MT7]-ILSYMGELQR.2y9_1.heavy 677.37 / 1096.55 28299.0 39.94200134277344 43 13 10 10 10 1.810477776461177 43.06289669554056 0.0 3 0.9161965130760408 4.233023416633001 28299.0 333.4967724883178 0.0 - - - - - - - 235.0 56 5 RTKN rhotekin 229 29 C20140707_OR006_04 C20140707_OR006_04 TB437104.[MT7]-ILSYMGELQR.2y7_1.heavy 677.37 / 896.43 17193.0 39.94200134277344 43 13 10 10 10 1.810477776461177 43.06289669554056 0.0 3 0.9161965130760408 4.233023416633001 17193.0 90.22478882481606 0.0 - - - - - - - 350.7142857142857 34 7 RTKN rhotekin 231 30 C20140707_OR006_04 C20140707_OR006_04 TB450321.[MT7]-GYVPSVFIPISTIR.3b6_1.heavy 564.998 / 747.416 5616.0 45.19160079956055 50 20 10 10 10 12.667638911154555 7.894130919057417 0.0 3 0.9980008394785108 27.59727223462498 5616.0 62.17714285714286 0.0 - - - - - - - 188.66666666666666 11 12 STAT4 signal transducer and activator of transcription 4 233 30 C20140707_OR006_04 C20140707_OR006_04 TB450321.[MT7]-GYVPSVFIPISTIR.3y6_1.heavy 564.998 / 686.42 29337.0 45.19160079956055 50 20 10 10 10 12.667638911154555 7.894130919057417 0.0 3 0.9980008394785108 27.59727223462498 29337.0 251.02004925373132 0.0 - - - - - - - 174.66666666666666 58 12 STAT4 signal transducer and activator of transcription 4 235 30 C20140707_OR006_04 C20140707_OR006_04 TB450321.[MT7]-GYVPSVFIPISTIR.3b5_1.heavy 564.998 / 648.347 7209.0 45.19160079956055 50 20 10 10 10 12.667638911154555 7.894130919057417 0.0 3 0.9980008394785108 27.59727223462498 7209.0 106.24077404667047 0.0 - - - - - - - 203.64285714285714 14 14 STAT4 signal transducer and activator of transcription 4 237 30 C20140707_OR006_04 C20140707_OR006_04 TB450321.[MT7]-GYVPSVFIPISTIR.3y5_1.heavy 564.998 / 589.367 5616.0 45.19160079956055 50 20 10 10 10 12.667638911154555 7.894130919057417 0.0 3 0.9980008394785108 27.59727223462498 5616.0 69.24404264392325 0.0 - - - - - - - 190.45454545454547 11 11 STAT4 signal transducer and activator of transcription 4 239 31 C20140707_OR006_04 C20140707_OR006_04 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 44973.0 16.2726993560791 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 44973.0 42.57008393406261 0.0 - - - - - - - 127.5 89 6 241 31 C20140707_OR006_04 C20140707_OR006_04 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 52858.0 16.2726993560791 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 52858.0 549.1481757322175 0.0 - - - - - - - 135.5 105 6 243 31 C20140707_OR006_04 C20140707_OR006_04 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 35366.0 16.2726993560791 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 35366.0 116.78405913052788 0.0 - - - - - - - 188.2 70 15 245 32 C20140707_OR006_04 C20140707_OR006_04 TB411903.[MT7]-ALNHLPLEYNSALYSR.3y7_1.heavy 669.026 / 810.41 6337.0 35.99169921875 44 14 10 10 10 4.434552710619854 22.55018860425772 0.0 3 0.943144947385945 5.151081171959459 6337.0 5.585432701038551 0.0 - - - - - - - 286.875 12 8 C6 complement component 6 247 32 C20140707_OR006_04 C20140707_OR006_04 TB411903.[MT7]-ALNHLPLEYNSALYSR.3b4_1.heavy 669.026 / 580.332 22922.0 35.99169921875 44 14 10 10 10 4.434552710619854 22.55018860425772 0.0 3 0.943144947385945 5.151081171959459 22922.0 51.73405473212996 0.0 - - - - - - - 270.0 45 2 C6 complement component 6 249 32 C20140707_OR006_04 C20140707_OR006_04 TB411903.[MT7]-ALNHLPLEYNSALYSR.3y8_1.heavy 669.026 / 973.474 3371.0 35.99169921875 44 14 10 10 10 4.434552710619854 22.55018860425772 0.0 3 0.943144947385945 5.151081171959459 3371.0 -0.25977617048147184 2.0 - - - - - - - 270.0 10 6 C6 complement component 6 251 32 C20140707_OR006_04 C20140707_OR006_04 TB411903.[MT7]-ALNHLPLEYNSALYSR.3y9_1.heavy 669.026 / 1102.52 6877.0 35.99169921875 44 14 10 10 10 4.434552710619854 22.55018860425772 0.0 3 0.943144947385945 5.151081171959459 6877.0 35.138000890207714 0.0 - - - - - - - 360.0 13 3 C6 complement component 6 253 33 C20140707_OR006_04 C20140707_OR006_04 TB412091.[MT7]-DLPPELLDAPFVR.3y6_1.heavy 542.639 / 704.373 4425.0 44.359649658203125 38 12 10 6 10 1.1779304213649129 56.596438514099546 0.0345001220703125 3 0.8913760684497632 3.710117476847519 4425.0 57.17509495856354 0.0 - - - - - - - 747.1428571428571 8 7 LRDD leucine-rich repeats and death domain containing 255 33 C20140707_OR006_04 C20140707_OR006_04 TB412091.[MT7]-DLPPELLDAPFVR.3b5_1.heavy 542.639 / 696.369 2735.0 44.359649658203125 38 12 10 6 10 1.1779304213649129 56.596438514099546 0.0345001220703125 3 0.8913760684497632 3.710117476847519 2735.0 3.129911805744581 2.0 - - - - - - - 231.25 5 8 LRDD leucine-rich repeats and death domain containing 257 33 C20140707_OR006_04 C20140707_OR006_04 TB412091.[MT7]-DLPPELLDAPFVR.3y4_1.heavy 542.639 / 518.308 4747.0 44.359649658203125 38 12 10 6 10 1.1779304213649129 56.596438514099546 0.0345001220703125 3 0.8913760684497632 3.710117476847519 4747.0 10.533110425560647 0.0 - - - - - - - 768.7777777777778 9 9 LRDD leucine-rich repeats and death domain containing 259 33 C20140707_OR006_04 C20140707_OR006_04 TB412091.[MT7]-DLPPELLDAPFVR.3y5_1.heavy 542.639 / 589.346 2253.0 44.359649658203125 38 12 10 6 10 1.1779304213649129 56.596438514099546 0.0345001220703125 3 0.8913760684497632 3.710117476847519 2253.0 26.859033754822118 1.0 - - - - - - - 288.25 4 12 LRDD leucine-rich repeats and death domain containing 261 34 C20140707_OR006_04 C20140707_OR006_04 TB437317.[MT7]-EQLTQELQEARK[MT7].4y6_2.heavy 440.999 / 444.773 6961.0 28.086299896240234 36 14 4 10 8 1.6910983009312954 42.41318809241761 0.0 4 0.9410501137344522 5.057827076757386 6961.0 25.941725813934816 1.0 - - - - - - - 284.75 14 4 GRIPAP1 GRIP1 associated protein 1 263 34 C20140707_OR006_04 C20140707_OR006_04 TB437317.[MT7]-EQLTQELQEARK[MT7].4y3_1.heavy 440.999 / 518.353 1519.0 28.086299896240234 36 14 4 10 8 1.6910983009312954 42.41318809241761 0.0 4 0.9410501137344522 5.057827076757386 1519.0 14.366938470635834 6.0 - - - - - - - 325.57142857142856 3 7 GRIPAP1 GRIP1 associated protein 1 265 34 C20140707_OR006_04 C20140707_OR006_04 TB437317.[MT7]-EQLTQELQEARK[MT7].4y7_2.heavy 440.999 / 509.294 8733.0 28.086299896240234 36 14 4 10 8 1.6910983009312954 42.41318809241761 0.0 4 0.9410501137344522 5.057827076757386 8733.0 32.40983524569718 0.0 - - - - - - - 271.2857142857143 17 7 GRIPAP1 GRIP1 associated protein 1 267 34 C20140707_OR006_04 C20140707_OR006_04 TB437317.[MT7]-EQLTQELQEARK[MT7].4b3_1.heavy 440.999 / 515.295 5948.0 28.086299896240234 36 14 4 10 8 1.6910983009312954 42.41318809241761 0.0 4 0.9410501137344522 5.057827076757386 5948.0 38.45721655918452 2.0 - - - - - - - 289.42857142857144 31 7 GRIPAP1 GRIP1 associated protein 1 269 35 C20140707_OR006_04 C20140707_OR006_04 TB412090.[MT7]-ASLDSAGGSGSSPILLPTPVVGGPR.3y7_1.heavy 812.779 / 681.404 7523.0 39.52524948120117 46 20 10 6 10 3.2572076914131314 23.078253069919146 0.0399017333984375 3 0.9931419416628953 14.894065799904524 7523.0 28.834122475809043 0.0 - - - - - - - 231.14285714285714 15 14 RTKN rhotekin 271 35 C20140707_OR006_04 C20140707_OR006_04 TB412090.[MT7]-ASLDSAGGSGSSPILLPTPVVGGPR.3b6_1.heavy 812.779 / 689.359 5225.0 39.52524948120117 46 20 10 6 10 3.2572076914131314 23.078253069919146 0.0399017333984375 3 0.9931419416628953 14.894065799904524 5225.0 33.0 0.0 - - - - - - - 241.375 10 16 RTKN rhotekin 273 35 C20140707_OR006_04 C20140707_OR006_04 TB412090.[MT7]-ASLDSAGGSGSSPILLPTPVVGGPR.3b4_1.heavy 812.779 / 531.289 6478.0 39.52524948120117 46 20 10 6 10 3.2572076914131314 23.078253069919146 0.0399017333984375 3 0.9931419416628953 14.894065799904524 6478.0 59.78977033492823 0.0 - - - - - - - 252.33333333333334 12 12 RTKN rhotekin 275 35 C20140707_OR006_04 C20140707_OR006_04 TB412090.[MT7]-ASLDSAGGSGSSPILLPTPVVGGPR.3y9_1.heavy 812.779 / 879.505 29885.0 39.52524948120117 46 20 10 6 10 3.2572076914131314 23.078253069919146 0.0399017333984375 3 0.9931419416628953 14.894065799904524 29885.0 67.15034055727554 0.0 - - - - - - - 234.75 59 4 RTKN rhotekin 277 36 C20140707_OR006_04 C20140707_OR006_04 TB437314.[MT7]-YLEDLQDEFDYR.2b3_1.heavy 875.408 / 550.299 1343.0 42.79059982299805 44 14 10 10 10 1.821920154010952 43.872769435939446 0.0 3 0.9344576103596731 4.794023369428405 1343.0 2.4759217877094972 1.0 - - - - - - - 248.15384615384616 2 13 STAT4 signal transducer and activator of transcription 4 279 36 C20140707_OR006_04 C20140707_OR006_04 TB437314.[MT7]-YLEDLQDEFDYR.2y8_1.heavy 875.408 / 1085.49 2327.0 42.79059982299805 44 14 10 10 10 1.821920154010952 43.872769435939446 0.0 3 0.9344576103596731 4.794023369428405 2327.0 1.95 1.0 - - - - - - - 293.09090909090907 4 11 STAT4 signal transducer and activator of transcription 4 281 36 C20140707_OR006_04 C20140707_OR006_04 TB437314.[MT7]-YLEDLQDEFDYR.2y5_1.heavy 875.408 / 729.32 985.0 42.79059982299805 44 14 10 10 10 1.821920154010952 43.872769435939446 0.0 3 0.9344576103596731 4.794023369428405 985.0 3.608727752279288 5.0 - - - - - - - 0.0 1 0 STAT4 signal transducer and activator of transcription 4 283 36 C20140707_OR006_04 C20140707_OR006_04 TB437314.[MT7]-YLEDLQDEFDYR.2y9_1.heavy 875.408 / 1200.52 537.0 42.79059982299805 44 14 10 10 10 1.821920154010952 43.872769435939446 0.0 3 0.9344576103596731 4.794023369428405 537.0 0.0 19.0 - - - - - - - 193.07692307692307 2 13 STAT4 signal transducer and activator of transcription 4 285 37 C20140707_OR006_04 C20140707_OR006_04 TB437315.[MT7]-TDTWTMVAPLSMPR.2y8_1.heavy 875.443 / 870.487 1036.0 42.191001892089844 45 15 10 10 10 1.7759768844813095 41.06863469629154 0.0 3 0.9519573188057519 5.607825722746292 1036.0 12.032558139534883 3.0 - - - - - - - 211.9090909090909 2 11 KLHL1 kelch-like 1 (Drosophila) 287 37 C20140707_OR006_04 C20140707_OR006_04 TB437315.[MT7]-TDTWTMVAPLSMPR.2y6_1.heavy 875.443 / 700.381 950.0 42.191001892089844 45 15 10 10 10 1.7759768844813095 41.06863469629154 0.0 3 0.9519573188057519 5.607825722746292 950.0 5.0520231213872835 1.0 - - - - - - - 0.0 1 0 KLHL1 kelch-like 1 (Drosophila) 289 37 C20140707_OR006_04 C20140707_OR006_04 TB437315.[MT7]-TDTWTMVAPLSMPR.2y10_1.heavy 875.443 / 1102.57 N/A 42.191001892089844 45 15 10 10 10 1.7759768844813095 41.06863469629154 0.0 3 0.9519573188057519 5.607825722746292 3368.0 36.446155439126926 0.0 - - - - - - - 172.55555555555554 6 9 KLHL1 kelch-like 1 (Drosophila) 291 37 C20140707_OR006_04 C20140707_OR006_04 TB437315.[MT7]-TDTWTMVAPLSMPR.2y7_1.heavy 875.443 / 771.418 1641.0 42.191001892089844 45 15 10 10 10 1.7759768844813095 41.06863469629154 0.0 3 0.9519573188057519 5.607825722746292 1641.0 1.5194444444444446 0.0 - - - - - - - 215.91666666666666 3 12 KLHL1 kelch-like 1 (Drosophila) 293 38 C20140707_OR006_04 C20140707_OR006_04 TB437311.[MT7]-VK[MT7]PQDFAAITIPR.4y4_1.heavy 436.764 / 486.303 11319.0 35.93585014343262 42 20 10 2 10 6.788455505958949 14.73089127743702 0.08919906616210938 3 0.9904045627901723 12.58873532901316 11319.0 96.8563974728746 0.0 - - - - - - - 269.6666666666667 22 3 TCF19 transcription factor 19 295 38 C20140707_OR006_04 C20140707_OR006_04 TB437311.[MT7]-VK[MT7]PQDFAAITIPR.4y5_1.heavy 436.764 / 599.388 2021.0 35.93585014343262 42 20 10 2 10 6.788455505958949 14.73089127743702 0.08919906616210938 3 0.9904045627901723 12.58873532901316 2021.0 4.952351485148514 1.0 - - - - - - - 269.6666666666667 4 3 TCF19 transcription factor 19 297 38 C20140707_OR006_04 C20140707_OR006_04 TB437311.[MT7]-VK[MT7]PQDFAAITIPR.4b5_1.heavy 436.764 / 856.513 1617.0 35.93585014343262 42 20 10 2 10 6.788455505958949 14.73089127743702 0.08919906616210938 3 0.9904045627901723 12.58873532901316 1617.0 7.786666666666666 0.0 - - - - - - - 336.75 3 4 TCF19 transcription factor 19 299 38 C20140707_OR006_04 C20140707_OR006_04 TB437311.[MT7]-VK[MT7]PQDFAAITIPR.4b7_2.heavy 436.764 / 537.813 7277.0 35.93585014343262 42 20 10 2 10 6.788455505958949 14.73089127743702 0.08919906616210938 3 0.9904045627901723 12.58873532901316 7277.0 8.731634809747804 1.0 - - - - - - - 270.0 14 2 TCF19 transcription factor 19 301 39 C20140707_OR006_04 C20140707_OR006_04 TB449928.[MT7]-LFVIGGR.2y4_1.heavy 453.288 / 402.246 5668.0 36.75149917602539 40 18 2 10 10 5.127811191722901 19.501498058550954 0.0 3 0.9877161860741712 11.123723484214219 5668.0 78.93214814814814 0.0 - - - - - - - 216.0 11 5 KLHL1 kelch-like 1 (Drosophila) 303 39 C20140707_OR006_04 C20140707_OR006_04 TB449928.[MT7]-LFVIGGR.2b3_1.heavy 453.288 / 504.33 5128.0 36.75149917602539 40 18 2 10 10 5.127811191722901 19.501498058550954 0.0 3 0.9877161860741712 11.123723484214219 5128.0 30.863182886452922 0.0 - - - - - - - 135.0 10 5 KLHL1 kelch-like 1 (Drosophila) 305 39 C20140707_OR006_04 C20140707_OR006_04 TB449928.[MT7]-LFVIGGR.2y5_1.heavy 453.288 / 501.314 4858.0 36.75149917602539 40 18 2 10 10 5.127811191722901 19.501498058550954 0.0 3 0.9877161860741712 11.123723484214219 4858.0 33.46622222222222 1.0 - - - - - - - 270.0 86 6 KLHL1 kelch-like 1 (Drosophila) 307 39 C20140707_OR006_04 C20140707_OR006_04 TB449928.[MT7]-LFVIGGR.2y6_1.heavy 453.288 / 648.383 13359.0 36.75149917602539 40 18 2 10 10 5.127811191722901 19.501498058550954 0.0 3 0.9877161860741712 11.123723484214219 13359.0 133.58999999999997 0.0 - - - - - - - 216.0 26 5 KLHL1 kelch-like 1 (Drosophila) 309 40 C20140707_OR006_04 C20140707_OR006_04 TB450466.[MT7]-AMEGLGMDEGDGEGNILPIMQSIMQNLLSK[MT7].3b6_1.heavy 1160.58 / 703.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - PEX19 peroxisomal biogenesis factor 19 311 40 C20140707_OR006_04 C20140707_OR006_04 TB450466.[MT7]-AMEGLGMDEGDGEGNILPIMQSIMQNLLSK[MT7].3b4_1.heavy 1160.58 / 533.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - PEX19 peroxisomal biogenesis factor 19 313 40 C20140707_OR006_04 C20140707_OR006_04 TB450466.[MT7]-AMEGLGMDEGDGEGNILPIMQSIMQNLLSK[MT7].3b5_1.heavy 1160.58 / 646.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - PEX19 peroxisomal biogenesis factor 19 315 40 C20140707_OR006_04 C20140707_OR006_04 TB450466.[MT7]-AMEGLGMDEGDGEGNILPIMQSIMQNLLSK[MT7].3y9_1.heavy 1160.58 / 1177.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - PEX19 peroxisomal biogenesis factor 19 317 41 C20140707_OR006_04 C20140707_OR006_04 TB450463.[MT7]-ELQALNTEEAAEQRAEVDR.3y17_2.heavy 772.723 / 965.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 319 41 C20140707_OR006_04 C20140707_OR006_04 TB450463.[MT7]-ELQALNTEEAAEQRAEVDR.3b4_1.heavy 772.723 / 586.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 321 41 C20140707_OR006_04 C20140707_OR006_04 TB450463.[MT7]-ELQALNTEEAAEQRAEVDR.3b5_1.heavy 772.723 / 699.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 323 41 C20140707_OR006_04 C20140707_OR006_04 TB450463.[MT7]-ELQALNTEEAAEQRAEVDR.3b3_1.heavy 772.723 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 325 42 C20140707_OR006_04 C20140707_OR006_04 TB412159.[MT7]-ELQALNTEEAAEQR.2b3_1.heavy 873.443 / 515.295 1894.0 29.008749961853027 38 13 10 5 10 1.5866397006249795 45.21614735862492 0.04189872741699219 3 0.9281878275830636 4.577511643505938 1894.0 15.906320346320346 0.0 - - - - - - - 182.33333333333334 3 9 HNF1B HNF1 homeobox B 327 42 C20140707_OR006_04 C20140707_OR006_04 TB412159.[MT7]-ELQALNTEEAAEQR.2y9_1.heavy 873.443 / 1047.47 2904.0 29.008749961853027 38 13 10 5 10 1.5866397006249795 45.21614735862492 0.04189872741699219 3 0.9281878275830636 4.577511643505938 2904.0 18.680196113459974 1.0 - - - - - - - 168.33333333333334 5 6 HNF1B HNF1 homeobox B 329 42 C20140707_OR006_04 C20140707_OR006_04 TB412159.[MT7]-ELQALNTEEAAEQR.2b4_1.heavy 873.443 / 586.332 2399.0 29.008749961853027 38 13 10 5 10 1.5866397006249795 45.21614735862492 0.04189872741699219 3 0.9281878275830636 4.577511643505938 2399.0 20.970185735832796 0.0 - - - - - - - 205.125 4 8 HNF1B HNF1 homeobox B 331 42 C20140707_OR006_04 C20140707_OR006_04 TB412159.[MT7]-ELQALNTEEAAEQR.2y10_1.heavy 873.443 / 1160.55 884.0 29.008749961853027 38 13 10 5 10 1.5866397006249795 45.21614735862492 0.04189872741699219 3 0.9281878275830636 4.577511643505938 884.0 2.5629334529185392 1.0 - - - - - - - 0.0 1 0 HNF1B HNF1 homeobox B 333 43 C20140707_OR006_04 C20140707_OR006_04 TB412393.[MT7]-LYDLYIEEC[CAM]EK[MT7]EPEVK[MT7].4y4_1.heavy 623.077 / 616.379 11778.0 36.841800689697266 42 12 10 10 10 1.0277318617528535 60.81851105419622 0.0 3 0.8898961740289999 3.6846259468574187 11778.0 47.63316312459442 0.0 - - - - - - - 178.66666666666666 23 3 FAM48A family with sequence similarity 48, member A 335 43 C20140707_OR006_04 C20140707_OR006_04 TB412393.[MT7]-LYDLYIEEC[CAM]EK[MT7]EPEVK[MT7].4b4_1.heavy 623.077 / 649.368 10038.0 36.841800689697266 42 12 10 10 10 1.0277318617528535 60.81851105419622 0.0 3 0.8898961740289999 3.6846259468574187 10038.0 16.751598675483244 0.0 - - - - - - - 698.7777777777778 20 9 FAM48A family with sequence similarity 48, member A 337 43 C20140707_OR006_04 C20140707_OR006_04 TB412393.[MT7]-LYDLYIEEC[CAM]EK[MT7]EPEVK[MT7].4b5_1.heavy 623.077 / 812.431 6959.0 36.841800689697266 42 12 10 10 10 1.0277318617528535 60.81851105419622 0.0 3 0.8898961740289999 3.6846259468574187 6959.0 16.491691602754845 2.0 - - - - - - - 301.5 16 8 FAM48A family with sequence similarity 48, member A 339 43 C20140707_OR006_04 C20140707_OR006_04 TB412393.[MT7]-LYDLYIEEC[CAM]EK[MT7]EPEVK[MT7].4b3_1.heavy 623.077 / 536.284 11108.0 36.841800689697266 42 12 10 10 10 1.0277318617528535 60.81851105419622 0.0 3 0.8898961740289999 3.6846259468574187 11108.0 14.920172451784591 0.0 - - - - - - - 294.8 22 5 FAM48A family with sequence similarity 48, member A 341 44 C20140707_OR006_04 C20140707_OR006_04 TB412292.[MT7]-GGDLYTFHPPAGAGC[CAM]TYR.3b5_1.heavy 695.331 / 650.327 2269.0 31.788949966430664 39 13 10 6 10 2.920888405201219 34.236159047339925 0.0399017333984375 3 0.9215543383732965 4.377207403475612 2269.0 5.839716553287982 1.0 - - - - - - - 231.0 4 6 TCF19 transcription factor 19 343 44 C20140707_OR006_04 C20140707_OR006_04 TB412292.[MT7]-GGDLYTFHPPAGAGC[CAM]TYR.3y8_1.heavy 695.331 / 855.378 1639.0 31.788949966430664 39 13 10 6 10 2.920888405201219 34.236159047339925 0.0399017333984375 3 0.9215543383732965 4.377207403475612 1639.0 11.967301587301588 0.0 - - - - - - - 189.0 3 4 TCF19 transcription factor 19 345 44 C20140707_OR006_04 C20140707_OR006_04 TB412292.[MT7]-GGDLYTFHPPAGAGC[CAM]TYR.3y10_1.heavy 695.331 / 1049.48 6933.0 31.788949966430664 39 13 10 6 10 2.920888405201219 34.236159047339925 0.0399017333984375 3 0.9215543383732965 4.377207403475612 6933.0 32.55575396825397 0.0 - - - - - - - 180.0 13 7 TCF19 transcription factor 19 347 44 C20140707_OR006_04 C20140707_OR006_04 TB412292.[MT7]-GGDLYTFHPPAGAGC[CAM]TYR.3y9_1.heavy 695.331 / 952.43 3529.0 31.788949966430664 39 13 10 6 10 2.920888405201219 34.236159047339925 0.0399017333984375 3 0.9215543383732965 4.377207403475612 3529.0 4.901388888888889 1.0 - - - - - - - 252.0 7 8 TCF19 transcription factor 19 349 45 C20140707_OR006_04 C20140707_OR006_04 TB449925.[MT7]-AVLELGR.2y5_1.heavy 451.283 / 587.351 2631.0 30.44064998626709 39 13 10 6 10 4.3420662354014485 23.03051003337687 0.037799835205078125 3 0.9050448831082589 3.9728777574763616 2631.0 31.530071713147407 0.0 - - - - - - - 167.0 5 3 LRDD leucine-rich repeats and death domain containing 351 45 C20140707_OR006_04 C20140707_OR006_04 TB449925.[MT7]-AVLELGR.2b4_1.heavy 451.283 / 557.341 1503.0 30.44064998626709 39 13 10 6 10 4.3420662354014485 23.03051003337687 0.037799835205078125 3 0.9050448831082589 3.9728777574763616 1503.0 7.685316960879884 0.0 - - - - - - - 232.85714285714286 3 7 LRDD leucine-rich repeats and death domain containing 353 45 C20140707_OR006_04 C20140707_OR006_04 TB449925.[MT7]-AVLELGR.2y3_1.heavy 451.283 / 345.224 2756.0 30.44064998626709 39 13 10 6 10 4.3420662354014485 23.03051003337687 0.037799835205078125 3 0.9050448831082589 3.9728777574763616 2756.0 12.336236331270662 0.0 - - - - - - - 232.71428571428572 5 7 LRDD leucine-rich repeats and death domain containing 355 45 C20140707_OR006_04 C20140707_OR006_04 TB449925.[MT7]-AVLELGR.2y6_1.heavy 451.283 / 686.42 1253.0 30.44064998626709 39 13 10 6 10 4.3420662354014485 23.03051003337687 0.037799835205078125 3 0.9050448831082589 3.9728777574763616 1253.0 8.137011952191234 0.0 - - - - - - - 209.0 2 6 LRDD leucine-rich repeats and death domain containing 357 46 C20140707_OR006_04 C20140707_OR006_04 TB437318.[MT7]-EQLTQELQEARK[MT7].2y8_1.heavy 880.991 / 1145.64 886.0 28.10890007019043 36 11 10 5 10 2.3796253080938206 33.617874094718985 0.045200347900390625 3 0.854512368085772 3.195491034016659 886.0 4.316185770750987 1.0 - - - - - - - 0.0 1 0 GRIPAP1 GRIP1 associated protein 1 359 46 C20140707_OR006_04 C20140707_OR006_04 TB437318.[MT7]-EQLTQELQEARK[MT7].2y9_1.heavy 880.991 / 1246.69 380.0 28.10890007019043 36 11 10 5 10 2.3796253080938206 33.617874094718985 0.045200347900390625 3 0.854512368085772 3.195491034016659 380.0 1.0015810276679844 1.0 - - - - - - - 0.0 0 0 GRIPAP1 GRIP1 associated protein 1 361 46 C20140707_OR006_04 C20140707_OR006_04 TB437318.[MT7]-EQLTQELQEARK[MT7].2y3_1.heavy 880.991 / 518.353 1392.0 28.10890007019043 36 11 10 5 10 2.3796253080938206 33.617874094718985 0.045200347900390625 3 0.854512368085772 3.195491034016659 1392.0 8.981759101310589 0.0 - - - - - - - 316.5 2 2 GRIPAP1 GRIP1 associated protein 1 363 46 C20140707_OR006_04 C20140707_OR006_04 TB437318.[MT7]-EQLTQELQEARK[MT7].2y6_1.heavy 880.991 / 888.538 886.0 28.10890007019043 36 11 10 5 10 2.3796253080938206 33.617874094718985 0.045200347900390625 3 0.854512368085772 3.195491034016659 886.0 2.445868475926675 1.0 - - - - - - - 0.0 1 0 GRIPAP1 GRIP1 associated protein 1 365 47 C20140707_OR006_04 C20140707_OR006_04 TB412295.[MT7]-EQNQDSQTEAEELRK[MT7].3y7_1.heavy 698.35 / 1018.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - OXR1 oxidation resistance 1 367 47 C20140707_OR006_04 C20140707_OR006_04 TB412295.[MT7]-EQNQDSQTEAEELRK[MT7].3b5_1.heavy 698.35 / 759.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - OXR1 oxidation resistance 1 369 47 C20140707_OR006_04 C20140707_OR006_04 TB412295.[MT7]-EQNQDSQTEAEELRK[MT7].3b3_1.heavy 698.35 / 516.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - OXR1 oxidation resistance 1 371 47 C20140707_OR006_04 C20140707_OR006_04 TB412295.[MT7]-EQNQDSQTEAEELRK[MT7].3y4_1.heavy 698.35 / 689.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - OXR1 oxidation resistance 1 373 48 C20140707_OR006_04 C20140707_OR006_04 TB412156.[MT7]-AFADAQGC[CAM]IELMK[MT7].3y3_1.heavy 581.3 / 535.339 11412.0 36.571998596191406 43 13 10 10 10 2.300789169141012 43.46334785526416 0.0 3 0.9141649935542672 4.1818995862333574 11412.0 28.689385474860337 0.0 - - - - - - - 656.4444444444445 22 9 KLHL1 kelch-like 1 (Drosophila) 375 48 C20140707_OR006_04 C20140707_OR006_04 TB412156.[MT7]-AFADAQGC[CAM]IELMK[MT7].3b4_1.heavy 581.3 / 549.279 17588.0 36.571998596191406 43 13 10 10 10 2.300789169141012 43.46334785526416 0.0 3 0.9141649935542672 4.1818995862333574 17588.0 87.04846522106449 0.0 - - - - - - - 335.75 35 4 KLHL1 kelch-like 1 (Drosophila) 377 48 C20140707_OR006_04 C20140707_OR006_04 TB412156.[MT7]-AFADAQGC[CAM]IELMK[MT7].3b5_1.heavy 581.3 / 620.316 7921.0 36.571998596191406 43 13 10 10 10 2.300789169141012 43.46334785526416 0.0 3 0.9141649935542672 4.1818995862333574 7921.0 39.75748239169757 0.0 - - - - - - - 291.0 15 6 KLHL1 kelch-like 1 (Drosophila) 379 48 C20140707_OR006_04 C20140707_OR006_04 TB412156.[MT7]-AFADAQGC[CAM]IELMK[MT7].3y4_1.heavy 581.3 / 664.382 13829.0 36.571998596191406 43 13 10 10 10 2.300789169141012 43.46334785526416 0.0 3 0.9141649935542672 4.1818995862333574 13829.0 39.68446486084349 0.0 - - - - - - - 235.0 27 8 KLHL1 kelch-like 1 (Drosophila) 381 49 C20140707_OR006_04 C20140707_OR006_04 TB450062.[MT7]-TYAIC[CAM]GAIR.2y8_1.heavy 584.817 / 923.477 38561.0 29.648799896240234 47 17 10 10 10 1.696771460279434 37.82562627257565 0.0 3 0.9736572128374721 7.587059552307461 38561.0 76.9471201814059 0.0 - - - - - - - 252.0 77 7 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 383 49 C20140707_OR006_04 C20140707_OR006_04 TB450062.[MT7]-TYAIC[CAM]GAIR.2y5_1.heavy 584.817 / 576.292 23187.0 29.648799896240234 47 17 10 10 10 1.696771460279434 37.82562627257565 0.0 3 0.9736572128374721 7.587059552307461 23187.0 35.11787698412699 0.0 - - - - - - - 648.0 46 7 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 385 49 C20140707_OR006_04 C20140707_OR006_04 TB450062.[MT7]-TYAIC[CAM]GAIR.2y6_1.heavy 584.817 / 689.376 12602.0 29.648799896240234 47 17 10 10 10 1.696771460279434 37.82562627257565 0.0 3 0.9736572128374721 7.587059552307461 12602.0 63.01 0.0 - - - - - - - 210.0 25 6 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 387 49 C20140707_OR006_04 C20140707_OR006_04 TB450062.[MT7]-TYAIC[CAM]GAIR.2y7_1.heavy 584.817 / 760.413 21297.0 29.648799896240234 47 17 10 10 10 1.696771460279434 37.82562627257565 0.0 3 0.9736572128374721 7.587059552307461 21297.0 132.40198412698413 0.0 - - - - - - - 216.0 42 14 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 389 50 C20140707_OR006_04 C20140707_OR006_04 TB450315.[MT7]-QMALSLEDTELQR.2y5_1.heavy 839.434 / 646.352 2360.0 35.61294937133789 30 5 10 5 10 0.975200448458464 66.2504154600377 0.043701171875 3 0.6991620882867629 2.1910516795465873 2360.0 1.1125175086216046 1.0 - - - - - - - 224.57142857142858 4 7 RTKN rhotekin 391 50 C20140707_OR006_04 C20140707_OR006_04 TB450315.[MT7]-QMALSLEDTELQR.2y9_1.heavy 839.434 / 1090.54 6687.0 35.61294937133789 30 5 10 5 10 0.975200448458464 66.2504154600377 0.043701171875 3 0.6991620882867629 2.1910516795465873 6687.0 40.836641221374045 0.0 - - - - - - - 205.85714285714286 13 7 RTKN rhotekin 393 50 C20140707_OR006_04 C20140707_OR006_04 TB450315.[MT7]-QMALSLEDTELQR.2y10_1.heavy 839.434 / 1203.62 1049.0 35.61294937133789 30 5 10 5 10 0.975200448458464 66.2504154600377 0.043701171875 3 0.6991620882867629 2.1910516795465873 1049.0 10.970458015267175 0.0 - - - - - - - 196.5 2 6 RTKN rhotekin 395 50 C20140707_OR006_04 C20140707_OR006_04 TB450315.[MT7]-QMALSLEDTELQR.2y10_2.heavy 839.434 / 602.314 524.0 35.61294937133789 30 5 10 5 10 0.975200448458464 66.2504154600377 0.043701171875 3 0.6991620882867629 2.1910516795465873 524.0 2.3926556543837356 11.0 - - - - - - - 0.0 1 0 RTKN rhotekin 397 51 C20140707_OR006_04 C20140707_OR006_04 TB450059.[MT7]-VK[MT7]PQDFAAITIPR.3y6_1.heavy 582.017 / 670.425 30988.0 35.94670104980469 46 16 10 10 10 2.005817296734846 39.76651049337852 0.0 3 0.966391690564369 6.7129768004548565 30988.0 105.21127311850591 0.0 - - - - - - - 305.22222222222223 61 9 TCF19 transcription factor 19 399 51 C20140707_OR006_04 C20140707_OR006_04 TB450059.[MT7]-VK[MT7]PQDFAAITIPR.3y11_1.heavy 582.017 / 1228.67 N/A 35.94670104980469 46 16 10 10 10 2.005817296734846 39.76651049337852 0.0 3 0.966391690564369 6.7129768004548565 0.0 0.0 13.0 - - - - - - - 0.0 0 0 TCF19 transcription factor 19 401 51 C20140707_OR006_04 C20140707_OR006_04 TB450059.[MT7]-VK[MT7]PQDFAAITIPR.3y8_1.heavy 582.017 / 888.53 15559.0 35.94670104980469 46 16 10 10 10 2.005817296734846 39.76651049337852 0.0 3 0.966391690564369 6.7129768004548565 15559.0 76.03688671172266 0.0 - - - - - - - 209.4 31 5 TCF19 transcription factor 19 403 51 C20140707_OR006_04 C20140707_OR006_04 TB450059.[MT7]-VK[MT7]PQDFAAITIPR.3y5_1.heavy 582.017 / 599.388 29288.0 35.94670104980469 46 16 10 10 10 2.005817296734846 39.76651049337852 0.0 3 0.966391690564369 6.7129768004548565 29288.0 98.83857142857141 0.0 - - - - - - - 239.83333333333334 58 6 TCF19 transcription factor 19 405 52 C20140707_OR006_04 C20140707_OR006_04 TB437112.[MT7]-NSGLTEEEAK[MT7].2y4_1.heavy 683.359 / 620.337 203.0 20.33690071105957 12 5 0 5 2 0.5093305274575699 103.30631809130166 0.043399810791015625 12 0.6875887353133943 2.147745018949563 203.0 1.2938719468131232 23.0 - - - - - - - 0.0 1 0 C6 complement component 6 407 52 C20140707_OR006_04 C20140707_OR006_04 TB437112.[MT7]-NSGLTEEEAK[MT7].2b4_1.heavy 683.359 / 516.29 1626.0 20.33690071105957 12 5 0 5 2 0.5093305274575699 103.30631809130166 0.043399810791015625 12 0.6875887353133943 2.147745018949563 1626.0 16.155467695274833 0.0 - - - - - - - 203.42857142857142 3 7 C6 complement component 6 409 52 C20140707_OR006_04 C20140707_OR006_04 TB437112.[MT7]-NSGLTEEEAK[MT7].2y9_2.heavy 683.359 / 554.286 508.0 20.33690071105957 12 5 0 5 2 0.5093305274575699 103.30631809130166 0.043399810791015625 12 0.6875887353133943 2.147745018949563 508.0 1.8732850671994639 15.0 - - - - - - - 192.11111111111111 13 9 C6 complement component 6 411 52 C20140707_OR006_04 C20140707_OR006_04 TB437112.[MT7]-NSGLTEEEAK[MT7].2y6_1.heavy 683.359 / 850.427 610.0 20.33690071105957 12 5 0 5 2 0.5093305274575699 103.30631809130166 0.043399810791015625 12 0.6875887353133943 2.147745018949563 610.0 5.952145286158744 2.0 - - - - - - - 0.0 1 0 C6 complement component 6 413 53 C20140707_OR006_04 C20140707_OR006_04 TB437113.[MT7]-RQLHLERK[MT7].2b4_1.heavy 684.427 / 679.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 415 53 C20140707_OR006_04 C20140707_OR006_04 TB437113.[MT7]-RQLHLERK[MT7].2b6_1.heavy 684.427 / 921.539 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 417 53 C20140707_OR006_04 C20140707_OR006_04 TB437113.[MT7]-RQLHLERK[MT7].2y6_1.heavy 684.427 / 939.586 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 419 53 C20140707_OR006_04 C20140707_OR006_04 TB437113.[MT7]-RQLHLERK[MT7].2y7_1.heavy 684.427 / 1067.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 421 54 C20140707_OR006_04 C20140707_OR006_04 TB436872.[MT7]-FHSVEPYNK[MT7].3y3_1.heavy 470.254 / 568.321 3229.0 23.760050296783447 33 13 8 6 6 1.2807000344557955 62.599360320636805 0.03660011291503906 6 0.9093623545214881 4.067914954760379 3229.0 6.232707444192766 1.0 - - - - - - - 360.25 6 8 STAT4 signal transducer and activator of transcription 4 423 54 C20140707_OR006_04 C20140707_OR006_04 TB436872.[MT7]-FHSVEPYNK[MT7].3b5_1.heavy 470.254 / 744.38 231.0 23.760050296783447 33 13 8 6 6 1.2807000344557955 62.599360320636805 0.03660011291503906 6 0.9093623545214881 4.067914954760379 231.0 -0.24237918215613385 14.0 - - - - - - - 0.0 1 0 STAT4 signal transducer and activator of transcription 4 425 54 C20140707_OR006_04 C20140707_OR006_04 TB436872.[MT7]-FHSVEPYNK[MT7].3b3_1.heavy 470.254 / 516.269 1269.0 23.760050296783447 33 13 8 6 6 1.2807000344557955 62.599360320636805 0.03660011291503906 6 0.9093623545214881 4.067914954760379 1269.0 2.0169978519404554 2.0 - - - - - - - 288.25 2 8 STAT4 signal transducer and activator of transcription 4 427 54 C20140707_OR006_04 C20140707_OR006_04 TB436872.[MT7]-FHSVEPYNK[MT7].3y4_1.heavy 470.254 / 665.374 577.0 23.760050296783447 33 13 8 6 6 1.2807000344557955 62.599360320636805 0.03660011291503906 6 0.9093623545214881 4.067914954760379 577.0 0.500650759219089 6.0 - - - - - - - 251.54545454545453 8 11 STAT4 signal transducer and activator of transcription 4 429 55 C20140707_OR006_04 C20140707_OR006_04 TB450056.[MT7]-ILILPSVTR.2y8_1.heavy 578.383 / 898.572 42643.0 39.70249938964844 47 17 10 10 10 2.7380132419725793 29.09948280671304 0.0 3 0.970743658413561 7.197601749527656 42643.0 119.81300659414961 0.0 - - - - - - - 251.7 85 10 PSG8;PSG1;PSG3;PSG5;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 431 55 C20140707_OR006_04 C20140707_OR006_04 TB450056.[MT7]-ILILPSVTR.2y5_1.heavy 578.383 / 559.32 51268.0 39.70249938964844 47 17 10 10 10 2.7380132419725793 29.09948280671304 0.0 3 0.970743658413561 7.197601749527656 51268.0 132.302254295035 0.0 - - - - - - - 279.55555555555554 102 9 PSG8;PSG1;PSG3;PSG5;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 433 55 C20140707_OR006_04 C20140707_OR006_04 TB450056.[MT7]-ILILPSVTR.2y6_1.heavy 578.383 / 672.404 33779.0 39.70249938964844 47 17 10 10 10 2.7380132419725793 29.09948280671304 0.0 3 0.970743658413561 7.197601749527656 33779.0 110.54327580090835 0.0 - - - - - - - 179.83333333333334 67 6 PSG8;PSG1;PSG3;PSG5;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 435 55 C20140707_OR006_04 C20140707_OR006_04 TB450056.[MT7]-ILILPSVTR.2y7_1.heavy 578.383 / 785.488 30904.0 39.70249938964844 47 17 10 10 10 2.7380132419725793 29.09948280671304 0.0 3 0.970743658413561 7.197601749527656 30904.0 165.7108635097493 0.0 - - - - - - - 287.4 61 10 PSG8;PSG1;PSG3;PSG5;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 5;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 437 56 C20140707_OR006_04 C20140707_OR006_04 TB411915.[MT7]-NSLHLDLEK[MT7].3y3_1.heavy 452.929 / 533.341 7625.0 29.774200439453125 50 20 10 10 10 7.982271897215739 12.527761680841838 0.0 3 0.9960500965964714 19.630261134283373 7625.0 12.443999999999999 0.0 - - - - - - - 267.85714285714283 15 7 SYT4 synaptotagmin IV 439 56 C20140707_OR006_04 C20140707_OR006_04 TB411915.[MT7]-NSLHLDLEK[MT7].3b4_1.heavy 452.929 / 596.327 4375.0 29.774200439453125 50 20 10 10 10 7.982271897215739 12.527761680841838 0.0 3 0.9960500965964714 19.630261134283373 4375.0 22.75 0.0 - - - - - - - 225.0 8 5 SYT4 synaptotagmin IV 441 56 C20140707_OR006_04 C20140707_OR006_04 TB411915.[MT7]-NSLHLDLEK[MT7].3y4_1.heavy 452.929 / 648.369 10250.0 29.774200439453125 50 20 10 10 10 7.982271897215739 12.527761680841838 0.0 3 0.9960500965964714 19.630261134283373 10250.0 59.0195 0.0 - - - - - - - 145.83333333333334 20 6 SYT4 synaptotagmin IV 443 56 C20140707_OR006_04 C20140707_OR006_04 TB411915.[MT7]-NSLHLDLEK[MT7].3b3_1.heavy 452.929 / 459.268 17501.0 29.774200439453125 50 20 10 10 10 7.982271897215739 12.527761680841838 0.0 3 0.9960500965964714 19.630261134283373 17501.0 112.93978666666666 0.0 - - - - - - - 250.0 35 6 SYT4 synaptotagmin IV 445 57 C20140707_OR006_04 C20140707_OR006_04 TB437506.[MT7]-FLEQVDQFYDDNFPMEIR.3b6_1.heavy 817.387 / 876.458 2935.0 49.03135108947754 44 20 10 6 8 9.020207586920922 11.086219362068512 0.03820037841796875 4 0.9973351183269178 23.90159659789506 2935.0 3.9625232774674117 0.0 - - - - - - - 242.23076923076923 5 13 STAT4 signal transducer and activator of transcription 4 447 57 C20140707_OR006_04 C20140707_OR006_04 TB437506.[MT7]-FLEQVDQFYDDNFPMEIR.3b4_1.heavy 817.387 / 662.363 6012.0 49.03135108947754 44 20 10 6 8 9.020207586920922 11.086219362068512 0.03820037841796875 4 0.9973351183269178 23.90159659789506 6012.0 11.4 0.0 - - - - - - - 623.7142857142857 12 7 STAT4 signal transducer and activator of transcription 4 449 57 C20140707_OR006_04 C20140707_OR006_04 TB437506.[MT7]-FLEQVDQFYDDNFPMEIR.3b3_1.heavy 817.387 / 534.304 3794.0 49.03135108947754 44 20 10 6 8 9.020207586920922 11.086219362068512 0.03820037841796875 4 0.9973351183269178 23.90159659789506 3794.0 24.67426573426573 1.0 - - - - - - - 200.6 8 10 STAT4 signal transducer and activator of transcription 4 451 57 C20140707_OR006_04 C20140707_OR006_04 TB437506.[MT7]-FLEQVDQFYDDNFPMEIR.3y5_1.heavy 817.387 / 645.339 5941.0 49.03135108947754 44 20 10 6 8 9.020207586920922 11.086219362068512 0.03820037841796875 4 0.9973351183269178 23.90159659789506 5941.0 16.33117318435754 1.0 - - - - - - - 190.91666666666666 11 12 STAT4 signal transducer and activator of transcription 4 453 58 C20140707_OR006_04 C20140707_OR006_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 259755.0 18.96769905090332 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 259755.0 3070.3472567178096 0.0 - - - - - - - 294.25 519 8 455 58 C20140707_OR006_04 C20140707_OR006_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 146118.0 18.96769905090332 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 146118.0 1654.1142803504379 0.0 - - - - - - - 176.375 292 8 457 58 C20140707_OR006_04 C20140707_OR006_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 164195.0 18.96769905090332 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 164195.0 633.546680890945 0.0 - - - - - - - 150.4 328 10 459 59 C20140707_OR006_04 C20140707_OR006_04 TB437501.[MT7]-LPLLPPQILADLENHALFK[MT7].4y4_1.heavy 608.365 / 622.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL1 kelch-like 1 (Drosophila) 461 59 C20140707_OR006_04 C20140707_OR006_04 TB437501.[MT7]-LPLLPPQILADLENHALFK[MT7].4b4_1.heavy 608.365 / 581.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL1 kelch-like 1 (Drosophila) 463 59 C20140707_OR006_04 C20140707_OR006_04 TB437501.[MT7]-LPLLPPQILADLENHALFK[MT7].4y6_1.heavy 608.365 / 873.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL1 kelch-like 1 (Drosophila) 465 59 C20140707_OR006_04 C20140707_OR006_04 TB437501.[MT7]-LPLLPPQILADLENHALFK[MT7].4y3_1.heavy 608.365 / 551.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL1 kelch-like 1 (Drosophila) 467 60 C20140707_OR006_04 C20140707_OR006_04 TB449939.[MT7]-LDHEIR.2b3_1.heavy 463.762 / 510.279 5699.0 20.271900177001953 40 10 10 10 10 0.6994646922877612 77.20238901769665 0.0 3 0.8271741924144727 2.924792822357334 5699.0 11.397836143816221 1.0 - - - - - - - 218.55555555555554 11 9 RTKN rhotekin 469 60 C20140707_OR006_04 C20140707_OR006_04 TB449939.[MT7]-LDHEIR.2y4_1.heavy 463.762 / 554.305 4323.0 20.271900177001953 40 10 10 10 10 0.6994646922877612 77.20238901769665 0.0 3 0.8271741924144727 2.924792822357334 4323.0 25.655452148831248 0.0 - - - - - - - 267.0 8 7 RTKN rhotekin 471 60 C20140707_OR006_04 C20140707_OR006_04 TB449939.[MT7]-LDHEIR.2y5_1.heavy 463.762 / 669.331 2358.0 20.271900177001953 40 10 10 10 10 0.6994646922877612 77.20238901769665 0.0 3 0.8271741924144727 2.924792822357334 2358.0 13.576302159511314 0.0 - - - - - - - 184.5 4 8 RTKN rhotekin 473 60 C20140707_OR006_04 C20140707_OR006_04 TB449939.[MT7]-LDHEIR.2b4_1.heavy 463.762 / 639.322 2456.0 20.271900177001953 40 10 10 10 10 0.6994646922877612 77.20238901769665 0.0 3 0.8271741924144727 2.924792822357334 2456.0 29.931172604635076 0.0 - - - - - - - 225.9 4 10 RTKN rhotekin 475 61 C20140707_OR006_04 C20140707_OR006_04 TB437504.[MT7]-AK[MT7]PSPAPPSTTTAPDASGPQK[MT7].4y5_1.heavy 610.337 / 660.38 12513.0 21.1382999420166 47 17 10 10 10 4.054549556163772 24.663652180050157 0.0 3 0.9783105127437219 8.364685528183998 12513.0 56.37885080371292 0.0 - - - - - - - 285.2857142857143 25 7 PEX19 peroxisomal biogenesis factor 19 477 61 C20140707_OR006_04 C20140707_OR006_04 TB437504.[MT7]-AK[MT7]PSPAPPSTTTAPDASGPQK[MT7].4y4_1.heavy 610.337 / 573.348 11672.0 21.1382999420166 47 17 10 10 10 4.054549556163772 24.663652180050157 0.0 3 0.9783105127437219 8.364685528183998 11672.0 15.350130413394599 1.0 - - - - - - - 202.57142857142858 24 14 PEX19 peroxisomal biogenesis factor 19 479 61 C20140707_OR006_04 C20140707_OR006_04 TB437504.[MT7]-AK[MT7]PSPAPPSTTTAPDASGPQK[MT7].4y3_1.heavy 610.337 / 516.326 18822.0 21.1382999420166 47 17 10 10 10 4.054549556163772 24.663652180050157 0.0 3 0.9783105127437219 8.364685528183998 18822.0 174.46180122254927 0.0 - - - - - - - 285.42857142857144 37 7 PEX19 peroxisomal biogenesis factor 19 481 61 C20140707_OR006_04 C20140707_OR006_04 TB437504.[MT7]-AK[MT7]PSPAPPSTTTAPDASGPQK[MT7].4b6_1.heavy 610.337 / 840.518 27654.0 21.1382999420166 47 17 10 10 10 4.054549556163772 24.663652180050157 0.0 3 0.9783105127437219 8.364685528183998 27654.0 143.7020357142857 0.0 - - - - - - - 236.25 55 8 PEX19 peroxisomal biogenesis factor 19 483 62 C20140707_OR006_04 C20140707_OR006_04 TB450456.[MT7]-LTSLQQELLSALLSSGVTK[MT7].3y6_1.heavy 759.449 / 722.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 485 62 C20140707_OR006_04 C20140707_OR006_04 TB450456.[MT7]-LTSLQQELLSALLSSGVTK[MT7].3b5_1.heavy 759.449 / 687.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 487 62 C20140707_OR006_04 C20140707_OR006_04 TB450456.[MT7]-LTSLQQELLSALLSSGVTK[MT7].3b8_1.heavy 759.449 / 1057.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 489 62 C20140707_OR006_04 C20140707_OR006_04 TB450456.[MT7]-LTSLQQELLSALLSSGVTK[MT7].3b7_1.heavy 759.449 / 944.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 491 63 C20140707_OR006_04 C20140707_OR006_04 TB449936.[MT7]-EELGAVR.2b3_1.heavy 459.262 / 516.279 2841.0 22.582500457763672 48 20 10 10 8 11.333810295062305 8.823158090405489 0.0 4 0.9982644793330967 29.61997204669761 2841.0 3.121978021978022 2.0 - - - - - - - 764.7142857142857 24 7 GRIPAP1 GRIP1 associated protein 1 493 63 C20140707_OR006_04 C20140707_OR006_04 TB449936.[MT7]-EELGAVR.2y5_1.heavy 459.262 / 515.33 9833.0 22.582500457763672 48 20 10 10 8 11.333810295062305 8.823158090405489 0.0 4 0.9982644793330967 29.61997204669761 9833.0 34.03115118788488 0.0 - - - - - - - 328.0 19 6 GRIPAP1 GRIP1 associated protein 1 495 63 C20140707_OR006_04 C20140707_OR006_04 TB449936.[MT7]-EELGAVR.2b4_1.heavy 459.262 / 573.3 11035.0 22.582500457763672 48 20 10 10 8 11.333810295062305 8.823158090405489 0.0 4 0.9982644793330967 29.61997204669761 11035.0 49.24084668192219 0.0 - - - - - - - 267.1111111111111 22 9 GRIPAP1 GRIP1 associated protein 1 497 63 C20140707_OR006_04 C20140707_OR006_04 TB449936.[MT7]-EELGAVR.2b6_1.heavy 459.262 / 743.406 1202.0 22.582500457763672 48 20 10 10 8 11.333810295062305 8.823158090405489 0.0 4 0.9982644793330967 29.61997204669761 1202.0 13.627059744909374 0.0 - - - - - - - 327.8333333333333 2 6 GRIPAP1 GRIP1 associated protein 1 499 64 C20140707_OR006_04 C20140707_OR006_04 TB436879.[MT7]-ESSAVPAR.2b4_1.heavy 480.765 / 519.253 2129.0 16.876300811767578 46 16 10 10 10 1.4707741557419334 43.497938568009054 0.0 3 0.9626252290193392 6.36372049743033 2129.0 15.303829915864778 0.0 - - - - - - - 147.11111111111111 4 9 GRIPAP1 GRIP1 associated protein 1 501 64 C20140707_OR006_04 C20140707_OR006_04 TB436879.[MT7]-ESSAVPAR.2y6_1.heavy 480.765 / 600.346 2187.0 16.876300811767578 46 16 10 10 10 1.4707741557419334 43.497938568009054 0.0 3 0.9626252290193392 6.36372049743033 2187.0 21.299478260869563 0.0 - - - - - - - 220.5 4 6 GRIPAP1 GRIP1 associated protein 1 503 64 C20140707_OR006_04 C20140707_OR006_04 TB436879.[MT7]-ESSAVPAR.2b5_1.heavy 480.765 / 618.321 1727.0 16.876300811767578 46 16 10 10 10 1.4707741557419334 43.497938568009054 0.0 3 0.9626252290193392 6.36372049743033 1727.0 9.79633176268617 1.0 - - - - - - - 162.27272727272728 5 11 GRIPAP1 GRIP1 associated protein 1 505 64 C20140707_OR006_04 C20140707_OR006_04 TB436879.[MT7]-ESSAVPAR.2y7_1.heavy 480.765 / 687.378 3453.0 16.876300811767578 46 16 10 10 10 1.4707741557419334 43.497938568009054 0.0 3 0.9626252290193392 6.36372049743033 3453.0 48.487791404875594 0.0 - - - - - - - 155.5 6 10 GRIPAP1 GRIP1 associated protein 1 507 65 C20140707_OR006_04 C20140707_OR006_04 TB412030.[MT7]-AHGLGSNLVTEVR.2y4_1.heavy 748.919 / 504.278 882.0 28.891825199127197 42 17 10 5 10 4.190461426136103 23.863720442883768 0.04269981384277344 3 0.9747866709916537 7.755870087428606 882.0 10.493 1.0 - - - - - - - 0.0 1 0 HNF1B HNF1 homeobox B 509 65 C20140707_OR006_04 C20140707_OR006_04 TB412030.[MT7]-AHGLGSNLVTEVR.2y9_1.heavy 748.919 / 974.526 1764.0 28.891825199127197 42 17 10 5 10 4.190461426136103 23.863720442883768 0.04269981384277344 3 0.9747866709916537 7.755870087428606 1764.0 3.5466666666666673 1.0 - - - - - - - 162.0 3 7 HNF1B HNF1 homeobox B 511 65 C20140707_OR006_04 C20140707_OR006_04 TB412030.[MT7]-AHGLGSNLVTEVR.2y10_1.heavy 748.919 / 1087.61 1134.0 28.891825199127197 42 17 10 5 10 4.190461426136103 23.863720442883768 0.04269981384277344 3 0.9747866709916537 7.755870087428606 1134.0 9.0 0.0 - - - - - - - 157.5 2 4 HNF1B HNF1 homeobox B 513 65 C20140707_OR006_04 C20140707_OR006_04 TB412030.[MT7]-AHGLGSNLVTEVR.2y11_1.heavy 748.919 / 1144.63 2142.0 28.891825199127197 42 17 10 5 10 4.190461426136103 23.863720442883768 0.04269981384277344 3 0.9747866709916537 7.755870087428606 2142.0 31.959999999999997 0.0 - - - - - - - 189.0 4 8 HNF1B HNF1 homeobox B 515 66 C20140707_OR006_04 C20140707_OR006_04 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 222193.0 38.056800842285156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 222193.0 765.4689510064288 0.0 - - - - - - - 298.5 444 2 517 66 C20140707_OR006_04 C20140707_OR006_04 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 129198.0 38.056800842285156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 129198.0 501.71456740442653 0.0 - - - - - - - 275.8888888888889 258 9 519 66 C20140707_OR006_04 C20140707_OR006_04 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 214336.0 38.056800842285156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 214336.0 305.4903908045977 0.0 - - - - - - - 198.8 428 5 521 67 C20140707_OR006_04 C20140707_OR006_04 TB450244.[MT7]-DLHLSDVFLK[MT7].3b6_1.heavy 492.288 / 825.422 1215.0 37.847299575805664 45 20 10 5 10 21.28532263323692 4.698073020695046 0.046398162841796875 3 0.996276549162595 20.21876895470464 1215.0 5.827500000000001 0.0 - - - - - - - 202.5 2 8 C6 complement component 6 523 67 C20140707_OR006_04 C20140707_OR006_04 TB450244.[MT7]-DLHLSDVFLK[MT7].3y3_1.heavy 492.288 / 551.367 6752.0 37.847299575805664 45 20 10 5 10 21.28532263323692 4.698073020695046 0.046398162841796875 3 0.996276549162595 20.21876895470464 6752.0 32.50962962962963 0.0 - - - - - - - 247.5 13 6 C6 complement component 6 525 67 C20140707_OR006_04 C20140707_OR006_04 TB450244.[MT7]-DLHLSDVFLK[MT7].3y4_1.heavy 492.288 / 650.436 2160.0 37.847299575805664 45 20 10 5 10 21.28532263323692 4.698073020695046 0.046398162841796875 3 0.996276549162595 20.21876895470464 2160.0 14.559999999999999 0.0 - - - - - - - 212.14285714285714 4 7 C6 complement component 6 527 67 C20140707_OR006_04 C20140707_OR006_04 TB450244.[MT7]-DLHLSDVFLK[MT7].3b3_1.heavy 492.288 / 510.279 9047.0 37.847299575805664 45 20 10 5 10 21.28532263323692 4.698073020695046 0.046398162841796875 3 0.996276549162595 20.21876895470464 9047.0 48.083129629629624 0.0 - - - - - - - 245.45454545454547 18 11 C6 complement component 6 529 68 C20140707_OR006_04 C20140707_OR006_04 TB437023.[MT7]-SLQSSSVSER.2y8_1.heavy 612.321 / 879.417 8204.0 19.596099853515625 46 16 10 10 10 1.85198456802155 37.53149961843275 0.0 3 0.963037963184733 6.399375041691573 8204.0 51.30682885537825 0.0 - - - - - - - 190.75 16 4 STAT4 signal transducer and activator of transcription 4 531 68 C20140707_OR006_04 C20140707_OR006_04 TB437023.[MT7]-SLQSSSVSER.2y9_1.heavy 612.321 / 992.501 10970.0 19.596099853515625 46 16 10 10 10 1.85198456802155 37.53149961843275 0.0 3 0.963037963184733 6.399375041691573 10970.0 25.487097832372367 0.0 - - - - - - - 318.0 21 6 STAT4 signal transducer and activator of transcription 4 533 68 C20140707_OR006_04 C20140707_OR006_04 TB437023.[MT7]-SLQSSSVSER.2y6_1.heavy 612.321 / 664.326 3148.0 19.596099853515625 46 16 10 10 10 1.85198456802155 37.53149961843275 0.0 3 0.963037963184733 6.399375041691573 3148.0 41.82657342657342 0.0 - - - - - - - 190.6 6 10 STAT4 signal transducer and activator of transcription 4 535 68 C20140707_OR006_04 C20140707_OR006_04 TB437023.[MT7]-SLQSSSVSER.2y7_1.heavy 612.321 / 751.358 6296.0 19.596099853515625 46 16 10 10 10 1.85198456802155 37.53149961843275 0.0 3 0.963037963184733 6.399375041691573 6296.0 23.230524109014674 0.0 - - - - - - - 254.41666666666666 12 12 STAT4 signal transducer and activator of transcription 4 537 69 C20140707_OR006_04 C20140707_OR006_04 TB437022.[MT7]-DVLYPSLK[MT7].3y3_1.heavy 408.248 / 491.331 6046.0 33.208499908447266 50 20 10 10 10 6.201160670440225 16.126013389183953 0.0 3 0.9914554513257842 13.341605126299843 6046.0 38.10388488930922 0.0 - - - - - - - 236.4 12 5 PEX19 peroxisomal biogenesis factor 19 539 69 C20140707_OR006_04 C20140707_OR006_04 TB437022.[MT7]-DVLYPSLK[MT7].3b4_1.heavy 408.248 / 635.352 1709.0 33.208499908447266 50 20 10 10 10 6.201160670440225 16.126013389183953 0.0 3 0.9914554513257842 13.341605126299843 1709.0 25.961145038167942 0.0 - - - - - - - 131.0 3 1 PEX19 peroxisomal biogenesis factor 19 541 69 C20140707_OR006_04 C20140707_OR006_04 TB437022.[MT7]-DVLYPSLK[MT7].3y4_1.heavy 408.248 / 588.384 3943.0 33.208499908447266 50 20 10 10 10 6.201160670440225 16.126013389183953 0.0 3 0.9914554513257842 13.341605126299843 3943.0 39.365676250629676 0.0 - - - - - - - 218.83333333333334 7 6 PEX19 peroxisomal biogenesis factor 19 543 69 C20140707_OR006_04 C20140707_OR006_04 TB437022.[MT7]-DVLYPSLK[MT7].3b3_1.heavy 408.248 / 472.289 11304.0 33.208499908447266 50 20 10 10 10 6.201160670440225 16.126013389183953 0.0 3 0.9914554513257842 13.341605126299843 11304.0 124.11006530635939 0.0 - - - - - - - 196.875 22 8 PEX19 peroxisomal biogenesis factor 19 545 70 C20140707_OR006_04 C20140707_OR006_04 TB450348.[MT7]-EMPSHC[CAM]LVHLHK[MT7].4y4_1.heavy 444.738 / 678.417 1116.0 24.324000358581543 38 13 10 5 10 1.8418715666368413 41.896794309038214 0.04179954528808594 3 0.9033471100109287 3.937252563795903 1116.0 9.66759128763613 0.0 - - - - - - - 279.125 2 8 PPOX protoporphyrinogen oxidase 547 70 C20140707_OR006_04 C20140707_OR006_04 TB450348.[MT7]-EMPSHC[CAM]LVHLHK[MT7].4b4_1.heavy 444.738 / 589.277 2678.0 24.324000358581543 38 13 10 5 10 1.8418715666368413 41.896794309038214 0.04179954528808594 3 0.9033471100109287 3.937252563795903 2678.0 27.13391531004207 0.0 - - - - - - - 267.8 5 5 PPOX protoporphyrinogen oxidase 549 70 C20140707_OR006_04 C20140707_OR006_04 TB450348.[MT7]-EMPSHC[CAM]LVHLHK[MT7].4b5_1.heavy 444.738 / 726.336 558.0 24.324000358581543 38 13 10 5 10 1.8418715666368413 41.896794309038214 0.04179954528808594 3 0.9033471100109287 3.937252563795903 558.0 4.303856502242153 5.0 - - - - - - - 0.0 1 0 PPOX protoporphyrinogen oxidase 551 70 C20140707_OR006_04 C20140707_OR006_04 TB450348.[MT7]-EMPSHC[CAM]LVHLHK[MT7].4y3_1.heavy 444.738 / 541.358 4128.0 24.324000358581543 38 13 10 5 10 1.8418715666368413 41.896794309038214 0.04179954528808594 3 0.9033471100109287 3.937252563795903 4128.0 27.91446508648302 0.0 - - - - - - - 234.4 8 10 PPOX protoporphyrinogen oxidase 553 71 C20140707_OR006_04 C20140707_OR006_04 TB412033.[MT7]-YTAGPYEC[CAM]EIR.2y8_1.heavy 751.857 / 1023.46 2273.0 29.113500595092773 38 10 10 10 8 2.3876384056712885 35.73327157240695 0.0 4 0.8372003598910773 3.016195890510382 2273.0 5.037910301382229 1.0 - - - - - - - 288.7142857142857 4 7 PSG8;PSG1;PSG2;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 3 555 71 C20140707_OR006_04 C20140707_OR006_04 TB412033.[MT7]-YTAGPYEC[CAM]EIR.2b4_1.heavy 751.857 / 537.279 1010.0 29.113500595092773 38 10 10 10 8 2.3876384056712885 35.73327157240695 0.0 4 0.8372003598910773 3.016195890510382 1010.0 1.1337273070924774 3.0 - - - - - - - 157.75 2 4 PSG8;PSG1;PSG2;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 3 557 71 C20140707_OR006_04 C20140707_OR006_04 TB412033.[MT7]-YTAGPYEC[CAM]EIR.2y9_1.heavy 751.857 / 1094.49 884.0 29.113500595092773 38 10 10 10 8 2.3876384056712885 35.73327157240695 0.0 4 0.8372003598910773 3.016195890510382 884.0 3.6340553109323115 3.0 - - - - - - - 221.0 2 4 PSG8;PSG1;PSG2;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 3 559 71 C20140707_OR006_04 C20140707_OR006_04 TB412033.[MT7]-YTAGPYEC[CAM]EIR.2y10_1.heavy 751.857 / 1195.54 505.0 29.113500595092773 38 10 10 10 8 2.3876384056712885 35.73327157240695 0.0 4 0.8372003598910773 3.016195890510382 505.0 1.8126440001839859 9.0 - - - - - - - 0.0 1 0 PSG8;PSG1;PSG2;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 3 561 72 C20140707_OR006_04 C20140707_OR006_04 TB412423.[MT7]-ELETLQQTVEELQAQVHSMDGAK[MT7].4b4_1.heavy 718.87 / 617.326 27058.0 48.78135108947754 44 18 10 6 10 4.678367600907183 21.374977028442352 0.037700653076171875 3 0.9810691854753502 8.955507463503578 27058.0 159.65226777007953 0.0 - - - - - - - 210.25 54 12 GRIPAP1 GRIP1 associated protein 1 563 72 C20140707_OR006_04 C20140707_OR006_04 TB412423.[MT7]-ELETLQQTVEELQAQVHSMDGAK[MT7].4y7_1.heavy 718.87 / 889.432 12988.0 48.78135108947754 44 18 10 6 10 4.678367600907183 21.374977028442352 0.037700653076171875 3 0.9810691854753502 8.955507463503578 12988.0 125.22983660130717 0.0 - - - - - - - 144.16666666666666 25 12 GRIPAP1 GRIP1 associated protein 1 565 72 C20140707_OR006_04 C20140707_OR006_04 TB412423.[MT7]-ELETLQQTVEELQAQVHSMDGAK[MT7].4y6_1.heavy 718.87 / 752.373 12339.0 48.78135108947754 44 18 10 6 10 4.678367600907183 21.374977028442352 0.037700653076171875 3 0.9810691854753502 8.955507463503578 12339.0 52.87843266540577 0.0 - - - - - - - 156.16666666666666 24 12 GRIPAP1 GRIP1 associated protein 1 567 72 C20140707_OR006_04 C20140707_OR006_04 TB412423.[MT7]-ELETLQQTVEELQAQVHSMDGAK[MT7].4b3_1.heavy 718.87 / 516.279 13926.0 48.78135108947754 44 18 10 6 10 4.678367600907183 21.374977028442352 0.037700653076171875 3 0.9810691854753502 8.955507463503578 13926.0 67.7413593758433 0.0 - - - - - - - 202.0 27 15 GRIPAP1 GRIP1 associated protein 1 569 73 C20140707_OR006_04 C20140707_OR006_04 TB450042.[MT7]-LEEQSTK[MT7].2y4_1.heavy 561.816 / 607.353 2499.0 18.539100646972656 42 20 2 10 10 9.890650773733288 10.110558171315796 0.0 3 0.9964210974624503 20.62328407862264 2499.0 15.505346534653466 0.0 - - - - - - - 290.3333333333333 4 6 STAT4 signal transducer and activator of transcription 4 571 73 C20140707_OR006_04 C20140707_OR006_04 TB450042.[MT7]-LEEQSTK[MT7].2b3_1.heavy 561.816 / 516.279 3559.0 18.539100646972656 42 20 2 10 10 9.890650773733288 10.110558171315796 0.0 3 0.9964210974624503 20.62328407862264 3559.0 13.528400295570279 0.0 - - - - - - - 295.2 7 10 STAT4 signal transducer and activator of transcription 4 573 73 C20140707_OR006_04 C20140707_OR006_04 TB450042.[MT7]-LEEQSTK[MT7].2y5_1.heavy 561.816 / 736.396 2347.0 18.539100646972656 42 20 2 10 10 9.890650773733288 10.110558171315796 0.0 3 0.9964210974624503 20.62328407862264 2347.0 9.991546556948771 1.0 - - - - - - - 132.5 6 4 STAT4 signal transducer and activator of transcription 4 575 73 C20140707_OR006_04 C20140707_OR006_04 TB450042.[MT7]-LEEQSTK[MT7].2y6_1.heavy 561.816 / 865.438 5679.0 18.539100646972656 42 20 2 10 10 9.890650773733288 10.110558171315796 0.0 3 0.9964210974624503 20.62328407862264 5679.0 40.134704496881405 0.0 - - - - - - - 180.53846153846155 28 13 STAT4 signal transducer and activator of transcription 4 577 74 C20140707_OR006_04 C20140707_OR006_04 TB450340.[MT7]-EQLTQELQEARK[MT7].3y6_1.heavy 587.663 / 888.538 9243.0 28.086299896240234 48 18 10 10 10 4.585111880990806 21.80971862749635 0.0 3 0.9846813791708715 9.958560669891863 9243.0 127.74878048780488 0.0 - - - - - - - 184.5 18 6 GRIPAP1 GRIP1 associated protein 1 579 74 C20140707_OR006_04 C20140707_OR006_04 TB450340.[MT7]-EQLTQELQEARK[MT7].3b6_1.heavy 587.663 / 873.443 13433.0 28.086299896240234 48 18 10 10 10 4.585111880990806 21.80971862749635 0.0 3 0.9846813791708715 9.958560669891863 13433.0 78.30544707201636 0.0 - - - - - - - 270.9 26 10 GRIPAP1 GRIP1 associated protein 1 581 74 C20140707_OR006_04 C20140707_OR006_04 TB450340.[MT7]-EQLTQELQEARK[MT7].3y3_1.heavy 587.663 / 518.353 14665.0 28.086299896240234 48 18 10 10 10 4.585111880990806 21.80971862749635 0.0 3 0.9846813791708715 9.958560669891863 14665.0 36.58813387423935 0.0 - - - - - - - 313.6363636363636 29 11 GRIPAP1 GRIP1 associated protein 1 583 74 C20140707_OR006_04 C20140707_OR006_04 TB450340.[MT7]-EQLTQELQEARK[MT7].3y9_1.heavy 587.663 / 1246.69 N/A 28.086299896240234 48 18 10 10 10 4.585111880990806 21.80971862749635 0.0 3 0.9846813791708715 9.958560669891863 0.0 0.0 16.0 - - - - - - - 0.0 0 0 GRIPAP1 GRIP1 associated protein 1 585 75 C20140707_OR006_04 C20140707_OR006_04 TB450043.[MT7]-LFLEGEK[MT7].2b3_1.heavy 562.334 / 518.346 6088.0 33.50605010986328 45 20 10 5 10 10.609084645597225 9.425883885420788 0.04450225830078125 3 0.993028128210546 14.771854802968672 6088.0 14.768567748679372 1.0 - - - - - - - 169.33333333333334 17 3 SYT4 synaptotagmin IV 587 75 C20140707_OR006_04 C20140707_OR006_04 TB450043.[MT7]-LFLEGEK[MT7].2y4_1.heavy 562.334 / 606.321 12429.0 33.50605010986328 45 20 10 5 10 10.609084645597225 9.425883885420788 0.04450225830078125 3 0.993028128210546 14.771854802968672 12429.0 30.541695137976344 0.0 - - - - - - - 649.875 24 8 SYT4 synaptotagmin IV 589 75 C20140707_OR006_04 C20140707_OR006_04 TB450043.[MT7]-LFLEGEK[MT7].2y5_1.heavy 562.334 / 719.406 13444.0 33.50605010986328 45 20 10 5 10 10.609084645597225 9.425883885420788 0.04450225830078125 3 0.993028128210546 14.771854802968672 13444.0 57.56231495899512 0.0 - - - - - - - 215.8 26 10 SYT4 synaptotagmin IV 591 75 C20140707_OR006_04 C20140707_OR006_04 TB450043.[MT7]-LFLEGEK[MT7].2y6_1.heavy 562.334 / 866.474 15600.0 33.50605010986328 45 20 10 5 10 10.609084645597225 9.425883885420788 0.04450225830078125 3 0.993028128210546 14.771854802968672 15600.0 47.67977357727686 0.0 - - - - - - - 190.5 31 6 SYT4 synaptotagmin IV 593 76 C20140707_OR006_04 C20140707_OR006_04 TB411890.[MT7]-HSGLYVC[CAM]SVR.3b4_1.heavy 441.232 / 539.306 6795.0 24.468299865722656 50 20 10 10 10 25.08791043981842 3.985983617084524 0.0 3 0.9947047759352853 16.952289954474637 6795.0 65.06305807239097 0.0 - - - - - - - 228.41666666666666 13 12 PSG1;PSG2 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2 595 76 C20140707_OR006_04 C20140707_OR006_04 TB411890.[MT7]-HSGLYVC[CAM]SVR.3b5_1.heavy 441.232 / 702.369 1550.0 24.468299865722656 50 20 10 10 10 25.08791043981842 3.985983617084524 0.0 3 0.9947047759352853 16.952289954474637 1550.0 2.1926174496644295 1.0 - - - - - - - 193.625 3 8 PSG1;PSG2 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2 597 76 C20140707_OR006_04 C20140707_OR006_04 TB411890.[MT7]-HSGLYVC[CAM]SVR.3y4_1.heavy 441.232 / 521.25 9298.0 24.468299865722656 50 20 10 10 10 25.08791043981842 3.985983617084524 0.0 3 0.9947047759352853 16.952289954474637 9298.0 87.46693770245528 0.0 - - - - - - - 278.22222222222223 18 9 PSG1;PSG2 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2 599 76 C20140707_OR006_04 C20140707_OR006_04 TB411890.[MT7]-HSGLYVC[CAM]SVR.3y5_1.heavy 441.232 / 620.318 4649.0 24.468299865722656 50 20 10 10 10 25.08791043981842 3.985983617084524 0.0 3 0.9947047759352853 16.952289954474637 4649.0 15.534997875423862 0.0 - - - - - - - 278.1666666666667 9 6 PSG1;PSG2 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2 601 77 C20140707_OR006_04 C20140707_OR006_04 TB437537.[MT7]-NSAMVNQEVLTLQEMLNSLDFK[MT7].4b8_1.heavy 703.867 / 1018.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 603 77 C20140707_OR006_04 C20140707_OR006_04 TB437537.[MT7]-NSAMVNQEVLTLQEMLNSLDFK[MT7].4b4_1.heavy 703.867 / 548.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 605 77 C20140707_OR006_04 C20140707_OR006_04 TB437537.[MT7]-NSAMVNQEVLTLQEMLNSLDFK[MT7].4b5_1.heavy 703.867 / 647.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 607 77 C20140707_OR006_04 C20140707_OR006_04 TB437537.[MT7]-NSAMVNQEVLTLQEMLNSLDFK[MT7].4y3_1.heavy 703.867 / 553.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 609 78 C20140707_OR006_04 C20140707_OR006_04 TB411960.[MT7]-LLHPSNC[CAM]LGIR.3y7_1.heavy 475.27 / 819.414 2644.0 30.459575176239014 36 10 10 6 10 0.7073463841849564 72.5167263878788 0.03790092468261719 3 0.842320884946268 3.0661694986639767 2644.0 12.975185185185184 0.0 - - - - - - - 216.0 5 7 KLHL1 kelch-like 1 (Drosophila) 611 78 C20140707_OR006_04 C20140707_OR006_04 TB411960.[MT7]-LLHPSNC[CAM]LGIR.3y6_1.heavy 475.27 / 732.382 1763.0 30.459575176239014 36 10 10 6 10 0.7073463841849564 72.5167263878788 0.03790092468261719 3 0.842320884946268 3.0661694986639767 1763.0 16.277433862433863 0.0 - - - - - - - 201.6 3 5 KLHL1 kelch-like 1 (Drosophila) 613 78 C20140707_OR006_04 C20140707_OR006_04 TB411960.[MT7]-LLHPSNC[CAM]LGIR.3b3_1.heavy 475.27 / 508.336 3651.0 30.459575176239014 36 10 10 6 10 0.7073463841849564 72.5167263878788 0.03790092468261719 3 0.842320884946268 3.0661694986639767 3651.0 6.761111111111111 1.0 - - - - - - - 266.0 7 9 KLHL1 kelch-like 1 (Drosophila) 615 78 C20140707_OR006_04 C20140707_OR006_04 TB411960.[MT7]-LLHPSNC[CAM]LGIR.3y8_1.heavy 475.27 / 916.467 755.0 30.459575176239014 36 10 10 6 10 0.7073463841849564 72.5167263878788 0.03790092468261719 3 0.842320884946268 3.0661694986639767 755.0 7.809656084656085 0.0 - - - - - - - 0.0 1 0 KLHL1 kelch-like 1 (Drosophila) 617 79 C20140707_OR006_04 C20140707_OR006_04 TB450339.[MT7]-VIMAENIPENPLK[MT7].3b6_1.heavy 586.002 / 802.425 23609.0 37.244300842285156 50 20 10 10 10 20.487653806472267 4.88098837205112 0.0 3 0.9948687817041396 17.221312369488214 23609.0 86.8578024691358 0.0 - - - - - - - 250.71428571428572 47 7 STAT4 signal transducer and activator of transcription 4 619 79 C20140707_OR006_04 C20140707_OR006_04 TB450339.[MT7]-VIMAENIPENPLK[MT7].3y3_1.heavy 586.002 / 501.352 31299.0 37.244300842285156 50 20 10 10 10 20.487653806472267 4.88098837205112 0.0 3 0.9948687817041396 17.221312369488214 31299.0 51.41490474888406 0.0 - - - - - - - 270.0 62 7 STAT4 signal transducer and activator of transcription 4 621 79 C20140707_OR006_04 C20140707_OR006_04 TB450339.[MT7]-VIMAENIPENPLK[MT7].3b4_1.heavy 586.002 / 559.339 15380.0 37.244300842285156 50 20 10 10 10 20.487653806472267 4.88098837205112 0.0 3 0.9948687817041396 17.221312369488214 15380.0 45.11797601062125 0.0 - - - - - - - 659.5555555555555 30 9 STAT4 signal transducer and activator of transcription 4 623 79 C20140707_OR006_04 C20140707_OR006_04 TB450339.[MT7]-VIMAENIPENPLK[MT7].3b5_1.heavy 586.002 / 688.382 20911.0 37.244300842285156 50 20 10 10 10 20.487653806472267 4.88098837205112 0.0 3 0.9948687817041396 17.221312369488214 20911.0 36.62001432789769 0.0 - - - - - - - 655.5714285714286 41 7 STAT4 signal transducer and activator of transcription 4 625 80 C20140707_OR006_04 C20140707_OR006_04 TB411680.[MT7]-AQEAAATQLGLK[MT7].3b6_1.heavy 496.959 / 686.359 4540.0 28.945199966430664 47 17 10 10 10 3.206714329077965 31.18456767202997 0.0 3 0.9787028612576375 8.441661690163452 4540.0 17.495555555555555 1.0 - - - - - - - 204.75 11 8 PPOX protoporphyrinogen oxidase 627 80 C20140707_OR006_04 C20140707_OR006_04 TB411680.[MT7]-AQEAAATQLGLK[MT7].3b4_1.heavy 496.959 / 544.285 11097.0 28.945199966430664 47 17 10 10 10 3.206714329077965 31.18456767202997 0.0 3 0.9787028612576375 8.441661690163452 11097.0 53.20691231192363 0.0 - - - - - - - 176.4 22 5 PPOX protoporphyrinogen oxidase 629 80 C20140707_OR006_04 C20140707_OR006_04 TB411680.[MT7]-AQEAAATQLGLK[MT7].3b5_1.heavy 496.959 / 615.322 13746.0 28.945199966430664 47 17 10 10 10 3.206714329077965 31.18456767202997 0.0 3 0.9787028612576375 8.441661690163452 13746.0 107.6358279041954 0.0 - - - - - - - 168.0 27 9 PPOX protoporphyrinogen oxidase 631 80 C20140707_OR006_04 C20140707_OR006_04 TB411680.[MT7]-AQEAAATQLGLK[MT7].3y4_1.heavy 496.959 / 574.404 9584.0 28.945199966430664 47 17 10 10 10 3.206714329077965 31.18456767202997 0.0 3 0.9787028612576375 8.441661690163452 9584.0 91.27619047619048 1.0 - - - - - - - 180.0 19 7 PPOX protoporphyrinogen oxidase 633 81 C20140707_OR006_04 C20140707_OR006_04 TB436999.[MT7]-GLVLQELK[MT7].2y4_1.heavy 594.384 / 661.4 16873.0 35.76789855957031 48 18 10 10 10 13.133066596654766 7.6143678450143435 0.0 3 0.981950928209787 9.172327302874198 16873.0 37.47203262233375 0.0 - - - - - - - 236.44444444444446 33 9 KLHL1 kelch-like 1 (Drosophila) 635 81 C20140707_OR006_04 C20140707_OR006_04 TB436999.[MT7]-GLVLQELK[MT7].2y5_1.heavy 594.384 / 774.484 29894.0 35.76789855957031 48 18 10 10 10 13.133066596654766 7.6143678450143435 0.0 3 0.981950928209787 9.172327302874198 29894.0 163.06183750336294 0.0 - - - - - - - 253.9090909090909 59 11 KLHL1 kelch-like 1 (Drosophila) 637 81 C20140707_OR006_04 C20140707_OR006_04 TB436999.[MT7]-GLVLQELK[MT7].2b4_1.heavy 594.384 / 527.367 15678.0 35.76789855957031 48 18 10 10 10 13.133066596654766 7.6143678450143435 0.0 3 0.981950928209787 9.172327302874198 15678.0 25.372382382013814 0.0 - - - - - - - 228.0 31 7 KLHL1 kelch-like 1 (Drosophila) 639 81 C20140707_OR006_04 C20140707_OR006_04 TB436999.[MT7]-GLVLQELK[MT7].2y3_1.heavy 594.384 / 533.341 8902.0 35.76789855957031 48 18 10 10 10 13.133066596654766 7.6143678450143435 0.0 3 0.981950928209787 9.172327302874198 8902.0 5.02196058363706 1.0 - - - - - - - 243.83333333333334 20 6 KLHL1 kelch-like 1 (Drosophila) 641 82 C20140707_OR006_04 C20140707_OR006_04 TB450133.[MT7]-NILAAPGILK[MT7].2y5_1.heavy 649.426 / 671.457 49680.0 37.22165107727051 42 17 10 5 10 6.386578842182863 15.65783535615464 0.045299530029296875 3 0.9763800290212488 8.014272933784806 49680.0 139.97142857142856 0.0 - - - - - - - 303.75 99 4 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 643 82 C20140707_OR006_04 C20140707_OR006_04 TB450133.[MT7]-NILAAPGILK[MT7].2b4_1.heavy 649.426 / 556.357 26865.0 37.22165107727051 42 17 10 5 10 6.386578842182863 15.65783535615464 0.045299530029296875 3 0.9763800290212488 8.014272933784806 26865.0 50.855555555555554 0.0 - - - - - - - 270.0 53 6 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 645 82 C20140707_OR006_04 C20140707_OR006_04 TB450133.[MT7]-NILAAPGILK[MT7].2y6_1.heavy 649.426 / 742.494 20115.0 37.22165107727051 42 17 10 5 10 6.386578842182863 15.65783535615464 0.045299530029296875 3 0.9763800290212488 8.014272933784806 20115.0 45.44499999999999 0.0 - - - - - - - 694.2857142857143 40 7 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 647 82 C20140707_OR006_04 C20140707_OR006_04 TB450133.[MT7]-NILAAPGILK[MT7].2y7_1.heavy 649.426 / 813.531 19980.0 37.22165107727051 42 17 10 5 10 6.386578842182863 15.65783535615464 0.045299530029296875 3 0.9763800290212488 8.014272933784806 19980.0 157.805 0.0 - - - - - - - 247.5 39 6 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 649 83 C20140707_OR006_04 C20140707_OR006_04 TB412418.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].3y7_1.heavy 896.51 / 1074.57 6259.0 50.02669906616211 43 17 10 6 10 6.557915446249079 15.248747993113703 0.039398193359375 3 0.9750155368753642 7.7914622453977715 6259.0 53.43789327789328 0.0 - - - - - - - 214.05555555555554 12 18 PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 651 83 C20140707_OR006_04 C20140707_OR006_04 TB412418.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].3y3_1.heavy 896.51 / 640.357 6397.0 50.02669906616211 43 17 10 6 10 6.557915446249079 15.248747993113703 0.039398193359375 3 0.9750155368753642 7.7914622453977715 6397.0 64.5094044795784 0.0 - - - - - - - 206.42857142857142 12 14 PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 653 83 C20140707_OR006_04 C20140707_OR006_04 TB412418.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].3b4_1.heavy 896.51 / 585.373 10868.0 50.02669906616211 43 17 10 6 10 6.557915446249079 15.248747993113703 0.039398193359375 3 0.9750155368753642 7.7914622453977715 10868.0 46.62268604651163 0.0 - - - - - - - 252.33333333333334 21 12 PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 655 83 C20140707_OR006_04 C20140707_OR006_04 TB412418.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].3b5_1.heavy 896.51 / 698.457 10524.0 50.02669906616211 43 17 10 6 10 6.557915446249079 15.248747993113703 0.039398193359375 3 0.9750155368753642 7.7914622453977715 10524.0 47.51126213592233 0.0 - - - - - - - 206.35714285714286 21 14 PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 657 84 C20140707_OR006_04 C20140707_OR006_04 TB412046.[MT7]-VQQAGEMQNWAQVHGVLK[MT7].3b9_1.heavy 771.079 / 1130.54 794.0 34.486698150634766 43 13 10 10 10 1.4823079957015202 53.9153848042015 0.0 3 0.9272412012601147 4.547267829130961 794.0 4.2272846595570135 5.0 - - - - - - - 185.2 4 5 RTKN rhotekin 659 84 C20140707_OR006_04 C20140707_OR006_04 TB412046.[MT7]-VQQAGEMQNWAQVHGVLK[MT7].3b6_1.heavy 771.079 / 757.396 3306.0 34.486698150634766 43 13 10 10 10 1.4823079957015202 53.9153848042015 0.0 3 0.9272412012601147 4.547267829130961 3306.0 19.512957559051372 0.0 - - - - - - - 225.0 6 10 RTKN rhotekin 661 84 C20140707_OR006_04 C20140707_OR006_04 TB412046.[MT7]-VQQAGEMQNWAQVHGVLK[MT7].3y4_1.heavy 771.079 / 560.389 7009.0 34.486698150634766 43 13 10 10 10 1.4823079957015202 53.9153848042015 0.0 3 0.9272412012601147 4.547267829130961 7009.0 68.13437278444826 0.0 - - - - - - - 248.125 14 8 RTKN rhotekin 663 84 C20140707_OR006_04 C20140707_OR006_04 TB412046.[MT7]-VQQAGEMQNWAQVHGVLK[MT7].3y5_1.heavy 771.079 / 697.448 6745.0 34.486698150634766 43 13 10 10 10 1.4823079957015202 53.9153848042015 0.0 3 0.9272412012601147 4.547267829130961 6745.0 28.012547704818637 0.0 - - - - - - - 245.71428571428572 13 7 RTKN rhotekin 665 85 C20140707_OR006_04 C20140707_OR006_04 TB437138.[MT7]-EADFRC[CAM]PGC[CAM]R.2y5_1.heavy 706.32 / 649.255 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCF19 transcription factor 19 667 85 C20140707_OR006_04 C20140707_OR006_04 TB437138.[MT7]-EADFRC[CAM]PGC[CAM]R.2y9_2.heavy 706.32 / 569.748 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCF19 transcription factor 19 669 85 C20140707_OR006_04 C20140707_OR006_04 TB437138.[MT7]-EADFRC[CAM]PGC[CAM]R.2b5_1.heavy 706.32 / 763.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCF19 transcription factor 19 671 85 C20140707_OR006_04 C20140707_OR006_04 TB437138.[MT7]-EADFRC[CAM]PGC[CAM]R.2y7_1.heavy 706.32 / 952.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCF19 transcription factor 19 673 86 C20140707_OR006_04 C20140707_OR006_04 TB450338.[MT7]-NETGPYQC[CAM]EIQDR.2b3_1.heavy 877.4 / 489.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG3 pregnancy specific beta-1-glycoprotein 3 675 86 C20140707_OR006_04 C20140707_OR006_04 TB450338.[MT7]-NETGPYQC[CAM]EIQDR.2y4_1.heavy 877.4 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG3 pregnancy specific beta-1-glycoprotein 3 677 86 C20140707_OR006_04 C20140707_OR006_04 TB450338.[MT7]-NETGPYQC[CAM]EIQDR.2b4_1.heavy 877.4 / 546.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG3 pregnancy specific beta-1-glycoprotein 3 679 86 C20140707_OR006_04 C20140707_OR006_04 TB450338.[MT7]-NETGPYQC[CAM]EIQDR.2y9_1.heavy 877.4 / 1208.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG3 pregnancy specific beta-1-glycoprotein 3 681 87 C20140707_OR006_04 C20140707_OR006_04 TB411741.[MT7]-K[MT7]GSAALK[MT7].2y4_1.heavy 553.867 / 546.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 683 87 C20140707_OR006_04 C20140707_OR006_04 TB411741.[MT7]-K[MT7]GSAALK[MT7].2b6_1.heavy 553.867 / 816.518 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 685 87 C20140707_OR006_04 C20140707_OR006_04 TB411741.[MT7]-K[MT7]GSAALK[MT7].2y6_1.heavy 553.867 / 690.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 687 87 C20140707_OR006_04 C20140707_OR006_04 TB411741.[MT7]-K[MT7]GSAALK[MT7].2b5_1.heavy 553.867 / 703.434 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 689 88 C20140707_OR006_04 C20140707_OR006_04 TB437424.[MT7]-LRPQPLTFSPSWGGPK[MT7].3y7_1.heavy 686.058 / 872.475 6891.0 36.50554847717285 43 18 10 5 10 5.629725867802489 17.76285423983425 0.044300079345703125 3 0.9878100829838401 11.1665711671121 6891.0 38.55484118706741 0.0 - - - - - - - 318.2 13 5 TCF19 transcription factor 19 691 88 C20140707_OR006_04 C20140707_OR006_04 TB437424.[MT7]-LRPQPLTFSPSWGGPK[MT7].3b4_1.heavy 686.058 / 639.406 3976.0 36.50554847717285 43 18 10 5 10 5.629725867802489 17.76285423983425 0.044300079345703125 3 0.9878100829838401 11.1665711671121 3976.0 11.578704004098011 1.0 - - - - - - - 624.8571428571429 19 7 TCF19 transcription factor 19 693 88 C20140707_OR006_04 C20140707_OR006_04 TB437424.[MT7]-LRPQPLTFSPSWGGPK[MT7].3y4_1.heavy 686.058 / 502.311 17758.0 36.50554847717285 43 18 10 5 10 5.629725867802489 17.76285423983425 0.044300079345703125 3 0.9878100829838401 11.1665711671121 17758.0 75.72279245283018 0.0 - - - - - - - 298.25 35 4 TCF19 transcription factor 19 695 88 C20140707_OR006_04 C20140707_OR006_04 TB437424.[MT7]-LRPQPLTFSPSWGGPK[MT7].3y5_1.heavy 686.058 / 688.39 5036.0 36.50554847717285 43 18 10 5 10 5.629725867802489 17.76285423983425 0.044300079345703125 3 0.9878100829838401 11.1665711671121 5036.0 16.578069078423795 0.0 - - - - - - - 265.3 10 10 TCF19 transcription factor 19 697 89 C20140707_OR006_04 C20140707_OR006_04 TB412410.[MT7]-FFQELFDSELASQATAEFEK[MT7].3y6_1.heavy 875.77 / 868.453 4817.0 51.01839828491211 50 20 10 10 10 21.971309890007017 4.551389994525632 0.0 3 0.9957212353356723 18.860282527683786 4817.0 32.35298507462686 0.0 - - - - - - - 128.84615384615384 9 13 PEX19 peroxisomal biogenesis factor 19 699 89 C20140707_OR006_04 C20140707_OR006_04 TB412410.[MT7]-FFQELFDSELASQATAEFEK[MT7].3b6_1.heavy 875.77 / 956.5 3412.0 51.01839828491211 50 20 10 10 10 21.971309890007017 4.551389994525632 0.0 3 0.9957212353356723 18.860282527683786 3412.0 12.12499818663691 0.0 - - - - - - - 164.84615384615384 6 13 PEX19 peroxisomal biogenesis factor 19 701 89 C20140707_OR006_04 C20140707_OR006_04 TB412410.[MT7]-FFQELFDSELASQATAEFEK[MT7].3b5_1.heavy 875.77 / 809.431 9367.0 51.01839828491211 50 20 10 10 10 21.971309890007017 4.551389994525632 0.0 3 0.9957212353356723 18.860282527683786 9367.0 25.401162407725707 0.0 - - - - - - - 276.0 18 16 PEX19 peroxisomal biogenesis factor 19 703 89 C20140707_OR006_04 C20140707_OR006_04 TB412410.[MT7]-FFQELFDSELASQATAEFEK[MT7].3b7_1.heavy 875.77 / 1071.53 5085.0 51.01839828491211 50 20 10 10 10 21.971309890007017 4.551389994525632 0.0 3 0.9957212353356723 18.860282527683786 5085.0 25.953051140804707 0.0 - - - - - - - 205.0625 10 16 PEX19 peroxisomal biogenesis factor 19 705 90 C20140707_OR006_04 C20140707_OR006_04 TB437425.[MT7]-LRPQPLTFSPSWGGPK[MT7].4y4_1.heavy 514.795 / 502.311 14011.0 36.4833984375 44 14 10 10 10 0.9304089196229929 66.6437036588631 0.0 3 0.9388392016329318 4.964632059256849 14011.0 61.05549118387909 0.0 - - - - - - - 276.3636363636364 28 11 TCF19 transcription factor 19 707 90 C20140707_OR006_04 C20140707_OR006_04 TB437425.[MT7]-LRPQPLTFSPSWGGPK[MT7].4b7_1.heavy 514.795 / 950.59 1718.0 36.4833984375 44 14 10 10 10 0.9304089196229929 66.6437036588631 0.0 3 0.9388392016329318 4.964632059256849 1718.0 19.3275 0.0 - - - - - - - 211.4 3 5 TCF19 transcription factor 19 709 90 C20140707_OR006_04 C20140707_OR006_04 TB437425.[MT7]-LRPQPLTFSPSWGGPK[MT7].4b4_1.heavy 514.795 / 639.406 2644.0 36.4833984375 44 14 10 10 10 0.9304089196229929 66.6437036588631 0.0 3 0.9388392016329318 4.964632059256849 2644.0 25.682077551331957 0.0 - - - - - - - 226.42857142857142 5 7 TCF19 transcription factor 19 711 90 C20140707_OR006_04 C20140707_OR006_04 TB437425.[MT7]-LRPQPLTFSPSWGGPK[MT7].4b9_2.heavy 514.795 / 592.849 5419.0 36.4833984375 44 14 10 10 10 0.9304089196229929 66.6437036588631 0.0 3 0.9388392016329318 4.964632059256849 5419.0 58.09003787878788 0.0 - - - - - - - 264.3333333333333 10 3 TCF19 transcription factor 19 713 91 C20140707_OR006_04 C20140707_OR006_04 TB412413.[MT7]-DVLLLVHNLPQNLAGYIWYK[MT7].3y6_1.heavy 886.507 / 973.526 5620.0 51.03839874267578 39 14 10 5 10 1.825940035343901 44.2265569093777 0.04000091552734375 3 0.9439645761832393 5.1889787002170875 5620.0 16.877399380804953 0.0 - - - - - - - 213.6153846153846 11 13 PSG3;PSG4;PSG5 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 5 715 91 C20140707_OR006_04 C20140707_OR006_04 TB412413.[MT7]-DVLLLVHNLPQNLAGYIWYK[MT7].3y3_1.heavy 886.507 / 640.357 10918.0 51.03839874267578 39 14 10 5 10 1.825940035343901 44.2265569093777 0.04000091552734375 3 0.9439645761832393 5.1889787002170875 10918.0 53.88467226377469 0.0 - - - - - - - 159.46666666666667 21 15 PSG3;PSG4;PSG5 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 5 717 91 C20140707_OR006_04 C20140707_OR006_04 TB412413.[MT7]-DVLLLVHNLPQNLAGYIWYK[MT7].3b4_1.heavy 886.507 / 585.373 11241.0 51.03839874267578 39 14 10 5 10 1.825940035343901 44.2265569093777 0.04000091552734375 3 0.9439645761832393 5.1889787002170875 11241.0 136.09039319108126 0.0 - - - - - - - 170.78571428571428 22 14 PSG3;PSG4;PSG5 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 5 719 91 C20140707_OR006_04 C20140707_OR006_04 TB412413.[MT7]-DVLLLVHNLPQNLAGYIWYK[MT7].3b5_1.heavy 886.507 / 698.457 9755.0 51.03839874267578 39 14 10 5 10 1.825940035343901 44.2265569093777 0.04000091552734375 3 0.9439645761832393 5.1889787002170875 9755.0 82.30513266203148 0.0 - - - - - - - 155.13333333333333 19 15 PSG3;PSG4;PSG5 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 5 721 92 C20140707_OR006_04 C20140707_OR006_04 TB450438.[MT7]-FQQSGQNLFIPQITTK[MT7].2b8_1.heavy 1069.6 / 1047.53 3764.0 39.555174827575684 42 16 10 6 10 6.484719382838665 15.420867750213322 0.039897918701171875 3 0.9694813971846808 7.0464327075840805 3764.0 21.0784 1.0 - - - - - - - 225.5 7 10 PSG2 pregnancy specific beta-1-glycoprotein 2 723 92 C20140707_OR006_04 C20140707_OR006_04 TB450438.[MT7]-FQQSGQNLFIPQITTK[MT7].2y6_1.heavy 1069.6 / 831.506 11293.0 39.555174827575684 42 16 10 6 10 6.484719382838665 15.420867750213322 0.039897918701171875 3 0.9694813971846808 7.0464327075840805 11293.0 107.88009434262948 0.0 - - - - - - - 161.0 22 7 PSG2 pregnancy specific beta-1-glycoprotein 2 725 92 C20140707_OR006_04 C20140707_OR006_04 TB450438.[MT7]-FQQSGQNLFIPQITTK[MT7].2b7_1.heavy 1069.6 / 934.45 1631.0 39.555174827575684 42 16 10 6 10 6.484719382838665 15.420867750213322 0.039897918701171875 3 0.9694813971846808 7.0464327075840805 1631.0 7.583313554293464 0.0 - - - - - - - 301.0 3 5 PSG2 pregnancy specific beta-1-glycoprotein 2 727 92 C20140707_OR006_04 C20140707_OR006_04 TB450438.[MT7]-FQQSGQNLFIPQITTK[MT7].2b9_1.heavy 1069.6 / 1194.6 3513.0 39.555174827575684 42 16 10 6 10 6.484719382838665 15.420867750213322 0.039897918701171875 3 0.9694813971846808 7.0464327075840805 3513.0 16.58527888446215 0.0 - - - - - - - 208.83333333333334 7 6 PSG2 pregnancy specific beta-1-glycoprotein 2 729 93 C20140707_OR006_04 C20140707_OR006_04 TB450031.[MT7]-LILEAMK[MT7].2y4_1.heavy 553.348 / 622.335 8220.0 37.47140121459961 46 16 10 10 10 3.1931529353443766 24.967512880461022 0.0 3 0.9691419441580166 7.007368020781045 8220.0 36.20702670623145 0.0 - - - - - - - 269.8 16 5 KLHL1 kelch-like 1 (Drosophila) 731 93 C20140707_OR006_04 C20140707_OR006_04 TB450031.[MT7]-LILEAMK[MT7].2y5_1.heavy 553.348 / 735.419 7816.0 37.47140121459961 46 16 10 10 10 3.1931529353443766 24.967512880461022 0.0 3 0.9691419441580166 7.007368020781045 7816.0 66.53993845477525 0.0 - - - - - - - 180.0 15 6 KLHL1 kelch-like 1 (Drosophila) 733 93 C20140707_OR006_04 C20140707_OR006_04 TB450031.[MT7]-LILEAMK[MT7].2b4_1.heavy 553.348 / 613.404 4447.0 37.47140121459961 46 16 10 10 10 3.1931529353443766 24.967512880461022 0.0 3 0.9691419441580166 7.007368020781045 4447.0 35.637483953669374 2.0 - - - - - - - 215.8 12 5 KLHL1 kelch-like 1 (Drosophila) 735 93 C20140707_OR006_04 C20140707_OR006_04 TB450031.[MT7]-LILEAMK[MT7].2y6_1.heavy 553.348 / 848.503 6199.0 37.47140121459961 46 16 10 10 10 3.1931529353443766 24.967512880461022 0.0 3 0.9691419441580166 7.007368020781045 6199.0 20.463333333333335 2.0 - - - - - - - 231.28571428571428 12 7 KLHL1 kelch-like 1 (Drosophila) 737 94 C20140707_OR006_04 C20140707_OR006_04 TB450132.[MT7]-DALFASQEK[MT7].3b4_1.heavy 432.906 / 591.326 4028.0 28.35099983215332 46 16 10 10 10 2.370505560998715 42.18509403448483 0.0 3 0.966747378294863 6.748986614893239 4028.0 0.6116274893480214 3.0 - - - - - - - 210.0 9 3 PEX19 peroxisomal biogenesis factor 19 739 94 C20140707_OR006_04 C20140707_OR006_04 TB450132.[MT7]-DALFASQEK[MT7].3b5_1.heavy 432.906 / 662.363 1259.0 28.35099983215332 46 16 10 10 10 2.370505560998715 42.18509403448483 0.0 3 0.966747378294863 6.748986614893239 1259.0 8.327160727425628 1.0 - - - - - - - 176.4 2 5 PEX19 peroxisomal biogenesis factor 19 741 94 C20140707_OR006_04 C20140707_OR006_04 TB450132.[MT7]-DALFASQEK[MT7].3y4_1.heavy 432.906 / 635.348 3147.0 28.35099983215332 46 16 10 10 10 2.370505560998715 42.18509403448483 0.0 3 0.966747378294863 6.748986614893239 3147.0 14.988194542961176 0.0 - - - - - - - 252.0 6 3 PEX19 peroxisomal biogenesis factor 19 743 94 C20140707_OR006_04 C20140707_OR006_04 TB450132.[MT7]-DALFASQEK[MT7].3b3_1.heavy 432.906 / 444.258 7301.0 28.35099983215332 46 16 10 10 10 2.370505560998715 42.18509403448483 0.0 3 0.966747378294863 6.748986614893239 7301.0 21.6360020921186 0.0 - - - - - - - 252.0 14 4 PEX19 peroxisomal biogenesis factor 19 745 95 C20140707_OR006_04 C20140707_OR006_04 TB450131.[MT7]-YYEAADTVTQFDNVR.3b6_1.heavy 645.978 / 857.38 8087.0 36.08190155029297 43 13 10 10 10 1.695742706684368 39.40413143131771 0.0 3 0.9286902132001025 4.5938054082545445 8087.0 66.26788550004211 0.0 - - - - - - - 246.22222222222223 16 9 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 747 95 C20140707_OR006_04 C20140707_OR006_04 TB450131.[MT7]-YYEAADTVTQFDNVR.3b4_1.heavy 645.978 / 671.316 16956.0 36.08190155029297 43 13 10 10 10 1.695742706684368 39.40413143131771 0.0 3 0.9286902132001025 4.5938054082545445 16956.0 19.051977265326798 0.0 - - - - - - - 304.0 33 3 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 749 95 C20140707_OR006_04 C20140707_OR006_04 TB450131.[MT7]-YYEAADTVTQFDNVR.3b3_1.heavy 645.978 / 600.279 17478.0 36.08190155029297 43 13 10 10 10 1.695742706684368 39.40413143131771 0.0 3 0.9286902132001025 4.5938054082545445 17478.0 17.888667817937616 0.0 - - - - - - - 1267.0 34 7 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 751 95 C20140707_OR006_04 C20140707_OR006_04 TB450131.[MT7]-YYEAADTVTQFDNVR.3y5_1.heavy 645.978 / 650.326 25955.0 36.08190155029297 43 13 10 10 10 1.695742706684368 39.40413143131771 0.0 3 0.9286902132001025 4.5938054082545445 25955.0 81.64235679098017 0.0 - - - - - - - 223.28571428571428 51 7 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 753 96 C20140707_OR006_04 C20140707_OR006_04 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1439630.0 35.052799224853516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1439630.0 937.6350287511231 0.0 - - - - - - - 270.0 2879 8 755 96 C20140707_OR006_04 C20140707_OR006_04 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 283039.0 35.052799224853516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 283039.0 217.74073290988963 0.0 - - - - - - - 270.0 566 7 757 96 C20140707_OR006_04 C20140707_OR006_04 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 447493.0 35.052799224853516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 447493.0 799.0077075025123 0.0 - - - - - - - 732.4285714285714 894 7 759 97 C20140707_OR006_04 C20140707_OR006_04 TB436995.[MT7]-ALQEYAAK[MT7].2y4_1.heavy 591.342 / 596.352 4003.0 25.1210994720459 40 14 6 10 10 1.303978128127148 51.1256019013274 0.0 3 0.946991756397648 5.336460625887538 4003.0 18.53569944488501 0.0 - - - - - - - 242.7 8 10 C6 complement component 6 761 97 C20140707_OR006_04 C20140707_OR006_04 TB436995.[MT7]-ALQEYAAK[MT7].2y5_1.heavy 591.342 / 725.395 4488.0 25.1210994720459 40 14 6 10 10 1.303978128127148 51.1256019013274 0.0 3 0.946991756397648 5.336460625887538 4488.0 41.01602397602398 0.0 - - - - - - - 222.33333333333334 8 6 C6 complement component 6 763 97 C20140707_OR006_04 C20140707_OR006_04 TB436995.[MT7]-ALQEYAAK[MT7].2b4_1.heavy 591.342 / 586.332 2669.0 25.1210994720459 40 14 6 10 10 1.303978128127148 51.1256019013274 0.0 3 0.946991756397648 5.336460625887538 2669.0 4.289148592876916 1.0 - - - - - - - 814.4285714285714 5 7 C6 complement component 6 765 97 C20140707_OR006_04 C20140707_OR006_04 TB436995.[MT7]-ALQEYAAK[MT7].2y7_1.heavy 591.342 / 966.538 2426.0 25.1210994720459 40 14 6 10 10 1.303978128127148 51.1256019013274 0.0 3 0.946991756397648 5.336460625887538 2426.0 19.54292912749984 2.0 - - - - - - - 202.11111111111111 12 9 C6 complement component 6 767 98 C20140707_OR006_04 C20140707_OR006_04 TB411884.[MT7]-TLFLFGVTK[MT7].3b4_1.heavy 438.607 / 619.394 3240.0 44.1927490234375 36 10 10 6 10 1.927840061220115 36.47091595162531 0.035400390625 3 0.8208910502739704 2.8714254112620727 3240.0 38.400000000000006 0.0 - - - - - - - 202.5 6 2 PSG2;PSG3;PSG11 pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 11 769 98 C20140707_OR006_04 C20140707_OR006_04 TB411884.[MT7]-TLFLFGVTK[MT7].3y7_2.heavy 438.607 / 478.29 4536.0 44.1927490234375 36 10 10 6 10 1.927840061220115 36.47091595162531 0.035400390625 3 0.8208910502739704 2.8714254112620727 4536.0 67.2 0.0 - - - - - - - 202.5 9 4 PSG2;PSG3;PSG11 pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 11 771 98 C20140707_OR006_04 C20140707_OR006_04 TB411884.[MT7]-TLFLFGVTK[MT7].3y4_1.heavy 438.607 / 548.352 5265.0 44.1927490234375 36 10 10 6 10 1.927840061220115 36.47091595162531 0.035400390625 3 0.8208910502739704 2.8714254112620727 5265.0 60.125 0.0 - - - - - - - 202.5 10 4 PSG2;PSG3;PSG11 pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 11 773 98 C20140707_OR006_04 C20140707_OR006_04 TB411884.[MT7]-TLFLFGVTK[MT7].3b3_1.heavy 438.607 / 506.31 2187.0 44.1927490234375 36 10 10 6 10 1.927840061220115 36.47091595162531 0.035400390625 3 0.8208910502739704 2.8714254112620727 2187.0 17.28 0.0 - - - - - - - 202.5 4 6 PSG2;PSG3;PSG11 pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 11 775 99 C20140707_OR006_04 C20140707_OR006_04 TB436993.[MT7]-EQALEATK[MT7].2y4_1.heavy 589.337 / 592.342 2919.0 21.36400032043457 42 17 10 5 10 7.027468116515659 14.229876015372339 0.04019927978515625 3 0.9705250354477337 7.170726822481696 2919.0 27.02777777777778 0.0 - - - - - - - 252.0 5 9 RTKN rhotekin 777 99 C20140707_OR006_04 C20140707_OR006_04 TB436993.[MT7]-EQALEATK[MT7].2y5_1.heavy 589.337 / 705.426 3027.0 21.36400032043457 42 17 10 5 10 7.027468116515659 14.229876015372339 0.04019927978515625 3 0.9705250354477337 7.170726822481696 3027.0 17.750925925925927 0.0 - - - - - - - 216.0 6 3 RTKN rhotekin 779 99 C20140707_OR006_04 C20140707_OR006_04 TB436993.[MT7]-EQALEATK[MT7].2b4_1.heavy 589.337 / 586.332 2378.0 21.36400032043457 42 17 10 5 10 7.027468116515659 14.229876015372339 0.04019927978515625 3 0.9705250354477337 7.170726822481696 2378.0 10.196598375468433 0.0 - - - - - - - 216.0 4 9 RTKN rhotekin 781 99 C20140707_OR006_04 C20140707_OR006_04 TB436993.[MT7]-EQALEATK[MT7].2y6_1.heavy 589.337 / 776.463 1838.0 21.36400032043457 42 17 10 5 10 7.027468116515659 14.229876015372339 0.04019927978515625 3 0.9705250354477337 7.170726822481696 1838.0 6.801115903334018 0.0 - - - - - - - 162.0 3 6 RTKN rhotekin 783 100 C20140707_OR006_04 C20140707_OR006_04 TB436992.[MT7]-MLSEDPWR.2b4_1.heavy 589.293 / 605.308 3769.0 35.132325172424316 43 18 10 5 10 5.033114200665526 19.86841466596904 0.045497894287109375 3 0.9826986937428085 9.369033073897457 3769.0 7.592649928293664 0.0 - - - - - - - 269.2857142857143 7 7 HNF1B HNF1 homeobox B 785 100 C20140707_OR006_04 C20140707_OR006_04 TB436992.[MT7]-MLSEDPWR.2y6_1.heavy 589.293 / 789.353 1750.0 35.132325172424316 43 18 10 5 10 5.033114200665526 19.86841466596904 0.045497894287109375 3 0.9826986937428085 9.369033073897457 1750.0 6.006944252648169 2.0 - - - - - - - 284.22222222222223 4 9 HNF1B HNF1 homeobox B 787 100 C20140707_OR006_04 C20140707_OR006_04 TB436992.[MT7]-MLSEDPWR.2b5_1.heavy 589.293 / 720.336 15479.0 35.132325172424316 43 18 10 5 10 5.033114200665526 19.86841466596904 0.045497894287109375 3 0.9826986937428085 9.369033073897457 15479.0 34.54921845767379 0.0 - - - - - - - 296.0 30 5 HNF1B HNF1 homeobox B 789 100 C20140707_OR006_04 C20140707_OR006_04 TB436992.[MT7]-MLSEDPWR.2y7_1.heavy 589.293 / 902.437 5922.0 35.132325172424316 43 18 10 5 10 5.033114200665526 19.86841466596904 0.045497894287109375 3 0.9826986937428085 9.369033073897457 5922.0 39.51669144981413 0.0 - - - - - - - 246.83333333333334 11 6 HNF1B HNF1 homeobox B 791 101 C20140707_OR006_04 C20140707_OR006_04 TB450432.[MT7]-RSPC[CAM]NLAIPSEVDVEK[MT7].3y3_1.heavy 701.377 / 519.326 6780.0 31.363000869750977 43 13 10 10 10 1.971848467362325 39.99979984923502 0.0 3 0.9259596163456445 4.507246340156012 6780.0 14.134472621459555 0.0 - - - - - - - 167.66666666666666 13 6 FAM48A family with sequence similarity 48, member A 793 101 C20140707_OR006_04 C20140707_OR006_04 TB450432.[MT7]-RSPC[CAM]NLAIPSEVDVEK[MT7].3b5_1.heavy 701.377 / 759.369 3013.0 31.363000869750977 43 13 10 10 10 1.971848467362325 39.99979984923502 0.0 3 0.9259596163456445 4.507246340156012 3013.0 8.794430765003646 0.0 - - - - - - - 265.3333333333333 6 9 FAM48A family with sequence similarity 48, member A 795 101 C20140707_OR006_04 C20140707_OR006_04 TB450432.[MT7]-RSPC[CAM]NLAIPSEVDVEK[MT7].3y8_1.heavy 701.377 / 1046.55 14439.0 31.363000869750977 43 13 10 10 10 1.971848467362325 39.99979984923502 0.0 3 0.9259596163456445 4.507246340156012 14439.0 125.45245246221356 0.0 - - - - - - - 188.5 28 6 FAM48A family with sequence similarity 48, member A 797 101 C20140707_OR006_04 C20140707_OR006_04 TB450432.[MT7]-RSPC[CAM]NLAIPSEVDVEK[MT7].3b7_1.heavy 701.377 / 943.49 5022.0 31.363000869750977 43 13 10 10 10 1.971848467362325 39.99979984923502 0.0 3 0.9259596163456445 4.507246340156012 5022.0 28.211235059760956 0.0 - - - - - - - 209.5 10 6 FAM48A family with sequence similarity 48, member A 799 102 C20140707_OR006_04 C20140707_OR006_04 TB437005.[MT7]-IGLLPLLNPT.2b4_1.heavy 597.883 / 541.383 106710.0 51.462799072265625 46 16 10 10 10 2.7421666976412475 36.46751311144499 0.0 3 0.9655204233579382 6.627131467045035 106710.0 561.0650448149164 0.0 - - - - - - - 158.66666666666666 213 9 PSG2 pregnancy specific beta-1-glycoprotein 2 801 102 C20140707_OR006_04 C20140707_OR006_04 TB437005.[MT7]-IGLLPLLNPT.2b6_1.heavy 597.883 / 751.52 52213.0 51.462799072265625 46 16 10 10 10 2.7421666976412475 36.46751311144499 0.0 3 0.9655204233579382 6.627131467045035 52213.0 501.58019786333534 0.0 - - - - - - - 171.33333333333334 104 9 PSG2 pregnancy specific beta-1-glycoprotein 2 803 102 C20140707_OR006_04 C20140707_OR006_04 TB437005.[MT7]-IGLLPLLNPT.2b7_1.heavy 597.883 / 864.604 31362.0 51.462799072265625 46 16 10 10 10 2.7421666976412475 36.46751311144499 0.0 3 0.9655204233579382 6.627131467045035 31362.0 244.416160869698 0.0 - - - - - - - 195.16666666666666 62 12 PSG2 pregnancy specific beta-1-glycoprotein 2 805 102 C20140707_OR006_04 C20140707_OR006_04 TB437005.[MT7]-IGLLPLLNPT.2b5_1.heavy 597.883 / 638.436 8626.0 51.462799072265625 46 16 10 10 10 2.7421666976412475 36.46751311144499 0.0 3 0.9655204233579382 6.627131467045035 8626.0 94.3311111111111 0.0 - - - - - - - 166.0 17 11 PSG2 pregnancy specific beta-1-glycoprotein 2 807 103 C20140707_OR006_04 C20140707_OR006_04 TB411946.[MT7]-EADFRC[CAM]PGC[CAM]R.3y7_2.heavy 471.216 / 476.716 10664.0 21.241000175476074 40 15 10 5 10 3.195252190465902 31.296434221493776 0.04120063781738281 3 0.9546142309711978 5.770934084089598 10664.0 79.80263070551825 0.0 - - - - - - - 285.1 21 10 TCF19 transcription factor 19 809 103 C20140707_OR006_04 C20140707_OR006_04 TB411946.[MT7]-EADFRC[CAM]PGC[CAM]R.3y4_1.heavy 471.216 / 489.224 2851.0 21.241000175476074 40 15 10 5 10 3.195252190465902 31.296434221493776 0.04120063781738281 3 0.9546142309711978 5.770934084089598 2851.0 2.968088316126565 1.0 - - - - - - - 271.57142857142856 5 7 TCF19 transcription factor 19 811 103 C20140707_OR006_04 C20140707_OR006_04 TB411946.[MT7]-EADFRC[CAM]PGC[CAM]R.3y9_2.heavy 471.216 / 569.748 845.0 21.241000175476074 40 15 10 5 10 3.195252190465902 31.296434221493776 0.04120063781738281 3 0.9546142309711978 5.770934084089598 845.0 7.654038021726701 3.0 - - - - - - - 0.0 1 0 TCF19 transcription factor 19 813 103 C20140707_OR006_04 C20140707_OR006_04 TB411946.[MT7]-EADFRC[CAM]PGC[CAM]R.3y5_1.heavy 471.216 / 649.255 2006.0 21.241000175476074 40 15 10 5 10 3.195252190465902 31.296434221493776 0.04120063781738281 3 0.9546142309711978 5.770934084089598 2006.0 11.847597290953399 0.0 - - - - - - - 193.66666666666666 4 6 TCF19 transcription factor 19 815 104 C20140707_OR006_04 C20140707_OR006_04 TB450168.[MT7]-SSTSLTSEEK[MT7].3y3_1.heavy 452.908 / 549.3 3106.0 20.011999130249023 46 16 10 10 10 1.8535794758397752 42.91986496845789 0.0 3 0.962876047893091 6.385317080201051 3106.0 14.129179834832982 0.0 - - - - - - - 159.8 6 5 SYT4 synaptotagmin IV 817 104 C20140707_OR006_04 C20140707_OR006_04 TB450168.[MT7]-SSTSLTSEEK[MT7].3b4_1.heavy 452.908 / 507.253 4881.0 20.011999130249023 46 16 10 10 10 1.8535794758397752 42.91986496845789 0.0 3 0.962876047893091 6.385317080201051 4881.0 67.33693503421476 0.0 - - - - - - - 199.625 9 8 SYT4 synaptotagmin IV 819 104 C20140707_OR006_04 C20140707_OR006_04 TB450168.[MT7]-SSTSLTSEEK[MT7].3b5_1.heavy 452.908 / 620.337 1686.0 20.011999130249023 46 16 10 10 10 1.8535794758397752 42.91986496845789 0.0 3 0.962876047893091 6.385317080201051 1686.0 7.460263702735098 0.0 - - - - - - - 258.09090909090907 3 11 SYT4 synaptotagmin IV 821 104 C20140707_OR006_04 C20140707_OR006_04 TB450168.[MT7]-SSTSLTSEEK[MT7].3y4_1.heavy 452.908 / 636.332 2574.0 20.011999130249023 46 16 10 10 10 1.8535794758397752 42.91986496845789 0.0 3 0.962876047893091 6.385317080201051 2574.0 18.30454619240869 0.0 - - - - - - - 199.375 5 8 SYT4 synaptotagmin IV 823 105 C20140707_OR006_04 C20140707_OR006_04 TB412308.[MT7]-DDYVFEC[CAM]EAGTQYQK[MT7].3y3_1.heavy 714.329 / 582.337 6293.0 31.96380043029785 46 16 10 10 10 2.3921510981714884 34.5756276229216 0.0 3 0.9671662706648513 6.792141926463497 6293.0 24.48786433492316 0.0 - - - - - - - 288.0 12 7 FAM48A family with sequence similarity 48, member A 825 105 C20140707_OR006_04 C20140707_OR006_04 TB412308.[MT7]-DDYVFEC[CAM]EAGTQYQK[MT7].3b6_1.heavy 714.329 / 913.406 4028.0 31.96380043029785 46 16 10 10 10 2.3921510981714884 34.5756276229216 0.0 3 0.9671662706648513 6.792141926463497 4028.0 17.584126984126986 0.0 - - - - - - - 226.8 8 5 FAM48A family with sequence similarity 48, member A 827 105 C20140707_OR006_04 C20140707_OR006_04 TB412308.[MT7]-DDYVFEC[CAM]EAGTQYQK[MT7].3b5_1.heavy 714.329 / 784.363 3272.0 31.96380043029785 46 16 10 10 10 2.3921510981714884 34.5756276229216 0.0 3 0.9671662706648513 6.792141926463497 3272.0 17.600923360335127 0.0 - - - - - - - 315.0 6 6 FAM48A family with sequence similarity 48, member A 829 105 C20140707_OR006_04 C20140707_OR006_04 TB412308.[MT7]-DDYVFEC[CAM]EAGTQYQK[MT7].3b3_1.heavy 714.329 / 538.227 7678.0 31.96380043029785 46 16 10 10 10 2.3921510981714884 34.5756276229216 0.0 3 0.9671662706648513 6.792141926463497 7678.0 19.325352762189535 0.0 - - - - - - - 224.0 15 9 FAM48A family with sequence similarity 48, member A 831 106 C20140707_OR006_04 C20140707_OR006_04 TB412404.[MT7]-K[MT7]YEDIC[CAM]PSTHNMDVPNIK[MT7].4y4_1.heavy 649.083 / 615.395 39948.0 29.900699615478516 38 8 10 10 10 0.5303573110848903 84.80833120909062 0.0 3 0.7916635396125306 2.655424994816829 39948.0 65.62985062631063 0.0 - - - - - - - 219.0 79 4 EIF5AL1;EIF5A;EIF5A2 eukaryotic translation initiation factor 5A-like 1;eukaryotic translation initiation factor 5A;eukaryotic translation initiation factor 5A2 833 106 C20140707_OR006_04 C20140707_OR006_04 TB412404.[MT7]-K[MT7]YEDIC[CAM]PSTHNMDVPNIK[MT7].4b4_1.heavy 649.083 / 824.439 7013.0 29.900699615478516 38 8 10 10 10 0.5303573110848903 84.80833120909062 0.0 3 0.7916635396125306 2.655424994816829 7013.0 51.44850479141836 1.0 - - - - - - - 171.875 16 8 EIF5AL1;EIF5A;EIF5A2 eukaryotic translation initiation factor 5A-like 1;eukaryotic translation initiation factor 5A;eukaryotic translation initiation factor 5A2 835 106 C20140707_OR006_04 C20140707_OR006_04 TB412404.[MT7]-K[MT7]YEDIC[CAM]PSTHNMDVPNIK[MT7].4b5_1.heavy 649.083 / 937.523 6136.0 29.900699615478516 38 8 10 10 10 0.5303573110848903 84.80833120909062 0.0 3 0.7916635396125306 2.655424994816829 6136.0 37.92048 1.0 - - - - - - - 208.55555555555554 14 9 EIF5AL1;EIF5A;EIF5A2 eukaryotic translation initiation factor 5A-like 1;eukaryotic translation initiation factor 5A;eukaryotic translation initiation factor 5A2 837 106 C20140707_OR006_04 C20140707_OR006_04 TB412404.[MT7]-K[MT7]YEDIC[CAM]PSTHNMDVPNIK[MT7].4y3_1.heavy 649.083 / 518.342 12272.0 29.900699615478516 38 8 10 10 10 0.5303573110848903 84.80833120909062 0.0 3 0.7916635396125306 2.655424994816829 12272.0 26.506135217657338 0.0 - - - - - - - 694.3636363636364 24 11 EIF5AL1;EIF5A;EIF5A2 eukaryotic translation initiation factor 5A-like 1;eukaryotic translation initiation factor 5A;eukaryotic translation initiation factor 5A2 839 107 C20140707_OR006_04 C20140707_OR006_04 TB411778.[MT7]-IVEMSTSK[MT7].2y4_1.heavy 591.836 / 566.327 6723.0 26.10379981994629 46 16 10 10 10 4.169716059215467 23.98244834417215 0.0 3 0.9620364831240765 6.313868628430457 6723.0 38.49737967914439 0.0 - - - - - - - 261.7 13 10 EIF5A;EIF5A2 eukaryotic translation initiation factor 5A;eukaryotic translation initiation factor 5A2 841 107 C20140707_OR006_04 C20140707_OR006_04 TB411778.[MT7]-IVEMSTSK[MT7].2y5_1.heavy 591.836 / 697.367 6101.0 26.10379981994629 46 16 10 10 10 4.169716059215467 23.98244834417215 0.0 3 0.9620364831240765 6.313868628430457 6101.0 14.519708463483564 1.0 - - - - - - - 249.33333333333334 13 9 EIF5A;EIF5A2 eukaryotic translation initiation factor 5A;eukaryotic translation initiation factor 5A2 843 107 C20140707_OR006_04 C20140707_OR006_04 TB411778.[MT7]-IVEMSTSK[MT7].2y6_1.heavy 591.836 / 826.41 6723.0 26.10379981994629 46 16 10 10 10 4.169716059215467 23.98244834417215 0.0 3 0.9620364831240765 6.313868628430457 6723.0 53.710618940609955 0.0 - - - - - - - 196.0 13 7 EIF5A;EIF5A2 eukaryotic translation initiation factor 5A;eukaryotic translation initiation factor 5A2 845 107 C20140707_OR006_04 C20140707_OR006_04 TB411778.[MT7]-IVEMSTSK[MT7].2y7_1.heavy 591.836 / 925.478 14692.0 26.10379981994629 46 16 10 10 10 4.169716059215467 23.98244834417215 0.0 3 0.9620364831240765 6.313868628430457 14692.0 46.221390998868024 0.0 - - - - - - - 261.8 29 10 EIF5A;EIF5A2 eukaryotic translation initiation factor 5A;eukaryotic translation initiation factor 5A2 847 108 C20140707_OR006_04 C20140707_OR006_04 TB412409.[MT7]-FFQELFDSELASQATAEFEK[MT7].4y5_1.heavy 657.08 / 767.406 1742.0 51.00839900970459 44 18 10 6 10 4.823036676464192 20.73382532792822 0.039997100830078125 3 0.9822882670575195 9.25952570068984 1742.0 13.866666666666665 0.0 - - - - - - - 156.33333333333334 3 12 PEX19 peroxisomal biogenesis factor 19 849 108 C20140707_OR006_04 C20140707_OR006_04 TB412409.[MT7]-FFQELFDSELASQATAEFEK[MT7].4b5_1.heavy 657.08 / 809.431 2948.0 51.00839900970459 44 18 10 6 10 4.823036676464192 20.73382532792822 0.039997100830078125 3 0.9822882670575195 9.25952570068984 2948.0 24.090000000000003 0.0 - - - - - - - 207.7 5 10 PEX19 peroxisomal biogenesis factor 19 851 108 C20140707_OR006_04 C20140707_OR006_04 TB412409.[MT7]-FFQELFDSELASQATAEFEK[MT7].4y7_1.heavy 657.08 / 939.49 1474.0 51.00839900970459 44 18 10 6 10 4.823036676464192 20.73382532792822 0.039997100830078125 3 0.9822882670575195 9.25952570068984 1474.0 9.411111111111111 0.0 - - - - - - - 240.08333333333334 2 12 PEX19 peroxisomal biogenesis factor 19 853 108 C20140707_OR006_04 C20140707_OR006_04 TB412409.[MT7]-FFQELFDSELASQATAEFEK[MT7].4y6_1.heavy 657.08 / 868.453 1072.0 51.00839900970459 44 18 10 6 10 4.823036676464192 20.73382532792822 0.039997100830078125 3 0.9822882670575195 9.25952570068984 1072.0 16.906666666666666 3.0 - - - - - - - 178.66666666666666 5 9 PEX19 peroxisomal biogenesis factor 19 855 109 C20140707_OR006_04 C20140707_OR006_04 TB412059.[MT7]-DDLNSQLQESLR.3y6_1.heavy 521.269 / 745.42 3687.0 32.67660140991211 39 12 9 10 8 1.0909769111660559 55.25323875171236 0.0 4 0.8959972652839114 3.793168255538055 3687.0 14.511943117202092 0.0 - - - - - - - 196.27272727272728 7 11 GRIPAP1 GRIP1 associated protein 1 857 109 C20140707_OR006_04 C20140707_OR006_04 TB412059.[MT7]-DDLNSQLQESLR.3b4_1.heavy 521.269 / 602.29 3178.0 32.67660140991211 39 12 9 10 8 1.0909769111660559 55.25323875171236 0.0 4 0.8959972652839114 3.793168255538055 3178.0 -0.26785864842518714 2.0 - - - - - - - 654.1428571428571 10 7 GRIPAP1 GRIP1 associated protein 1 859 109 C20140707_OR006_04 C20140707_OR006_04 TB412059.[MT7]-DDLNSQLQESLR.3y4_1.heavy 521.269 / 504.278 7755.0 32.67660140991211 39 12 9 10 8 1.0909769111660559 55.25323875171236 0.0 4 0.8959972652839114 3.793168255538055 7755.0 15.280250432152119 0.0 - - - - - - - 724.9 15 10 GRIPAP1 GRIP1 associated protein 1 861 109 C20140707_OR006_04 C20140707_OR006_04 TB412059.[MT7]-DDLNSQLQESLR.3y5_1.heavy 521.269 / 632.336 6865.0 32.67660140991211 39 12 9 10 8 1.0909769111660559 55.25323875171236 0.0 4 0.8959972652839114 3.793168255538055 6865.0 26.47340910216412 1.0 - - - - - - - 228.6 18 5 GRIPAP1 GRIP1 associated protein 1 863 110 C20140707_OR006_04 C20140707_OR006_04 TB437288.[MT7]-LQQGAPGQGTQQPAR.2y12_1.heavy 840.949 / 1167.59 2466.0 19.639999389648438 40 10 10 10 10 0.9217935677704902 71.47619322816118 0.0 3 0.8292857893286267 2.9433789017795755 2466.0 14.370363518638426 0.0 - - - - - - - 213.5 4 4 KLHL1 kelch-like 1 (Drosophila) 865 110 C20140707_OR006_04 C20140707_OR006_04 TB437288.[MT7]-LQQGAPGQGTQQPAR.2b4_1.heavy 840.949 / 571.332 2846.0 19.639999389648438 40 10 10 10 10 0.9217935677704902 71.47619322816118 0.0 3 0.8292857893286267 2.9433789017795755 2846.0 10.431838724327598 0.0 - - - - - - - 208.8 5 5 KLHL1 kelch-like 1 (Drosophila) 867 110 C20140707_OR006_04 C20140707_OR006_04 TB437288.[MT7]-LQQGAPGQGTQQPAR.2y10_1.heavy 840.949 / 1039.53 4933.0 19.639999389648438 40 10 10 10 10 0.9217935677704902 71.47619322816118 0.0 3 0.8292857893286267 2.9433789017795755 4933.0 59.32040394389668 0.0 - - - - - - - 213.5 9 4 KLHL1 kelch-like 1 (Drosophila) 869 110 C20140707_OR006_04 C20140707_OR006_04 TB437288.[MT7]-LQQGAPGQGTQQPAR.2b5_1.heavy 840.949 / 642.369 7304.0 19.639999389648438 40 10 10 10 10 0.9217935677704902 71.47619322816118 0.0 3 0.8292857893286267 2.9433789017795755 7304.0 38.25655972778383 1.0 - - - - - - - 284.6 15 5 KLHL1 kelch-like 1 (Drosophila) 871 111 C20140707_OR006_04 C20140707_OR006_04 TB411770.[MT7]-TDTWTMVAPLSMPR.3y7_1.heavy 583.964 / 771.418 4650.0 42.239898681640625 43 17 10 6 10 11.139238933560586 8.977273994789485 0.0391998291015625 3 0.9744367144209848 7.702372198689953 4650.0 36.108938547486034 0.0 - - - - - - - 201.08333333333334 9 12 KLHL1 kelch-like 1 (Drosophila) 873 111 C20140707_OR006_04 C20140707_OR006_04 TB411770.[MT7]-TDTWTMVAPLSMPR.3y6_1.heavy 583.964 / 700.381 15381.0 42.239898681640625 43 17 10 6 10 11.139238933560586 8.977273994789485 0.0391998291015625 3 0.9744367144209848 7.702372198689953 15381.0 89.3912453671241 0.0 - - - - - - - 243.72727272727272 30 11 KLHL1 kelch-like 1 (Drosophila) 875 111 C20140707_OR006_04 C20140707_OR006_04 TB411770.[MT7]-TDTWTMVAPLSMPR.3b5_1.heavy 583.964 / 749.359 3756.0 42.239898681640625 43 17 10 6 10 11.139238933560586 8.977273994789485 0.0391998291015625 3 0.9744367144209848 7.702372198689953 3756.0 36.814977088695 0.0 - - - - - - - 189.875 7 8 KLHL1 kelch-like 1 (Drosophila) 877 111 C20140707_OR006_04 C20140707_OR006_04 TB411770.[MT7]-TDTWTMVAPLSMPR.3y5_1.heavy 583.964 / 603.328 2862.0 42.239898681640625 43 17 10 6 10 11.139238933560586 8.977273994789485 0.0391998291015625 3 0.9744367144209848 7.702372198689953 2862.0 14.670345201367464 0.0 - - - - - - - 275.0769230769231 5 13 KLHL1 kelch-like 1 (Drosophila) 879 112 C20140707_OR006_04 C20140707_OR006_04 TB412301.[MT7]-ELAEEEPHLVEQFQK[MT7].3y6_1.heavy 705.372 / 922.511 5643.0 33.95294952392578 41 16 10 5 10 2.463000000877523 35.24484524970738 0.0438995361328125 3 0.9694984637830435 7.0484139236134915 5643.0 33.63780776533498 0.0 - - - - - - - 247.66666666666666 11 9 PEX19 peroxisomal biogenesis factor 19 881 112 C20140707_OR006_04 C20140707_OR006_04 TB412301.[MT7]-ELAEEEPHLVEQFQK[MT7].3b6_1.heavy 705.372 / 845.401 5906.0 33.95294952392578 41 16 10 5 10 2.463000000877523 35.24484524970738 0.0438995361328125 3 0.9694984637830435 7.0484139236134915 5906.0 37.45688320998179 0.0 - - - - - - - 185.66666666666666 11 12 PEX19 peroxisomal biogenesis factor 19 883 112 C20140707_OR006_04 C20140707_OR006_04 TB412301.[MT7]-ELAEEEPHLVEQFQK[MT7].3b4_1.heavy 705.372 / 587.316 4987.0 33.95294952392578 41 16 10 5 10 2.463000000877523 35.24484524970738 0.0438995361328125 3 0.9694984637830435 7.0484139236134915 4987.0 6.101185350379033 1.0 - - - - - - - 196.5 9 6 PEX19 peroxisomal biogenesis factor 19 885 112 C20140707_OR006_04 C20140707_OR006_04 TB412301.[MT7]-ELAEEEPHLVEQFQK[MT7].3b5_1.heavy 705.372 / 716.358 3806.0 33.95294952392578 41 16 10 5 10 2.463000000877523 35.24484524970738 0.0438995361328125 3 0.9694984637830435 7.0484139236134915 3806.0 25.563479798920127 0.0 - - - - - - - 262.2 7 5 PEX19 peroxisomal biogenesis factor 19 887 113 C20140707_OR006_04 C20140707_OR006_04 TB437558.[MT7]-TRELETLQQTVEELQAQVHSMDGAK[MT7].4b7_1.heavy 783.158 / 987.559 1076.0 46.30660057067871 39 13 10 6 10 2.1457110434483364 37.24216929453077 0.038997650146484375 3 0.9156901939275509 4.220109899784422 1076.0 1.2085844432912416 3.0 - - - - - - - 147.0 2 11 GRIPAP1 GRIP1 associated protein 1 889 113 C20140707_OR006_04 C20140707_OR006_04 TB437558.[MT7]-TRELETLQQTVEELQAQVHSMDGAK[MT7].4b5_1.heavy 783.158 / 773.427 461.0 46.30660057067871 39 13 10 6 10 2.1457110434483364 37.24216929453077 0.038997650146484375 3 0.9156901939275509 4.220109899784422 461.0 0.6608554913294797 16.0 - - - - - - - 0.0 1 0 GRIPAP1 GRIP1 associated protein 1 891 113 C20140707_OR006_04 C20140707_OR006_04 TB437558.[MT7]-TRELETLQQTVEELQAQVHSMDGAK[MT7].4y7_1.heavy 783.158 / 889.432 2153.0 46.30660057067871 39 13 10 6 10 2.1457110434483364 37.24216929453077 0.038997650146484375 3 0.9156901939275509 4.220109899784422 2153.0 11.184415584415586 0.0 - - - - - - - 174.9090909090909 4 11 GRIPAP1 GRIP1 associated protein 1 893 113 C20140707_OR006_04 C20140707_OR006_04 TB437558.[MT7]-TRELETLQQTVEELQAQVHSMDGAK[MT7].4y6_1.heavy 783.158 / 752.373 2229.0 46.30660057067871 39 13 10 6 10 2.1457110434483364 37.24216929453077 0.038997650146484375 3 0.9156901939275509 4.220109899784422 2229.0 1.4497560975609758 0.0 - - - - - - - 256.25 4 12 GRIPAP1 GRIP1 associated protein 1 895 114 C20140707_OR006_04 C20140707_OR006_04 TB437559.[MT7]-LVMQETLSC[CAM]LVVNLYPGNEGYSLMLR.3b6_1.heavy 1048.54 / 846.451 844.0 54.64217472076416 45 20 10 7 8 9.603593603786456 10.412768816099478 0.025501251220703125 4 0.9950056225168076 17.455840682617637 844.0 6.3923645320197044 0.0 - - - - - - - 0.0 1 0 FAM48A family with sequence similarity 48, member A 897 114 C20140707_OR006_04 C20140707_OR006_04 TB437559.[MT7]-LVMQETLSC[CAM]LVVNLYPGNEGYSLMLR.3y11_1.heavy 1048.54 / 1236.6 1983.0 54.64217472076416 45 20 10 7 8 9.603593603786456 10.412768816099478 0.025501251220703125 4 0.9950056225168076 17.455840682617637 1983.0 9.083771239346397 1.0 - - - - - - - 150.71428571428572 3 21 FAM48A family with sequence similarity 48, member A 899 114 C20140707_OR006_04 C20140707_OR006_04 TB437559.[MT7]-LVMQETLSC[CAM]LVVNLYPGNEGYSLMLR.3b4_1.heavy 1048.54 / 616.361 548.0 54.64217472076416 45 20 10 7 8 9.603593603786456 10.412768816099478 0.025501251220703125 4 0.9950056225168076 17.455840682617637 548.0 0.12985781990521325 5.0 - - - - - - - 0.0 1 0 FAM48A family with sequence similarity 48, member A 901 114 C20140707_OR006_04 C20140707_OR006_04 TB437559.[MT7]-LVMQETLSC[CAM]LVVNLYPGNEGYSLMLR.3b5_1.heavy 1048.54 / 745.404 633.0 54.64217472076416 45 20 10 7 8 9.603593603786456 10.412768816099478 0.025501251220703125 4 0.9950056225168076 17.455840682617637 633.0 14.527142857142856 1.0 - - - - - - - 141.3 2 20 FAM48A family with sequence similarity 48, member A 903 115 C20140707_OR006_04 C20140707_OR006_04 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 19831.0 22.70549964904785 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 19831.0 22.669465884659 1.0 - - - - - - - 199.5 41 4 905 115 C20140707_OR006_04 C20140707_OR006_04 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 24503.0 22.70549964904785 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 24503.0 155.83048245614034 0.0 - - - - - - - 190.0 49 6 907 115 C20140707_OR006_04 C20140707_OR006_04 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 55845.0 22.70549964904785 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 55845.0 219.5077067669173 0.0 - - - - - - - 228.0 111 9 909 116 C20140707_OR006_04 C20140707_OR006_04 TB411678.[MT7]-VSSLLGK[MT7].2y4_1.heavy 496.323 / 574.404 1512.0 30.524999618530273 44 18 10 10 6 2.5350864825265296 31.443438228064267 0.0 6 0.9806445496086754 8.856410390940665 1512.0 23.16 0.0 - - - - - - - 252.0 3 8 SLC12A4 solute carrier family 12 (potassium/chloride transporters), member 4 911 116 C20140707_OR006_04 C20140707_OR006_04 TB411678.[MT7]-VSSLLGK[MT7].2y5_1.heavy 496.323 / 661.437 1638.0 30.524999618530273 44 18 10 10 6 2.5350864825265296 31.443438228064267 0.0 6 0.9806445496086754 8.856410390940665 1638.0 2.6 3.0 - - - - - - - 252.0 4 4 SLC12A4 solute carrier family 12 (potassium/chloride transporters), member 4 913 116 C20140707_OR006_04 C20140707_OR006_04 TB411678.[MT7]-VSSLLGK[MT7].2b4_1.heavy 496.323 / 531.326 2016.0 30.524999618530273 44 18 10 10 6 2.5350864825265296 31.443438228064267 0.0 6 0.9806445496086754 8.856410390940665 2016.0 3.7199999999999998 3.0 - - - - - - - 283.5 4 8 SLC12A4 solute carrier family 12 (potassium/chloride transporters), member 4 915 116 C20140707_OR006_04 C20140707_OR006_04 TB411678.[MT7]-VSSLLGK[MT7].2y6_1.heavy 496.323 / 748.469 4787.0 30.524999618530273 44 18 10 10 6 2.5350864825265296 31.443438228064267 0.0 6 0.9806445496086754 8.856410390940665 4787.0 34.19285714285714 1.0 - - - - - - - 252.0 9 5 SLC12A4 solute carrier family 12 (potassium/chloride transporters), member 4 917 117 C20140707_OR006_04 C20140707_OR006_04 TB411679.[MT7]-EILDSK[MT7].2b3_1.heavy 496.797 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - NT5C;OXR1 5', 3'-nucleotidase, cytosolic;oxidation resistance 1 919 117 C20140707_OR006_04 C20140707_OR006_04 TB411679.[MT7]-EILDSK[MT7].2y4_1.heavy 496.797 / 606.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - NT5C;OXR1 5', 3'-nucleotidase, cytosolic;oxidation resistance 1 921 117 C20140707_OR006_04 C20140707_OR006_04 TB411679.[MT7]-EILDSK[MT7].2y5_1.heavy 496.797 / 719.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - NT5C;OXR1 5', 3'-nucleotidase, cytosolic;oxidation resistance 1 923 117 C20140707_OR006_04 C20140707_OR006_04 TB411679.[MT7]-EILDSK[MT7].2b4_1.heavy 496.797 / 615.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - NT5C;OXR1 5', 3'-nucleotidase, cytosolic;oxidation resistance 1 925 118 C20140707_OR006_04 C20140707_OR006_04 TB450164.[MT7]-LFIPQITTK[MT7].2b3_1.heavy 674.926 / 518.346 40257.0 39.72220039367676 39 13 10 6 10 0.9332675632277733 69.20427188898017 0.039402008056640625 3 0.9087260734993633 4.053488821735157 40257.0 332.2320694451344 0.0 - - - - - - - 258.8888888888889 80 9 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 927 118 C20140707_OR006_04 C20140707_OR006_04 TB450164.[MT7]-LFIPQITTK[MT7].2y4_1.heavy 674.926 / 606.394 5523.0 39.72220039367676 39 13 10 6 10 0.9332675632277733 69.20427188898017 0.039402008056640625 3 0.9087260734993633 4.053488821735157 5523.0 9.757106120349734 1.0 - - - - - - - 272.6666666666667 25 9 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 929 118 C20140707_OR006_04 C20140707_OR006_04 TB450164.[MT7]-LFIPQITTK[MT7].2y5_1.heavy 674.926 / 734.453 2700.0 39.72220039367676 39 13 10 6 10 0.9332675632277733 69.20427188898017 0.039402008056640625 3 0.9087260734993633 4.053488821735157 2700.0 12.190765536984024 0.0 - - - - - - - 286.22222222222223 5 9 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 931 118 C20140707_OR006_04 C20140707_OR006_04 TB450164.[MT7]-LFIPQITTK[MT7].2y6_1.heavy 674.926 / 831.506 53881.0 39.72220039367676 39 13 10 6 10 0.9332675632277733 69.20427188898017 0.039402008056640625 3 0.9087260734993633 4.053488821735157 53881.0 109.18858452138493 1.0 - - - - - - - 232.0 107 9 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 933 119 C20140707_OR006_04 C20140707_OR006_04 TB412199.[MT7]-FLYVGGALHALPTGLR.3y7_1.heavy 610.357 / 727.446 62920.0 41.678951263427734 40 14 10 6 10 2.6295215166052883 32.24914341337902 0.0370025634765625 3 0.9463036612132026 5.3018480646277 62920.0 372.8620477842926 0.0 - - - - - - - 282.6363636363636 125 11 PPOX protoporphyrinogen oxidase 935 119 C20140707_OR006_04 C20140707_OR006_04 TB412199.[MT7]-FLYVGGALHALPTGLR.3b3_1.heavy 610.357 / 568.325 29997.0 41.678951263427734 40 14 10 6 10 2.6295215166052883 32.24914341337902 0.0370025634765625 3 0.9463036612132026 5.3018480646277 29997.0 89.05359375 0.0 - - - - - - - 601.0 59 7 PPOX protoporphyrinogen oxidase 937 119 C20140707_OR006_04 C20140707_OR006_04 TB412199.[MT7]-FLYVGGALHALPTGLR.3b7_1.heavy 610.357 / 852.474 35941.0 41.678951263427734 40 14 10 6 10 2.6295215166052883 32.24914341337902 0.0370025634765625 3 0.9463036612132026 5.3018480646277 35941.0 136.98823770491805 0.0 - - - - - - - 207.2 71 15 PPOX protoporphyrinogen oxidase 939 119 C20140707_OR006_04 C20140707_OR006_04 TB412199.[MT7]-FLYVGGALHALPTGLR.3y5_1.heavy 610.357 / 543.325 88527.0 41.678951263427734 40 14 10 6 10 2.6295215166052883 32.24914341337902 0.0370025634765625 3 0.9463036612132026 5.3018480646277 88527.0 172.66682783378062 0.0 - - - - - - - 251.25 177 12 PPOX protoporphyrinogen oxidase 941 120 C20140707_OR006_04 C20140707_OR006_04 TB437298.[MT7]-LLEQLQEIGQEK[MT7].3b4_1.heavy 572.664 / 628.379 139304.0 41.12510108947754 41 15 10 6 10 2.211758155668166 37.844699562540015 0.03440093994140625 3 0.9592322533433201 6.091404347897386 139304.0 176.72039958642415 0.0 - - - - - - - 310.3333333333333 278 6 GRIPAP1 GRIP1 associated protein 1 943 120 C20140707_OR006_04 C20140707_OR006_04 TB437298.[MT7]-LLEQLQEIGQEK[MT7].3b5_1.heavy 572.664 / 741.463 42938.0 41.12510108947754 41 15 10 6 10 2.211758155668166 37.844699562540015 0.03440093994140625 3 0.9592322533433201 6.091404347897386 42938.0 139.60824675324676 0.0 - - - - - - - 301.0 85 14 GRIPAP1 GRIP1 associated protein 1 945 120 C20140707_OR006_04 C20140707_OR006_04 TB437298.[MT7]-LLEQLQEIGQEK[MT7].3b3_1.heavy 572.664 / 500.32 66858.0 41.12510108947754 41 15 10 6 10 2.211758155668166 37.844699562540015 0.03440093994140625 3 0.9592322533433201 6.091404347897386 66858.0 109.79364680480222 0.0 - - - - - - - 303.8 133 10 GRIPAP1 GRIP1 associated protein 1 947 120 C20140707_OR006_04 C20140707_OR006_04 TB437298.[MT7]-LLEQLQEIGQEK[MT7].3y4_1.heavy 572.664 / 605.338 183223.0 41.12510108947754 41 15 10 6 10 2.211758155668166 37.844699562540015 0.03440093994140625 3 0.9592322533433201 6.091404347897386 183223.0 177.8522351797862 0.0 - - - - - - - 277.6666666666667 366 6 GRIPAP1 GRIP1 associated protein 1 949 121 C20140707_OR006_04 C20140707_OR006_04 TB411956.[MT7]-RMGESDDSILR.2b8_1.heavy 711.86 / 1022.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 951 121 C20140707_OR006_04 C20140707_OR006_04 TB411956.[MT7]-RMGESDDSILR.2y5_1.heavy 711.86 / 603.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 953 121 C20140707_OR006_04 C20140707_OR006_04 TB411956.[MT7]-RMGESDDSILR.2b6_1.heavy 711.86 / 820.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 955 121 C20140707_OR006_04 C20140707_OR006_04 TB411956.[MT7]-RMGESDDSILR.2b7_1.heavy 711.86 / 935.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 957 122 C20140707_OR006_04 C20140707_OR006_04 TB437296.[MT7]-SVRGPNGAIFELGPR.3y7_1.heavy 571.989 / 831.472 2376.0 34.10110092163086 33 7 10 10 6 0.5952235920113779 85.20619559297725 0.0 5 0.7060981307226378 2.21819638203902 2376.0 6.165 1.0 - - - - - - - 247.5 5 8 PPOX protoporphyrinogen oxidase 959 122 C20140707_OR006_04 C20140707_OR006_04 TB437296.[MT7]-SVRGPNGAIFELGPR.3y6_1.heavy 571.989 / 718.388 5676.0 34.10110092163086 33 7 10 10 6 0.5952235920113779 85.20619559297725 0.0 5 0.7060981307226378 2.21819638203902 5676.0 32.96666666666667 2.0 - - - - - - - 188.57142857142858 12 7 PPOX protoporphyrinogen oxidase 961 122 C20140707_OR006_04 C20140707_OR006_04 TB437296.[MT7]-SVRGPNGAIFELGPR.3b8_1.heavy 571.989 / 883.487 2112.0 34.10110092163086 33 7 10 10 6 0.5952235920113779 85.20619559297725 0.0 5 0.7060981307226378 2.21819638203902 2112.0 10.32 0.0 - - - - - - - 264.0 4 5 PPOX protoporphyrinogen oxidase 963 122 C20140707_OR006_04 C20140707_OR006_04 TB437296.[MT7]-SVRGPNGAIFELGPR.3b7_1.heavy 571.989 / 812.45 11483.0 34.10110092163086 33 7 10 10 6 0.5952235920113779 85.20619559297725 0.0 5 0.7060981307226378 2.21819638203902 11483.0 125.05160984848486 0.0 - - - - - - - 226.28571428571428 22 7 PPOX protoporphyrinogen oxidase 965 123 C20140707_OR006_04 C20140707_OR006_04 TB411869.[MT7]-DALFASQEK[MT7].2y4_1.heavy 648.856 / 635.348 4673.0 28.371999740600586 43 18 10 5 10 8.917875299847868 11.21343331653291 0.04199981689453125 3 0.9831893750511526 9.505175932212932 4673.0 26.33799577349039 0.0 - - - - - - - 227.4 9 5 PEX19 peroxisomal biogenesis factor 19 967 123 C20140707_OR006_04 C20140707_OR006_04 TB411869.[MT7]-DALFASQEK[MT7].2y5_1.heavy 648.856 / 706.385 6062.0 28.371999740600586 43 18 10 5 10 8.917875299847868 11.21343331653291 0.04199981689453125 3 0.9831893750511526 9.505175932212932 6062.0 32.752563407102095 0.0 - - - - - - - 252.75 12 4 PEX19 peroxisomal biogenesis factor 19 969 123 C20140707_OR006_04 C20140707_OR006_04 TB411869.[MT7]-DALFASQEK[MT7].2b4_1.heavy 648.856 / 591.326 4041.0 28.371999740600586 43 18 10 5 10 8.917875299847868 11.21343331653291 0.04199981689453125 3 0.9831893750511526 9.505175932212932 4041.0 15.760772367474216 0.0 - - - - - - - 210.66666666666666 8 9 PEX19 peroxisomal biogenesis factor 19 971 123 C20140707_OR006_04 C20140707_OR006_04 TB411869.[MT7]-DALFASQEK[MT7].2y6_1.heavy 648.856 / 853.454 5683.0 28.371999740600586 43 18 10 5 10 8.917875299847868 11.21343331653291 0.04199981689453125 3 0.9831893750511526 9.505175932212932 5683.0 48.246999842841426 0.0 - - - - - - - 144.14285714285714 11 7 PEX19 peroxisomal biogenesis factor 19 973 124 C20140707_OR006_04 C20140707_OR006_04 TB450156.[MT7]-SILLGLLLGAGR.2y9_1.heavy 663.933 / 869.557 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPOX protoporphyrinogen oxidase 975 124 C20140707_OR006_04 C20140707_OR006_04 TB450156.[MT7]-SILLGLLLGAGR.2b4_1.heavy 663.933 / 571.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPOX protoporphyrinogen oxidase 977 124 C20140707_OR006_04 C20140707_OR006_04 TB450156.[MT7]-SILLGLLLGAGR.2b6_1.heavy 663.933 / 741.499 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPOX protoporphyrinogen oxidase 979 124 C20140707_OR006_04 C20140707_OR006_04 TB450156.[MT7]-SILLGLLLGAGR.2y10_1.heavy 663.933 / 982.641 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPOX protoporphyrinogen oxidase 981 125 C20140707_OR006_04 C20140707_OR006_04 TB437018.[MT7]-EQHAAELK[MT7].3y3_1.heavy 405.231 / 533.341 3476.0 17.657466888427734 38 17 8 5 8 2.6533492252629194 37.68821648047141 0.04309844970703125 4 0.9765208291255225 8.038362186445424 3476.0 60.36027027027028 0.0 - - - - - - - 111.0 6 10 GRIPAP1 GRIP1 associated protein 1 983 125 C20140707_OR006_04 C20140707_OR006_04 TB437018.[MT7]-EQHAAELK[MT7].3b3_1.heavy 405.231 / 539.269 N/A 17.657466888427734 38 17 8 5 8 2.6533492252629194 37.68821648047141 0.04309844970703125 4 0.9765208291255225 8.038362186445424 3476.0 9.671685830644737 1.0 - - - - - - - 207.2 11 5 GRIPAP1 GRIP1 associated protein 1 985 125 C20140707_OR006_04 C20140707_OR006_04 TB437018.[MT7]-EQHAAELK[MT7].3y4_1.heavy 405.231 / 604.379 4438.0 17.657466888427734 38 17 8 5 8 2.6533492252629194 37.68821648047141 0.04309844970703125 4 0.9765208291255225 8.038362186445424 4438.0 33.83475225225225 0.0 - - - - - - - 160.33333333333334 8 12 GRIPAP1 GRIP1 associated protein 1 987 125 C20140707_OR006_04 C20140707_OR006_04 TB437018.[MT7]-EQHAAELK[MT7].3y5_1.heavy 405.231 / 675.416 962.0 17.657466888427734 38 17 8 5 8 2.6533492252629194 37.68821648047141 0.04309844970703125 4 0.9765208291255225 8.038362186445424 962.0 3.54768115942029 1.0 - - - - - - - 222.0 2 10 GRIPAP1 GRIP1 associated protein 1 989 126 C20140707_OR006_04 C20140707_OR006_04 TB437293.[MT7]-RSENINHNSAFK[MT7].3b6_1.heavy 568.972 / 858.455 1662.0 18.586599349975586 42 12 10 10 10 1.1916801705431352 58.810237653865215 0.0 3 0.8800490771746966 3.5271233844152525 1662.0 14.016867469879518 1.0 - - - - - - - 110.66666666666667 3 3 C6 complement component 6 991 126 C20140707_OR006_04 C20140707_OR006_04 TB437293.[MT7]-RSENINHNSAFK[MT7].3b4_1.heavy 568.972 / 631.328 1164.0 18.586599349975586 42 12 10 10 10 1.1916801705431352 58.810237653865215 0.0 3 0.8800490771746966 3.5271233844152525 1164.0 10.705060240963856 2.0 - - - - - - - 213.57142857142858 2 7 C6 complement component 6 993 126 C20140707_OR006_04 C20140707_OR006_04 TB437293.[MT7]-RSENINHNSAFK[MT7].3y4_1.heavy 568.972 / 596.352 1828.0 18.586599349975586 42 12 10 10 10 1.1916801705431352 58.810237653865215 0.0 3 0.8800490771746966 3.5271233844152525 1828.0 20.51939245704623 1.0 - - - - - - - 118.57142857142857 3 7 C6 complement component 6 995 126 C20140707_OR006_04 C20140707_OR006_04 TB437293.[MT7]-RSENINHNSAFK[MT7].3y5_1.heavy 568.972 / 710.395 2576.0 18.586599349975586 42 12 10 10 10 1.1916801705431352 58.810237653865215 0.0 3 0.8800490771746966 3.5271233844152525 2576.0 21.880481927710843 0.0 - - - - - - - 264.3636363636364 5 11 C6 complement component 6 997 127 C20140707_OR006_04 C20140707_OR006_04 TB411866.[MT7]-HSGLYAC[CAM]SVR.3y6_1.heavy 431.888 / 755.351 1302.0 21.555850505828857 41 16 10 5 10 1.7551084992625265 37.98435634872666 0.04179954528808594 3 0.9658267672503065 6.656941564572705 1302.0 6.337141880341879 0.0 - - - - - - - 216.66666666666666 2 3 PSG8;PSG3;PSG4;PSG7 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene) 999 127 C20140707_OR006_04 C20140707_OR006_04 TB411866.[MT7]-HSGLYAC[CAM]SVR.3b4_1.heavy 431.888 / 539.306 4231.0 21.555850505828857 41 16 10 5 10 1.7551084992625265 37.98435634872666 0.04179954528808594 3 0.9658267672503065 6.656941564572705 4231.0 30.565187947536337 0.0 - - - - - - - 240.88888888888889 8 9 PSG8;PSG3;PSG4;PSG7 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene) 1001 127 C20140707_OR006_04 C20140707_OR006_04 TB411866.[MT7]-HSGLYAC[CAM]SVR.3y4_1.heavy 431.888 / 521.25 5533.0 21.555850505828857 41 16 10 5 10 1.7551084992625265 37.98435634872666 0.04179954528808594 3 0.9658267672503065 6.656941564572705 5533.0 21.269001063452677 0.0 - - - - - - - 236.45454545454547 11 11 PSG8;PSG3;PSG4;PSG7 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene) 1003 127 C20140707_OR006_04 C20140707_OR006_04 TB411866.[MT7]-HSGLYAC[CAM]SVR.3y5_1.heavy 431.888 / 592.287 2821.0 21.555850505828857 41 16 10 5 10 1.7551084992625265 37.98435634872666 0.04179954528808594 3 0.9658267672503065 6.656941564572705 2821.0 15.608 0.0 - - - - - - - 230.25 5 8 PSG8;PSG3;PSG4;PSG7 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene) 1005 128 C20140707_OR006_04 C20140707_OR006_04 TB437017.[MT7]-QLQEFEK[MT7].2y4_1.heavy 605.34 / 696.369 6447.0 27.458499908447266 44 20 6 10 8 19.773924024047428 5.057165177654581 0.0 4 0.9991999482004887 43.628909449886464 6447.0 34.40098814229249 0.0 - - - - - - - 234.85714285714286 12 7 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1007 128 C20140707_OR006_04 C20140707_OR006_04 TB437017.[MT7]-QLQEFEK[MT7].2y5_1.heavy 605.34 / 824.427 4172.0 27.458499908447266 44 20 6 10 8 19.773924024047428 5.057165177654581 0.0 4 0.9991999482004887 43.628909449886464 4172.0 47.1211682037769 0.0 - - - - - - - 198.57142857142858 8 7 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1009 128 C20140707_OR006_04 C20140707_OR006_04 TB437017.[MT7]-QLQEFEK[MT7].2y3_1.heavy 605.34 / 567.326 8344.0 27.458499908447266 44 20 6 10 8 19.773924024047428 5.057165177654581 0.0 4 0.9991999482004887 43.628909449886464 8344.0 11.879593220338984 0.0 - - - - - - - 740.5714285714286 16 7 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1011 128 C20140707_OR006_04 C20140707_OR006_04 TB437017.[MT7]-QLQEFEK[MT7].2y6_1.heavy 605.34 / 937.511 9608.0 27.458499908447266 44 20 6 10 8 19.773924024047428 5.057165177654581 0.0 4 0.9991999482004887 43.628909449886464 9608.0 23.12543846799809 2.0 - - - - - - - 240.0 29 10 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1013 129 C20140707_OR006_04 C20140707_OR006_04 TB437151.[MT7]-RMGESDDSILR.3y6_1.heavy 474.909 / 718.373 732.0 25.162500381469727 46 16 10 10 10 2.808637175151545 35.60445645479442 0.0 3 0.967722522589963 6.850739301883247 732.0 0.03809523809523807 4.0 - - - - - - - 170.8 2 5 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 1015 129 C20140707_OR006_04 C20140707_OR006_04 TB437151.[MT7]-RMGESDDSILR.3y4_1.heavy 474.909 / 488.319 10610.0 25.162500381469727 46 16 10 10 10 2.808637175151545 35.60445645479442 0.0 3 0.967722522589963 6.850739301883247 10610.0 51.600546448087435 0.0 - - - - - - - 266.1818181818182 21 11 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 1017 129 C20140707_OR006_04 C20140707_OR006_04 TB437151.[MT7]-RMGESDDSILR.3b7_1.heavy 474.909 / 935.401 1463.0 25.162500381469727 46 16 10 10 10 2.808637175151545 35.60445645479442 0.0 3 0.967722522589963 6.850739301883247 1463.0 7.974549180327869 0.0 - - - - - - - 292.8 2 5 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 1019 129 C20140707_OR006_04 C20140707_OR006_04 TB437151.[MT7]-RMGESDDSILR.3y5_1.heavy 474.909 / 603.346 6586.0 25.162500381469727 46 16 10 10 10 2.808637175151545 35.60445645479442 0.0 3 0.967722522589963 6.850739301883247 6586.0 18.585784543325527 0.0 - - - - - - - 305.0 13 8 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 1021 130 C20140707_OR006_04 C20140707_OR006_04 TB437400.[MT7]-LTILQSLGDPLYYGK[MT7].2y4_1.heavy 985.066 / 674.363 4176.0 48.0447998046875 39 16 10 3 10 2.1527963750531054 46.45121162354855 0.07579803466796875 3 0.9641700650555947 6.500309395468119 4176.0 26.29333333333333 0.0 - - - - - - - 205.71428571428572 8 14 FAM48A family with sequence similarity 48, member A 1023 130 C20140707_OR006_04 C20140707_OR006_04 TB437400.[MT7]-LTILQSLGDPLYYGK[MT7].2y8_1.heavy 985.066 / 1056.55 5041.0 48.0447998046875 39 16 10 3 10 2.1527963750531054 46.45121162354855 0.07579803466796875 3 0.9641700650555947 6.500309395468119 5041.0 57.41138888888888 0.0 - - - - - - - 184.0 10 18 FAM48A family with sequence similarity 48, member A 1025 130 C20140707_OR006_04 C20140707_OR006_04 TB437400.[MT7]-LTILQSLGDPLYYGK[MT7].2y3_1.heavy 985.066 / 511.3 6265.0 48.0447998046875 39 16 10 3 10 2.1527963750531054 46.45121162354855 0.07579803466796875 3 0.9641700650555947 6.500309395468119 6265.0 43.6519675925926 0.0 - - - - - - - 198.0 12 8 FAM48A family with sequence similarity 48, member A 1027 130 C20140707_OR006_04 C20140707_OR006_04 TB437400.[MT7]-LTILQSLGDPLYYGK[MT7].2y6_1.heavy 985.066 / 884.5 10657.0 48.0447998046875 39 16 10 3 10 2.1527963750531054 46.45121162354855 0.07579803466796875 3 0.9641700650555947 6.500309395468119 10657.0 66.60625 0.0 - - - - - - - 184.5 21 16 FAM48A family with sequence similarity 48, member A 1029 131 C20140707_OR006_04 C20140707_OR006_04 TB437401.[MT7]-SDDSQPTVWPAHDVK[MT7].3y3_1.heavy 657.333 / 505.31 6059.0 27.735225200653076 42 17 10 5 10 4.2737217412172726 18.35121551825252 0.04450035095214844 3 0.9776150995857656 8.233250031717432 6059.0 11.80227932040232 0.0 - - - - - - - 667.1428571428571 12 7 FAM48A family with sequence similarity 48, member A 1031 131 C20140707_OR006_04 C20140707_OR006_04 TB437401.[MT7]-SDDSQPTVWPAHDVK[MT7].3y6_1.heavy 657.333 / 810.459 10478.0 27.735225200653076 42 17 10 5 10 4.2737217412172726 18.35121551825252 0.04450035095214844 3 0.9776150995857656 8.233250031717432 10478.0 50.6588063827114 0.0 - - - - - - - 268.0 20 8 FAM48A family with sequence similarity 48, member A 1033 131 C20140707_OR006_04 C20140707_OR006_04 TB437401.[MT7]-SDDSQPTVWPAHDVK[MT7].3b4_1.heavy 657.333 / 549.227 2146.0 27.735225200653076 42 17 10 5 10 4.2737217412172726 18.35121551825252 0.04450035095214844 3 0.9776150995857656 8.233250031717432 2146.0 3.797878228975416 2.0 - - - - - - - 667.2857142857143 4 7 FAM48A family with sequence similarity 48, member A 1035 131 C20140707_OR006_04 C20140707_OR006_04 TB437401.[MT7]-SDDSQPTVWPAHDVK[MT7].3b5_1.heavy 657.333 / 677.286 13255.0 27.735225200653076 42 17 10 5 10 4.2737217412172726 18.35121551825252 0.04450035095214844 3 0.9776150995857656 8.233250031717432 13255.0 41.20861386138614 0.0 - - - - - - - 266.44444444444446 26 9 FAM48A family with sequence similarity 48, member A 1037 132 C20140707_OR006_04 C20140707_OR006_04 TB437404.[MT7]-EEYGESPLQDAEEAK[MT7].2y5_1.heavy 991.975 / 691.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1039 132 C20140707_OR006_04 C20140707_OR006_04 TB437404.[MT7]-EEYGESPLQDAEEAK[MT7].2y9_1.heavy 991.975 / 1144.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1041 132 C20140707_OR006_04 C20140707_OR006_04 TB437404.[MT7]-EEYGESPLQDAEEAK[MT7].2b6_1.heavy 991.975 / 839.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1043 132 C20140707_OR006_04 C20140707_OR006_04 TB437404.[MT7]-EEYGESPLQDAEEAK[MT7].2b5_1.heavy 991.975 / 752.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1045 133 C20140707_OR006_04 C20140707_OR006_04 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 131680.0 32.31230163574219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 131680.0 182.64342851974365 0.0 - - - - - - - 192.0 263 10 1047 133 C20140707_OR006_04 C20140707_OR006_04 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 125282.0 32.31230163574219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 125282.0 342.7602692076914 0.0 - - - - - - - 197.8181818181818 250 11 1049 133 C20140707_OR006_04 C20140707_OR006_04 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 268863.0 32.31230163574219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 268863.0 353.15027156784186 0.0 - - - - - - - 384.0 537 2 1051 134 C20140707_OR006_04 C20140707_OR006_04 TB411950.[MT7]-QAAVSVLGTEPNS.2b8_1.heavy 708.876 / 870.516 2014.0 31.158899307250977 43 13 10 10 10 1.6882135974623529 53.02237411422836 0.0 3 0.9010674176721296 3.8908584900880285 2014.0 7.353460166168666 0.0 - - - - - - - 210.0 4 9 PPOX protoporphyrinogen oxidase 1053 134 C20140707_OR006_04 C20140707_OR006_04 TB411950.[MT7]-QAAVSVLGTEPNS.2b4_1.heavy 708.876 / 514.311 6294.0 31.158899307250977 43 13 10 10 10 1.6882135974623529 53.02237411422836 0.0 3 0.9010674176721296 3.8908584900880285 6294.0 57.695 0.0 - - - - - - - 210.0 12 6 PPOX protoporphyrinogen oxidase 1055 134 C20140707_OR006_04 C20140707_OR006_04 TB411950.[MT7]-QAAVSVLGTEPNS.2b6_1.heavy 708.876 / 700.411 3902.0 31.158899307250977 43 13 10 10 10 1.6882135974623529 53.02237411422836 0.0 3 0.9010674176721296 3.8908584900880285 3902.0 24.63043173547515 1.0 - - - - - - - 647.2857142857143 10 7 PPOX protoporphyrinogen oxidase 1057 134 C20140707_OR006_04 C20140707_OR006_04 TB411950.[MT7]-QAAVSVLGTEPNS.2b7_1.heavy 708.876 / 813.495 5035.0 31.158899307250977 43 13 10 10 10 1.6882135974623529 53.02237411422836 0.0 3 0.9010674176721296 3.8908584900880285 5035.0 24.775396825396825 0.0 - - - - - - - 241.5 10 12 PPOX protoporphyrinogen oxidase 1059 135 C20140707_OR006_04 C20140707_OR006_04 TB411666.[MT7]-DGGPNVK[MT7].2y4_1.heavy 487.779 / 601.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1061 135 C20140707_OR006_04 C20140707_OR006_04 TB411666.[MT7]-DGGPNVK[MT7].2b6_1.heavy 487.779 / 684.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1063 135 C20140707_OR006_04 C20140707_OR006_04 TB411666.[MT7]-DGGPNVK[MT7].2y6_1.heavy 487.779 / 715.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1065 135 C20140707_OR006_04 C20140707_OR006_04 TB411666.[MT7]-DGGPNVK[MT7].2b5_1.heavy 487.779 / 585.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1067 136 C20140707_OR006_04 C20140707_OR006_04 TB450151.[MT7]-LQDILTNSK[MT7].3y3_1.heavy 440.597 / 492.29 9940.0 34.018001556396484 42 12 10 10 10 1.9527884457389872 51.208824088549605 0.0 3 0.8910667677932154 3.7047470733141723 9940.0 26.83956043956044 0.0 - - - - - - - 254.83333333333334 19 6 GRIPAP1 GRIP1 associated protein 1 1069 136 C20140707_OR006_04 C20140707_OR006_04 TB450151.[MT7]-LQDILTNSK[MT7].3b4_1.heavy 440.597 / 614.363 11725.0 34.018001556396484 42 12 10 10 10 1.9527884457389872 51.208824088549605 0.0 3 0.8910667677932154 3.7047470733141723 11725.0 120.46873170631157 0.0 - - - - - - - 254.75 23 8 GRIPAP1 GRIP1 associated protein 1 1071 136 C20140707_OR006_04 C20140707_OR006_04 TB450151.[MT7]-LQDILTNSK[MT7].3y4_1.heavy 440.597 / 593.338 5862.0 34.018001556396484 42 12 10 10 10 1.9527884457389872 51.208824088549605 0.0 3 0.8910667677932154 3.7047470733141723 5862.0 28.27552941176471 0.0 - - - - - - - 222.75 11 4 GRIPAP1 GRIP1 associated protein 1 1073 136 C20140707_OR006_04 C20140707_OR006_04 TB450151.[MT7]-LQDILTNSK[MT7].3b3_1.heavy 440.597 / 501.279 15293.0 34.018001556396484 42 12 10 10 10 1.9527884457389872 51.208824088549605 0.0 3 0.8910667677932154 3.7047470733141723 15293.0 32.99996570936067 0.0 - - - - - - - 191.0 30 2 GRIPAP1 GRIP1 associated protein 1 1075 137 C20140707_OR006_04 C20140707_OR006_04 TB450504.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].4b4_1.heavy 672.635 / 585.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1077 137 C20140707_OR006_04 C20140707_OR006_04 TB450504.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].4b5_1.heavy 672.635 / 698.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1079 137 C20140707_OR006_04 C20140707_OR006_04 TB450504.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].4y3_1.heavy 672.635 / 640.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1081 137 C20140707_OR006_04 C20140707_OR006_04 TB450504.[MT7]-DVLLLVHNLPQNLTGYIWYK[MT7].4b6_1.heavy 672.635 / 797.525 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG8;PSG1;PSG2;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1083 138 C20140707_OR006_04 C20140707_OR006_04 TB412435.[MT7]-SLSSSPQAQPPRPAELSDEEVAELFQR.4y5_1.heavy 778.897 / 692.373 5109.0 40.55254936218262 46 20 10 6 10 5.815916139423442 13.5265766292937 0.03859710693359375 3 0.9964611943619722 20.73986177789997 5109.0 7.253274760383386 1.0 - - - - - - - 256.1818181818182 10 11 GRIPAP1 GRIP1 associated protein 1 1085 138 C20140707_OR006_04 C20140707_OR006_04 TB412435.[MT7]-SLSSSPQAQPPRPAELSDEEVAELFQR.4b5_1.heavy 778.897 / 606.321 4067.0 40.55254936218262 46 20 10 6 10 5.815916139423442 13.5265766292937 0.03859710693359375 3 0.9964611943619722 20.73986177789997 4067.0 7.265433231850835 0.0 - - - - - - - 294.0 8 11 GRIPAP1 GRIP1 associated protein 1 1087 138 C20140707_OR006_04 C20140707_OR006_04 TB412435.[MT7]-SLSSSPQAQPPRPAELSDEEVAELFQR.4y7_1.heavy 778.897 / 862.478 4067.0 40.55254936218262 46 20 10 6 10 5.815916139423442 13.5265766292937 0.03859710693359375 3 0.9964611943619722 20.73986177789997 4067.0 9.460407673860912 0.0 - - - - - - - 216.53846153846155 8 13 GRIPAP1 GRIP1 associated protein 1 1089 138 C20140707_OR006_04 C20140707_OR006_04 TB412435.[MT7]-SLSSSPQAQPPRPAELSDEEVAELFQR.4y6_1.heavy 778.897 / 763.41 8342.0 40.55254936218262 46 20 10 6 10 5.815916139423442 13.5265766292937 0.03859710693359375 3 0.9964611943619722 20.73986177789997 8342.0 43.32348587583607 0.0 - - - - - - - 229.4 16 10 GRIPAP1 GRIP1 associated protein 1 1091 139 C20140707_OR006_04 C20140707_OR006_04 TB437473.[MT7]-LTSLQQELLSALLSSGVTK[MT7].4b7_1.heavy 569.838 / 944.517 108.0 53.00519943237305 37 7 10 10 10 0.7238215115707926 71.2132820967603 0.0 3 0.7240754456633536 2.293156696132366 108.0 1.79 5.0 - - - - - - - 0.0 0 0 HNF1B HNF1 homeobox B 1093 139 C20140707_OR006_04 C20140707_OR006_04 TB437473.[MT7]-LTSLQQELLSALLSSGVTK[MT7].4b4_1.heavy 569.838 / 559.357 2162.0 53.00519943237305 37 7 10 10 10 0.7238215115707926 71.2132820967603 0.0 3 0.7240754456633536 2.293156696132366 2162.0 37.367901234567896 0.0 - - - - - - - 182.25 4 8 HNF1B HNF1 homeobox B 1095 139 C20140707_OR006_04 C20140707_OR006_04 TB437473.[MT7]-LTSLQQELLSALLSSGVTK[MT7].4b5_1.heavy 569.838 / 687.416 757.0 53.00519943237305 37 7 10 10 10 0.7238215115707926 71.2132820967603 0.0 3 0.7240754456633536 2.293156696132366 757.0 16.822222222222223 0.0 - - - - - - - 0.0 1 0 HNF1B HNF1 homeobox B 1097 139 C20140707_OR006_04 C20140707_OR006_04 TB437473.[MT7]-LTSLQQELLSALLSSGVTK[MT7].4y6_1.heavy 569.838 / 722.417 2054.0 53.00519943237305 37 7 10 10 10 0.7238215115707926 71.2132820967603 0.0 3 0.7240754456633536 2.293156696132366 2054.0 47.07083333333333 0.0 - - - - - - - 140.4 4 5 HNF1B HNF1 homeobox B 1099 140 C20140707_OR006_04 C20140707_OR006_04 TB450404.[MT7]-NQEFLLLPAEELHK[MT7].4b4_1.heavy 493.03 / 663.322 4797.0 39.80100059509277 31 11 4 6 10 0.7058266961032897 73.3801590231637 0.039402008056640625 3 0.8769340458089537 3.4812519945934786 4797.0 -1.2656992084432712 0.0 - - - - - - - 201.8 9 5 KLHL1 kelch-like 1 (Drosophila) 1101 140 C20140707_OR006_04 C20140707_OR006_04 TB450404.[MT7]-NQEFLLLPAEELHK[MT7].4b5_1.heavy 493.03 / 776.406 2777.0 39.80100059509277 31 11 4 6 10 0.7058266961032897 73.3801590231637 0.039402008056640625 3 0.8769340458089537 3.4812519945934786 2777.0 9.967747303982037 0.0 - - - - - - - 126.0 5 2 KLHL1 kelch-like 1 (Drosophila) 1103 140 C20140707_OR006_04 C20140707_OR006_04 TB450404.[MT7]-NQEFLLLPAEELHK[MT7].4y3_1.heavy 493.03 / 541.358 1262.0 39.80100059509277 31 11 4 6 10 0.7058266961032897 73.3801590231637 0.039402008056640625 3 0.8769340458089537 3.4812519945934786 1262.0 -0.14284097340124502 3.0 - - - - - - - 227.2 17 5 KLHL1 kelch-like 1 (Drosophila) 1105 140 C20140707_OR006_04 C20140707_OR006_04 TB450404.[MT7]-NQEFLLLPAEELHK[MT7].4b3_1.heavy 493.03 / 516.253 1389.0 39.80100059509277 31 11 4 6 10 0.7058266961032897 73.3801590231637 0.039402008056640625 3 0.8769340458089537 3.4812519945934786 1389.0 -0.5 2.0 - - - - - - - 201.8 2 5 KLHL1 kelch-like 1 (Drosophila) 1107 141 C20140707_OR006_04 C20140707_OR006_04 TB437576.[MT7]-DTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPK[MT7].4b8_1.heavy 903.479 / 1000.58 4099.0 39.99150085449219 46 20 10 6 10 32.77095139804705 3.0514829668924226 0.0395965576171875 3 0.9941448144298971 16.120551811704114 4099.0 18.875039198443787 0.0 - - - - - - - 175.0 8 9 SDC1 syndecan 1 1109 141 C20140707_OR006_04 C20140707_OR006_04 TB437576.[MT7]-DTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPK[MT7].4b4_1.heavy 903.479 / 602.327 10404.0 39.99150085449219 46 20 10 6 10 32.77095139804705 3.0514829668924226 0.0395965576171875 3 0.9941448144298971 16.120551811704114 10404.0 57.293748112352766 0.0 - - - - - - - 189.0 20 10 SDC1 syndecan 1 1111 141 C20140707_OR006_04 C20140707_OR006_04 TB437576.[MT7]-DTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPK[MT7].4b5_1.heavy 903.479 / 715.411 5675.0 39.99150085449219 46 20 10 6 10 32.77095139804705 3.0514829668924226 0.0395965576171875 3 0.9941448144298971 16.120551811704114 5675.0 18.002739415893142 0.0 - - - - - - - 175.0 11 6 SDC1 syndecan 1 1113 141 C20140707_OR006_04 C20140707_OR006_04 TB437576.[MT7]-DTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPK[MT7].4y7_1.heavy 903.479 / 799.443 12821.0 39.99150085449219 46 20 10 6 10 32.77095139804705 3.0514829668924226 0.0395965576171875 3 0.9941448144298971 16.120551811704114 12821.0 32.31314007096357 0.0 - - - - - - - 689.1111111111111 25 9 SDC1 syndecan 1 1115 142 C20140707_OR006_04 C20140707_OR006_04 TB450508.[MT7]-ARFEMVLDLMQQLQDLGHPPK[MT7].4b8_1.heavy 689.372 / 1106.58 805.0 44.81534957885742 28 11 10 3 4 0.820739211164202 66.3829216836406 0.07690048217773438 10 0.8623767814208012 3.287797818264978 805.0 11.464275020585374 1.0 - - - - - - - 0.0 1 0 PEX19 peroxisomal biogenesis factor 19 1117 142 C20140707_OR006_04 C20140707_OR006_04 TB450508.[MT7]-ARFEMVLDLMQQLQDLGHPPK[MT7].4b5_1.heavy 689.372 / 779.399 1317.0 44.81534957885742 28 11 10 3 4 0.820739211164202 66.3829216836406 0.07690048217773438 10 0.8623767814208012 3.287797818264978 1317.0 1.797952218430034 1.0 - - - - - - - 146.21428571428572 2 14 PEX19 peroxisomal biogenesis factor 19 1119 142 C20140707_OR006_04 C20140707_OR006_04 TB450508.[MT7]-ARFEMVLDLMQQLQDLGHPPK[MT7].4b6_1.heavy 689.372 / 878.468 439.0 44.81534957885742 28 11 10 3 4 0.820739211164202 66.3829216836406 0.07690048217773438 10 0.8623767814208012 3.287797818264978 439.0 1.2027397260273973 11.0 - - - - - - - 0.0 1 0 PEX19 peroxisomal biogenesis factor 19 1121 142 C20140707_OR006_04 C20140707_OR006_04 TB450508.[MT7]-ARFEMVLDLMQQLQDLGHPPK[MT7].4b4_1.heavy 689.372 / 648.359 585.0 44.81534957885742 28 11 10 3 4 0.820739211164202 66.3829216836406 0.07690048217773438 10 0.8623767814208012 3.287797818264978 585.0 1.86986301369863 15.0 - - - - - - - 213.16666666666666 2 12 PEX19 peroxisomal biogenesis factor 19 1123 143 C20140707_OR006_04 C20140707_OR006_04 TB437578.[MT7]-IFDDFGTHYFTSGSLGGVYDLLYQFSSEELK[MT7].4y5_1.heavy 956.721 / 749.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 1125 143 C20140707_OR006_04 C20140707_OR006_04 TB437578.[MT7]-IFDDFGTHYFTSGSLGGVYDLLYQFSSEELK[MT7].4b4_1.heavy 956.721 / 635.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 1127 143 C20140707_OR006_04 C20140707_OR006_04 TB437578.[MT7]-IFDDFGTHYFTSGSLGGVYDLLYQFSSEELK[MT7].4y7_1.heavy 956.721 / 983.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 1129 143 C20140707_OR006_04 C20140707_OR006_04 TB437578.[MT7]-IFDDFGTHYFTSGSLGGVYDLLYQFSSEELK[MT7].4y6_1.heavy 956.721 / 836.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 1131 144 C20140707_OR006_04 C20140707_OR006_04 TB450400.[MT7]-QMALSLEDTELQRK[MT7].4y8_2.heavy 488.27 / 581.813 2251.0 32.59400177001953 39 9 10 10 10 1.761697459087416 44.979580845081635 0.0 3 0.8109266346370153 2.7922482295961357 2251.0 4.201866666666666 0.0 - - - - - - - 166.66666666666666 4 6 RTKN rhotekin 1133 144 C20140707_OR006_04 C20140707_OR006_04 TB450400.[MT7]-QMALSLEDTELQRK[MT7].4b4_1.heavy 488.27 / 588.33 4003.0 32.59400177001953 39 9 10 10 10 1.761697459087416 44.979580845081635 0.0 3 0.8109266346370153 2.7922482295961357 4003.0 13.34297774816789 0.0 - - - - - - - 287.5 8 10 RTKN rhotekin 1135 144 C20140707_OR006_04 C20140707_OR006_04 TB450400.[MT7]-QMALSLEDTELQRK[MT7].4b5_1.heavy 488.27 / 675.362 3252.0 32.59400177001953 39 9 10 10 10 1.761697459087416 44.979580845081635 0.0 3 0.8109266346370153 2.7922482295961357 3252.0 12.834560000000002 0.0 - - - - - - - 250.0 6 10 RTKN rhotekin 1137 144 C20140707_OR006_04 C20140707_OR006_04 TB450400.[MT7]-QMALSLEDTELQRK[MT7].4y7_2.heavy 488.27 / 517.292 9881.0 32.59400177001953 39 9 10 10 10 1.761697459087416 44.979580845081635 0.0 3 0.8109266346370153 2.7922482295961357 9881.0 51.223104000000006 0.0 - - - - - - - 218.75 19 4 RTKN rhotekin 1139 145 C20140707_OR006_04 C20140707_OR006_04 TB436937.[MT7]-AFVVNIK[MT7].2y4_1.heavy 539.847 / 617.41 17247.0 33.70899963378906 48 18 10 10 10 6.344266438838055 15.762263606683405 0.0 3 0.9858367866774882 10.35780073110919 17247.0 32.23758613148637 0.0 - - - - - - - 309.6666666666667 34 3 SYT4 synaptotagmin IV 1141 145 C20140707_OR006_04 C20140707_OR006_04 TB436937.[MT7]-AFVVNIK[MT7].2y5_1.heavy 539.847 / 716.479 6899.0 33.70899963378906 48 18 10 10 10 6.344266438838055 15.762263606683405 0.0 3 0.9858367866774882 10.35780073110919 6899.0 18.72508773126568 0.0 - - - - - - - 243.33333333333334 13 6 SYT4 synaptotagmin IV 1143 145 C20140707_OR006_04 C20140707_OR006_04 TB436937.[MT7]-AFVVNIK[MT7].2y3_1.heavy 539.847 / 518.342 13798.0 33.70899963378906 48 18 10 10 10 6.344266438838055 15.762263606683405 0.0 3 0.9858367866774882 10.35780073110919 13798.0 12.48687305752859 0.0 - - - - - - - 243.16666666666666 27 6 SYT4 synaptotagmin IV 1145 145 C20140707_OR006_04 C20140707_OR006_04 TB436937.[MT7]-AFVVNIK[MT7].2y6_1.heavy 539.847 / 863.547 6235.0 33.70899963378906 48 18 10 10 10 6.344266438838055 15.762263606683405 0.0 3 0.9858367866774882 10.35780073110919 6235.0 14.987639119570987 0.0 - - - - - - - 177.0 12 6 SYT4 synaptotagmin IV 1147 146 C20140707_OR006_04 C20140707_OR006_04 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 287615.0 26.525800704956055 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 287615.0 73.04087597773773 0.0 - - - - - - - 2908.0 575 1 1149 146 C20140707_OR006_04 C20140707_OR006_04 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 341346.0 26.525800704956055 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 341346.0 69.55881256239167 0.0 - - - - - - - 3413.0 682 1 1151 146 C20140707_OR006_04 C20140707_OR006_04 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 387617.0 26.525800704956055 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 387617.0 55.13247472388159 0.0 - - - - - - - 3413.0 775 1 1153 147 C20140707_OR006_04 C20140707_OR006_04 TB450371.[MT7]-DHASIQMNVAEVDK[MT7].4y4_1.heavy 461.991 / 634.353 5730.0 28.35099983215332 38 8 10 10 10 0.6885561218942419 78.02623799109676 0.0 3 0.7687690923284305 2.515310869048186 5730.0 45.13363723916533 0.0 - - - - - - - 187.0 11 8 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 1155 147 C20140707_OR006_04 C20140707_OR006_04 TB450371.[MT7]-DHASIQMNVAEVDK[MT7].4b4_1.heavy 461.991 / 555.264 1246.0 28.35099983215332 38 8 10 10 10 0.6885561218942419 78.02623799109676 0.0 3 0.7687690923284305 2.515310869048186 1246.0 1.7749623682890114 3.0 - - - - - - - 274.1 4 10 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 1157 147 C20140707_OR006_04 C20140707_OR006_04 TB450371.[MT7]-DHASIQMNVAEVDK[MT7].4y3_1.heavy 461.991 / 505.31 6976.0 28.35099983215332 38 8 10 10 10 0.6885561218942419 78.02623799109676 0.0 3 0.7687690923284305 2.515310869048186 6976.0 14.108764044943822 0.0 - - - - - - - 267.0 13 7 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 1159 147 C20140707_OR006_04 C20140707_OR006_04 TB450371.[MT7]-DHASIQMNVAEVDK[MT7].4b6_1.heavy 461.991 / 796.407 2242.0 28.35099983215332 38 8 10 10 10 0.6885561218942419 78.02623799109676 0.0 3 0.7687690923284305 2.515310869048186 2242.0 14.519096278160772 0.0 - - - - - - - 224.4 4 5 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 1161 148 C20140707_OR006_04 C20140707_OR006_04 TB437081.[MT7]-TLFLFGVTK[MT7].2y4_1.heavy 657.407 / 548.352 8963.0 44.20159912109375 50 20 10 10 10 15.390237663928188 6.497625454763518 0.0 3 0.9988252990303104 36.00445017033638 8963.0 45.701632665639444 0.0 - - - - - - - 229.33333333333334 17 12 PSG2;PSG3;PSG11 pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 11 1163 148 C20140707_OR006_04 C20140707_OR006_04 TB437081.[MT7]-TLFLFGVTK[MT7].2b3_1.heavy 657.407 / 506.31 10300.0 44.20159912109375 50 20 10 10 10 15.390237663928188 6.497625454763518 0.0 3 0.9988252990303104 36.00445017033638 10300.0 24.33652261887556 0.0 - - - - - - - 284.2307692307692 20 13 PSG2;PSG3;PSG11 pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 11 1165 148 C20140707_OR006_04 C20140707_OR006_04 TB437081.[MT7]-TLFLFGVTK[MT7].2y5_1.heavy 657.407 / 695.421 9514.0 44.20159912109375 50 20 10 10 10 15.390237663928188 6.497625454763518 0.0 3 0.9988252990303104 36.00445017033638 9514.0 70.80134800231615 0.0 - - - - - - - 218.33333333333334 19 9 PSG2;PSG3;PSG11 pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 11 1167 148 C20140707_OR006_04 C20140707_OR006_04 TB437081.[MT7]-TLFLFGVTK[MT7].2y6_1.heavy 657.407 / 808.505 5346.0 44.20159912109375 50 20 10 10 10 15.390237663928188 6.497625454763518 0.0 3 0.9988252990303104 36.00445017033638 5346.0 10.334618369192004 0.0 - - - - - - - 224.64285714285714 10 14 PSG2;PSG3;PSG11 pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 11 1169 149 C20140707_OR006_04 C20140707_OR006_04 TB412336.[MT7]-TNLK[MT7]PGSPSDLENATPK[MT7].4b12_2.heavy 551.059 / 764.417 9989.0 25.75589942932129 44 14 10 10 10 4.542450366985567 22.014549840059427 0.0 3 0.9359055692885871 4.848471180014498 9989.0 53.3929973293788 0.0 - - - - - - - 277.75 19 4 SYT4 synaptotagmin IV 1171 149 C20140707_OR006_04 C20140707_OR006_04 TB412336.[MT7]-TNLK[MT7]PGSPSDLENATPK[MT7].4b4_2.heavy 551.059 / 373.244 10482.0 25.75589942932129 44 14 10 10 10 4.542450366985567 22.014549840059427 0.0 3 0.9359055692885871 4.848471180014498 10482.0 15.475017614331858 1.0 - - - - - - - 753.7777777777778 27 9 SYT4 synaptotagmin IV 1173 149 C20140707_OR006_04 C20140707_OR006_04 TB412336.[MT7]-TNLK[MT7]PGSPSDLENATPK[MT7].4b4_1.heavy 551.059 / 745.481 7522.0 25.75589942932129 44 14 10 10 10 4.542450366985567 22.014549840059427 0.0 3 0.9359055692885871 4.848471180014498 7522.0 19.71357746725656 0.0 - - - - - - - 277.375 15 8 SYT4 synaptotagmin IV 1175 149 C20140707_OR006_04 C20140707_OR006_04 TB412336.[MT7]-TNLK[MT7]PGSPSDLENATPK[MT7].4b10_2.heavy 551.059 / 643.353 44025.0 25.75589942932129 44 14 10 10 10 4.542450366985567 22.014549840059427 0.0 3 0.9359055692885871 4.848471180014498 44025.0 151.24070247254554 0.0 - - - - - - - 274.1111111111111 88 9 SYT4 synaptotagmin IV 1177 150 C20140707_OR006_04 C20140707_OR006_04 TB436935.[MT7]-DAEQLSK[MT7].2y4_1.heavy 539.803 / 619.39 7594.0 19.681100845336914 35 17 0 10 8 3.057914962196187 32.70202122565902 0.0 4 0.975518121545319 7.871363497230804 7594.0 32.7686301369863 1.0 - - - - - - - 175.2 182 10 LOC100509491;DUSP22 hypothetical protein LOC100509491;dual specificity phosphatase 22 1179 150 C20140707_OR006_04 C20140707_OR006_04 TB436935.[MT7]-DAEQLSK[MT7].2y5_1.heavy 539.803 / 748.432 3115.0 19.681100845336914 35 17 0 10 8 3.057914962196187 32.70202122565902 0.0 4 0.975518121545319 7.871363497230804 3115.0 23.34309669764683 0.0 - - - - - - - 275.8333333333333 6 6 LOC100509491;DUSP22 hypothetical protein LOC100509491;dual specificity phosphatase 22 1181 150 C20140707_OR006_04 C20140707_OR006_04 TB436935.[MT7]-DAEQLSK[MT7].2b4_1.heavy 539.803 / 588.275 11099.0 19.681100845336914 35 17 0 10 8 3.057914962196187 32.70202122565902 0.0 4 0.975518121545319 7.871363497230804 11099.0 142.5267716424234 0.0 - - - - - - - 162.16666666666666 22 6 LOC100509491;DUSP22 hypothetical protein LOC100509491;dual specificity phosphatase 22 1183 150 C20140707_OR006_04 C20140707_OR006_04 TB436935.[MT7]-DAEQLSK[MT7].2y6_1.heavy 539.803 / 819.469 8373.0 19.681100845336914 35 17 0 10 8 3.057914962196187 32.70202122565902 0.0 4 0.975518121545319 7.871363497230804 8373.0 124.07887390959554 0.0 - - - - - - - 253.0 16 5 LOC100509491;DUSP22 hypothetical protein LOC100509491;dual specificity phosphatase 22 1185 151 C20140707_OR006_04 C20140707_OR006_04 TB436932.[MT7]-EILREK[MT7].2y4_1.heavy 538.339 / 689.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 1187 151 C20140707_OR006_04 C20140707_OR006_04 TB436932.[MT7]-EILREK[MT7].2b3_1.heavy 538.339 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 1189 151 C20140707_OR006_04 C20140707_OR006_04 TB436932.[MT7]-EILREK[MT7].2y5_1.heavy 538.339 / 802.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 1191 151 C20140707_OR006_04 C20140707_OR006_04 TB436932.[MT7]-EILREK[MT7].2b5_1.heavy 538.339 / 785.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 1193 152 C20140707_OR006_04 C20140707_OR006_04 TB437071.[MT7]-GTIEYTVESR.2y9_1.heavy 649.839 / 1097.55 3621.0 26.525800704956055 44 14 10 10 10 1.2553088226388016 56.92994344957111 0.0 3 0.9340366885239526 4.77853142430066 3621.0 23.1744 0.0 - - - - - - - 208.22222222222223 7 9 OXR1 oxidation resistance 1 1195 152 C20140707_OR006_04 C20140707_OR006_04 TB437071.[MT7]-GTIEYTVESR.2b4_1.heavy 649.839 / 545.305 2497.0 26.525800704956055 44 14 10 10 10 1.2553088226388016 56.92994344957111 0.0 3 0.9340366885239526 4.77853142430066 2497.0 2.2797479462285284 1.0 - - - - - - - 291.55555555555554 8 9 OXR1 oxidation resistance 1 1197 152 C20140707_OR006_04 C20140707_OR006_04 TB437071.[MT7]-GTIEYTVESR.2y6_1.heavy 649.839 / 754.373 2372.0 26.525800704956055 44 14 10 10 10 1.2553088226388016 56.92994344957111 0.0 3 0.9340366885239526 4.77853142430066 2372.0 18.311839999999997 0.0 - - - - - - - 208.33333333333334 4 6 OXR1 oxidation resistance 1 1199 152 C20140707_OR006_04 C20140707_OR006_04 TB437071.[MT7]-GTIEYTVESR.2y7_1.heavy 649.839 / 883.416 3621.0 26.525800704956055 44 14 10 10 10 1.2553088226388016 56.92994344957111 0.0 3 0.9340366885239526 4.77853142430066 3621.0 37.94808 0.0 - - - - - - - 208.33333333333334 7 6 OXR1 oxidation resistance 1 1201 153 C20140707_OR006_04 C20140707_OR006_04 TB437072.[MT7]-NSATGMESSK[MT7].2y9_1.heavy 650.326 / 1041.5 1496.0 17.425600051879883 43 13 10 10 10 1.1247271181142728 59.25932304981336 0.0 3 0.9244204979975766 4.460528644453532 1496.0 34.906666666666666 0.0 - - - - - - - 157.0 2 8 PSG3 pregnancy specific beta-1-glycoprotein 3 1203 153 C20140707_OR006_04 C20140707_OR006_04 TB437072.[MT7]-NSATGMESSK[MT7].2y6_1.heavy 650.326 / 782.383 658.0 17.425600051879883 43 13 10 10 10 1.1247271181142728 59.25932304981336 0.0 3 0.9244204979975766 4.460528644453532 658.0 2.076186395521937 1.0 - - - - - - - 149.375 2 8 PSG3 pregnancy specific beta-1-glycoprotein 3 1205 153 C20140707_OR006_04 C20140707_OR006_04 TB437072.[MT7]-NSATGMESSK[MT7].2b5_1.heavy 650.326 / 575.291 N/A 17.425600051879883 43 13 10 10 10 1.1247271181142728 59.25932304981336 0.0 3 0.9244204979975766 4.460528644453532 239.0 1.466489757914339 36.0 - - - - - - - 0.0 1 0 PSG3 pregnancy specific beta-1-glycoprotein 3 1207 153 C20140707_OR006_04 C20140707_OR006_04 TB437072.[MT7]-NSATGMESSK[MT7].2y7_1.heavy 650.326 / 883.431 1496.0 17.425600051879883 43 13 10 10 10 1.1247271181142728 59.25932304981336 0.0 3 0.9244204979975766 4.460528644453532 1496.0 30.871366852886403 0.0 - - - - - - - 149.5 2 8 PSG3 pregnancy specific beta-1-glycoprotein 3 1209 154 C20140707_OR006_04 C20140707_OR006_04 TB450279.[MT7]-NSVQMTEQDTK[MT7].2b4_1.heavy 784.895 / 573.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1211 154 C20140707_OR006_04 C20140707_OR006_04 TB450279.[MT7]-NSVQMTEQDTK[MT7].2y3_1.heavy 784.895 / 507.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1213 154 C20140707_OR006_04 C20140707_OR006_04 TB450279.[MT7]-NSVQMTEQDTK[MT7].2y6_1.heavy 784.895 / 865.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1215 154 C20140707_OR006_04 C20140707_OR006_04 TB450279.[MT7]-NSVQMTEQDTK[MT7].2y7_1.heavy 784.895 / 996.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1217 155 C20140707_OR006_04 C20140707_OR006_04 TB437274.[MT7]-QC[CAM]REQHAAELK[MT7].2b3_1.heavy 829.438 / 589.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 1219 155 C20140707_OR006_04 C20140707_OR006_04 TB437274.[MT7]-QC[CAM]REQHAAELK[MT7].2y4_1.heavy 829.438 / 604.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 1221 155 C20140707_OR006_04 C20140707_OR006_04 TB437274.[MT7]-QC[CAM]REQHAAELK[MT7].2y5_1.heavy 829.438 / 675.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 1223 155 C20140707_OR006_04 C20140707_OR006_04 TB437274.[MT7]-QC[CAM]REQHAAELK[MT7].2b6_1.heavy 829.438 / 983.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 1225 156 C20140707_OR006_04 C20140707_OR006_04 TB450276.[MT7]-DDLNSQLQESLR.2y8_1.heavy 781.401 / 960.511 6285.0 32.67660140991211 48 18 10 10 10 4.002004584645693 24.987477621506333 0.0 3 0.9800957827554491 8.733067508618134 6285.0 32.82537135278514 0.0 - - - - - - - 276.4 12 5 GRIPAP1 GRIP1 associated protein 1 1227 156 C20140707_OR006_04 C20140707_OR006_04 TB450276.[MT7]-DDLNSQLQESLR.2b4_1.heavy 781.401 / 602.29 3771.0 32.67660140991211 48 18 10 10 10 4.002004584645693 24.987477621506333 0.0 3 0.9800957827554491 8.733067508618134 3771.0 16.249637137387875 0.0 - - - - - - - 238.8 7 10 GRIPAP1 GRIP1 associated protein 1 1229 156 C20140707_OR006_04 C20140707_OR006_04 TB450276.[MT7]-DDLNSQLQESLR.2y9_1.heavy 781.401 / 1074.55 7040.0 32.67660140991211 48 18 10 10 10 4.002004584645693 24.987477621506333 0.0 3 0.9800957827554491 8.733067508618134 7040.0 34.20159837786033 0.0 - - - - - - - 188.5 14 6 GRIPAP1 GRIP1 associated protein 1 1231 156 C20140707_OR006_04 C20140707_OR006_04 TB450276.[MT7]-DDLNSQLQESLR.2y6_1.heavy 781.401 / 745.42 1634.0 32.67660140991211 48 18 10 10 10 4.002004584645693 24.987477621506333 0.0 3 0.9800957827554491 8.733067508618134 1634.0 10.591170437691313 1.0 - - - - - - - 201.1 3 10 GRIPAP1 GRIP1 associated protein 1 1233 157 C20140707_OR006_04 C20140707_OR006_04 TB437171.[MT7]-TIQTMDQSDK[MT7].2y4_1.heavy 727.874 / 621.332 2358.0 22.92127561569214 43 17 10 6 10 4.7119644646483705 21.222570915008475 0.03989982604980469 3 0.970988172746664 7.228018002612428 2358.0 11.443810511985088 0.0 - - - - - - - 224.5 4 6 STAT4 signal transducer and activator of transcription 4 1235 157 C20140707_OR006_04 C20140707_OR006_04 TB437171.[MT7]-TIQTMDQSDK[MT7].2y5_1.heavy 727.874 / 736.359 1347.0 22.92127561569214 43 17 10 6 10 4.7119644646483705 21.222570915008475 0.03989982604980469 3 0.970988172746664 7.228018002612428 1347.0 9.424825321463898 0.0 - - - - - - - 210.625 2 8 STAT4 signal transducer and activator of transcription 4 1237 157 C20140707_OR006_04 C20140707_OR006_04 TB437171.[MT7]-TIQTMDQSDK[MT7].2y9_1.heavy 727.874 / 1209.59 898.0 22.92127561569214 43 17 10 6 10 4.7119644646483705 21.222570915008475 0.03989982604980469 3 0.970988172746664 7.228018002612428 898.0 13.566214285714285 0.0 - - - - - - - 0.0 1 0 STAT4 signal transducer and activator of transcription 4 1239 157 C20140707_OR006_04 C20140707_OR006_04 TB437171.[MT7]-TIQTMDQSDK[MT7].2y7_1.heavy 727.874 / 968.448 3593.0 22.92127561569214 43 17 10 6 10 4.7119644646483705 21.222570915008475 0.03989982604980469 3 0.970988172746664 7.228018002612428 3593.0 11.889003626772173 0.0 - - - - - - - 224.66666666666666 7 3 STAT4 signal transducer and activator of transcription 4 1241 158 C20140707_OR006_04 C20140707_OR006_04 TB412101.[MT7]-GVDIYPENLNSK[MT7].2y8_1.heavy 818.943 / 1108.58 2776.0 31.524599075317383 50 20 10 10 10 8.353364253728088 11.971224642259582 0.0 3 0.9959083002409382 19.28689409371918 2776.0 27.594907232901956 0.0 - - - - - - - 224.33333333333334 5 9 SYT4 synaptotagmin IV 1243 158 C20140707_OR006_04 C20140707_OR006_04 TB412101.[MT7]-GVDIYPENLNSK[MT7].2b4_1.heavy 818.943 / 529.31 5931.0 31.524599075317383 50 20 10 10 10 8.353364253728088 11.971224642259582 0.0 3 0.9959083002409382 19.28689409371918 5931.0 31.042823862350012 0.0 - - - - - - - 234.14285714285714 11 7 SYT4 synaptotagmin IV 1245 158 C20140707_OR006_04 C20140707_OR006_04 TB412101.[MT7]-GVDIYPENLNSK[MT7].2b5_1.heavy 818.943 / 692.374 4669.0 31.524599075317383 50 20 10 10 10 8.353364253728088 11.971224642259582 0.0 3 0.9959083002409382 19.28689409371918 4669.0 22.719901658593866 0.0 - - - - - - - 210.11111111111111 9 9 SYT4 synaptotagmin IV 1247 158 C20140707_OR006_04 C20140707_OR006_04 TB412101.[MT7]-GVDIYPENLNSK[MT7].2y7_1.heavy 818.943 / 945.512 8454.0 31.524599075317383 50 20 10 10 10 8.353364253728088 11.971224642259582 0.0 3 0.9959083002409382 19.28689409371918 8454.0 52.9485877622817 0.0 - - - - - - - 210.16666666666666 16 6 SYT4 synaptotagmin IV 1249 159 C20140707_OR006_04 C20140707_OR006_04 TB437563.[MT7]-ADLESESFRPNLSDPSELLLPDQIEK[MT7].4y5_1.heavy 808.422 / 776.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - OXR1 oxidation resistance 1 1251 159 C20140707_OR006_04 C20140707_OR006_04 TB437563.[MT7]-ADLESESFRPNLSDPSELLLPDQIEK[MT7].4b14_2.heavy 808.422 / 853.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - OXR1 oxidation resistance 1 1253 159 C20140707_OR006_04 C20140707_OR006_04 TB437563.[MT7]-ADLESESFRPNLSDPSELLLPDQIEK[MT7].4b17_2.heavy 808.422 / 1009.97 N/A N/A - - - - - - - - - 0.0 - - - - - - - OXR1 oxidation resistance 1 1255 159 C20140707_OR006_04 C20140707_OR006_04 TB437563.[MT7]-ADLESESFRPNLSDPSELLLPDQIEK[MT7].4y6_1.heavy 808.422 / 873.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - OXR1 oxidation resistance 1 1257 160 C20140707_OR006_04 C20140707_OR006_04 TB437569.[MT7]-DSSLEADHVISAIPASVLSELLPAEAAPLAR.4b8_2.heavy 822.447 / 500.229 530.0 52.37952518463135 29 10 10 3 6 2.5713164377194797 38.89058481214812 0.07970046997070312 6 0.8396743212678078 3.0400445042994133 530.0 8.623728813559321 5.0 - - - - - - - 0.0 1 0 PPOX protoporphyrinogen oxidase 1259 160 C20140707_OR006_04 C20140707_OR006_04 TB437569.[MT7]-DSSLEADHVISAIPASVLSELLPAEAAPLAR.4b7_1.heavy 822.447 / 862.391 236.0 52.37952518463135 29 10 10 3 6 2.5713164377194797 38.89058481214812 0.07970046997070312 6 0.8396743212678078 3.0400445042994133 236.0 0.39999999999999997 19.0 - - - - - - - 0.0 0 0 PPOX protoporphyrinogen oxidase 1261 160 C20140707_OR006_04 C20140707_OR006_04 TB437569.[MT7]-DSSLEADHVISAIPASVLSELLPAEAAPLAR.4y9_1.heavy 822.447 / 895.5 2888.0 52.37952518463135 29 10 10 3 6 2.5713164377194797 38.89058481214812 0.07970046997070312 6 0.8396743212678078 3.0400445042994133 2888.0 11.901636803874093 0.0 - - - - - - - 199.125 5 8 PPOX protoporphyrinogen oxidase 1263 160 C20140707_OR006_04 C20140707_OR006_04 TB437569.[MT7]-DSSLEADHVISAIPASVLSELLPAEAAPLAR.4b5_1.heavy 822.447 / 676.327 589.0 52.37952518463135 29 10 10 3 6 2.5713164377194797 38.89058481214812 0.07970046997070312 6 0.8396743212678078 3.0400445042994133 589.0 0.0 3.0 - - - - - - - 0.0 1 0 PPOX protoporphyrinogen oxidase 1265 161 C20140707_OR006_04 C20140707_OR006_04 TB450285.[MT7]-VHLVGIDIFTGK[MT7].3b4_1.heavy 529.655 / 593.389 9324.0 40.63930130004883 44 14 10 10 10 3.5839332867739144 27.902305092853787 0.0 3 0.9470791030106884 5.34090240580215 9324.0 32.35699234210326 0.0 - - - - - - - 242.0 18 9 EIF5AL1;EIF5A;EIF5A2 eukaryotic translation initiation factor 5A-like 1;eukaryotic translation initiation factor 5A;eukaryotic translation initiation factor 5A2 1267 161 C20140707_OR006_04 C20140707_OR006_04 TB450285.[MT7]-VHLVGIDIFTGK[MT7].3b5_1.heavy 529.655 / 650.411 9687.0 40.63930130004883 44 14 10 10 10 3.5839332867739144 27.902305092853787 0.0 3 0.9470791030106884 5.34090240580215 9687.0 152.1099173553719 0.0 - - - - - - - 166.375 19 8 EIF5AL1;EIF5A;EIF5A2 eukaryotic translation initiation factor 5A-like 1;eukaryotic translation initiation factor 5A;eukaryotic translation initiation factor 5A2 1269 161 C20140707_OR006_04 C20140707_OR006_04 TB450285.[MT7]-VHLVGIDIFTGK[MT7].3y4_1.heavy 529.655 / 596.352 8476.0 40.63930130004883 44 14 10 10 10 3.5839332867739144 27.902305092853787 0.0 3 0.9470791030106884 5.34090240580215 8476.0 9.5445195815138 0.0 - - - - - - - 242.0 16 2 EIF5AL1;EIF5A;EIF5A2 eukaryotic translation initiation factor 5A-like 1;eukaryotic translation initiation factor 5A;eukaryotic translation initiation factor 5A2 1271 161 C20140707_OR006_04 C20140707_OR006_04 TB450285.[MT7]-VHLVGIDIFTGK[MT7].3b7_1.heavy 529.655 / 878.522 10535.0 40.63930130004883 44 14 10 10 10 3.5839332867739144 27.902305092853787 0.0 3 0.9470791030106884 5.34090240580215 10535.0 121.45723140495868 0.0 - - - - - - - 193.6 21 5 EIF5AL1;EIF5A;EIF5A2 eukaryotic translation initiation factor 5A-like 1;eukaryotic translation initiation factor 5A;eukaryotic translation initiation factor 5A2 1273 162 C20140707_OR006_04 C20140707_OR006_04 TB412442.[MT7]-GTNLFC[CAM]YRQPEDADTGEEPLLTIAVNK[MT7].3y6_1.heavy 1113.9 / 789.495 3199.0 41.219974517822266 39 16 10 3 10 3.6980353755112265 27.041385450828937 0.0699005126953125 3 0.9607241309616183 6.206798973060302 3199.0 25.284192439862544 0.0 - - - - - - - 202.8181818181818 6 11 RTKN rhotekin 1275 162 C20140707_OR006_04 C20140707_OR006_04 TB412442.[MT7]-GTNLFC[CAM]YRQPEDADTGEEPLLTIAVNK[MT7].3b4_1.heavy 1113.9 / 530.305 3781.0 41.219974517822266 39 16 10 3 10 3.6980353755112265 27.041385450828937 0.0699005126953125 3 0.9607241309616183 6.206798973060302 3781.0 12.99352920430519 0.0 - - - - - - - 183.22222222222223 7 9 RTKN rhotekin 1277 162 C20140707_OR006_04 C20140707_OR006_04 TB412442.[MT7]-GTNLFC[CAM]YRQPEDADTGEEPLLTIAVNK[MT7].3y4_1.heavy 1113.9 / 575.363 6495.0 41.219974517822266 39 16 10 3 10 3.6980353755112265 27.041385450828937 0.0699005126953125 3 0.9607241309616183 6.206798973060302 6495.0 24.77750630366091 0.0 - - - - - - - 194.0 12 9 RTKN rhotekin 1279 162 C20140707_OR006_04 C20140707_OR006_04 TB412442.[MT7]-GTNLFC[CAM]YRQPEDADTGEEPLLTIAVNK[MT7].3b8_1.heavy 1113.9 / 1156.57 582.0 41.219974517822266 39 16 10 3 10 3.6980353755112265 27.041385450828937 0.0699005126953125 3 0.9607241309616183 6.206798973060302 582.0 5.88 1.0 - - - - - - - 0.0 1 0 RTKN rhotekin 1281 163 C20140707_OR006_04 C20140707_OR006_04 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 279093.0 37.73320007324219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 279093.0 129.8622947227524 0.0 - - - - - - - 281.4 558 5 1283 163 C20140707_OR006_04 C20140707_OR006_04 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 572321.0 37.73320007324219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 572321.0 119.44424054060843 1.0 - - - - - - - 469.0 1340 1 1285 163 C20140707_OR006_04 C20140707_OR006_04 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 620859.0 37.73320007324219 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 620859.0 137.40350567480309 0.0 - - - - - - - 469.0 1241 1 1287 164 C20140707_OR006_04 C20140707_OR006_04 TB437467.[MT7]-TVVVLGGGISGLAASY[MT7]HLSR.4y8_1.heavy 562.078 / 1048.57 2194.0 37.336700439453125 43 15 10 10 8 6.29747508892154 15.879380003569857 0.0 4 0.9516187362826615 5.58800837136783 2194.0 31.634418604651156 0.0 - - - - - - - 193.5 4 6 PPOX protoporphyrinogen oxidase 1289 164 C20140707_OR006_04 C20140707_OR006_04 TB437467.[MT7]-TVVVLGGGISGLAASY[MT7]HLSR.4y9_1.heavy 562.078 / 1161.65 516.0 37.336700439453125 43 15 10 10 8 6.29747508892154 15.879380003569857 0.0 4 0.9516187362826615 5.58800837136783 516.0 6.0 1.0 - - - - - - - 0.0 1 0 PPOX protoporphyrinogen oxidase 1291 164 C20140707_OR006_04 C20140707_OR006_04 TB437467.[MT7]-TVVVLGGGISGLAASY[MT7]HLSR.4b4_1.heavy 562.078 / 543.362 15748.0 37.336700439453125 43 15 10 10 8 6.29747508892154 15.879380003569857 0.0 4 0.9516187362826615 5.58800837136783 15748.0 63.008781227252605 0.0 - - - - - - - 243.66666666666666 31 9 PPOX protoporphyrinogen oxidase 1293 164 C20140707_OR006_04 C20140707_OR006_04 TB437467.[MT7]-TVVVLGGGISGLAASY[MT7]HLSR.4y7_1.heavy 562.078 / 977.529 1549.0 37.336700439453125 43 15 10 10 8 6.29747508892154 15.879380003569857 0.0 4 0.9516187362826615 5.58800837136783 1549.0 10.646956083029021 2.0 - - - - - - - 157.66666666666666 9 9 PPOX protoporphyrinogen oxidase 1295 165 C20140707_OR006_04 C20140707_OR006_04 TB437561.[MT7]-TSNPYRVPANLENVGFEVQTAEDDLK[MT7].4b15_2.heavy 799.411 / 878.959 7491.0 42.41804885864258 40 16 10 6 8 4.0857782472504125 19.38418895432195 0.039398193359375 4 0.961152370845444 6.241141739666095 7491.0 45.7464017121116 0.0 - - - - - - - 215.54545454545453 14 11 C6 complement component 6 1297 165 C20140707_OR006_04 C20140707_OR006_04 TB437561.[MT7]-TSNPYRVPANLENVGFEVQTAEDDLK[MT7].4b12_2.heavy 799.411 / 743.892 7016.0 42.41804885864258 40 16 10 6 8 4.0857782472504125 19.38418895432195 0.039398193359375 4 0.961152370845444 6.241141739666095 7016.0 38.44509074701372 0.0 - - - - - - - 318.8181818181818 14 11 C6 complement component 6 1299 165 C20140707_OR006_04 C20140707_OR006_04 TB437561.[MT7]-TSNPYRVPANLENVGFEVQTAEDDLK[MT7].4b13_2.heavy 799.411 / 800.914 10714.0 42.41804885864258 40 16 10 6 8 4.0857782472504125 19.38418895432195 0.039398193359375 4 0.961152370845444 6.241141739666095 10714.0 53.57 1.0 - - - - - - - 152.0 23 10 C6 complement component 6 1301 165 C20140707_OR006_04 C20140707_OR006_04 TB437561.[MT7]-TSNPYRVPANLENVGFEVQTAEDDLK[MT7].4b10_2.heavy 799.411 / 622.829 4741.0 42.41804885864258 40 16 10 6 8 4.0857782472504125 19.38418895432195 0.039398193359375 4 0.961152370845444 6.241141739666095 4741.0 7.208410028562361 0.0 - - - - - - - 278.06666666666666 9 15 C6 complement component 6 1303 166 C20140707_OR006_04 C20140707_OR006_04 TB436944.[MT7]-FQLSGQK[MT7].2b3_1.heavy 548.324 / 533.32 7117.0 26.35540008544922 48 18 10 10 10 3.2003662338918373 31.24642390642711 0.0 3 0.9819130023539288 9.162676573145578 7117.0 8.994511292737904 0.0 - - - - - - - 749.0 14 7 PSG8;PSG3;PSG4;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1305 166 C20140707_OR006_04 C20140707_OR006_04 TB436944.[MT7]-FQLSGQK[MT7].2y4_1.heavy 548.324 / 563.327 14608.0 26.35540008544922 48 18 10 10 10 3.2003662338918373 31.24642390642711 0.0 3 0.9819130023539288 9.162676573145578 14608.0 29.67802142381462 0.0 - - - - - - - 360.8888888888889 29 9 PSG8;PSG3;PSG4;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1307 166 C20140707_OR006_04 C20140707_OR006_04 TB436944.[MT7]-FQLSGQK[MT7].2y5_1.heavy 548.324 / 676.411 10987.0 26.35540008544922 48 18 10 10 10 3.2003662338918373 31.24642390642711 0.0 3 0.9819130023539288 9.162676573145578 10987.0 19.231119916528186 0.0 - - - - - - - 249.8 21 10 PSG8;PSG3;PSG4;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1309 166 C20140707_OR006_04 C20140707_OR006_04 TB436944.[MT7]-FQLSGQK[MT7].2y6_1.heavy 548.324 / 804.47 6493.0 26.35540008544922 48 18 10 10 10 3.2003662338918373 31.24642390642711 0.0 3 0.9819130023539288 9.162676573145578 6493.0 13.806168421052632 0.0 - - - - - - - 291.5833333333333 12 12 PSG8;PSG3;PSG4;PSG6;PSG7;PSG11 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 11 1311 167 C20140707_OR006_04 C20140707_OR006_04 TB437070.[MT7]-NILAAPGILK[MT7].3b4_1.heavy 433.286 / 556.357 16692.0 37.22165107727051 41 16 10 5 10 2.2854102291264544 30.101131944719334 0.045299530029296875 3 0.9625579290880477 6.357962563120529 16692.0 252.41560975609755 0.0 - - - - - - - 123.0 33 6 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1313 167 C20140707_OR006_04 C20140707_OR006_04 TB437070.[MT7]-NILAAPGILK[MT7].3b5_1.heavy 433.286 / 627.395 16569.0 37.22165107727051 41 16 10 5 10 2.2854102291264544 30.101131944719334 0.045299530029296875 3 0.9625579290880477 6.357962563120529 16569.0 128.49428571428572 0.0 - - - - - - - 147.4 33 5 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1315 167 C20140707_OR006_04 C20140707_OR006_04 TB437070.[MT7]-NILAAPGILK[MT7].3y4_1.heavy 433.286 / 574.404 20374.0 37.22165107727051 41 16 10 5 10 2.2854102291264544 30.101131944719334 0.045299530029296875 3 0.9625579290880477 6.357962563120529 20374.0 314.72032520325206 0.0 - - - - - - - 153.5 40 4 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1317 167 C20140707_OR006_04 C20140707_OR006_04 TB437070.[MT7]-NILAAPGILK[MT7].3b3_1.heavy 433.286 / 485.32 24302.0 37.22165107727051 41 16 10 5 10 2.2854102291264544 30.101131944719334 0.045299530029296875 3 0.9625579290880477 6.357962563120529 24302.0 96.46557637474541 0.0 - - - - - - - 280.57142857142856 48 7 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1319 168 C20140707_OR006_04 C20140707_OR006_04 TB436942.[MT7]-SLLVC[CAM]NSR.2y4_1.heavy 546.801 / 536.225 8458.0 26.189699172973633 48 18 10 10 10 13.552047262832154 7.378958917466294 0.0 3 0.9818596932434233 9.14916252383079 8458.0 31.65469306930693 0.0 - - - - - - - 315.625 16 8 RTKN rhotekin 1321 168 C20140707_OR006_04 C20140707_OR006_04 TB436942.[MT7]-SLLVC[CAM]NSR.2y5_1.heavy 546.801 / 635.293 9215.0 26.189699172973633 48 18 10 10 10 13.552047262832154 7.378958917466294 0.0 3 0.9818596932434233 9.14916252383079 9215.0 11.99803157528106 0.0 - - - - - - - 210.16666666666666 18 6 RTKN rhotekin 1323 168 C20140707_OR006_04 C20140707_OR006_04 TB436942.[MT7]-SLLVC[CAM]NSR.2y6_1.heavy 546.801 / 748.377 9594.0 26.189699172973633 48 18 10 10 10 13.552047262832154 7.378958917466294 0.0 3 0.9818596932434233 9.14916252383079 9594.0 25.12361284608931 0.0 - - - - - - - 252.33333333333334 19 3 RTKN rhotekin 1325 168 C20140707_OR006_04 C20140707_OR006_04 TB436942.[MT7]-SLLVC[CAM]NSR.2y7_1.heavy 546.801 / 861.461 8836.0 26.189699172973633 48 18 10 10 10 13.552047262832154 7.378958917466294 0.0 3 0.9818596932434233 9.14916252383079 8836.0 44.49800157158573 0.0 - - - - - - - 176.4 17 5 RTKN rhotekin 1327 169 C20140707_OR006_04 C20140707_OR006_04 TB450007.[MT7]-IPLMWK[MT7].2y4_1.heavy 538.332 / 721.419 5482.0 40.475725173950195 44 18 10 6 10 7.173652408395235 13.93990038923147 0.03749847412109375 3 0.9844236543395362 9.875616989471327 5482.0 56.73568791208791 1.0 - - - - - - - 280.0 10 10 RTKN2;RTKN rhotekin 2;rhotekin 1329 169 C20140707_OR006_04 C20140707_OR006_04 TB450007.[MT7]-IPLMWK[MT7].2y5_1.heavy 538.332 / 818.471 49103.0 40.475725173950195 44 18 10 6 10 7.173652408395235 13.93990038923147 0.03749847412109375 3 0.9844236543395362 9.875616989471327 49103.0 490.19422720035135 0.0 - - - - - - - 298.22222222222223 98 9 RTKN2;RTKN rhotekin 2;rhotekin 1331 169 C20140707_OR006_04 C20140707_OR006_04 TB450007.[MT7]-IPLMWK[MT7].2b4_1.heavy 538.332 / 599.371 816.0 40.475725173950195 44 18 10 6 10 7.173652408395235 13.93990038923147 0.03749847412109375 3 0.9844236543395362 9.875616989471327 816.0 4.882051282051282 9.0 - - - - - - - 210.1 6 10 RTKN2;RTKN rhotekin 2;rhotekin 1333 169 C20140707_OR006_04 C20140707_OR006_04 TB450007.[MT7]-IPLMWK[MT7].2y3_1.heavy 538.332 / 608.335 15279.0 40.475725173950195 44 18 10 6 10 7.173652408395235 13.93990038923147 0.03749847412109375 3 0.9844236543395362 9.875616989471327 15279.0 153.52358732462505 0.0 - - - - - - - 248.125 30 8 RTKN2;RTKN rhotekin 2;rhotekin 1335 170 C20140707_OR006_04 C20140707_OR006_04 TB437062.[MT7]-K[MT7]PPQALAK[MT7].2y4_1.heavy 642.922 / 546.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - RTKN rhotekin 1337 170 C20140707_OR006_04 C20140707_OR006_04 TB437062.[MT7]-K[MT7]PPQALAK[MT7].2y5_1.heavy 642.922 / 674.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - RTKN rhotekin 1339 170 C20140707_OR006_04 C20140707_OR006_04 TB437062.[MT7]-K[MT7]PPQALAK[MT7].2y6_1.heavy 642.922 / 771.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - RTKN rhotekin 1341 170 C20140707_OR006_04 C20140707_OR006_04 TB437062.[MT7]-K[MT7]PPQALAK[MT7].2y7_1.heavy 642.922 / 868.537 N/A N/A - - - - - - - - - 0.0 - - - - - - - RTKN rhotekin 1343 171 C20140707_OR006_04 C20140707_OR006_04 TB436940.[MT7]-DTEYFK[MT7].2y4_1.heavy 545.787 / 730.389 3721.0 25.92919921875 38 20 2 10 6 11.398405480261104 8.773156927359043 0.0 5 0.9967611400610124 21.679486831399206 3721.0 7.802096774193549 0.0 - - - - - - - 238.46153846153845 7 13 RTKN rhotekin 1345 171 C20140707_OR006_04 C20140707_OR006_04 TB436940.[MT7]-DTEYFK[MT7].2y5_1.heavy 545.787 / 831.437 8186.0 25.92919921875 38 20 2 10 6 11.398405480261104 8.773156927359043 0.0 5 0.9967611400610124 21.679486831399206 8186.0 73.93806451612903 1.0 - - - - - - - 227.33333333333334 16 6 RTKN rhotekin 1347 171 C20140707_OR006_04 C20140707_OR006_04 TB436940.[MT7]-DTEYFK[MT7].2b4_1.heavy 545.787 / 653.29 4217.0 25.92919921875 38 20 2 10 6 11.398405480261104 8.773156927359043 0.0 5 0.9967611400610124 21.679486831399206 4217.0 16.030201210977765 1.0 - - - - - - - 248.0 13 9 RTKN rhotekin 1349 171 C20140707_OR006_04 C20140707_OR006_04 TB436940.[MT7]-DTEYFK[MT7].2y3_1.heavy 545.787 / 601.347 9923.0 25.92919921875 38 20 2 10 6 11.398405480261104 8.773156927359043 0.0 5 0.9967611400610124 21.679486831399206 9923.0 103.49795698924731 1.0 - - - - - - - 330.6666666666667 42 12 RTKN rhotekin 1351 172 C20140707_OR006_04 C20140707_OR006_04 TB450387.[MT7]-SVLYFILLNALINK[MT7].3y3_1.heavy 637.064 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 1353 172 C20140707_OR006_04 C20140707_OR006_04 TB450387.[MT7]-SVLYFILLNALINK[MT7].3b6_1.heavy 637.064 / 867.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 1355 172 C20140707_OR006_04 C20140707_OR006_04 TB450387.[MT7]-SVLYFILLNALINK[MT7].3b4_1.heavy 637.064 / 607.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 1357 172 C20140707_OR006_04 C20140707_OR006_04 TB450387.[MT7]-SVLYFILLNALINK[MT7].3b5_1.heavy 637.064 / 754.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 1359 173 C20140707_OR006_04 C20140707_OR006_04 TB412002.[MT7]-TNLK[MT7]PGSPSDLENATPK[MT7].3b4_1.heavy 734.409 / 745.481 3078.0 25.788599491119385 38 17 8 5 8 3.2310829233987644 30.949375912274753 0.04360008239746094 4 0.9742104100193508 7.668357472473218 3078.0 8.673495670781241 0.0 - - - - - - - 283.0 6 10 SYT4 synaptotagmin IV 1361 173 C20140707_OR006_04 C20140707_OR006_04 TB412002.[MT7]-TNLK[MT7]PGSPSDLENATPK[MT7].3b10_2.heavy 734.409 / 643.353 6033.0 25.788599491119385 38 17 8 5 8 3.2310829233987644 30.949375912274753 0.04360008239746094 4 0.9742104100193508 7.668357472473218 6033.0 32.208699186991865 1.0 - - - - - - - 287.0 16 6 SYT4 synaptotagmin IV 1363 173 C20140707_OR006_04 C20140707_OR006_04 TB412002.[MT7]-TNLK[MT7]PGSPSDLENATPK[MT7].3y5_1.heavy 734.409 / 674.395 2216.0 25.788599491119385 38 17 8 5 8 3.2310829233987644 30.949375912274753 0.04360008239746094 4 0.9742104100193508 7.668357472473218 2216.0 9.157452941241184 0.0 - - - - - - - 258.3 4 10 SYT4 synaptotagmin IV 1365 173 C20140707_OR006_04 C20140707_OR006_04 TB412002.[MT7]-TNLK[MT7]PGSPSDLENATPK[MT7].3b12_2.heavy 734.409 / 764.417 985.0 25.788599491119385 38 17 8 5 8 3.2310829233987644 30.949375912274753 0.04360008239746094 4 0.9742104100193508 7.668357472473218 985.0 11.203373983739837 0.0 - - - - - - - 0.0 1 0 SYT4 synaptotagmin IV 1367 174 C20140707_OR006_04 C20140707_OR006_04 TB450389.[MT7]-STVGTLYAVGGMDNNK[MT7].3y7_1.heavy 638.999 / 879.411 23180.0 32.915300369262695 41 16 10 5 10 2.149454957507162 31.033837879250953 0.044597625732421875 3 0.9672416058753636 6.799990671806786 23180.0 140.5824074074074 0.0 - - - - - - - 214.2 46 10 KLHL1 kelch-like 1 (Drosophila) 1369 174 C20140707_OR006_04 C20140707_OR006_04 TB450389.[MT7]-STVGTLYAVGGMDNNK[MT7].3b6_1.heavy 638.999 / 703.411 20282.0 32.915300369262695 41 16 10 5 10 2.149454957507162 31.033837879250953 0.044597625732421875 3 0.9672416058753636 6.799990671806786 20282.0 20.800443207586063 0.0 - - - - - - - 1212.75 40 8 KLHL1 kelch-like 1 (Drosophila) 1371 174 C20140707_OR006_04 C20140707_OR006_04 TB450389.[MT7]-STVGTLYAVGGMDNNK[MT7].3b5_1.heavy 638.999 / 590.327 13983.0 32.915300369262695 41 16 10 5 10 2.149454957507162 31.033837879250953 0.044597625732421875 3 0.9672416058753636 6.799990671806786 13983.0 19.231669372294373 0.0 - - - - - - - 204.75 27 8 KLHL1 kelch-like 1 (Drosophila) 1373 174 C20140707_OR006_04 C20140707_OR006_04 TB450389.[MT7]-STVGTLYAVGGMDNNK[MT7].3b7_1.heavy 638.999 / 866.474 7811.0 32.915300369262695 41 16 10 5 10 2.149454957507162 31.033837879250953 0.044597625732421875 3 0.9672416058753636 6.799990671806786 7811.0 27.12152777777778 0.0 - - - - - - - 252.0 15 9 KLHL1 kelch-like 1 (Drosophila) 1375 175 C20140707_OR006_04 C20140707_OR006_04 TB450388.[MT7]-AMLDELAMETLQEK[MT7].3b6_1.heavy 637.333 / 817.425 67876.0 44.097599029541016 48 18 10 10 10 2.389396692969115 33.154733934880774 0.0 3 0.9819174580933978 9.163808821687306 67876.0 445.49695367054244 0.0 - - - - - - - 198.25 135 8 GRIPAP1 GRIP1 associated protein 1 1377 175 C20140707_OR006_04 C20140707_OR006_04 TB450388.[MT7]-AMLDELAMETLQEK[MT7].3b4_1.heavy 637.333 / 575.298 81339.0 44.097599029541016 48 18 10 10 10 2.389396692969115 33.154733934880774 0.0 3 0.9819174580933978 9.163808821687306 81339.0 204.97108713207476 0.0 - - - - - - - 641.0 162 7 GRIPAP1 GRIP1 associated protein 1 1379 175 C20140707_OR006_04 C20140707_OR006_04 TB450388.[MT7]-AMLDELAMETLQEK[MT7].3b5_1.heavy 637.333 / 704.341 138557.0 44.097599029541016 48 18 10 10 10 2.389396692969115 33.154733934880774 0.0 3 0.9819174580933978 9.163808821687306 138557.0 289.896177509353 0.0 - - - - - - - 253.42857142857142 277 7 GRIPAP1 GRIP1 associated protein 1 1381 175 C20140707_OR006_04 C20140707_OR006_04 TB450388.[MT7]-AMLDELAMETLQEK[MT7].3b7_1.heavy 637.333 / 888.462 95083.0 44.097599029541016 48 18 10 10 10 2.389396692969115 33.154733934880774 0.0 3 0.9819174580933978 9.163808821687306 95083.0 493.77624480095074 0.0 - - - - - - - 233.5 190 6 GRIPAP1 GRIP1 associated protein 1 1383 176 C20140707_OR006_04 C20140707_OR006_04 TB412447.[MT7]-LLLESQLILATAEPLC[CAM]LDPSIAVTC[CAM]TANRLLYNK[MT7].4b8_1.heavy 1026.32 / 1054.66 1151.0 54.25155067443848 44 18 10 6 10 3.4350652111103672 24.68889370933853 0.030101776123046875 3 0.9814417776110781 9.04524304930535 1151.0 2.893054054054054 2.0 - - - - - - - 180.0 2 21 FAM48A family with sequence similarity 48, member A 1385 176 C20140707_OR006_04 C20140707_OR006_04 TB412447.[MT7]-LLLESQLILATAEPLC[CAM]LDPSIAVTC[CAM]TANRLLYNK[MT7].4b7_1.heavy 1026.32 / 941.579 1973.0 54.25155067443848 44 18 10 6 10 3.4350652111103672 24.68889370933853 0.030101776123046875 3 0.9814417776110781 9.04524304930535 1973.0 23.5470518588681 0.0 - - - - - - - 175.83333333333334 3 18 FAM48A family with sequence similarity 48, member A 1387 176 C20140707_OR006_04 C20140707_OR006_04 TB412447.[MT7]-LLLESQLILATAEPLC[CAM]LDPSIAVTC[CAM]TANRLLYNK[MT7].4b4_1.heavy 1026.32 / 613.404 863.0 54.25155067443848 44 18 10 6 10 3.4350652111103672 24.68889370933853 0.030101776123046875 3 0.9814417776110781 9.04524304930535 863.0 10.524390243902438 2.0 - - - - - - - 128.73333333333332 2 15 FAM48A family with sequence similarity 48, member A 1389 176 C20140707_OR006_04 C20140707_OR006_04 TB412447.[MT7]-LLLESQLILATAEPLC[CAM]LDPSIAVTC[CAM]TANRLLYNK[MT7].4b6_1.heavy 1026.32 / 828.495 1480.0 54.25155067443848 44 18 10 6 10 3.4350652111103672 24.68889370933853 0.030101776123046875 3 0.9814417776110781 9.04524304930535 1480.0 11.069918699186992 0.0 - - - - - - - 170.69230769230768 2 13 FAM48A family with sequence similarity 48, member A 1391 177 C20140707_OR006_04 C20140707_OR006_04 TB411984.[MT7]-YIQAEPPTNK[MT7].3y3_1.heavy 483.604 / 506.306 2934.0 25.457700729370117 39 17 2 10 10 2.0544172554691396 34.543066261488605 0.0 3 0.9762260308740104 7.988170741385696 2934.0 3.9444367800522033 1.0 - - - - - - - 209.57142857142858 18 7 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1393 177 C20140707_OR006_04 C20140707_OR006_04 TB411984.[MT7]-YIQAEPPTNK[MT7].3b4_1.heavy 483.604 / 620.352 3668.0 25.457700729370117 39 17 2 10 10 2.0544172554691396 34.543066261488605 0.0 3 0.9762260308740104 7.988170741385696 3668.0 14.41665907099036 1.0 - - - - - - - 209.85714285714286 7 7 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1395 177 C20140707_OR006_04 C20140707_OR006_04 TB411984.[MT7]-YIQAEPPTNK[MT7].3b3_1.heavy 483.604 / 549.315 4279.0 25.457700729370117 39 17 2 10 10 2.0544172554691396 34.543066261488605 0.0 3 0.9762260308740104 7.988170741385696 4279.0 9.940831620116217 0.0 - - - - - - - 326.0 8 6 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1397 177 C20140707_OR006_04 C20140707_OR006_04 TB411984.[MT7]-YIQAEPPTNK[MT7].3y4_1.heavy 483.604 / 603.358 3179.0 25.457700729370117 39 17 2 10 10 2.0544172554691396 34.543066261488605 0.0 3 0.9762260308740104 7.988170741385696 3179.0 0.8400218102508179 1.0 - - - - - - - 255.72727272727272 6 11 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1399 178 C20140707_OR006_04 C20140707_OR006_04 TB450527.[MT7]-AMEGLGMDEGDGEGNILPIMQSIMQNLLSK[MT7].4b8_1.heavy 870.684 / 949.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - PEX19 peroxisomal biogenesis factor 19 1401 178 C20140707_OR006_04 C20140707_OR006_04 TB450527.[MT7]-AMEGLGMDEGDGEGNILPIMQSIMQNLLSK[MT7].4b4_1.heavy 870.684 / 533.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - PEX19 peroxisomal biogenesis factor 19 1403 178 C20140707_OR006_04 C20140707_OR006_04 TB450527.[MT7]-AMEGLGMDEGDGEGNILPIMQSIMQNLLSK[MT7].4b5_1.heavy 870.684 / 646.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - PEX19 peroxisomal biogenesis factor 19 1405 178 C20140707_OR006_04 C20140707_OR006_04 TB450527.[MT7]-AMEGLGMDEGDGEGNILPIMQSIMQNLLSK[MT7].4b6_1.heavy 870.684 / 703.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - PEX19 peroxisomal biogenesis factor 19 1407 179 C20140707_OR006_04 C20140707_OR006_04 TB437454.[MT7]-GLPAMDEQSMTSDPYIK[MT7].3b6_1.heavy 724.358 / 729.372 9309.0 35.90250015258789 47 17 10 10 10 4.923802468643364 20.309506857116588 0.0 3 0.9726840823865289 7.450079175478388 9309.0 16.091522972725606 0.0 - - - - - - - 210.0 18 9 SYT4 synaptotagmin IV 1409 179 C20140707_OR006_04 C20140707_OR006_04 TB437454.[MT7]-GLPAMDEQSMTSDPYIK[MT7].3b5_1.heavy 724.358 / 614.345 3912.0 35.90250015258789 47 17 10 10 10 4.923802468643364 20.309506857116588 0.0 3 0.9726840823865289 7.450079175478388 3912.0 13.564444444444444 2.0 - - - - - - - 233.1818181818182 7 11 SYT4 synaptotagmin IV 1411 179 C20140707_OR006_04 C20140707_OR006_04 TB437454.[MT7]-GLPAMDEQSMTSDPYIK[MT7].3y4_1.heavy 724.358 / 664.415 26442.0 35.90250015258789 47 17 10 10 10 4.923802468643364 20.309506857116588 0.0 3 0.9726840823865289 7.450079175478388 26442.0 78.54822290894107 0.0 - - - - - - - 330.0 52 9 SYT4 synaptotagmin IV 1413 179 C20140707_OR006_04 C20140707_OR006_04 TB437454.[MT7]-GLPAMDEQSMTSDPYIK[MT7].3b7_1.heavy 724.358 / 858.415 4182.0 35.90250015258789 47 17 10 10 10 4.923802468643364 20.309506857116588 0.0 3 0.9726840823865289 7.450079175478388 4182.0 43.83355555555555 1.0 - - - - - - - 256.5 8 10 SYT4 synaptotagmin IV 1415 180 C20140707_OR006_04 C20140707_OR006_04 TB412313.[MT7]-LGTLFFSLEYNFERK[MT7].4y9_2.heavy 538.797 / 665.35 1811.0 49.61107540130615 34 11 10 3 10 1.3793522792534703 51.095528396554684 0.0792999267578125 3 0.8679437248663182 3.358021421421936 1811.0 -0.5 1.0 - - - - - - - 111.6 3 5 SYT4 synaptotagmin IV 1417 180 C20140707_OR006_04 C20140707_OR006_04 TB412313.[MT7]-LGTLFFSLEYNFERK[MT7].4b4_1.heavy 538.797 / 529.347 1115.0 49.61107540130615 34 11 10 3 10 1.3793522792534703 51.095528396554684 0.0792999267578125 3 0.8679437248663182 3.358021421421936 1115.0 7.540287769784173 0.0 - - - - - - - 188.85714285714286 2 7 SYT4 synaptotagmin IV 1419 180 C20140707_OR006_04 C20140707_OR006_04 TB412313.[MT7]-LGTLFFSLEYNFERK[MT7].4b5_1.heavy 538.797 / 676.415 2090.0 49.61107540130615 34 11 10 3 10 1.3793522792534703 51.095528396554684 0.0792999267578125 3 0.8679437248663182 3.358021421421936 2090.0 58.96785714285714 0.0 - - - - - - - 97.8 4 5 SYT4 synaptotagmin IV 1421 180 C20140707_OR006_04 C20140707_OR006_04 TB412313.[MT7]-LGTLFFSLEYNFERK[MT7].4y7_2.heavy 538.797 / 565.292 3065.0 49.61107540130615 34 11 10 3 10 1.3793522792534703 51.095528396554684 0.0792999267578125 3 0.8679437248663182 3.358021421421936 3065.0 52.688809523809525 0.0 - - - - - - - 174.1 6 10 SYT4 synaptotagmin IV 1423 181 C20140707_OR006_04 C20140707_OR006_04 TB436911.[MT7]-EAQVLGK[MT7].2y4_1.heavy 516.818 / 560.389 9839.0 23.03070068359375 44 14 10 10 10 1.3530176774024434 52.4040900423624 0.0 3 0.9384540611178886 4.948911406454477 9839.0 75.6185152838428 0.0 - - - - - - - 190.55555555555554 19 9 RTKN rhotekin 1425 181 C20140707_OR006_04 C20140707_OR006_04 TB436911.[MT7]-EAQVLGK[MT7].2y5_1.heavy 516.818 / 688.447 4119.0 23.03070068359375 44 14 10 10 10 1.3530176774024434 52.4040900423624 0.0 3 0.9384540611178886 4.948911406454477 4119.0 41.887364740522635 0.0 - - - - - - - 171.25 8 4 RTKN rhotekin 1427 181 C20140707_OR006_04 C20140707_OR006_04 TB436911.[MT7]-EAQVLGK[MT7].2b4_1.heavy 516.818 / 572.316 11784.0 23.03070068359375 44 14 10 10 10 1.3530176774024434 52.4040900423624 0.0 3 0.9384540611178886 4.948911406454477 11784.0 98.38868122270742 0.0 - - - - - - - 254.22222222222223 23 9 RTKN rhotekin 1429 181 C20140707_OR006_04 C20140707_OR006_04 TB436911.[MT7]-EAQVLGK[MT7].2y6_1.heavy 516.818 / 759.484 12356.0 23.03070068359375 44 14 10 10 10 1.3530176774024434 52.4040900423624 0.0 3 0.9384540611178886 4.948911406454477 12356.0 130.70146590967215 0.0 - - - - - - - 197.45454545454547 24 11 RTKN rhotekin 1431 182 C20140707_OR006_04 C20140707_OR006_04 TB412314.[MT7]-ENPAVIDFELAPIVDLVR.2b4_1.heavy 1077.6 / 556.285 3213.0 52.96662425994873 40 17 10 3 10 3.625034481852318 27.585944492561644 0.07709884643554688 3 0.9721939295871663 7.383819227964399 3213.0 51.00139205955335 0.0 - - - - - - - 177.71428571428572 6 7 C6 complement component 6 1433 182 C20140707_OR006_04 C20140707_OR006_04 TB412314.[MT7]-ENPAVIDFELAPIVDLVR.2y10_1.heavy 1077.6 / 1124.67 726.0 52.96662425994873 40 17 10 3 10 3.625034481852318 27.585944492561644 0.07709884643554688 3 0.9721939295871663 7.383819227964399 726.0 2.5733074232413524 0.0 - - - - - - - 0.0 1 0 C6 complement component 6 1435 182 C20140707_OR006_04 C20140707_OR006_04 TB412314.[MT7]-ENPAVIDFELAPIVDLVR.2b5_1.heavy 1077.6 / 655.353 2954.0 52.96662425994873 40 17 10 3 10 3.625034481852318 27.585944492561644 0.07709884643554688 3 0.9721939295871663 7.383819227964399 2954.0 22.134908666925767 0.0 - - - - - - - 112.41666666666667 5 12 C6 complement component 6 1437 182 C20140707_OR006_04 C20140707_OR006_04 TB412314.[MT7]-ENPAVIDFELAPIVDLVR.2y7_1.heavy 1077.6 / 811.504 1399.0 52.96662425994873 40 17 10 3 10 3.625034481852318 27.585944492561644 0.07709884643554688 3 0.9721939295871663 7.383819227964399 1399.0 26.096730769230767 0.0 - - - - - - - 109.0 2 10 C6 complement component 6 1439 183 C20140707_OR006_04 C20140707_OR006_04 TB437458.[MT7]-YLEDLQDEFDYRYK[MT7].3b4_1.heavy 729.028 / 665.326 9631.0 40.9026985168457 46 16 10 10 10 3.291352823103107 30.382643664959446 0.0 3 0.9692796665408653 7.023139352714755 9631.0 31.5981552211443 0.0 - - - - - - - 211.91666666666666 19 12 STAT4 signal transducer and activator of transcription 4 1441 183 C20140707_OR006_04 C20140707_OR006_04 TB437458.[MT7]-YLEDLQDEFDYRYK[MT7].3b3_1.heavy 729.028 / 550.299 2540.0 40.9026985168457 46 16 10 10 10 3.291352823103107 30.382643664959446 0.0 3 0.9692796665408653 7.023139352714755 2540.0 22.404716981132076 0.0 - - - - - - - 244.3846153846154 5 13 STAT4 signal transducer and activator of transcription 4 1443 183 C20140707_OR006_04 C20140707_OR006_04 TB437458.[MT7]-YLEDLQDEFDYRYK[MT7].3y4_1.heavy 729.028 / 773.443 5715.0 40.9026985168457 46 16 10 10 10 3.291352823103107 30.382643664959446 0.0 3 0.9692796665408653 7.023139352714755 5715.0 68.1127358490566 0.0 - - - - - - - 211.85714285714286 11 14 STAT4 signal transducer and activator of transcription 4 1445 183 C20140707_OR006_04 C20140707_OR006_04 TB437458.[MT7]-YLEDLQDEFDYRYK[MT7].3b7_1.heavy 729.028 / 1021.5 3387.0 40.9026985168457 46 16 10 10 10 3.291352823103107 30.382643664959446 0.0 3 0.9692796665408653 7.023139352714755 3387.0 14.57290780141844 0.0 - - - - - - - 275.2 6 15 STAT4 signal transducer and activator of transcription 4 1447 184 C20140707_OR006_04 C20140707_OR006_04 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 155257.0 40.48509979248047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 155257.0 786.1169591865482 0.0 - - - - - - - 281.5 310 12 1449 184 C20140707_OR006_04 C20140707_OR006_04 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 238405.0 40.48509979248047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 238405.0 559.0737018425461 0.0 - - - - - - - 825.6 476 10 1451 184 C20140707_OR006_04 C20140707_OR006_04 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 309419.0 40.48509979248047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 309419.0 645.8577916367234 0.0 - - - - - - - 741.5454545454545 618 11 1453 185 C20140707_OR006_04 C20140707_OR006_04 TB450521.[MT7]-M[OXI]TQIIHETDLLMNTMLIEELQDWK[MT7].4y5_1.heavy 813.167 / 833.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1455 185 C20140707_OR006_04 C20140707_OR006_04 TB450521.[MT7]-M[OXI]TQIIHETDLLMNTMLIEELQDWK[MT7].4b4_1.heavy 813.167 / 634.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1457 185 C20140707_OR006_04 C20140707_OR006_04 TB450521.[MT7]-M[OXI]TQIIHETDLLMNTMLIEELQDWK[MT7].4b5_1.heavy 813.167 / 747.419 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1459 185 C20140707_OR006_04 C20140707_OR006_04 TB450521.[MT7]-M[OXI]TQIIHETDLLMNTMLIEELQDWK[MT7].4b9_2.heavy 813.167 / 615.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1461 186 C20140707_OR006_04 C20140707_OR006_04 TB450399.[MT7]-YLC[CAM]IPAADSPSQNLTR.2b3_1.heavy 975.497 / 581.287 15612.0 35.67940139770508 37 7 10 10 10 0.412374634950657 118.58345227471452 0.0 3 0.721807618335655 2.283309536227253 15612.0 131.4701909851887 0.0 - - - - - - - 229.5 31 4 DUSP22 dual specificity phosphatase 22 1463 186 C20140707_OR006_04 C20140707_OR006_04 TB450399.[MT7]-YLC[CAM]IPAADSPSQNLTR.2y8_1.heavy 975.497 / 902.469 4854.0 35.67940139770508 37 7 10 10 10 0.412374634950657 118.58345227471452 0.0 3 0.721807618335655 2.283309536227253 4854.0 16.62125808699114 0.0 - - - - - - - 299.85714285714283 9 7 DUSP22 dual specificity phosphatase 22 1465 186 C20140707_OR006_04 C20140707_OR006_04 TB450399.[MT7]-YLC[CAM]IPAADSPSQNLTR.2b4_1.heavy 975.497 / 694.371 12069.0 35.67940139770508 37 7 10 10 10 0.412374634950657 118.58345227471452 0.0 3 0.721807618335655 2.283309536227253 12069.0 50.19948985291379 0.0 - - - - - - - 229.25 24 4 DUSP22 dual specificity phosphatase 22 1467 186 C20140707_OR006_04 C20140707_OR006_04 TB450399.[MT7]-YLC[CAM]IPAADSPSQNLTR.2y11_1.heavy 975.497 / 1159.57 1050.0 35.67940139770508 37 7 10 10 10 0.412374634950657 118.58345227471452 0.0 3 0.721807618335655 2.283309536227253 1050.0 9.985924361607315 1.0 - - - - - - - 262.3636363636364 2 11 DUSP22 dual specificity phosphatase 22 1469 187 C20140707_OR006_04 C20140707_OR006_04 TB450398.[MT7]-SYPVTLNVLYGPDLPR.3y7_1.heavy 650.027 / 817.42 23521.0 43.09629821777344 44 14 10 10 10 1.8430396396404554 42.99272116217301 0.0 3 0.9329081784081031 4.7377158833179305 23521.0 133.2417948371173 0.0 - - - - - - - 267.9 47 10 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 1471 187 C20140707_OR006_04 C20140707_OR006_04 TB450398.[MT7]-SYPVTLNVLYGPDLPR.3y6_1.heavy 650.027 / 654.357 37217.0 43.09629821777344 44 14 10 10 10 1.8430396396404554 42.99272116217301 0.0 3 0.9329081784081031 4.7377158833179305 37217.0 228.73450970663816 0.0 - - - - - - - 190.0 74 12 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 1473 187 C20140707_OR006_04 C20140707_OR006_04 TB450398.[MT7]-SYPVTLNVLYGPDLPR.3b4_1.heavy 650.027 / 591.326 15482.0 43.09629821777344 44 14 10 10 10 1.8430396396404554 42.99272116217301 0.0 3 0.9329081784081031 4.7377158833179305 15482.0 46.81028235294118 0.0 - - - - - - - 244.15384615384616 30 13 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 1475 187 C20140707_OR006_04 C20140707_OR006_04 TB450398.[MT7]-SYPVTLNVLYGPDLPR.3b7_1.heavy 650.027 / 919.5 15979.0 43.09629821777344 44 14 10 10 10 1.8430396396404554 42.99272116217301 0.0 3 0.9329081784081031 4.7377158833179305 15979.0 88.96928529480856 0.0 - - - - - - - 160.0 31 13 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 1477 188 C20140707_OR006_04 C20140707_OR006_04 TB411733.[MT7]-RLQFGVAVIDDK[MT7].3y3_1.heavy 550.326 / 521.269 12524.0 34.9635009765625 44 14 10 10 10 2.0256406972557004 43.03023712127212 0.0 3 0.9324540502583902 4.721579380902784 12524.0 38.03861081654295 0.0 - - - - - - - 323.2 25 5 KLHL1 kelch-like 1 (Drosophila) 1479 188 C20140707_OR006_04 C20140707_OR006_04 TB411733.[MT7]-RLQFGVAVIDDK[MT7].3b5_1.heavy 550.326 / 746.443 5387.0 34.9635009765625 44 14 10 10 10 2.0256406972557004 43.03023712127212 0.0 3 0.9324540502583902 4.721579380902784 5387.0 19.805996282527882 1.0 - - - - - - - 242.4 10 5 KLHL1 kelch-like 1 (Drosophila) 1481 188 C20140707_OR006_04 C20140707_OR006_04 TB411733.[MT7]-RLQFGVAVIDDK[MT7].3y4_1.heavy 550.326 / 634.353 7541.0 34.9635009765625 44 14 10 10 10 2.0256406972557004 43.03023712127212 0.0 3 0.9324540502583902 4.721579380902784 7541.0 13.859683559409282 0.0 - - - - - - - 168.5 15 4 KLHL1 kelch-like 1 (Drosophila) 1483 188 C20140707_OR006_04 C20140707_OR006_04 TB411733.[MT7]-RLQFGVAVIDDK[MT7].3b7_1.heavy 550.326 / 916.549 4040.0 34.9635009765625 44 14 10 10 10 2.0256406972557004 43.03023712127212 0.0 3 0.9324540502583902 4.721579380902784 4040.0 43.59395291201983 0.0 - - - - - - - 224.5 8 6 KLHL1 kelch-like 1 (Drosophila) 1485 189 C20140707_OR006_04 C20140707_OR006_04 TB437390.[MT7]-SYPVTLNVLYGPDLPR.2y8_1.heavy 974.537 / 930.504 4067.0 43.09607410430908 40 17 10 3 10 2.479747924710153 27.588880328691275 0.07410049438476562 3 0.9777718039016674 8.262329226859757 4067.0 6.72 1.0 - - - - - - - 232.4 8 15 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 1487 189 C20140707_OR006_04 C20140707_OR006_04 TB437390.[MT7]-SYPVTLNVLYGPDLPR.2b4_1.heavy 974.537 / 591.326 6142.0 43.09607410430908 40 17 10 3 10 2.479747924710153 27.588880328691275 0.07410049438476562 3 0.9777718039016674 8.262329226859757 6142.0 23.186666666666667 0.0 - - - - - - - 276.6666666666667 12 9 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 1489 189 C20140707_OR006_04 C20140707_OR006_04 TB437390.[MT7]-SYPVTLNVLYGPDLPR.2y10_1.heavy 974.537 / 1143.62 4980.0 43.09607410430908 40 17 10 3 10 2.479747924710153 27.588880328691275 0.07410049438476562 3 0.9777718039016674 8.262329226859757 4980.0 49.885714285714286 0.0 - - - - - - - 181.0909090909091 9 11 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 1491 189 C20140707_OR006_04 C20140707_OR006_04 TB437390.[MT7]-SYPVTLNVLYGPDLPR.2y7_1.heavy 974.537 / 817.42 4399.0 43.09607410430908 40 17 10 3 10 2.479747924710153 27.588880328691275 0.07410049438476562 3 0.9777718039016674 8.262329226859757 4399.0 23.055 0.0 - - - - - - - 235.16666666666666 8 12 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 1493 190 C20140707_OR006_04 C20140707_OR006_04 TB437392.[MT7]-QMALSLEDTELQRK[MT7].2y8_1.heavy 975.532 / 1162.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - RTKN rhotekin 1495 190 C20140707_OR006_04 C20140707_OR006_04 TB437392.[MT7]-QMALSLEDTELQRK[MT7].2b4_1.heavy 975.532 / 588.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - RTKN rhotekin 1497 190 C20140707_OR006_04 C20140707_OR006_04 TB437392.[MT7]-QMALSLEDTELQRK[MT7].2y6_1.heavy 975.532 / 918.549 N/A N/A - - - - - - - - - 0.0 - - - - - - - RTKN rhotekin 1499 190 C20140707_OR006_04 C20140707_OR006_04 TB437392.[MT7]-QMALSLEDTELQRK[MT7].2y7_1.heavy 975.532 / 1033.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - RTKN rhotekin 1501 191 C20140707_OR006_04 C20140707_OR006_04 TB411989.[MT7]-TIQTMDQSDK[MT7].3b6_1.heavy 485.585 / 834.415 1002.0 22.93125057220459 43 17 10 6 10 3.5066556139555707 28.51720014991669 0.03989982604980469 3 0.9789626637206095 8.493812602122503 1002.0 9.027027027027026 0.0 - - - - - - - 111.0 2 2 STAT4 signal transducer and activator of transcription 4 1503 191 C20140707_OR006_04 C20140707_OR006_04 TB411989.[MT7]-TIQTMDQSDK[MT7].3y3_1.heavy 485.585 / 493.274 8903.0 22.93125057220459 43 17 10 6 10 3.5066556139555707 28.51720014991669 0.03989982604980469 3 0.9789626637206095 8.493812602122503 8903.0 21.374108802845363 0.0 - - - - - - - 267.2 17 5 STAT4 signal transducer and activator of transcription 4 1505 191 C20140707_OR006_04 C20140707_OR006_04 TB411989.[MT7]-TIQTMDQSDK[MT7].3b4_1.heavy 485.585 / 588.347 6232.0 22.93125057220459 43 17 10 6 10 3.5066556139555707 28.51720014991669 0.03989982604980469 3 0.9789626637206095 8.493812602122503 6232.0 15.03846088412289 0.0 - - - - - - - 259.77777777777777 12 9 STAT4 signal transducer and activator of transcription 4 1507 191 C20140707_OR006_04 C20140707_OR006_04 TB411989.[MT7]-TIQTMDQSDK[MT7].3y5_1.heavy 485.585 / 736.359 1558.0 22.93125057220459 43 17 10 6 10 3.5066556139555707 28.51720014991669 0.03989982604980469 3 0.9789626637206095 8.493812602122503 1558.0 18.374179748610885 0.0 - - - - - - - 250.5 3 4 STAT4 signal transducer and activator of transcription 4 1509 192 C20140707_OR006_04 C20140707_OR006_04 TB437194.[MT7]-SDPVTLNLLPK[MT7].3b6_1.heavy 495.636 / 757.421 1135.0 38.22130012512207 38 13 10 5 10 1.2933804674357987 54.148497484647606 0.046802520751953125 3 0.9287113127359259 4.5944934755267655 1135.0 5.286720395687911 0.0 - - - - - - - 265.3333333333333 2 3 PSG1;PSG3;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1511 192 C20140707_OR006_04 C20140707_OR006_04 TB437194.[MT7]-SDPVTLNLLPK[MT7].3b4_1.heavy 495.636 / 543.289 1703.0 38.22130012512207 38 13 10 5 10 1.2933804674357987 54.148497484647606 0.046802520751953125 3 0.9287113127359259 4.5944934755267655 1703.0 18.203370816910116 0.0 - - - - - - - 227.3 3 10 PSG1;PSG3;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1513 192 C20140707_OR006_04 C20140707_OR006_04 TB437194.[MT7]-SDPVTLNLLPK[MT7].3b5_1.heavy 495.636 / 644.337 2384.0 38.22130012512207 38 13 10 5 10 1.2933804674357987 54.148497484647606 0.046802520751953125 3 0.9287113127359259 4.5944934755267655 2384.0 2.449486337290332 0.0 - - - - - - - 298.125 4 8 PSG1;PSG3;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1515 192 C20140707_OR006_04 C20140707_OR006_04 TB437194.[MT7]-SDPVTLNLLPK[MT7].3b7_1.heavy 495.636 / 871.464 1930.0 38.22130012512207 38 13 10 5 10 1.2933804674357987 54.148497484647606 0.046802520751953125 3 0.9287113127359259 4.5944934755267655 1930.0 12.455726872246697 0.0 - - - - - - - 265.0 3 3 PSG1;PSG3;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1517 193 C20140707_OR006_04 C20140707_OR006_04 TB450115.[MT7]-SDPVTLNLLHGPDLPR.3y7_1.heavy 630.018 / 791.416 26253.0 38.66674995422363 35 18 2 5 10 4.202048466138035 23.79791685075606 0.040500640869140625 3 0.9834332436525967 9.575075938106293 26253.0 110.5101104771387 0.0 - - - - - - - 214.5 52 8 PSG2;PSG11 pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 11 1519 193 C20140707_OR006_04 C20140707_OR006_04 TB450115.[MT7]-SDPVTLNLLHGPDLPR.3y6_1.heavy 630.018 / 654.357 28496.0 38.66674995422363 35 18 2 5 10 4.202048466138035 23.79791685075606 0.040500640869140625 3 0.9834332436525967 9.575075938106293 28496.0 72.87463941921106 0.0 - - - - - - - 220.0 56 6 PSG2;PSG11 pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 11 1521 193 C20140707_OR006_04 C20140707_OR006_04 TB450115.[MT7]-SDPVTLNLLHGPDLPR.3b4_1.heavy 630.018 / 543.289 9762.0 38.66674995422363 35 18 2 5 10 4.202048466138035 23.79791685075606 0.040500640869140625 3 0.9834332436525967 9.575075938106293 9762.0 17.443016842312616 2.0 - - - - - - - 249.33333333333334 136 9 PSG2;PSG11 pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 11 1523 193 C20140707_OR006_04 C20140707_OR006_04 TB450115.[MT7]-SDPVTLNLLHGPDLPR.3b7_1.heavy 630.018 / 871.464 14908.0 38.66674995422363 35 18 2 5 10 4.202048466138035 23.79791685075606 0.040500640869140625 3 0.9834332436525967 9.575075938106293 14908.0 129.31560606060606 0.0 - - - - - - - 249.33333333333334 29 9 PSG2;PSG11 pregnancy specific beta-1-glycoprotein 2;pregnancy specific beta-1-glycoprotein 11 1525 194 C20140707_OR006_04 C20140707_OR006_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 145120.0 35.50360107421875 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 145120.0 340.06123924061654 0.0 - - - - - - - 278.14285714285717 290 7 1527 194 C20140707_OR006_04 C20140707_OR006_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 37863.0 35.50360107421875 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 37863.0 113.21000377893245 1.0 - - - - - - - 270.3333333333333 87 9 1529 194 C20140707_OR006_04 C20140707_OR006_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 28853.0 35.50360107421875 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 28853.0 115.23426078028749 0.0 - - - - - - - 341.0 57 5 1531 195 C20140707_OR006_04 C20140707_OR006_04 TB449896.[MT7]-K[MT7]LDHEIR.3b3_2.heavy 400.243 / 323.212 19275.0 18.17060089111328 37 9 10 10 8 1.0062559954827268 65.47565859174344 0.0 4 0.8091962890437051 2.7791272640180047 19275.0 36.052277716794734 0.0 - - - - - - - 750.0 38 10 RTKN rhotekin 1533 195 C20140707_OR006_04 C20140707_OR006_04 TB449896.[MT7]-K[MT7]LDHEIR.3b3_1.heavy 400.243 / 645.417 1262.0 18.17060089111328 37 9 10 10 8 1.0062559954827268 65.47565859174344 0.0 4 0.8091962890437051 2.7791272640180047 1262.0 14.152428571428572 1.0 - - - - - - - 108.88888888888889 3 9 RTKN rhotekin 1535 195 C20140707_OR006_04 C20140707_OR006_04 TB449896.[MT7]-K[MT7]LDHEIR.3y4_1.heavy 400.243 / 554.305 5467.0 18.17060089111328 37 9 10 10 8 1.0062559954827268 65.47565859174344 0.0 4 0.8091962890437051 2.7791272640180047 5467.0 14.184158944319979 0.0 - - - - - - - 192.5 10 8 RTKN rhotekin 1537 195 C20140707_OR006_04 C20140707_OR006_04 TB449896.[MT7]-K[MT7]LDHEIR.3y5_1.heavy 400.243 / 669.331 1121.0 18.17060089111328 37 9 10 10 8 1.0062559954827268 65.47565859174344 0.0 4 0.8091962890437051 2.7791272640180047 1121.0 11.476904761904763 0.0 - - - - - - - 175.0 2 8 RTKN rhotekin 1539 196 C20140707_OR006_04 C20140707_OR006_04 TB437193.[MT7]-SDPVTLNLLPK[MT7].2b8_1.heavy 742.95 / 984.548 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG1;PSG3;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1541 196 C20140707_OR006_04 C20140707_OR006_04 TB437193.[MT7]-SDPVTLNLLPK[MT7].2b4_1.heavy 742.95 / 543.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG1;PSG3;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1543 196 C20140707_OR006_04 C20140707_OR006_04 TB437193.[MT7]-SDPVTLNLLPK[MT7].2b7_1.heavy 742.95 / 871.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG1;PSG3;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1545 196 C20140707_OR006_04 C20140707_OR006_04 TB437193.[MT7]-SDPVTLNLLPK[MT7].2b5_1.heavy 742.95 / 644.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG1;PSG3;PSG4;PSG6;PSG7;PSG9 pregnancy specific beta-1-glycoprotein 1;pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 6;pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene);pregnancy specific beta-1-glycoprotein 9 1547 197 C20140707_OR006_04 C20140707_OR006_04 TB450117.[MT7]-ESVSPESLK[MT7].2y8_1.heavy 632.355 / 990.559 4007.0 25.820849418640137 35 15 9 5 6 3.5108955152594112 28.48276161035548 0.04269981384277344 6 0.9592039825609127 6.0892788106045606 4007.0 43.57895480225989 1.0 - - - - - - - 226.08333333333334 12 12 SYT4 synaptotagmin IV 1549 197 C20140707_OR006_04 C20140707_OR006_04 TB450117.[MT7]-ESVSPESLK[MT7].2y5_1.heavy 632.355 / 717.426 5186.0 25.820849418640137 35 15 9 5 6 3.5108955152594112 28.48276161035548 0.04269981384277344 6 0.9592039825609127 6.0892788106045606 5186.0 28.798633564501742 0.0 - - - - - - - 236.0 10 7 SYT4 synaptotagmin IV 1551 197 C20140707_OR006_04 C20140707_OR006_04 TB450117.[MT7]-ESVSPESLK[MT7].2b4_1.heavy 632.355 / 547.284 3653.0 25.820849418640137 35 15 9 5 6 3.5108955152594112 28.48276161035548 0.04269981384277344 6 0.9592039825609127 6.0892788106045606 3653.0 31.15000088507324 2.0 - - - - - - - 286.42857142857144 10 7 SYT4 synaptotagmin IV 1553 197 C20140707_OR006_04 C20140707_OR006_04 TB450117.[MT7]-ESVSPESLK[MT7].2y6_1.heavy 632.355 / 804.458 3182.0 25.820849418640137 35 15 9 5 6 3.5108955152594112 28.48276161035548 0.04269981384277344 6 0.9592039825609127 6.0892788106045606 3182.0 13.089472496349071 0.0 - - - - - - - 236.0 6 3 SYT4 synaptotagmin IV 1555 198 C20140707_OR006_04 C20140707_OR006_04 TB437198.[MT7]-EQLTQELQEAR.2b3_1.heavy 744.892 / 515.295 8636.0 30.094125270843506 38 13 10 5 10 2.264924062084628 34.80543619759571 0.04030036926269531 3 0.9209062485084051 4.358994763481163 8636.0 71.64604870259481 0.0 - - - - - - - 250.0 17 12 GRIPAP1 GRIP1 associated protein 1 1557 198 C20140707_OR006_04 C20140707_OR006_04 TB437198.[MT7]-EQLTQELQEAR.2y8_1.heavy 744.892 / 974.49 12891.0 30.094125270843506 38 13 10 5 10 2.264924062084628 34.80543619759571 0.04030036926269531 3 0.9209062485084051 4.358994763481163 12891.0 40.74497808219178 0.0 - - - - - - - 285.7142857142857 25 7 GRIPAP1 GRIP1 associated protein 1 1559 198 C20140707_OR006_04 C20140707_OR006_04 TB437198.[MT7]-EQLTQELQEAR.2y9_1.heavy 744.892 / 1087.57 5006.0 30.094125270843506 38 13 10 5 10 2.264924062084628 34.80543619759571 0.04030036926269531 3 0.9209062485084051 4.358994763481163 5006.0 48.05760000000001 0.0 - - - - - - - 222.22222222222223 10 9 GRIPAP1 GRIP1 associated protein 1 1561 198 C20140707_OR006_04 C20140707_OR006_04 TB437198.[MT7]-EQLTQELQEAR.2y10_1.heavy 744.892 / 1215.63 3004.0 30.094125270843506 38 13 10 5 10 2.264924062084628 34.80543619759571 0.04030036926269531 3 0.9209062485084051 4.358994763481163 3004.0 45.42048 0.0 - - - - - - - 180.55555555555554 6 9 GRIPAP1 GRIP1 associated protein 1 1563 199 C20140707_OR006_04 C20140707_OR006_04 TB437059.[MT7]-HRQIVVDK[MT7].2y4_1.heavy 641.895 / 604.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 1565 199 C20140707_OR006_04 C20140707_OR006_04 TB437059.[MT7]-HRQIVVDK[MT7].2y3_1.heavy 641.895 / 505.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 1567 199 C20140707_OR006_04 C20140707_OR006_04 TB437059.[MT7]-HRQIVVDK[MT7].2b7_1.heavy 641.895 / 992.576 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 1569 199 C20140707_OR006_04 C20140707_OR006_04 TB437059.[MT7]-HRQIVVDK[MT7].2b5_1.heavy 641.895 / 778.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6 complement component 6 1571 200 C20140707_OR006_04 C20140707_OR006_04 TB437399.[MT7]-NQEFLLLPAEELHK[MT7].3y7_1.heavy 657.038 / 967.533 15635.0 39.810851097106934 40 14 10 6 10 1.8239244943790676 43.97143844095483 0.039402008056640625 3 0.940200446278961 5.021402732356559 15635.0 46.05707090782176 0.0 - - - - - - - 240.75 31 8 KLHL1 kelch-like 1 (Drosophila) 1573 200 C20140707_OR006_04 C20140707_OR006_04 TB437399.[MT7]-NQEFLLLPAEELHK[MT7].3b4_1.heavy 657.038 / 663.322 13815.0 39.810851097106934 40 14 10 6 10 1.8239244943790676 43.97143844095483 0.039402008056640625 3 0.940200446278961 5.021402732356559 13815.0 62.5871144859813 0.0 - - - - - - - 294.25 27 8 KLHL1 kelch-like 1 (Drosophila) 1575 200 C20140707_OR006_04 C20140707_OR006_04 TB437399.[MT7]-NQEFLLLPAEELHK[MT7].3b5_1.heavy 657.038 / 776.406 16599.0 39.810851097106934 40 14 10 6 10 1.8239244943790676 43.97143844095483 0.039402008056640625 3 0.940200446278961 5.021402732356559 16599.0 102.23122429906542 0.0 - - - - - - - 347.75 33 8 KLHL1 kelch-like 1 (Drosophila) 1577 200 C20140707_OR006_04 C20140707_OR006_04 TB437399.[MT7]-NQEFLLLPAEELHK[MT7].3b3_1.heavy 657.038 / 516.253 8460.0 39.810851097106934 40 14 10 6 10 1.8239244943790676 43.97143844095483 0.039402008056640625 3 0.940200446278961 5.021402732356559 8460.0 30.501203680133823 0.0 - - - - - - - 243.1818181818182 16 11 KLHL1 kelch-like 1 (Drosophila) 1579 201 C20140707_OR006_04 C20140707_OR006_04 TB437199.[MT7]-EQLTQELQEAR.3b9_2.heavy 496.931 / 622.318 125.0 30.154249668121338 29 5 10 6 8 2.0778474363259725 48.12672877312828 0.03940010070800781 4 0.6712866042014747 2.0905825745537934 125.0 0.0 42.0 - - - - - - - 166.66666666666666 7 12 GRIPAP1 GRIP1 associated protein 1 1581 201 C20140707_OR006_04 C20140707_OR006_04 TB437199.[MT7]-EQLTQELQEAR.3y6_1.heavy 496.931 / 745.384 1252.0 30.154249668121338 29 5 10 6 8 2.0778474363259725 48.12672877312828 0.03940010070800781 4 0.6712866042014747 2.0905825745537934 1252.0 4.4064 1.0 - - - - - - - 200.2 2 5 GRIPAP1 GRIP1 associated protein 1 1583 201 C20140707_OR006_04 C20140707_OR006_04 TB437199.[MT7]-EQLTQELQEAR.3b3_1.heavy 496.931 / 515.295 1503.0 30.154249668121338 29 5 10 6 8 2.0778474363259725 48.12672877312828 0.03940010070800781 4 0.6712866042014747 2.0905825745537934 1503.0 5.585044388398486 5.0 - - - - - - - 200.1 4 10 GRIPAP1 GRIP1 associated protein 1 1585 201 C20140707_OR006_04 C20140707_OR006_04 TB437199.[MT7]-EQLTQELQEAR.3y4_1.heavy 496.931 / 503.257 3882.0 30.154249668121338 29 5 10 6 8 2.0778474363259725 48.12672877312828 0.03940010070800781 4 0.6712866042014747 2.0905825745537934 3882.0 7.8549804253011954 0.0 - - - - - - - 204.63636363636363 7 11 GRIPAP1 GRIP1 associated protein 1 1587 202 C20140707_OR006_04 C20140707_OR006_04 TB411995.[MT7]-SDGDPIVDPEK[MT7].3b6_1.heavy 487.255 / 729.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1589 202 C20140707_OR006_04 C20140707_OR006_04 TB411995.[MT7]-SDGDPIVDPEK[MT7].3y3_1.heavy 487.255 / 517.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1591 202 C20140707_OR006_04 C20140707_OR006_04 TB411995.[MT7]-SDGDPIVDPEK[MT7].3b4_1.heavy 487.255 / 519.217 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1593 202 C20140707_OR006_04 C20140707_OR006_04 TB411995.[MT7]-SDGDPIVDPEK[MT7].3b5_1.heavy 487.255 / 616.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1595 203 C20140707_OR006_04 C20140707_OR006_04 TB450262.[MT7]-ILPGLYIGNFK[MT7].2y4_1.heavy 761.965 / 609.348 14885.0 44.54634952545166 46 20 10 6 10 8.862096228604312 11.284011978704159 0.036998748779296875 3 0.9923088131036173 14.063290265297715 14885.0 170.67306089162742 0.0 - - - - - - - 221.58333333333334 29 12 LOC100509491;DUSP22 hypothetical protein LOC100509491;dual specificity phosphatase 22 1597 203 C20140707_OR006_04 C20140707_OR006_04 TB450262.[MT7]-ILPGLYIGNFK[MT7].2y5_1.heavy 761.965 / 722.432 5670.0 44.54634952545166 46 20 10 6 10 8.862096228604312 11.284011978704159 0.036998748779296875 3 0.9923088131036173 14.063290265297715 5670.0 12.152005248304203 0.0 - - - - - - - 299.7692307692308 11 13 LOC100509491;DUSP22 hypothetical protein LOC100509491;dual specificity phosphatase 22 1599 203 C20140707_OR006_04 C20140707_OR006_04 TB450262.[MT7]-ILPGLYIGNFK[MT7].2y9_1.heavy 761.965 / 1152.65 22239.0 44.54634952545166 46 20 10 6 10 8.862096228604312 11.284011978704159 0.036998748779296875 3 0.9923088131036173 14.063290265297715 22239.0 197.1100356824264 0.0 - - - - - - - 199.41666666666666 44 12 LOC100509491;DUSP22 hypothetical protein LOC100509491;dual specificity phosphatase 22 1601 203 C20140707_OR006_04 C20140707_OR006_04 TB450262.[MT7]-ILPGLYIGNFK[MT7].2y6_1.heavy 761.965 / 885.495 6291.0 44.54634952545166 46 20 10 6 10 8.862096228604312 11.284011978704159 0.036998748779296875 3 0.9923088131036173 14.063290265297715 6291.0 69.7320466724287 0.0 - - - - - - - 221.6 12 10 LOC100509491;DUSP22 hypothetical protein LOC100509491;dual specificity phosphatase 22 1603 204 C20140707_OR006_04 C20140707_OR006_04 TB450519.[MT7]-TLLLVSELGLDSEVLPVRGDHPAAQNR.4y16_2.heavy 761.672 / 873.456 8730.0 44.42919921875 40 14 10 6 10 1.1087477881211312 58.97525642280273 0.0355987548828125 3 0.9305008048194878 4.653980356792967 8730.0 30.052599574338707 0.0 - - - - - - - 184.0 17 7 PPOX protoporphyrinogen oxidase 1605 204 C20140707_OR006_04 C20140707_OR006_04 TB450519.[MT7]-TLLLVSELGLDSEVLPVRGDHPAAQNR.4b4_1.heavy 761.672 / 585.409 24445.0 44.42919921875 40 14 10 6 10 1.1087477881211312 58.97525642280273 0.0355987548828125 3 0.9305008048194878 4.653980356792967 24445.0 79.92692232448535 0.0 - - - - - - - 312.4 48 10 PPOX protoporphyrinogen oxidase 1607 204 C20140707_OR006_04 C20140707_OR006_04 TB450519.[MT7]-TLLLVSELGLDSEVLPVRGDHPAAQNR.4y7_1.heavy 761.672 / 793.406 8363.0 44.42919921875 40 14 10 6 10 1.1087477881211312 58.97525642280273 0.0355987548828125 3 0.9305008048194878 4.653980356792967 8363.0 -4.545108695652175 0.0 - - - - - - - 275.90909090909093 16 11 PPOX protoporphyrinogen oxidase 1609 204 C20140707_OR006_04 C20140707_OR006_04 TB450519.[MT7]-TLLLVSELGLDSEVLPVRGDHPAAQNR.4y6_1.heavy 761.672 / 656.347 5698.0 44.42919921875 40 14 10 6 10 1.1087477881211312 58.97525642280273 0.0355987548828125 3 0.9305008048194878 4.653980356792967 5698.0 23.225543478260867 0.0 - - - - - - - 239.2 11 10 PPOX protoporphyrinogen oxidase 1611 205 C20140707_OR006_04 C20140707_OR006_04 TB411992.[MT7]-ELRELHEDK[MT7].3y3_1.heavy 486.271 / 535.284 1474.0 20.835100173950195 31 16 4 5 6 2.5687068952344556 38.93009365355117 0.04000091552734375 5 0.9644176624356072 6.5230225560692 1474.0 13.096298975286317 1.0 - - - - - - - 197.375 2 8 GRIPAP1 GRIP1 associated protein 1 1613 205 C20140707_OR006_04 C20140707_OR006_04 TB411992.[MT7]-ELRELHEDK[MT7].3y8_2.heavy 486.271 / 592.331 737.0 20.835100173950195 31 16 4 5 6 2.5687068952344556 38.93009365355117 0.04000091552734375 5 0.9644176624356072 6.5230225560692 737.0 7.157207353827607 8.0 - - - - - - - 263.25 2 8 GRIPAP1 GRIP1 associated protein 1 1615 205 C20140707_OR006_04 C20140707_OR006_04 TB411992.[MT7]-ELRELHEDK[MT7].3b8_2.heavy 486.271 / 583.8 1053.0 20.835100173950195 31 16 4 5 6 2.5687068952344556 38.93009365355117 0.04000091552734375 5 0.9644176624356072 6.5230225560692 1053.0 3.19696394686907 0.0 - - - - - - - 281.0 2 3 GRIPAP1 GRIP1 associated protein 1 1617 205 C20140707_OR006_04 C20140707_OR006_04 TB411992.[MT7]-ELRELHEDK[MT7].3b7_2.heavy 486.271 / 526.286 1053.0 20.835100173950195 31 16 4 5 6 2.5687068952344556 38.93009365355117 0.04000091552734375 5 0.9644176624356072 6.5230225560692 1053.0 3.4649273213481955 3.0 - - - - - - - 180.57142857142858 5 7 GRIPAP1 GRIP1 associated protein 1 1619 206 C20140707_OR006_04 C20140707_OR006_04 TB450518.[MT7]-TLFYVESLEEEVVPGMDFPGPHEK[MT7].4b4_1.heavy 760.133 / 669.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL1 kelch-like 1 (Drosophila) 1621 206 C20140707_OR006_04 C20140707_OR006_04 TB450518.[MT7]-TLFYVESLEEEVVPGMDFPGPHEK[MT7].4b5_1.heavy 760.133 / 768.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL1 kelch-like 1 (Drosophila) 1623 206 C20140707_OR006_04 C20140707_OR006_04 TB450518.[MT7]-TLFYVESLEEEVVPGMDFPGPHEK[MT7].4y6_1.heavy 760.133 / 808.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL1 kelch-like 1 (Drosophila) 1625 206 C20140707_OR006_04 C20140707_OR006_04 TB450518.[MT7]-TLFYVESLEEEVVPGMDFPGPHEK[MT7].4b3_1.heavy 760.133 / 506.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL1 kelch-like 1 (Drosophila) 1627 207 C20140707_OR006_04 C20140707_OR006_04 TB436924.[MT7]-MESYLK[MT7].2y4_1.heavy 529.793 / 654.394 6564.0 28.69059944152832 47 17 10 10 10 4.149840153075086 24.097313706384252 0.0 3 0.9781228723226643 8.328604984603375 6564.0 5.979913072131302 0.0 - - - - - - - 220.625 13 8 KLHL1 kelch-like 1 (Drosophila) 1629 207 C20140707_OR006_04 C20140707_OR006_04 TB436924.[MT7]-MESYLK[MT7].2y5_1.heavy 529.793 / 783.437 4796.0 28.69059944152832 47 17 10 10 10 4.149840153075086 24.097313706384252 0.0 3 0.9781228723226643 8.328604984603375 4796.0 35.018412698412696 0.0 - - - - - - - 210.11111111111111 9 9 KLHL1 kelch-like 1 (Drosophila) 1631 207 C20140707_OR006_04 C20140707_OR006_04 TB436924.[MT7]-MESYLK[MT7].2b4_1.heavy 529.793 / 655.288 2272.0 28.69059944152832 47 17 10 10 10 4.149840153075086 24.097313706384252 0.0 3 0.9781228723226643 8.328604984603375 2272.0 31.73587301587302 0.0 - - - - - - - 154.11111111111111 4 9 KLHL1 kelch-like 1 (Drosophila) 1633 207 C20140707_OR006_04 C20140707_OR006_04 TB436924.[MT7]-MESYLK[MT7].2y3_1.heavy 529.793 / 567.362 1767.0 28.69059944152832 47 17 10 10 10 4.149840153075086 24.097313706384252 0.0 3 0.9781228723226643 8.328604984603375 1767.0 15.701112682696841 3.0 - - - - - - - 234.14285714285714 4 7 KLHL1 kelch-like 1 (Drosophila) 1635 208 C20140707_OR006_04 C20140707_OR006_04 TB437444.[MT7]-FQQSGQNLFIPQITTK[MT7].4y4_1.heavy 535.302 / 606.394 2041.0 39.55849965413412 41 15 10 6 10 1.538476253053032 43.332918876303665 0.039897918701171875 3 0.9524643459655756 5.637896097732947 2041.0 10.035842404750124 1.0 - - - - - - - 286.3333333333333 4 3 PSG2 pregnancy specific beta-1-glycoprotein 2 1637 208 C20140707_OR006_04 C20140707_OR006_04 TB437444.[MT7]-FQQSGQNLFIPQITTK[MT7].4b7_1.heavy 535.302 / 934.45 2686.0 39.55849965413412 41 15 10 6 10 1.538476253053032 43.332918876303665 0.039897918701171875 3 0.9524643459655756 5.637896097732947 2686.0 12.493023255813954 0.0 - - - - - - - 184.14285714285714 5 7 PSG2 pregnancy specific beta-1-glycoprotein 2 1639 208 C20140707_OR006_04 C20140707_OR006_04 TB437444.[MT7]-FQQSGQNLFIPQITTK[MT7].4b15_2.heavy 535.302 / 924.492 N/A 39.55849965413412 41 15 10 6 10 1.538476253053032 43.332918876303665 0.039897918701171875 3 0.9524643459655756 5.637896097732947 107.0 1.1890697674418604 22.0 - - - - - - - 190.88888888888889 2 9 PSG2 pregnancy specific beta-1-glycoprotein 2 1641 208 C20140707_OR006_04 C20140707_OR006_04 TB437444.[MT7]-FQQSGQNLFIPQITTK[MT7].4y6_1.heavy 535.302 / 831.506 3546.0 39.55849965413412 41 15 10 6 10 1.538476253053032 43.332918876303665 0.039897918701171875 3 0.9524643459655756 5.637896097732947 3546.0 42.36549011084547 0.0 - - - - - - - 143.0 7 9 PSG2 pregnancy specific beta-1-glycoprotein 2 1643 209 C20140707_OR006_04 C20140707_OR006_04 TB436923.[MT7]-ELHEDK[MT7].2y4_1.heavy 529.79 / 672.343 1193.0 16.193300247192383 50 20 10 10 10 5.865157466258342 17.049840618140244 0.0 3 0.9938187267337463 15.689150760669065 1193.0 15.734296762589928 0.0 - - - - - - - 123.0909090909091 2 11 GRIPAP1 GRIP1 associated protein 1 1645 209 C20140707_OR006_04 C20140707_OR006_04 TB436923.[MT7]-ELHEDK[MT7].2y5_1.heavy 529.79 / 785.427 755.0 16.193300247192383 50 20 10 10 10 5.865157466258342 17.049840618140244 0.0 3 0.9938187267337463 15.689150760669065 755.0 21.82139937106918 0.0 - - - - - - - 0.0 1 0 GRIPAP1 GRIP1 associated protein 1 1647 209 C20140707_OR006_04 C20140707_OR006_04 TB436923.[MT7]-ELHEDK[MT7].2y3_1.heavy 529.79 / 535.284 1153.0 16.193300247192383 50 20 10 10 10 5.865157466258342 17.049840618140244 0.0 3 0.9938187267337463 15.689150760669065 1153.0 6.478152324618978 1.0 - - - - - - - 122.66666666666667 2 12 GRIPAP1 GRIP1 associated protein 1 1649 209 C20140707_OR006_04 C20140707_OR006_04 TB436923.[MT7]-ELHEDK[MT7].2b5_1.heavy 529.79 / 768.364 517.0 16.193300247192383 50 20 10 10 10 5.865157466258342 17.049840618140244 0.0 3 0.9938187267337463 15.689150760669065 517.0 12.152097989949748 0.0 - - - - - - - 0.0 1 0 GRIPAP1 GRIP1 associated protein 1 1651 210 C20140707_OR006_04 C20140707_OR006_04 TB437448.[MT7]-ENPAVIDFELAPIVDLVR.3y7_1.heavy 718.736 / 811.504 8753.0 52.956974029541016 46 20 10 6 10 8.699296954665233 11.495181797003987 0.0384979248046875 3 0.996079940918723 19.704893399671704 8753.0 186.21948517520215 0.0 - - - - - - - 174.14285714285714 17 7 C6 complement component 6 1653 210 C20140707_OR006_04 C20140707_OR006_04 TB437448.[MT7]-ENPAVIDFELAPIVDLVR.3b4_1.heavy 718.736 / 556.285 7480.0 52.956974029541016 46 20 10 6 10 8.699296954665233 11.495181797003987 0.0384979248046875 3 0.996079940918723 19.704893399671704 7480.0 40.32345013477089 0.0 - - - - - - - 180.8235294117647 14 17 C6 complement component 6 1655 210 C20140707_OR006_04 C20140707_OR006_04 TB437448.[MT7]-ENPAVIDFELAPIVDLVR.3b5_1.heavy 718.736 / 655.353 8169.0 52.956974029541016 46 20 10 6 10 8.699296954665233 11.495181797003987 0.0384979248046875 3 0.996079940918723 19.704893399671704 8169.0 48.221320754716984 0.0 - - - - - - - 179.3846153846154 16 13 C6 complement component 6 1657 210 C20140707_OR006_04 C20140707_OR006_04 TB437448.[MT7]-ENPAVIDFELAPIVDLVR.3b7_1.heavy 718.736 / 883.464 5146.0 52.956974029541016 46 20 10 6 10 8.699296954665233 11.495181797003987 0.0384979248046875 3 0.996079940918723 19.704893399671704 5146.0 69.66518867924528 0.0 - - - - - - - 91.54545454545455 10 11 C6 complement component 6 1659 211 C20140707_OR006_04 C20140707_OR006_04 TB437042.[MT7]-HVSNAPLTK[MT7].3y3_1.heavy 418.918 / 505.347 5984.0 19.288299560546875 36 16 2 10 8 1.8638115805111144 36.5220410764869 0.0 4 0.9648885554038399 6.566879319996465 5984.0 9.560765060686023 1.0 - - - - - - - 193.28571428571428 33 7 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1661 211 C20140707_OR006_04 C20140707_OR006_04 TB437042.[MT7]-HVSNAPLTK[MT7].3b4_1.heavy 418.918 / 582.312 3764.0 19.288299560546875 36 16 2 10 8 1.8638115805111144 36.5220410764869 0.0 4 0.9648885554038399 6.566879319996465 3764.0 15.015313560836162 0.0 - - - - - - - 229.5 7 8 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1663 211 C20140707_OR006_04 C20140707_OR006_04 TB437042.[MT7]-HVSNAPLTK[MT7].3b5_1.heavy 418.918 / 653.349 3764.0 19.288299560546875 36 16 2 10 8 1.8638115805111144 36.5220410764869 0.0 4 0.9648885554038399 6.566879319996465 3764.0 22.085002680007147 0.0 - - - - - - - 212.6 7 5 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1665 211 C20140707_OR006_04 C20140707_OR006_04 TB437042.[MT7]-HVSNAPLTK[MT7].3y4_1.heavy 418.918 / 602.399 4247.0 19.288299560546875 36 16 2 10 8 1.8638115805111144 36.5220410764869 0.0 4 0.9648885554038399 6.566879319996465 4247.0 31.22383473289262 0.0 - - - - - - - 185.25 8 12 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1667 212 C20140707_OR006_04 C20140707_OR006_04 TB437385.[MT7]-YYEAADTVTQFDNVR.2b3_1.heavy 968.464 / 600.279 4724.0 36.08190155029297 45 15 10 10 10 2.749620132175749 28.85557120338259 0.0 3 0.9503336183320631 5.514638238579239 4724.0 31.843259259259256 0.0 - - - - - - - 202.5 9 8 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1669 212 C20140707_OR006_04 C20140707_OR006_04 TB437385.[MT7]-YYEAADTVTQFDNVR.2b4_1.heavy 968.464 / 671.316 2295.0 36.08190155029297 45 15 10 10 10 2.749620132175749 28.85557120338259 0.0 3 0.9503336183320631 5.514638238579239 2295.0 19.889999999999997 0.0 - - - - - - - 236.25 4 8 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1671 212 C20140707_OR006_04 C20140707_OR006_04 TB437385.[MT7]-YYEAADTVTQFDNVR.2y9_1.heavy 968.464 / 1079.55 2969.0 36.08190155029297 45 15 10 10 10 2.749620132175749 28.85557120338259 0.0 3 0.9503336183320631 5.514638238579239 2969.0 4.178592592592593 0.0 - - - - - - - 270.0 5 7 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1673 212 C20140707_OR006_04 C20140707_OR006_04 TB437385.[MT7]-YYEAADTVTQFDNVR.2y10_1.heavy 968.464 / 1194.57 810.0 36.08190155029297 45 15 10 10 10 2.749620132175749 28.85557120338259 0.0 3 0.9503336183320631 5.514638238579239 810.0 1.5 2.0 - - - - - - - 0.0 1 0 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1675 213 C20140707_OR006_04 C20140707_OR006_04 TB449988.[MT7]-FVHVLK[MT7].2b3_1.heavy 515.836 / 528.305 3868.0 27.904499053955078 47 17 10 10 10 2.7114376852074065 32.28997921660038 0.0 3 0.9745611012521903 7.721260906399556 3868.0 19.294968010680908 0.0 - - - - - - - 212.3 7 10 SYT4 synaptotagmin IV 1677 213 C20140707_OR006_04 C20140707_OR006_04 TB449988.[MT7]-FVHVLK[MT7].2y4_1.heavy 515.836 / 640.426 5116.0 27.904499053955078 47 17 10 10 10 2.7114376852074065 32.28997921660038 0.0 3 0.9745611012521903 7.721260906399556 5116.0 40.35135120274914 0.0 - - - - - - - 199.8 10 5 SYT4 synaptotagmin IV 1679 213 C20140707_OR006_04 C20140707_OR006_04 TB449988.[MT7]-FVHVLK[MT7].2y5_1.heavy 515.836 / 739.495 2121.0 27.904499053955078 47 17 10 10 10 2.7114376852074065 32.28997921660038 0.0 3 0.9745611012521903 7.721260906399556 2121.0 19.58458340186916 0.0 - - - - - - - 249.66666666666666 4 6 SYT4 synaptotagmin IV 1681 213 C20140707_OR006_04 C20140707_OR006_04 TB449988.[MT7]-FVHVLK[MT7].2y3_1.heavy 515.836 / 503.367 4991.0 27.904499053955078 47 17 10 10 10 2.7114376852074065 32.28997921660038 0.0 3 0.9745611012521903 7.721260906399556 4991.0 9.315003693355171 0.0 - - - - - - - 784.2857142857143 9 7 SYT4 synaptotagmin IV 1683 214 C20140707_OR006_04 C20140707_OR006_04 TB411726.[MT7]-GSSGLEEK[MT7].2y4_1.heavy 547.8 / 662.384 303.0 18.328950881958008 40 15 10 5 10 2.8429876802373224 27.655625709102235 0.0457000732421875 3 0.956069033272984 5.866432965178746 303.0 0.0 17.0 - - - - - - - 0.0 0 0 C6 complement component 6 1685 214 C20140707_OR006_04 C20140707_OR006_04 TB411726.[MT7]-GSSGLEEK[MT7].2y6_1.heavy 547.8 / 806.438 909.0 18.328950881958008 40 15 10 5 10 2.8429876802373224 27.655625709102235 0.0457000732421875 3 0.956069033272984 5.866432965178746 909.0 9.210397350993377 0.0 - - - - - - - 0.0 1 0 C6 complement component 6 1687 214 C20140707_OR006_04 C20140707_OR006_04 TB411726.[MT7]-GSSGLEEK[MT7].2b7_1.heavy 547.8 / 804.386 1439.0 18.328950881958008 40 15 10 5 10 2.8429876802373224 27.655625709102235 0.0457000732421875 3 0.956069033272984 5.866432965178746 1439.0 11.237613644883169 0.0 - - - - - - - 209.84615384615384 2 13 C6 complement component 6 1689 214 C20140707_OR006_04 C20140707_OR006_04 TB411726.[MT7]-GSSGLEEK[MT7].2b5_1.heavy 547.8 / 546.3 2196.0 18.328950881958008 40 15 10 5 10 2.8429876802373224 27.655625709102235 0.0457000732421875 3 0.956069033272984 5.866432965178746 2196.0 15.38167400881057 0.0 - - - - - - - 185.72727272727272 4 11 C6 complement component 6 1691 215 C20140707_OR006_04 C20140707_OR006_04 TB437182.[MT7]-RTLFLFGVTK[MT7].3b4_1.heavy 490.641 / 662.411 9410.0 38.970425605773926 40 14 10 6 10 2.008442894661648 39.14419007456868 0.038898468017578125 3 0.9387165333949619 4.959608968051548 9410.0 66.93422619047618 0.0 - - - - - - - 291.2 18 5 PSG3 pregnancy specific beta-1-glycoprotein 3 1693 215 C20140707_OR006_04 C20140707_OR006_04 TB437182.[MT7]-RTLFLFGVTK[MT7].3b5_1.heavy 490.641 / 775.495 6162.0 38.970425605773926 40 14 10 6 10 2.008442894661648 39.14419007456868 0.038898468017578125 3 0.9387165333949619 4.959608968051548 6162.0 54.19258928571429 0.0 - - - - - - - 201.6 12 5 PSG3 pregnancy specific beta-1-glycoprotein 3 1695 215 C20140707_OR006_04 C20140707_OR006_04 TB437182.[MT7]-RTLFLFGVTK[MT7].3y4_1.heavy 490.641 / 548.352 17477.0 38.970425605773926 40 14 10 6 10 2.008442894661648 39.14419007456868 0.038898468017578125 3 0.9387165333949619 4.959608968051548 17477.0 75.83769642857143 0.0 - - - - - - - 201.6 34 10 PSG3 pregnancy specific beta-1-glycoprotein 3 1697 215 C20140707_OR006_04 C20140707_OR006_04 TB437182.[MT7]-RTLFLFGVTK[MT7].3y5_1.heavy 490.641 / 695.421 5041.0 38.970425605773926 40 14 10 6 10 2.008442894661648 39.14419007456868 0.038898468017578125 3 0.9387165333949619 4.959608968051548 5041.0 23.734708333333334 0.0 - - - - - - - 252.0 10 4 PSG3 pregnancy specific beta-1-glycoprotein 3 1699 216 C20140707_OR006_04 C20140707_OR006_04 TB411820.[MT7]-LAETQQEK[MT7].3y3_1.heavy 412.234 / 548.316 4419.0 19.243999481201172 48 18 10 10 10 2.113508133438663 35.38109808718383 0.0 3 0.9818356275216783 9.143081257405296 4419.0 54.892123611682436 0.0 - - - - - - - 184.63636363636363 8 11 GRIPAP1 GRIP1 associated protein 1 1701 216 C20140707_OR006_04 C20140707_OR006_04 TB411820.[MT7]-LAETQQEK[MT7].3b4_1.heavy 412.234 / 559.321 1768.0 19.243999481201172 48 18 10 10 10 2.113508133438663 35.38109808718383 0.0 3 0.9818356275216783 9.143081257405296 1768.0 11.958170770706747 0.0 - - - - - - - 143.375 3 8 GRIPAP1 GRIP1 associated protein 1 1703 216 C20140707_OR006_04 C20140707_OR006_04 TB411820.[MT7]-LAETQQEK[MT7].3b5_1.heavy 412.234 / 687.379 1326.0 19.243999481201172 48 18 10 10 10 2.113508133438663 35.38109808718383 0.0 3 0.9818356275216783 9.143081257405296 1326.0 20.00662942989214 0.0 - - - - - - - 162.0 2 6 GRIPAP1 GRIP1 associated protein 1 1705 216 C20140707_OR006_04 C20140707_OR006_04 TB411820.[MT7]-LAETQQEK[MT7].3b3_1.heavy 412.234 / 458.273 12905.0 19.243999481201172 48 18 10 10 10 2.113508133438663 35.38109808718383 0.0 3 0.9818356275216783 9.143081257405296 12905.0 38.31857250694086 0.0 - - - - - - - 276.375 25 8 GRIPAP1 GRIP1 associated protein 1 1707 217 C20140707_OR006_04 C20140707_OR006_04 TB437243.[MT7]-GRLSALPFADILR.3y7_1.heavy 524.983 / 831.472 1675.0 43.058799743652344 44 14 10 10 10 4.948036654882405 16.19216825758008 0.0 3 0.9325570130739302 4.725223715807433 1675.0 3.9976133651551313 1.0 - - - - - - - 104.75 3 4 STAT4 signal transducer and activator of transcription 4 1709 217 C20140707_OR006_04 C20140707_OR006_04 TB437243.[MT7]-GRLSALPFADILR.3y6_1.heavy 524.983 / 734.42 4103.0 43.058799743652344 44 14 10 10 10 4.948036654882405 16.19216825758008 0.0 3 0.9325570130739302 4.725223715807433 4103.0 71.20875249500997 0.0 - - - - - - - 181.33333333333334 8 6 STAT4 signal transducer and activator of transcription 4 1711 217 C20140707_OR006_04 C20140707_OR006_04 TB437243.[MT7]-GRLSALPFADILR.3b6_1.heavy 524.983 / 742.469 4271.0 43.058799743652344 44 14 10 10 10 4.948036654882405 16.19216825758008 0.0 3 0.9325570130739302 4.725223715807433 4271.0 92.53833333333333 0.0 - - - - - - - 111.66666666666667 8 6 STAT4 signal transducer and activator of transcription 4 1713 217 C20140707_OR006_04 C20140707_OR006_04 TB437243.[MT7]-GRLSALPFADILR.3b5_1.heavy 524.983 / 629.385 5610.0 43.058799743652344 44 14 10 10 10 4.948036654882405 16.19216825758008 0.0 3 0.9325570130739302 4.725223715807433 5610.0 30.813134328358206 0.0 - - - - - - - 230.25 11 8 STAT4 signal transducer and activator of transcription 4 1715 218 C20140707_OR006_04 C20140707_OR006_04 TB411996.[MT7]-DMEVLSQEIVR.2y5_1.heavy 731.888 / 644.373 2844.0 37.10689926147461 43 13 10 10 10 1.0757369348416173 58.512428236690276 0.0 3 0.9299593041322144 4.6357402509398 2844.0 7.3833525089707805 0.0 - - - - - - - 215.5 5 6 GRIPAP1 GRIP1 associated protein 1 1717 218 C20140707_OR006_04 C20140707_OR006_04 TB411996.[MT7]-DMEVLSQEIVR.2b4_1.heavy 731.888 / 619.288 11245.0 37.10689926147461 43 13 10 10 10 1.0757369348416173 58.512428236690276 0.0 3 0.9299593041322144 4.6357402509398 11245.0 28.59334558250261 1.0 - - - - - - - 307.375 28 8 GRIPAP1 GRIP1 associated protein 1 1719 218 C20140707_OR006_04 C20140707_OR006_04 TB411996.[MT7]-DMEVLSQEIVR.2y10_1.heavy 731.888 / 1203.64 3490.0 37.10689926147461 43 13 10 10 10 1.0757369348416173 58.512428236690276 0.0 3 0.9299593041322144 4.6357402509398 3490.0 29.299488531926794 0.0 - - - - - - - 242.375 6 8 GRIPAP1 GRIP1 associated protein 1 1721 218 C20140707_OR006_04 C20140707_OR006_04 TB411996.[MT7]-DMEVLSQEIVR.2y7_1.heavy 731.888 / 844.489 9953.0 37.10689926147461 43 13 10 10 10 1.0757369348416173 58.512428236690276 0.0 3 0.9299593041322144 4.6357402509398 9953.0 95.61060357228482 0.0 - - - - - - - 244.33333333333334 19 9 GRIPAP1 GRIP1 associated protein 1 1723 219 C20140707_OR006_04 C20140707_OR006_04 TB437240.[MT7]-NSVQMTEQDTK[MT7].3y3_1.heavy 523.599 / 507.289 9536.0 20.75510025024414 43 18 10 5 10 5.4690291306523635 18.28478101159276 0.04000091552734375 3 0.9883382824761977 11.417161756852416 9536.0 48.045770848799805 0.0 - - - - - - - 207.2 19 5 STAT4 signal transducer and activator of transcription 4 1725 219 C20140707_OR006_04 C20140707_OR006_04 TB437240.[MT7]-NSVQMTEQDTK[MT7].3b4_1.heavy 523.599 / 573.311 17517.0 20.75510025024414 43 18 10 5 10 5.4690291306523635 18.28478101159276 0.04000091552734375 3 0.9883382824761977 11.417161756852416 17517.0 127.99053171163614 0.0 - - - - - - - 298.0 35 8 STAT4 signal transducer and activator of transcription 4 1727 219 C20140707_OR006_04 C20140707_OR006_04 TB437240.[MT7]-NSVQMTEQDTK[MT7].3b5_1.heavy 523.599 / 704.352 4146.0 20.75510025024414 43 18 10 5 10 5.4690291306523635 18.28478101159276 0.04000091552734375 3 0.9883382824761977 11.417161756852416 4146.0 18.582072289156628 0.0 - - - - - - - 228.2 8 10 STAT4 signal transducer and activator of transcription 4 1729 219 C20140707_OR006_04 C20140707_OR006_04 TB437240.[MT7]-NSVQMTEQDTK[MT7].3y4_1.heavy 523.599 / 635.348 5390.0 20.75510025024414 43 18 10 5 10 5.4690291306523635 18.28478101159276 0.04000091552734375 3 0.9883382824761977 11.417161756852416 5390.0 28.803265141277166 0.0 - - - - - - - 190.25 10 12 STAT4 signal transducer and activator of transcription 4 1731 220 C20140707_OR006_04 C20140707_OR006_04 TB437048.[MT7]-ESVSPESLK[MT7].3y3_1.heavy 421.906 / 491.331 9135.0 25.820849418640137 32 17 6 5 4 4.057381771809638 24.646435958970375 0.04269981384277344 7 0.9749380993617965 7.779365041098149 9135.0 31.854325651743125 0.0 - - - - - - - 370.5 18 2 SYT4 synaptotagmin IV 1733 220 C20140707_OR006_04 C20140707_OR006_04 TB437048.[MT7]-ESVSPESLK[MT7].3b4_1.heavy 421.906 / 547.284 5678.0 25.820849418640137 32 17 6 5 4 4.057381771809638 24.646435958970375 0.04269981384277344 7 0.9749380993617965 7.779365041098149 5678.0 18.303957860615885 2.0 - - - - - - - 299.85714285714283 18 7 SYT4 synaptotagmin IV 1735 220 C20140707_OR006_04 C20140707_OR006_04 TB437048.[MT7]-ESVSPESLK[MT7].3y4_1.heavy 421.906 / 620.374 1481.0 25.820849418640137 32 17 6 5 4 4.057381771809638 24.646435958970375 0.04269981384277344 7 0.9749380993617965 7.779365041098149 1481.0 5.914268720969752 1.0 - - - - - - - 259.2 2 10 SYT4 synaptotagmin IV 1737 220 C20140707_OR006_04 C20140707_OR006_04 TB437048.[MT7]-ESVSPESLK[MT7].3b3_1.heavy 421.906 / 460.252 3580.0 25.820849418640137 32 17 6 5 4 4.057381771809638 24.646435958970375 0.04269981384277344 7 0.9749380993617965 7.779365041098149 3580.0 32.511763931404495 2.0 - - - - - - - 246.75 27 4 SYT4 synaptotagmin IV 1739 221 C20140707_OR006_04 C20140707_OR006_04 TB437188.[MT7]-EHEEAESGEGTR.3y6_1.heavy 492.222 / 606.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC12A4 solute carrier family 12 (potassium/chloride transporters), member 4 1741 221 C20140707_OR006_04 C20140707_OR006_04 TB437188.[MT7]-EHEEAESGEGTR.3b4_1.heavy 492.222 / 669.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC12A4 solute carrier family 12 (potassium/chloride transporters), member 4 1743 221 C20140707_OR006_04 C20140707_OR006_04 TB437188.[MT7]-EHEEAESGEGTR.3b3_1.heavy 492.222 / 540.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC12A4 solute carrier family 12 (potassium/chloride transporters), member 4 1745 221 C20140707_OR006_04 C20140707_OR006_04 TB437188.[MT7]-EHEEAESGEGTR.3y5_1.heavy 492.222 / 519.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC12A4 solute carrier family 12 (potassium/chloride transporters), member 4 1747 222 C20140707_OR006_04 C20140707_OR006_04 TB412373.[MT7]-VTHILSVHDSARPMLEGVK[MT7].4y10_2.heavy 595.087 / 616.351 27710.0 30.562000274658203 50 20 10 10 10 7.932331503350168 12.606633996292976 0.0 3 0.9966422682099176 21.29206450820169 27710.0 46.00218798733519 0.0 - - - - - - - 672.0 55 9 DUSP22 dual specificity phosphatase 22 1749 222 C20140707_OR006_04 C20140707_OR006_04 TB412373.[MT7]-VTHILSVHDSARPMLEGVK[MT7].4y12_2.heavy 595.087 / 742.394 28214.0 30.562000274658203 50 20 10 10 10 7.932331503350168 12.606633996292976 0.0 3 0.9966422682099176 21.29206450820169 28214.0 118.18033509700174 0.0 - - - - - - - 252.0 56 9 DUSP22 dual specificity phosphatase 22 1751 222 C20140707_OR006_04 C20140707_OR006_04 TB412373.[MT7]-VTHILSVHDSARPMLEGVK[MT7].4y11_2.heavy 595.087 / 673.865 36653.0 30.562000274658203 50 20 10 10 10 7.932331503350168 12.606633996292976 0.0 3 0.9966422682099176 21.29206450820169 36653.0 228.35400793650794 0.0 - - - - - - - 238.0 73 9 DUSP22 dual specificity phosphatase 22 1753 222 C20140707_OR006_04 C20140707_OR006_04 TB412373.[MT7]-VTHILSVHDSARPMLEGVK[MT7].4y14_2.heavy 595.087 / 835.444 19019.0 30.562000274658203 50 20 10 10 10 7.932331503350168 12.606633996292976 0.0 3 0.9966422682099176 21.29206450820169 19019.0 85.28361111111111 0.0 - - - - - - - 302.4 38 5 DUSP22 dual specificity phosphatase 22 1755 223 C20140707_OR006_04 C20140707_OR006_04 TB436979.[MT7]-VVLVESSER.2y8_1.heavy 581.333 / 918.489 54290.0 27.32659912109375 48 18 10 10 10 3.0603711085212795 26.66610164636228 0.0 3 0.9806995780844948 8.86906786094952 54290.0 50.34815181518152 0.0 - - - - - - - 252.75 108 4 PPOX protoporphyrinogen oxidase 1757 223 C20140707_OR006_04 C20140707_OR006_04 TB436979.[MT7]-VVLVESSER.2y5_1.heavy 581.333 / 607.268 13509.0 27.32659912109375 48 18 10 10 10 3.0603711085212795 26.66610164636228 0.0 3 0.9806995780844948 8.86906786094952 13509.0 9.995276991821436 1.0 - - - - - - - 151.4 32 5 PPOX protoporphyrinogen oxidase 1759 223 C20140707_OR006_04 C20140707_OR006_04 TB436979.[MT7]-VVLVESSER.2y6_1.heavy 581.333 / 706.337 23358.0 27.32659912109375 48 18 10 10 10 3.0603711085212795 26.66610164636228 0.0 3 0.9806995780844948 8.86906786094952 23358.0 43.50351452585419 0.0 - - - - - - - 757.625 46 8 PPOX protoporphyrinogen oxidase 1761 223 C20140707_OR006_04 C20140707_OR006_04 TB436979.[MT7]-VVLVESSER.2y7_1.heavy 581.333 / 819.421 20959.0 27.32659912109375 48 18 10 10 10 3.0603711085212795 26.66610164636228 0.0 3 0.9806995780844948 8.86906786094952 20959.0 128.75029743343728 0.0 - - - - - - - 234.57142857142858 41 7 PPOX protoporphyrinogen oxidase 1763 224 C20140707_OR006_04 C20140707_OR006_04 TB412371.[MT7]-VSLEDHSSQGTLVNNVRLPR.4b4_1.heavy 592.073 / 573.336 6183.0 31.54534912109375 38 13 10 5 10 1.0604566573921324 57.80894999780232 0.041500091552734375 3 0.900575350210226 3.881053143416251 6183.0 1.4518344584678604 0.0 - - - - - - - 176.6 12 5 TCF19 transcription factor 19 1765 224 C20140707_OR006_04 C20140707_OR006_04 TB412371.[MT7]-VSLEDHSSQGTLVNNVRLPR.4y13_2.heavy 592.073 / 727.415 15016.0 31.54534912109375 38 13 10 5 10 1.0604566573921324 57.80894999780232 0.041500091552734375 3 0.900575350210226 3.881053143416251 15016.0 12.689577464788732 1.0 - - - - - - - 252.5 30 4 TCF19 transcription factor 19 1767 224 C20140707_OR006_04 C20140707_OR006_04 TB412371.[MT7]-VSLEDHSSQGTLVNNVRLPR.4b5_1.heavy 592.073 / 688.363 14637.0 31.54534912109375 38 13 10 5 10 1.0604566573921324 57.80894999780232 0.041500091552734375 3 0.900575350210226 3.881053143416251 14637.0 16.85273925947137 0.0 - - - - - - - 252.5 29 4 TCF19 transcription factor 19 1769 224 C20140707_OR006_04 C20140707_OR006_04 TB412371.[MT7]-VSLEDHSSQGTLVNNVRLPR.4y14_2.heavy 592.073 / 770.931 9590.0 31.54534912109375 38 13 10 5 10 1.0604566573921324 57.80894999780232 0.041500091552734375 3 0.900575350210226 3.881053143416251 9590.0 7.496567367609028 0.0 - - - - - - - 328.3 19 10 TCF19 transcription factor 19 1771 225 C20140707_OR006_04 C20140707_OR006_04 TB411812.[MT7]-EQEATPRPR.3y7_1.heavy 409.89 / 826.453 23.0 15.345775365829468 25 15 2 2 6 2.051673484769641 39.2896835256834 0.08570003509521484 5 0.9562431839955159 5.878182183586266 23.0 0.11794117647058827 25.0 - - - - - - - 0.0 0 0 SDC1 syndecan 1 1773 225 C20140707_OR006_04 C20140707_OR006_04 TB411812.[MT7]-EQEATPRPR.3y8_2.heavy 409.89 / 477.759 1874.0 15.345775365829468 25 15 2 2 6 2.051673484769641 39.2896835256834 0.08570003509521484 5 0.9562431839955159 5.878182183586266 1874.0 12.178755194836945 0.0 - - - - - - - 136.8235294117647 3 17 SDC1 syndecan 1 1775 225 C20140707_OR006_04 C20140707_OR006_04 TB411812.[MT7]-EQEATPRPR.3b4_1.heavy 409.89 / 602.29 1558.0 15.345775365829468 25 15 2 2 6 2.051673484769641 39.2896835256834 0.08570003509521484 5 0.9562431839955159 5.878182183586266 1558.0 19.120012658227846 1.0 - - - - - - - 105.84210526315789 15 19 SDC1 syndecan 1 1777 225 C20140707_OR006_04 C20140707_OR006_04 TB411812.[MT7]-EQEATPRPR.3b3_1.heavy 409.89 / 531.253 3433.0 15.345775365829468 25 15 2 2 6 2.051673484769641 39.2896835256834 0.08570003509521484 5 0.9562431839955159 5.878182183586266 3433.0 28.12196943796944 1.0 - - - - - - - 141.92857142857142 8 14 SDC1 syndecan 1 1779 226 C20140707_OR006_04 C20140707_OR006_04 TB437232.[MT7]-SDVSGLSDPYVK[MT7].3y3_1.heavy 518.947 / 553.347 5764.0 29.525699615478516 36 18 0 10 8 4.671307419877787 21.407283017698767 0.0 4 0.987889387053723 11.20314697308632 5764.0 19.285744931861515 1.0 - - - - - - - 264.77777777777777 11 9 SYT4 synaptotagmin IV 1781 226 C20140707_OR006_04 C20140707_OR006_04 TB437232.[MT7]-SDVSGLSDPYVK[MT7].3b5_1.heavy 518.947 / 590.29 7643.0 29.525699615478516 36 18 0 10 8 4.671307419877787 21.407283017698767 0.0 4 0.987889387053723 11.20314697308632 7643.0 28.070099800399202 0.0 - - - - - - - 595.0 15 8 SYT4 synaptotagmin IV 1783 226 C20140707_OR006_04 C20140707_OR006_04 TB437232.[MT7]-SDVSGLSDPYVK[MT7].3y4_1.heavy 518.947 / 650.399 6766.0 29.525699615478516 36 18 0 10 8 4.671307419877787 21.407283017698767 0.0 4 0.987889387053723 11.20314697308632 6766.0 16.547924269856942 1.0 - - - - - - - 234.875 66 8 SYT4 synaptotagmin IV 1785 226 C20140707_OR006_04 C20140707_OR006_04 TB437232.[MT7]-SDVSGLSDPYVK[MT7].3b8_1.heavy 518.947 / 905.433 1504.0 29.525699615478516 36 18 0 10 8 4.671307419877787 21.407283017698767 0.0 4 0.987889387053723 11.20314697308632 1504.0 17.92777587250996 0.0 - - - - - - - 225.6 3 5 SYT4 synaptotagmin IV 1787 227 C20140707_OR006_04 C20140707_OR006_04 TB437337.[MT7]-FDTTPNELVQLNK[MT7].3b6_1.heavy 603 / 820.396 5645.0 35.99169921875 36 16 2 10 8 2.062554347437198 38.626113774389644 0.0 4 0.9690625779803712 6.998327158189866 5645.0 50.489596626532766 0.0 - - - - - - - 218.25 11 8 OXR1 oxidation resistance 1 1789 227 C20140707_OR006_04 C20140707_OR006_04 TB437337.[MT7]-FDTTPNELVQLNK[MT7].3y3_1.heavy 603 / 518.342 11559.0 35.99169921875 36 16 2 10 8 2.062554347437198 38.626113774389644 0.0 4 0.9690625779803712 6.998327158189866 11559.0 23.995245535714286 1.0 - - - - - - - 302.375 23 8 OXR1 oxidation resistance 1 1791 227 C20140707_OR006_04 C20140707_OR006_04 TB437337.[MT7]-FDTTPNELVQLNK[MT7].3b4_1.heavy 603 / 609.3 13978.0 35.99169921875 36 16 2 10 8 2.062554347437198 38.626113774389644 0.0 4 0.9690625779803712 6.998327158189866 13978.0 60.293446115103265 1.0 - - - - - - - 376.2 88 5 OXR1 oxidation resistance 1 1793 227 C20140707_OR006_04 C20140707_OR006_04 TB437337.[MT7]-FDTTPNELVQLNK[MT7].3b7_1.heavy 603 / 949.438 7795.0 35.99169921875 36 16 2 10 8 2.062554347437198 38.626113774389644 0.0 4 0.9690625779803712 6.998327158189866 7795.0 26.797387289273065 0.0 - - - - - - - 302.375 15 8 OXR1 oxidation resistance 1 1795 228 C20140707_OR006_04 C20140707_OR006_04 TB437336.[MT7]-TMTGLDTPVLMVIK[MT7].3b6_1.heavy 603.015 / 763.378 2103.0 44.473774909973145 31 17 2 6 6 2.8705592341476396 27.855906555133604 0.035701751708984375 5 0.9796529525299367 8.63719100832452 2103.0 14.963653846153846 1.0 - - - - - - - 220.83333333333334 11 12 OXR1 oxidation resistance 1 1797 228 C20140707_OR006_04 C20140707_OR006_04 TB437336.[MT7]-TMTGLDTPVLMVIK[MT7].3b4_1.heavy 603.015 / 535.267 1636.0 44.473774909973145 31 17 2 6 6 2.8705592341476396 27.855906555133604 0.035701751708984375 5 0.9796529525299367 8.63719100832452 1636.0 2.0407852928360284 0.0 - - - - - - - 185.84615384615384 3 13 OXR1 oxidation resistance 1 1799 228 C20140707_OR006_04 C20140707_OR006_04 TB437336.[MT7]-TMTGLDTPVLMVIK[MT7].3y4_1.heavy 603.015 / 634.408 2336.0 44.473774909973145 31 17 2 6 6 2.8705592341476396 27.855906555133604 0.035701751708984375 5 0.9796529525299367 8.63719100832452 2336.0 6.988034188034188 1.0 - - - - - - - 254.46666666666667 5 15 OXR1 oxidation resistance 1 1801 228 C20140707_OR006_04 C20140707_OR006_04 TB437336.[MT7]-TMTGLDTPVLMVIK[MT7].3b7_1.heavy 603.015 / 864.425 1791.0 44.473774909973145 31 17 2 6 6 2.8705592341476396 27.855906555133604 0.035701751708984375 5 0.9796529525299367 8.63719100832452 1791.0 5.395961538461537 0.0 - - - - - - - 167.14285714285714 3 14 OXR1 oxidation resistance 1 1803 229 C20140707_OR006_04 C20140707_OR006_04 TB436832.[MT7]-SISLIR.2y4_1.heavy 416.772 / 488.319 5165.0 30.084050178527832 24 11 2 5 6 4.668938475310872 21.418144730069866 0.04030036926269531 6 0.875228995709124 3.456869017000046 5165.0 6.763690476190476 1.0 - - - - - - - 236.25 33 8 C6 complement component 6 1805 229 C20140707_OR006_04 C20140707_OR006_04 TB436832.[MT7]-SISLIR.2y5_1.heavy 416.772 / 601.403 6047.0 30.084050178527832 24 11 2 5 6 4.668938475310872 21.418144730069866 0.04030036926269531 6 0.875228995709124 3.456869017000046 6047.0 16.960395238095238 0.0 - - - - - - - 277.2 12 5 C6 complement component 6 1807 229 C20140707_OR006_04 C20140707_OR006_04 TB436832.[MT7]-SISLIR.2b4_1.heavy 416.772 / 545.341 5039.0 30.084050178527832 24 11 2 5 6 4.668938475310872 21.418144730069866 0.04030036926269531 6 0.875228995709124 3.456869017000046 5039.0 25.195 2.0 - - - - - - - 252.0 22 5 C6 complement component 6 1809 229 C20140707_OR006_04 C20140707_OR006_04 TB436832.[MT7]-SISLIR.2y3_2.heavy 416.772 / 201.147 1134.0 30.084050178527832 24 11 2 5 6 4.668938475310872 21.418144730069866 0.04030036926269531 6 0.875228995709124 3.456869017000046 1134.0 0.5999999999999999 8.0 - - - - - - - 236.25 2 8 C6 complement component 6 1811 230 C20140707_OR006_04 C20140707_OR006_04 TB412238.[MT7]-VAHSYTMENIMEVIR.3y7_1.heavy 646.33 / 874.482 6496.0 41.25519943237305 50 20 10 10 10 8.493760705811246 11.773347927212285 0.0 3 0.9960679493063607 19.67480366621269 6496.0 39.78937394247039 0.0 - - - - - - - 196.66666666666666 12 9 KLHL1 kelch-like 1 (Drosophila) 1813 230 C20140707_OR006_04 C20140707_OR006_04 TB412238.[MT7]-VAHSYTMENIMEVIR.3b4_1.heavy 646.33 / 539.306 N/A 41.25519943237305 50 20 10 10 10 8.493760705811246 11.773347927212285 0.0 3 0.9960679493063607 19.67480366621269 4232.0 4.442195065765957 7.0 - - - - - - - 738.4 11 10 KLHL1 kelch-like 1 (Drosophila) 1815 230 C20140707_OR006_04 C20140707_OR006_04 TB412238.[MT7]-VAHSYTMENIMEVIR.3y4_1.heavy 646.33 / 516.314 6397.0 41.25519943237305 50 20 10 10 10 8.493760705811246 11.773347927212285 0.0 3 0.9960679493063607 19.67480366621269 6397.0 9.891752911247268 0.0 - - - - - - - 295.1666666666667 12 12 KLHL1 kelch-like 1 (Drosophila) 1817 230 C20140707_OR006_04 C20140707_OR006_04 TB412238.[MT7]-VAHSYTMENIMEVIR.3y8_1.heavy 646.33 / 1003.52 6299.0 41.25519943237305 50 20 10 10 10 8.493760705811246 11.773347927212285 0.0 3 0.9960679493063607 19.67480366621269 6299.0 42.21884538401221 0.0 - - - - - - - 274.07142857142856 12 14 KLHL1 kelch-like 1 (Drosophila) 1819 231 C20140707_OR006_04 C20140707_OR006_04 TB436971.[MT7]-VNLYHAK[MT7].2y4_1.heavy 566.839 / 662.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYT4 synaptotagmin IV 1821 231 C20140707_OR006_04 C20140707_OR006_04 TB436971.[MT7]-VNLYHAK[MT7].2b4_1.heavy 566.839 / 634.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYT4 synaptotagmin IV 1823 231 C20140707_OR006_04 C20140707_OR006_04 TB436971.[MT7]-VNLYHAK[MT7].2b6_1.heavy 566.839 / 842.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYT4 synaptotagmin IV 1825 231 C20140707_OR006_04 C20140707_OR006_04 TB436971.[MT7]-VNLYHAK[MT7].2y6_1.heavy 566.839 / 889.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - SYT4 synaptotagmin IV 1827 232 C20140707_OR006_04 C20140707_OR006_04 TB412385.[MT7]-AK[MT7]PSPAPPSTTTAPDASGPQK[MT7].3y3_1.heavy 813.447 / 516.326 532.0 21.1382999420166 48 18 10 10 10 5.738742038129193 17.425421692695494 0.0 3 0.9853155377775591 10.171862048921954 532.0 7.4166144034015415 0.0 - - - - - - - 0.0 1 0 PEX19 peroxisomal biogenesis factor 19 1829 232 C20140707_OR006_04 C20140707_OR006_04 TB412385.[MT7]-AK[MT7]PSPAPPSTTTAPDASGPQK[MT7].3b6_1.heavy 813.447 / 840.518 2448.0 21.1382999420166 48 18 10 10 10 5.738742038129193 17.425421692695494 0.0 3 0.9853155377775591 10.171862048921954 2448.0 21.923359022056868 0.0 - - - - - - - 182.28571428571428 4 7 PEX19 peroxisomal biogenesis factor 19 1831 232 C20140707_OR006_04 C20140707_OR006_04 TB412385.[MT7]-AK[MT7]PSPAPPSTTTAPDASGPQK[MT7].3y4_1.heavy 813.447 / 573.348 852.0 21.1382999420166 48 18 10 10 10 5.738742038129193 17.425421692695494 0.0 3 0.9853155377775591 10.171862048921954 852.0 6.022641509433963 1.0 - - - - - - - 0.0 1 0 PEX19 peroxisomal biogenesis factor 19 1833 232 C20140707_OR006_04 C20140707_OR006_04 TB412385.[MT7]-AK[MT7]PSPAPPSTTTAPDASGPQK[MT7].3y8_1.heavy 813.447 / 943.497 2342.0 21.1382999420166 48 18 10 10 10 5.738742038129193 17.425421692695494 0.0 3 0.9853155377775591 10.171862048921954 2342.0 25.61283727522367 0.0 - - - - - - - 177.0 4 3 PEX19 peroxisomal biogenesis factor 19 1835 233 C20140707_OR006_04 C20140707_OR006_04 TB412245.[MT7]-QMALSLEDTELQRK[MT7].3y7_1.heavy 650.69 / 1033.58 11528.0 32.59400177001953 43 13 10 10 10 1.526041640891798 43.68600756379595 0.0 3 0.9104584225298812 4.093123334239807 11528.0 104.0221875 0.0 - - - - - - - 244.36363636363637 23 11 RTKN rhotekin 1837 233 C20140707_OR006_04 C20140707_OR006_04 TB412245.[MT7]-QMALSLEDTELQRK[MT7].3y6_1.heavy 650.69 / 918.549 7429.0 32.59400177001953 43 13 10 10 10 1.526041640891798 43.68600756379595 0.0 3 0.9104584225298812 4.093123334239807 7429.0 20.894062500000004 0.0 - - - - - - - 201.14285714285714 14 7 RTKN rhotekin 1839 233 C20140707_OR006_04 C20140707_OR006_04 TB412245.[MT7]-QMALSLEDTELQRK[MT7].3b4_1.heavy 650.69 / 588.33 15243.0 32.59400177001953 43 13 10 10 10 1.526041640891798 43.68600756379595 0.0 3 0.9104584225298812 4.093123334239807 15243.0 109.54512073170733 0.0 - - - - - - - 230.4 30 5 RTKN rhotekin 1841 233 C20140707_OR006_04 C20140707_OR006_04 TB412245.[MT7]-QMALSLEDTELQRK[MT7].3y8_1.heavy 650.69 / 1162.62 7685.0 32.59400177001953 43 13 10 10 10 1.526041640891798 43.68600756379595 0.0 3 0.9104584225298812 4.093123334239807 7685.0 22.00651549631556 0.0 - - - - - - - 237.71428571428572 15 7 RTKN rhotekin 1843 234 C20140707_OR006_04 C20140707_OR006_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 240903.0 43.993900299072266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 240903.0 181.95132391557604 0.0 - - - - - - - 229.25 481 12 1845 234 C20140707_OR006_04 C20140707_OR006_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 338785.0 43.993900299072266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 338785.0 351.75429417245005 0.0 - - - - - - - 296.6666666666667 677 6 1847 234 C20140707_OR006_04 C20140707_OR006_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 285395.0 43.993900299072266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 285395.0 599.393527682442 0.0 - - - - - - - 212.5 570 8 1849 235 C20140707_OR006_04 C20140707_OR006_04 TB412388.[MT7]-FLEQVDQFYDDNFPMEIR.2b3_1.heavy 1225.58 / 534.304 1950.0 49.060001373291016 45 15 10 10 10 1.457952598789614 45.726223693426704 0.0 3 0.9504050961167853 5.518644227897097 1950.0 6.072664359861592 0.0 - - - - - - - 137.0 3 10 STAT4 signal transducer and activator of transcription 4 1851 235 C20140707_OR006_04 C20140707_OR006_04 TB412388.[MT7]-FLEQVDQFYDDNFPMEIR.2y5_1.heavy 1225.58 / 645.339 2094.0 49.060001373291016 45 15 10 10 10 1.457952598789614 45.726223693426704 0.0 3 0.9504050961167853 5.518644227897097 2094.0 0.828486646884273 1.0 - - - - - - - 192.5 4 6 STAT4 signal transducer and activator of transcription 4 1853 235 C20140707_OR006_04 C20140707_OR006_04 TB412388.[MT7]-FLEQVDQFYDDNFPMEIR.2b4_1.heavy 1225.58 / 662.363 1444.0 49.060001373291016 45 15 10 10 10 1.457952598789614 45.726223693426704 0.0 3 0.9504050961167853 5.518644227897097 1444.0 18.852222222222224 0.0 - - - - - - - 202.2 2 5 STAT4 signal transducer and activator of transcription 4 1855 235 C20140707_OR006_04 C20140707_OR006_04 TB412388.[MT7]-FLEQVDQFYDDNFPMEIR.2y7_1.heavy 1225.58 / 906.45 1300.0 49.060001373291016 45 15 10 10 10 1.457952598789614 45.726223693426704 0.0 3 0.9504050961167853 5.518644227897097 1300.0 4.349712714864507 0.0 - - - - - - - 208.44444444444446 2 9 STAT4 signal transducer and activator of transcription 4 1857 236 C20140707_OR006_04 C20140707_OR006_04 TB412244.[MT7]-YLC[CAM]IPAADSPSQNLTR.3y7_1.heavy 650.667 / 815.437 35376.0 35.67940139770508 46 16 10 10 10 4.4146032819552286 22.652092071047882 0.0 3 0.9676016136738493 6.8378743452241455 35376.0 62.235555555555564 0.0 - - - - - - - 708.75 70 8 DUSP22 dual specificity phosphatase 22 1859 236 C20140707_OR006_04 C20140707_OR006_04 TB412244.[MT7]-YLC[CAM]IPAADSPSQNLTR.3y6_1.heavy 650.667 / 718.384 12422.0 35.67940139770508 46 16 10 10 10 4.4146032819552286 22.652092071047882 0.0 3 0.9676016136738493 6.8378743452241455 12422.0 5.702341387213565 0.0 - - - - - - - 337.5 24 2 DUSP22 dual specificity phosphatase 22 1861 236 C20140707_OR006_04 C20140707_OR006_04 TB412244.[MT7]-YLC[CAM]IPAADSPSQNLTR.3b4_1.heavy 650.667 / 694.371 41587.0 35.67940139770508 46 16 10 10 10 4.4146032819552286 22.652092071047882 0.0 3 0.9676016136738493 6.8378743452241455 41587.0 77.84651503267973 0.0 - - - - - - - 297.0 83 5 DUSP22 dual specificity phosphatase 22 1863 236 C20140707_OR006_04 C20140707_OR006_04 TB412244.[MT7]-YLC[CAM]IPAADSPSQNLTR.3b3_1.heavy 650.667 / 581.287 52928.0 35.67940139770508 46 16 10 10 10 4.4146032819552286 22.652092071047882 0.0 3 0.9676016136738493 6.8378743452241455 52928.0 37.01469024561832 0.0 - - - - - - - 135.0 105 2 DUSP22 dual specificity phosphatase 22 1865 237 C20140707_OR006_04 C20140707_OR006_04 TB411606.[MT7]-LGGWIR.2b3_1.heavy 423.259 / 372.236 1865.0 34.87590026855469 47 17 10 10 10 1.9075170164513149 40.22143105783862 0.0 3 0.9795637586335516 8.618257362636841 1865.0 7.523101503759398 0.0 - - - - - - - 304.42857142857144 3 7 PPOX protoporphyrinogen oxidase 1867 237 C20140707_OR006_04 C20140707_OR006_04 TB411606.[MT7]-LGGWIR.2y5_1.heavy 423.259 / 588.325 9323.0 34.87590026855469 47 17 10 10 10 1.9075170164513149 40.22143105783862 0.0 3 0.9795637586335516 8.618257362636841 9323.0 6.18461851026485 1.0 - - - - - - - 221.66666666666666 21 3 PPOX protoporphyrinogen oxidase 1869 237 C20140707_OR006_04 C20140707_OR006_04 TB411606.[MT7]-LGGWIR.2b4_1.heavy 423.259 / 558.316 4528.0 34.87590026855469 47 17 10 10 10 1.9075170164513149 40.22143105783862 0.0 3 0.9795637586335516 8.618257362636841 4528.0 41.05840601503759 0.0 - - - - - - - 249.5 9 8 PPOX protoporphyrinogen oxidase 1871 237 C20140707_OR006_04 C20140707_OR006_04 TB411606.[MT7]-LGGWIR.2b5_1.heavy 423.259 / 671.4 1199.0 34.87590026855469 47 17 10 10 10 1.9075170164513149 40.22143105783862 0.0 3 0.9795637586335516 8.618257362636841 1199.0 2.9924392592053386 0.0 - - - - - - - 232.75 2 4 PPOX protoporphyrinogen oxidase 1873 238 C20140707_OR006_04 C20140707_OR006_04 TB437221.[MT7]-SAIIETYVMDSR.2y8_1.heavy 764.893 / 1000.44 10087.0 37.73320007324219 46 16 10 10 10 3.1279141688650958 31.97018671272655 0.0 3 0.9602949590818887 6.1729391566079626 10087.0 94.89071807228915 0.0 - - - - - - - 249.3 20 10 GRIPAP1 GRIP1 associated protein 1 1875 238 C20140707_OR006_04 C20140707_OR006_04 TB437221.[MT7]-SAIIETYVMDSR.2b4_1.heavy 764.893 / 529.347 7098.0 37.73320007324219 46 16 10 10 10 3.1279141688650958 31.97018671272655 0.0 3 0.9602949590818887 6.1729391566079626 7098.0 17.836457421232723 1.0 - - - - - - - 290.77777777777777 14 9 GRIPAP1 GRIP1 associated protein 1 1877 238 C20140707_OR006_04 C20140707_OR006_04 TB437221.[MT7]-SAIIETYVMDSR.2y9_1.heavy 764.893 / 1113.52 10461.0 37.73320007324219 46 16 10 10 10 3.1279141688650958 31.97018671272655 0.0 3 0.9602949590818887 6.1729391566079626 10461.0 38.831976206212815 0.0 - - - - - - - 218.375 20 8 GRIPAP1 GRIP1 associated protein 1 1879 238 C20140707_OR006_04 C20140707_OR006_04 TB437221.[MT7]-SAIIETYVMDSR.2y7_1.heavy 764.893 / 871.398 3487.0 37.73320007324219 46 16 10 10 10 3.1279141688650958 31.97018671272655 0.0 3 0.9602949590818887 6.1729391566079626 3487.0 9.578369612937287 0.0 - - - - - - - 231.57142857142858 6 7 GRIPAP1 GRIP1 associated protein 1 1881 239 C20140707_OR006_04 C20140707_OR006_04 TB437220.[MT7]-ILPGLYIGNFK[MT7].3b6_1.heavy 508.313 / 801.499 7377.0 44.555599212646484 47 17 10 10 10 2.327303455155708 30.21979229571727 0.0 3 0.9749446759807467 7.780390256756968 7377.0 102.10447409733125 0.0 - - - - - - - 264.625 14 8 LOC100509491;DUSP22 hypothetical protein LOC100509491;dual specificity phosphatase 22 1883 239 C20140707_OR006_04 C20140707_OR006_04 TB437220.[MT7]-ILPGLYIGNFK[MT7].3b4_1.heavy 508.313 / 525.352 26448.0 44.555599212646484 47 17 10 10 10 2.327303455155708 30.21979229571727 0.0 3 0.9749446759807467 7.780390256756968 26448.0 92.90147926686598 0.0 - - - - - - - 162.69230769230768 52 13 LOC100509491;DUSP22 hypothetical protein LOC100509491;dual specificity phosphatase 22 1885 239 C20140707_OR006_04 C20140707_OR006_04 TB437220.[MT7]-ILPGLYIGNFK[MT7].3b5_1.heavy 508.313 / 638.436 29508.0 44.555599212646484 47 17 10 10 10 2.327303455155708 30.21979229571727 0.0 3 0.9749446759807467 7.780390256756968 29508.0 192.05505384281372 0.0 - - - - - - - 295.61538461538464 59 13 LOC100509491;DUSP22 hypothetical protein LOC100509491;dual specificity phosphatase 22 1887 239 C20140707_OR006_04 C20140707_OR006_04 TB437220.[MT7]-ILPGLYIGNFK[MT7].3y4_1.heavy 508.313 / 609.348 23936.0 44.555599212646484 47 17 10 10 10 2.327303455155708 30.21979229571727 0.0 3 0.9749446759807467 7.780390256756968 23936.0 400.56563011456626 0.0 - - - - - - - 164.6 47 10 LOC100509491;DUSP22 hypothetical protein LOC100509491;dual specificity phosphatase 22 1889 240 C20140707_OR006_04 C20140707_OR006_04 TB436844.[MT7]-YLYPDIPK[MT7].3y3_1.heavy 432.92 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1891 240 C20140707_OR006_04 C20140707_OR006_04 TB436844.[MT7]-YLYPDIPK[MT7].3b5_1.heavy 432.92 / 796.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1893 240 C20140707_OR006_04 C20140707_OR006_04 TB436844.[MT7]-YLYPDIPK[MT7].3b3_1.heavy 432.92 / 584.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1895 240 C20140707_OR006_04 C20140707_OR006_04 TB436844.[MT7]-YLYPDIPK[MT7].3y5_2.heavy 432.92 / 357.219 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1897 241 C20140707_OR006_04 C20140707_OR006_04 TB436842.[MT7]-IHPSYTNYR.3y7_1.heavy 432.227 / 900.421 N/A 22.82979965209961 42 12 10 10 10 1.0704689108000334 62.27800358708427 0.0 3 0.8973976067733175 3.8194288742988705 0.0 0.0 9.0 - - - - - - - 0.0 1 0 PSG2 pregnancy specific beta-1-glycoprotein 2 1899 241 C20140707_OR006_04 C20140707_OR006_04 TB436842.[MT7]-IHPSYTNYR.3y6_1.heavy 432.227 / 803.368 4872.0 22.82979965209961 42 12 10 10 10 1.0704689108000334 62.27800358708427 0.0 3 0.8973976067733175 3.8194288742988705 4872.0 46.61676409441115 0.0 - - - - - - - 166.16666666666666 9 6 PSG2 pregnancy specific beta-1-glycoprotein 2 1901 241 C20140707_OR006_04 C20140707_OR006_04 TB436842.[MT7]-IHPSYTNYR.3y4_1.heavy 432.227 / 553.273 9190.0 22.82979965209961 42 12 10 10 10 1.0704689108000334 62.27800358708427 0.0 3 0.8973976067733175 3.8194288742988705 9190.0 48.71807228915662 0.0 - - - - - - - 210.4 18 10 PSG2 pregnancy specific beta-1-glycoprotein 2 1903 241 C20140707_OR006_04 C20140707_OR006_04 TB436842.[MT7]-IHPSYTNYR.3y5_1.heavy 432.227 / 716.336 5979.0 22.82979965209961 42 12 10 10 10 1.0704689108000334 62.27800358708427 0.0 3 0.8973976067733175 3.8194288742988705 5979.0 67.8411748616086 0.0 - - - - - - - 184.66666666666666 11 6 PSG2 pregnancy specific beta-1-glycoprotein 2 1905 242 C20140707_OR006_04 C20140707_OR006_04 TB449962.[MT7]-ADGIVSK[MT7].2y5_1.heavy 489.297 / 647.421 21450.0 23.38562536239624 39 14 10 5 10 1.6494601051932074 53.30611283934924 0.04110145568847656 3 0.9348522297963245 4.808682886751467 21450.0 -0.8094339622641513 0.0 - - - - - - - 230.0 42 6 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 1907 242 C20140707_OR006_04 C20140707_OR006_04 TB449962.[MT7]-ADGIVSK[MT7].2b4_1.heavy 489.297 / 501.279 12955.0 23.38562536239624 39 14 10 5 10 1.6494601051932074 53.30611283934924 0.04110145568847656 3 0.9348522297963245 4.808682886751467 12955.0 -0.3487213997308203 1.0 - - - - - - - 212.28571428571428 25 7 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 1909 242 C20140707_OR006_04 C20140707_OR006_04 TB449962.[MT7]-ADGIVSK[MT7].2y6_1.heavy 489.297 / 762.448 4035.0 23.38562536239624 39 14 10 5 10 1.6494601051932074 53.30611283934924 0.04110145568847656 3 0.9348522297963245 4.808682886751467 4035.0 12.171447549840197 2.0 - - - - - - - 194.66666666666666 8 6 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 1911 242 C20140707_OR006_04 C20140707_OR006_04 TB449962.[MT7]-ADGIVSK[MT7].2b5_1.heavy 489.297 / 600.347 3929.0 23.38562536239624 39 14 10 5 10 1.6494601051932074 53.30611283934924 0.04110145568847656 3 0.9348522297963245 4.808682886751467 3929.0 0.024257990867579904 3.0 - - - - - - - 239.0 7 8 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 1913 243 C20140707_OR006_04 C20140707_OR006_04 TB437229.[MT7]-VTFLIYNLFK[MT7].3y3_1.heavy 515.981 / 551.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1915 243 C20140707_OR006_04 C20140707_OR006_04 TB437229.[MT7]-VTFLIYNLFK[MT7].3b4_1.heavy 515.981 / 605.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1917 243 C20140707_OR006_04 C20140707_OR006_04 TB437229.[MT7]-VTFLIYNLFK[MT7].3b5_1.heavy 515.981 / 718.462 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1919 243 C20140707_OR006_04 C20140707_OR006_04 TB437229.[MT7]-VTFLIYNLFK[MT7].3y4_1.heavy 515.981 / 665.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - STAT4 signal transducer and activator of transcription 4 1921 244 C20140707_OR006_04 C20140707_OR006_04 TB449963.[MT7]-FWAFLR.2y4_1.heavy 492.283 / 506.309 9740.0 45.26250076293945 43 13 10 10 10 1.4500776877796457 46.745098650490576 0.0 3 0.924435708640063 4.460983377087913 9740.0 44.557701149425284 0.0 - - - - - - - 261.0 19 8 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1923 244 C20140707_OR006_04 C20140707_OR006_04 TB449963.[MT7]-FWAFLR.2b3_1.heavy 492.283 / 549.294 6783.0 45.26250076293945 43 13 10 10 10 1.4500776877796457 46.745098650490576 0.0 3 0.924435708640063 4.460983377087913 6783.0 149.6937931034483 0.0 - - - - - - - 87.0 13 2 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1925 244 C20140707_OR006_04 C20140707_OR006_04 TB449963.[MT7]-FWAFLR.2b5_2.heavy 492.283 / 405.227 6261.0 45.26250076293945 43 13 10 10 10 1.4500776877796457 46.745098650490576 0.0 3 0.924435708640063 4.460983377087913 6261.0 63.7408866995074 0.0 - - - - - - - 136.71428571428572 12 7 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1927 244 C20140707_OR006_04 C20140707_OR006_04 TB449963.[MT7]-FWAFLR.2y3_1.heavy 492.283 / 435.271 4174.0 45.26250076293945 43 13 10 10 10 1.4500776877796457 46.745098650490576 0.0 3 0.924435708640063 4.460983377087913 4174.0 33.112861024033435 0.0 - - - - - - - 253.0909090909091 8 11 LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 1929 245 C20140707_OR006_04 C20140707_OR006_04 TB437228.[MT7]-DLVK[MT7]PGDENLR.3y7_1.heavy 515.294 / 800.39 4762.0 24.774049758911133 32 11 8 5 8 1.7082011759881779 58.541114129693156 0.040699005126953125 4 0.8749241123753515 3.4525612794601974 4762.0 40.292624851852125 1.0 - - - - - - - 261.8 9 5 GRIPAP1 GRIP1 associated protein 1 1931 245 C20140707_OR006_04 C20140707_OR006_04 TB437228.[MT7]-DLVK[MT7]PGDENLR.3y6_1.heavy 515.294 / 703.337 714.0 24.774049758911133 32 11 8 5 8 1.7082011759881779 58.541114129693156 0.040699005126953125 4 0.8749241123753515 3.4525612794601974 714.0 6.720000000000001 2.0 - - - - - - - 0.0 1 0 GRIPAP1 GRIP1 associated protein 1 1933 245 C20140707_OR006_04 C20140707_OR006_04 TB437228.[MT7]-DLVK[MT7]PGDENLR.3y4_1.heavy 515.294 / 531.289 4762.0 24.774049758911133 32 11 8 5 8 1.7082011759881779 58.541114129693156 0.040699005126953125 4 0.8749241123753515 3.4525612794601974 4762.0 14.406050420168068 0.0 - - - - - - - 290.8888888888889 9 9 GRIPAP1 GRIP1 associated protein 1 1935 245 C20140707_OR006_04 C20140707_OR006_04 TB437228.[MT7]-DLVK[MT7]PGDENLR.3b7_2.heavy 515.294 / 507.297 3095.0 24.774049758911133 32 11 8 5 8 1.7082011759881779 58.541114129693156 0.040699005126953125 4 0.8749241123753515 3.4525612794601974 3095.0 6.791083099906629 1.0 - - - - - - - 255.0 13 7 GRIPAP1 GRIP1 associated protein 1 1937 246 C20140707_OR006_04 C20140707_OR006_04 TB449960.[MT7]-TWLQSPV.2b3_1.heavy 487.775 / 545.32 2305.0 39.31852436065674 35 9 10 6 10 0.599223558223193 89.24270992453344 0.038898468017578125 3 0.8128247388630246 2.806847466753327 2305.0 10.911788014948595 0.0 - - - - - - - 273.25 4 4 RTKN rhotekin 1939 246 C20140707_OR006_04 C20140707_OR006_04 TB449960.[MT7]-TWLQSPV.2b4_1.heavy 487.775 / 673.379 2791.0 39.31852436065674 35 9 10 6 10 0.599223558223193 89.24270992453344 0.038898468017578125 3 0.8128247388630246 2.806847466753327 2791.0 26.82788593000714 1.0 - - - - - - - 257.625 5 8 RTKN rhotekin 1941 246 C20140707_OR006_04 C20140707_OR006_04 TB449960.[MT7]-TWLQSPV.2y3_1.heavy 487.775 / 302.171 2912.0 39.31852436065674 35 9 10 6 10 0.599223558223193 89.24270992453344 0.038898468017578125 3 0.8128247388630246 2.806847466753327 2912.0 17.546446280991738 0.0 - - - - - - - 242.5 5 4 RTKN rhotekin 1943 246 C20140707_OR006_04 C20140707_OR006_04 TB449960.[MT7]-TWLQSPV.2b5_1.heavy 487.775 / 760.411 1092.0 39.31852436065674 35 9 10 6 10 0.599223558223193 89.24270992453344 0.038898468017578125 3 0.8128247388630246 2.806847466753327 1092.0 0.0 0.0 - - - - - - - 194.0 2 5 RTKN rhotekin 1945 247 C20140707_OR006_04 C20140707_OR006_04 TB437320.[MT7]-LYDLYIEEC[CAM]EK[MT7].2b3_1.heavy 881.944 / 536.284 3902.0 38.25620079040527 36 15 10 5 6 3.315638733488867 30.16010127700958 0.04599761962890625 5 0.9599090181484513 6.142954501077251 3902.0 29.74475409836065 0.0 - - - - - - - 188.54545454545453 7 11 FAM48A family with sequence similarity 48, member A 1947 247 C20140707_OR006_04 C20140707_OR006_04 TB437320.[MT7]-LYDLYIEEC[CAM]EK[MT7].2y8_1.heavy 881.944 / 1227.6 366.0 38.25620079040527 36 15 10 5 6 3.315638733488867 30.16010127700958 0.04599761962890625 5 0.9599090181484513 6.142954501077251 366.0 0.8069999999999999 26.0 - - - - - - - 299.45454545454544 2 11 FAM48A family with sequence similarity 48, member A 1949 247 C20140707_OR006_04 C20140707_OR006_04 TB437320.[MT7]-LYDLYIEEC[CAM]EK[MT7].2b4_1.heavy 881.944 / 649.368 1585.0 38.25620079040527 36 15 10 5 6 3.315638733488867 30.16010127700958 0.04599761962890625 5 0.9599090181484513 6.142954501077251 1585.0 2.2307694930229434 1.0 - - - - - - - 255.0909090909091 3 11 FAM48A family with sequence similarity 48, member A 1951 247 C20140707_OR006_04 C20140707_OR006_04 TB437320.[MT7]-LYDLYIEEC[CAM]EK[MT7].2y3_1.heavy 881.944 / 580.288 732.0 38.25620079040527 36 15 10 5 6 3.315638733488867 30.16010127700958 0.04599761962890625 5 0.9599090181484513 6.142954501077251 732.0 3.8999999999999995 7.0 - - - - - - - 216.88888888888889 3 9 FAM48A family with sequence similarity 48, member A 1953 248 C20140707_OR006_04 C20140707_OR006_04 TB436983.[MT7]-LLDFLQK[MT7].2y4_1.heavy 582.865 / 679.426 25914.0 43.16849899291992 48 18 10 10 10 4.512305454602945 22.16162026398086 0.0 3 0.9830216480253191 9.457976154967815 25914.0 113.07927272727272 0.0 - - - - - - - 313.7 51 10 FAM48A family with sequence similarity 48, member A 1955 248 C20140707_OR006_04 C20140707_OR006_04 TB436983.[MT7]-LLDFLQK[MT7].2y5_1.heavy 582.865 / 794.453 17001.0 43.16849899291992 48 18 10 10 10 4.512305454602945 22.16162026398086 0.0 3 0.9830216480253191 9.457976154967815 17001.0 82.30445014662757 0.0 - - - - - - - 247.78571428571428 34 14 FAM48A family with sequence similarity 48, member A 1957 248 C20140707_OR006_04 C20140707_OR006_04 TB436983.[MT7]-LLDFLQK[MT7].2y3_1.heavy 582.865 / 532.357 14855.0 43.16849899291992 48 18 10 10 10 4.512305454602945 22.16162026398086 0.0 3 0.9830216480253191 9.457976154967815 14855.0 53.117878787878794 0.0 - - - - - - - 241.85714285714286 29 14 FAM48A family with sequence similarity 48, member A 1959 248 C20140707_OR006_04 C20140707_OR006_04 TB436983.[MT7]-LLDFLQK[MT7].2y6_1.heavy 582.865 / 907.537 30701.0 43.16849899291992 48 18 10 10 10 4.512305454602945 22.16162026398086 0.0 3 0.9830216480253191 9.457976154967815 30701.0 236.44721774193548 0.0 - - - - - - - 235.07692307692307 61 13 FAM48A family with sequence similarity 48, member A 1961 249 C20140707_OR006_04 C20140707_OR006_04 TB412352.[MT7]-LTSLQQELLSALLSSGVTK[MT7].2y6_1.heavy 1138.67 / 722.417 2200.0 52.99554920196533 39 13 10 6 10 0.912773939882212 62.836354696305065 0.038600921630859375 3 0.9012017852423907 3.8935486591219854 2200.0 63.196078431372555 0.0 - - - - - - - 175.28571428571428 4 7 HNF1B HNF1 homeobox B 1963 249 C20140707_OR006_04 C20140707_OR006_04 TB412352.[MT7]-LTSLQQELLSALLSSGVTK[MT7].2b7_1.heavy 1138.67 / 944.517 1689.0 52.99554920196533 39 13 10 6 10 0.912773939882212 62.836354696305065 0.038600921630859375 3 0.9012017852423907 3.8935486591219854 1689.0 25.27048510313216 0.0 - - - - - - - 159.22222222222223 3 9 HNF1B HNF1 homeobox B 1965 249 C20140707_OR006_04 C20140707_OR006_04 TB412352.[MT7]-LTSLQQELLSALLSSGVTK[MT7].2b5_1.heavy 1138.67 / 687.416 921.0 52.99554920196533 39 13 10 6 10 0.912773939882212 62.836354696305065 0.038600921630859375 3 0.9012017852423907 3.8935486591219854 921.0 12.31283422459893 0.0 - - - - - - - 0.0 1 0 HNF1B HNF1 homeobox B 1967 249 C20140707_OR006_04 C20140707_OR006_04 TB412352.[MT7]-LTSLQQELLSALLSSGVTK[MT7].2y11_1.heavy 1138.67 / 1219.74 563.0 52.99554920196533 39 13 10 6 10 0.912773939882212 62.836354696305065 0.038600921630859375 3 0.9012017852423907 3.8935486591219854 563.0 7.727450980392156 2.0 - - - - - - - 0.0 1 0 HNF1B HNF1 homeobox B 1969 250 C20140707_OR006_04 C20140707_OR006_04 TB412114.[MT7]-QC[CAM]REQHAAELK[MT7].3b4_1.heavy 553.294 / 718.342 590.0 16.709299087524414 43 13 10 10 10 2.337556968175136 42.77970606126753 0.0 3 0.9295924190926119 4.623501237136162 590.0 4.654037267080746 0.0 - - - - - - - 0.0 1 0 GRIPAP1 GRIP1 associated protein 1 1971 250 C20140707_OR006_04 C20140707_OR006_04 TB412114.[MT7]-QC[CAM]REQHAAELK[MT7].3b5_1.heavy 553.294 / 846.401 966.0 16.709299087524414 43 13 10 10 10 2.337556968175136 42.77970606126753 0.0 3 0.9295924190926119 4.623501237136162 966.0 12.022429906542058 0.0 - - - - - - - 0.0 1 0 GRIPAP1 GRIP1 associated protein 1 1973 250 C20140707_OR006_04 C20140707_OR006_04 TB412114.[MT7]-QC[CAM]REQHAAELK[MT7].3y4_1.heavy 553.294 / 604.379 5205.0 16.709299087524414 43 13 10 10 10 2.337556968175136 42.77970606126753 0.0 3 0.9295924190926119 4.623501237136162 5205.0 71.21275120450456 0.0 - - - - - - - 175.72727272727272 10 11 GRIPAP1 GRIP1 associated protein 1 1975 250 C20140707_OR006_04 C20140707_OR006_04 TB412114.[MT7]-QC[CAM]REQHAAELK[MT7].3y5_1.heavy 553.294 / 675.416 2629.0 16.709299087524414 43 13 10 10 10 2.337556968175136 42.77970606126753 0.0 3 0.9295924190926119 4.623501237136162 2629.0 39.312149532710286 0.0 - - - - - - - 111.83333333333333 5 12 GRIPAP1 GRIP1 associated protein 1 1977 251 C20140707_OR006_04 C20140707_OR006_04 TB412251.[MT7]-LTILQSLGDPLYYGK[MT7].3y6_1.heavy 657.046 / 884.5 14029.0 48.0447998046875 50 20 10 10 10 18.145119900901978 5.511123682077685 0.0 3 0.9980147277324998 27.69366639238447 14029.0 74.40795580110498 0.0 - - - - - - - 211.92857142857142 28 14 FAM48A family with sequence similarity 48, member A 1979 251 C20140707_OR006_04 C20140707_OR006_04 TB412251.[MT7]-LTILQSLGDPLYYGK[MT7].3y3_1.heavy 657.046 / 511.3 27552.0 48.0447998046875 50 20 10 10 10 18.145119900901978 5.511123682077685 0.0 3 0.9980147277324998 27.69366639238447 27552.0 221.4431902805074 0.0 - - - - - - - 222.53846153846155 55 13 FAM48A family with sequence similarity 48, member A 1981 251 C20140707_OR006_04 C20140707_OR006_04 TB412251.[MT7]-LTILQSLGDPLYYGK[MT7].3b5_1.heavy 657.046 / 713.468 12366.0 48.0447998046875 50 20 10 10 10 18.145119900901978 5.511123682077685 0.0 3 0.9980147277324998 27.69366639238447 12366.0 99.81617795247453 0.0 - - - - - - - 155.92307692307693 24 13 FAM48A family with sequence similarity 48, member A 1983 251 C20140707_OR006_04 C20140707_OR006_04 TB412251.[MT7]-LTILQSLGDPLYYGK[MT7].3y4_1.heavy 657.046 / 674.363 25311.0 48.0447998046875 50 20 10 10 10 18.145119900901978 5.511123682077685 0.0 3 0.9980147277324998 27.69366639238447 25311.0 159.79755760368664 0.0 - - - - - - - 241.0 50 12 FAM48A family with sequence similarity 48, member A 1985 252 C20140707_OR006_04 C20140707_OR006_04 TB450499.[MT7]-DVLLLVHNLPQNLAGYIWYK[MT7].4b8_2.heavy 665.132 / 524.817 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG3;PSG4;PSG5 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 5 1987 252 C20140707_OR006_04 C20140707_OR006_04 TB450499.[MT7]-DVLLLVHNLPQNLAGYIWYK[MT7].4b4_1.heavy 665.132 / 585.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG3;PSG4;PSG5 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 5 1989 252 C20140707_OR006_04 C20140707_OR006_04 TB450499.[MT7]-DVLLLVHNLPQNLAGYIWYK[MT7].4b5_1.heavy 665.132 / 698.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG3;PSG4;PSG5 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 5 1991 252 C20140707_OR006_04 C20140707_OR006_04 TB450499.[MT7]-DVLLLVHNLPQNLAGYIWYK[MT7].4y3_1.heavy 665.132 / 640.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - PSG3;PSG4;PSG5 pregnancy specific beta-1-glycoprotein 3;pregnancy specific beta-1-glycoprotein 4;pregnancy specific beta-1-glycoprotein 5 1993 253 C20140707_OR006_04 C20140707_OR006_04 TB437493.[MT7]-EVLVQALEELLPSPNFGVK[MT7].2y8_1.heavy 1185.68 / 989.554 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 1995 253 C20140707_OR006_04 C20140707_OR006_04 TB437493.[MT7]-EVLVQALEELLPSPNFGVK[MT7].2b4_1.heavy 1185.68 / 585.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 1997 253 C20140707_OR006_04 C20140707_OR006_04 TB437493.[MT7]-EVLVQALEELLPSPNFGVK[MT7].2b6_1.heavy 1185.68 / 784.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 1999 253 C20140707_OR006_04 C20140707_OR006_04 TB437493.[MT7]-EVLVQALEELLPSPNFGVK[MT7].2y10_1.heavy 1185.68 / 1215.72 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 2001 254 C20140707_OR006_04 C20140707_OR006_04 TB437494.[MT7]-EVLVQALEELLPSPNFGVK[MT7].3b6_1.heavy 790.789 / 784.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 2003 254 C20140707_OR006_04 C20140707_OR006_04 TB437494.[MT7]-EVLVQALEELLPSPNFGVK[MT7].3b4_1.heavy 790.789 / 585.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 2005 254 C20140707_OR006_04 C20140707_OR006_04 TB437494.[MT7]-EVLVQALEELLPSPNFGVK[MT7].3b5_1.heavy 790.789 / 713.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 2007 254 C20140707_OR006_04 C20140707_OR006_04 TB437494.[MT7]-EVLVQALEELLPSPNFGVK[MT7].3y8_1.heavy 790.789 / 989.554 N/A N/A - - - - - - - - - 0.0 - - - - - - - HNF1B HNF1 homeobox B 2009 255 C20140707_OR006_04 C20140707_OR006_04 TB450290.[MT7]-ATLILNSIGSLSK[MT7].3b4_1.heavy 535.666 / 543.362 24439.0 41.972599029541016 46 16 10 10 10 2.869799015023889 27.237144859112682 0.0 3 0.9657639708597678 6.650798369907495 24439.0 100.26296969108569 0.0 - - - - - - - 169.28571428571428 48 7 TCF19 transcription factor 19 2011 255 C20140707_OR006_04 C20140707_OR006_04 TB450290.[MT7]-ATLILNSIGSLSK[MT7].3b5_1.heavy 535.666 / 656.446 14750.0 41.972599029541016 46 16 10 10 10 2.869799015023889 27.237144859112682 0.0 3 0.9657639708597678 6.650798369907495 14750.0 91.41622867017065 0.0 - - - - - - - 251.16666666666666 29 6 TCF19 transcription factor 19 2013 255 C20140707_OR006_04 C20140707_OR006_04 TB450290.[MT7]-ATLILNSIGSLSK[MT7].3y4_1.heavy 535.666 / 578.363 10443.0 41.972599029541016 46 16 10 10 10 2.869799015023889 27.237144859112682 0.0 3 0.9657639708597678 6.650798369907495 10443.0 70.81484343603303 0.0 - - - - - - - 242.25 20 8 TCF19 transcription factor 19 2015 255 C20140707_OR006_04 C20140707_OR006_04 TB450290.[MT7]-ATLILNSIGSLSK[MT7].3y5_1.heavy 535.666 / 635.385 40373.0 41.972599029541016 46 16 10 10 10 2.869799015023889 27.237144859112682 0.0 3 0.9657639708597678 6.650798369907495 40373.0 100.41024301718075 0.0 - - - - - - - 264.1818181818182 80 11 TCF19 transcription factor 19 2017 256 C20140707_OR006_04 C20140707_OR006_04 TB437358.[MT7]-DHASIQMNVAEVDK[MT7].3y7_1.heavy 615.652 / 918.501 16653.0 28.35099983215332 33 3 10 10 10 3.320847731796009 30.112792899997604 0.0 3 0.5559339398103106 1.778570351515085 16653.0 52.666666666666664 1.0 - - - - - - - 201.6 33 10 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 2019 256 C20140707_OR006_04 C20140707_OR006_04 TB437358.[MT7]-DHASIQMNVAEVDK[MT7].3b6_1.heavy 615.652 / 796.407 28134.0 28.35099983215332 33 3 10 10 10 3.320847731796009 30.112792899997604 0.0 3 0.5559339398103106 1.778570351515085 28134.0 60.34473744261169 0.0 - - - - - - - 204.75 56 8 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 2021 256 C20140707_OR006_04 C20140707_OR006_04 TB437358.[MT7]-DHASIQMNVAEVDK[MT7].3y3_1.heavy 615.652 / 505.31 40750.0 28.35099983215332 33 3 10 10 10 3.320847731796009 30.112792899997604 0.0 3 0.5559339398103106 1.778570351515085 40750.0 44.98617212770466 0.0 - - - - - - - 226.8 81 5 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 2023 256 C20140707_OR006_04 C20140707_OR006_04 TB437358.[MT7]-DHASIQMNVAEVDK[MT7].3y5_1.heavy 615.652 / 705.39 58665.0 28.35099983215332 33 3 10 10 10 3.320847731796009 30.112792899997604 0.0 3 0.5559339398103106 1.778570351515085 58665.0 42.48379260374571 0.0 - - - - - - - 336.0 117 6 LOC100291837;RPS21 40S ribosomal protein S21-like;ribosomal protein S21 2025 257 C20140707_OR006_04 C20140707_OR006_04 TB437355.[MT7]-ILAAANMPVQGPLEK[MT7].2y4_1.heavy 920.534 / 630.394 1235.0 37.31360054016113 36 11 10 5 10 2.050623682535292 48.76565156819257 0.046199798583984375 3 0.8734216400170207 3.431558737827727 1235.0 11.239344586314582 0.0 - - - - - - - 257.0 2 12 STAT4 signal transducer and activator of transcription 4 2027 257 C20140707_OR006_04 C20140707_OR006_04 TB437355.[MT7]-ILAAANMPVQGPLEK[MT7].2y8_1.heavy 920.534 / 1011.6 9384.0 37.31360054016113 36 11 10 5 10 2.050623682535292 48.76565156819257 0.046199798583984375 3 0.8734216400170207 3.431558737827727 9384.0 111.6251525624568 0.0 - - - - - - - 222.2 18 5 STAT4 signal transducer and activator of transcription 4 2029 257 C20140707_OR006_04 C20140707_OR006_04 TB437355.[MT7]-ILAAANMPVQGPLEK[MT7].2y5_1.heavy 920.534 / 687.416 3334.0 37.31360054016113 36 11 10 5 10 2.050623682535292 48.76565156819257 0.046199798583984375 3 0.8734216400170207 3.431558737827727 3334.0 19.29535627530364 0.0 - - - - - - - 283.8 6 10 STAT4 signal transducer and activator of transcription 4 2031 257 C20140707_OR006_04 C20140707_OR006_04 TB437355.[MT7]-ILAAANMPVQGPLEK[MT7].2b6_1.heavy 920.534 / 698.432 2964.0 37.31360054016113 36 11 10 5 10 2.050623682535292 48.76565156819257 0.046199798583984375 3 0.8734216400170207 3.431558737827727 2964.0 3.8666666666666663 1.0 - - - - - - - 432.0 5 4 STAT4 signal transducer and activator of transcription 4 2033 258 C20140707_OR006_04 C20140707_OR006_04 TB437357.[MT7]-EC[CAM]VGPPDPDLEPGETS.2b3_1.heavy 921.913 / 533.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 2035 258 C20140707_OR006_04 C20140707_OR006_04 TB437357.[MT7]-EC[CAM]VGPPDPDLEPGETS.2b4_1.heavy 921.913 / 590.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 2037 258 C20140707_OR006_04 C20140707_OR006_04 TB437357.[MT7]-EC[CAM]VGPPDPDLEPGETS.2b7_1.heavy 921.913 / 899.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 2039 258 C20140707_OR006_04 C20140707_OR006_04 TB437357.[MT7]-EC[CAM]VGPPDPDLEPGETS.2b9_1.heavy 921.913 / 1111.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIPAP1 GRIP1 associated protein 1 2041 259 C20140707_OR006_04 C20140707_OR006_04 TB437211.[MT7]-ILSY[MT7]MGELQR.3y6_1.heavy 499.949 / 733.366 663.0 34.8973503112793 34 11 10 5 8 2.225011901522529 44.94357982156055 0.04290008544921875 4 0.8708358183671137 3.3962676115217807 663.0 3.9926467241869723 2.0 - - - - - - - 265.3333333333333 2 3 RTKN rhotekin 2043 259 C20140707_OR006_04 C20140707_OR006_04 TB437211.[MT7]-ILSY[MT7]MGELQR.3y8_2.heavy 499.949 / 564.285 2255.0 34.8973503112793 34 11 10 5 8 2.225011901522529 44.94357982156055 0.04290008544921875 4 0.8708358183671137 3.3962676115217807 2255.0 9.103491809686245 0.0 - - - - - - - 252.1 4 10 RTKN rhotekin 2045 259 C20140707_OR006_04 C20140707_OR006_04 TB437211.[MT7]-ILSY[MT7]MGELQR.3y9_2.heavy 499.949 / 620.827 2521.0 34.8973503112793 34 11 10 5 8 2.225011901522529 44.94357982156055 0.04290008544921875 4 0.8708358183671137 3.3962676115217807 2521.0 4.74778906018276 0.0 - - - - - - - 265.0 5 3 RTKN rhotekin 2047 259 C20140707_OR006_04 C20140707_OR006_04 TB437211.[MT7]-ILSY[MT7]MGELQR.3y5_1.heavy 499.949 / 602.326 531.0 34.8973503112793 34 11 10 5 8 2.225011901522529 44.94357982156055 0.04290008544921875 4 0.8708358183671137 3.3962676115217807 531.0 3.7939849624060153 9.0 - - - - - - - 0.0 1 0 RTKN rhotekin 2049 260 C20140707_OR006_04 C20140707_OR006_04 TB437098.[MT7]-LFIPQITTK[MT7].3y3_1.heavy 450.286 / 493.31 24427.0 39.70249938964844 42 12 10 10 10 1.6685876575499032 45.881081555828416 0.0 3 0.8854383946502897 3.6108276867074514 24427.0 282.21485436893204 0.0 - - - - - - - 240.33333333333334 48 3 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 2051 260 C20140707_OR006_04 C20140707_OR006_04 TB437098.[MT7]-LFIPQITTK[MT7].3b5_1.heavy 450.286 / 743.457 3401.0 39.70249938964844 42 12 10 10 10 1.6685876575499032 45.881081555828416 0.0 3 0.8854383946502897 3.6108276867074514 3401.0 63.39728155339806 0.0 - - - - - - - 176.57142857142858 6 7 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 2053 260 C20140707_OR006_04 C20140707_OR006_04 TB437098.[MT7]-LFIPQITTK[MT7].3y4_1.heavy 450.286 / 606.394 7833.0 39.70249938964844 42 12 10 10 10 1.6685876575499032 45.881081555828416 0.0 3 0.8854383946502897 3.6108276867074514 7833.0 95.06067961165047 0.0 - - - - - - - 154.5 15 2 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 2055 260 C20140707_OR006_04 C20140707_OR006_04 TB437098.[MT7]-LFIPQITTK[MT7].3b3_1.heavy 450.286 / 518.346 14532.0 39.70249938964844 42 12 10 10 10 1.6685876575499032 45.881081555828416 0.0 3 0.8854383946502897 3.6108276867074514 14532.0 136.85475728155342 0.0 - - - - - - - 180.25 29 8 PSG8;PSG3 pregnancy specific beta-1-glycoprotein 8;pregnancy specific beta-1-glycoprotein 3 2057 261 C20140707_OR006_04 C20140707_OR006_04 TB437214.[MT7]-TFSEWLESVK[MT7].2y4_1.heavy 757.411 / 606.358 1142.0 44.21044921875 39 18 10 3 8 4.233746104609255 23.61974420032665 0.07080078125 4 0.9804980445978853 8.822973074089612 1142.0 6.246040816326531 1.0 - - - - - - - 249.33333333333334 3 18 C6 complement component 6 2059 261 C20140707_OR006_04 C20140707_OR006_04 TB437214.[MT7]-TFSEWLESVK[MT7].2y5_1.heavy 757.411 / 719.442 2203.0 44.21044921875 39 18 10 3 8 4.233746104609255 23.61974420032665 0.07080078125 4 0.9804980445978853 8.822973074089612 2203.0 3.239705882352941 0.0 - - - - - - - 244.78947368421052 4 19 C6 complement component 6 2061 261 C20140707_OR006_04 C20140707_OR006_04 TB437214.[MT7]-TFSEWLESVK[MT7].2b4_1.heavy 757.411 / 609.3 2285.0 44.21044921875 39 18 10 3 8 4.233746104609255 23.61974420032665 0.07080078125 4 0.9804980445978853 8.822973074089612 2285.0 10.259183673469387 0.0 - - - - - - - 292.88235294117646 4 17 C6 complement component 6 2063 261 C20140707_OR006_04 C20140707_OR006_04 TB437214.[MT7]-TFSEWLESVK[MT7].2y6_1.heavy 757.411 / 905.521 1305.0 44.21044921875 39 18 10 3 8 4.233746104609255 23.61974420032665 0.07080078125 4 0.9804980445978853 8.822973074089612 1305.0 2.4018404907975457 3.0 - - - - - - - 234.0 2 15 C6 complement component 6 2065 262 C20140707_OR006_04 C20140707_OR006_04 TB449950.[MT7]-GDIVEK[MT7].2y4_1.heavy 474.784 / 632.41 918.0 20.765100479125977 39 18 6 5 10 4.241791309377843 23.574945749668977 0.04000091552734375 3 0.9850545798827969 10.082446471617777 918.0 11.459999999999999 1.0 - - - - - - - 0.0 1 0 SLC12A4 solute carrier family 12 (potassium/chloride transporters), member 4 2067 262 C20140707_OR006_04 C20140707_OR006_04 TB449950.[MT7]-GDIVEK[MT7].2b4_1.heavy 474.784 / 529.31 1632.0 20.765100479125977 39 18 6 5 10 4.241791309377843 23.574945749668977 0.04000091552734375 3 0.9850545798827969 10.082446471617777 1632.0 18.986666666666668 0.0 - - - - - - - 233.14285714285714 3 7 SLC12A4 solute carrier family 12 (potassium/chloride transporters), member 4 2069 262 C20140707_OR006_04 C20140707_OR006_04 TB449950.[MT7]-GDIVEK[MT7].2y3_1.heavy 474.784 / 519.326 1938.0 20.765100479125977 39 18 6 5 10 4.241791309377843 23.574945749668977 0.04000091552734375 3 0.9850545798827969 10.082446471617777 1938.0 11.97 0.0 - - - - - - - 166.9090909090909 3 11 SLC12A4 solute carrier family 12 (potassium/chloride transporters), member 4 2071 262 C20140707_OR006_04 C20140707_OR006_04 TB449950.[MT7]-GDIVEK[MT7].2b5_1.heavy 474.784 / 658.353 612.0 20.765100479125977 39 18 6 5 10 4.241791309377843 23.574945749668977 0.04000091552734375 3 0.9850545798827969 10.082446471617777 612.0 2.5999999999999996 9.0 - - - - - - - 204.0 5 9 SLC12A4 solute carrier family 12 (potassium/chloride transporters), member 4 2073 263 C20140707_OR006_04 C20140707_OR006_04 TB436953.[MT7]-ETLSGLAK[MT7].2y4_1.heavy 553.837 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - PEX19 peroxisomal biogenesis factor 19 2075 263 C20140707_OR006_04 C20140707_OR006_04 TB436953.[MT7]-ETLSGLAK[MT7].2y5_1.heavy 553.837 / 619.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - PEX19 peroxisomal biogenesis factor 19 2077 263 C20140707_OR006_04 C20140707_OR006_04 TB436953.[MT7]-ETLSGLAK[MT7].2b5_1.heavy 553.837 / 632.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - PEX19 peroxisomal biogenesis factor 19 2079 263 C20140707_OR006_04 C20140707_OR006_04 TB436953.[MT7]-ETLSGLAK[MT7].2y7_1.heavy 553.837 / 833.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - PEX19 peroxisomal biogenesis factor 19 2081 264 C20140707_OR006_04 C20140707_OR006_04 TB437488.[MT7]-FQLSSAFQQQQQQIQQLR.3y7_1.heavy 784.084 / 913.521 7334.0 39.308799743652344 48 18 10 10 10 3.849118821261807 25.979972207565755 0.0 3 0.985079118041588 10.090754364793945 7334.0 40.50755813953488 0.0 - - - - - - - 176.53846153846155 14 13 FAM48A family with sequence similarity 48, member A 2083 264 C20140707_OR006_04 C20140707_OR006_04 TB437488.[MT7]-FQLSSAFQQQQQQIQQLR.3b6_1.heavy 784.084 / 778.422 7907.0 39.308799743652344 48 18 10 10 10 3.849118821261807 25.979972207565755 0.0 3 0.985079118041588 10.090754364793945 7907.0 10.811918131051797 0.0 - - - - - - - 802.25 15 8 FAM48A family with sequence similarity 48, member A 2085 264 C20140707_OR006_04 C20140707_OR006_04 TB437488.[MT7]-FQLSSAFQQQQQQIQQLR.3y4_1.heavy 784.084 / 544.32 9856.0 39.308799743652344 48 18 10 10 10 3.849118821261807 25.979972207565755 0.0 3 0.985079118041588 10.090754364793945 9856.0 66.67338275616939 0.0 - - - - - - - 246.92307692307693 19 13 FAM48A family with sequence similarity 48, member A 2087 264 C20140707_OR006_04 C20140707_OR006_04 TB437488.[MT7]-FQLSSAFQQQQQQIQQLR.3b3_1.heavy 784.084 / 533.32 8251.0 39.308799743652344 48 18 10 10 10 3.849118821261807 25.979972207565755 0.0 3 0.985079118041588 10.090754364793945 8251.0 49.72218340611353 0.0 - - - - - - - 267.3333333333333 16 9 FAM48A family with sequence similarity 48, member A 2089 265 C20140707_OR006_04 C20140707_OR006_04 TB412264.[MT7]-DDLNSQLQESLRANSR.3y15_2.heavy 664.007 / 865.943 5795.0 31.514599323272705 43 17 10 6 10 2.359736919487788 36.084883318651684 0.03999900817871094 3 0.9720292501826601 7.361948732959915 5795.0 23.53260582010582 0.0 - - - - - - - 283.5 11 8 GRIPAP1 GRIP1 associated protein 1 2091 265 C20140707_OR006_04 C20140707_OR006_04 TB412264.[MT7]-DDLNSQLQESLRANSR.3b4_1.heavy 664.007 / 602.29 5795.0 31.514599323272705 43 17 10 6 10 2.359736919487788 36.084883318651684 0.03999900817871094 3 0.9720292501826601 7.361948732959915 5795.0 11.140299823633157 0.0 - - - - - - - 661.5 11 8 GRIPAP1 GRIP1 associated protein 1 2093 265 C20140707_OR006_04 C20140707_OR006_04 TB412264.[MT7]-DDLNSQLQESLRANSR.3y14_2.heavy 664.007 / 808.429 5669.0 31.514599323272705 43 17 10 6 10 2.359736919487788 36.084883318651684 0.03999900817871094 3 0.9720292501826601 7.361948732959915 5669.0 13.111972789115647 0.0 - - - - - - - 198.0 11 7 GRIPAP1 GRIP1 associated protein 1 2095 265 C20140707_OR006_04 C20140707_OR006_04 TB412264.[MT7]-DDLNSQLQESLRANSR.3y13_2.heavy 664.007 / 751.887 4535.0 31.514599323272705 43 17 10 6 10 2.359736919487788 36.084883318651684 0.03999900817871094 3 0.9720292501826601 7.361948732959915 4535.0 17.096230158730158 0.0 - - - - - - - 173.25 9 8 GRIPAP1 GRIP1 associated protein 1 2097 266 C20140707_OR006_04 C20140707_OR006_04 TB412267.[MT7]-EALVEEC[CAM]NRAEC[CAM]LQR.3y6_1.heavy 674.327 / 776.372 3705.0 26.461100578308105 36 13 10 5 8 1.9162501367703249 42.78447797384325 0.04260063171386719 4 0.9214770488182734 4.37502362993253 3705.0 34.67514876291889 0.0 - - - - - - - 370.5 7 2 HNF1B HNF1 homeobox B 2099 266 C20140707_OR006_04 C20140707_OR006_04 TB412267.[MT7]-EALVEEC[CAM]NRAEC[CAM]LQR.3b4_1.heavy 674.327 / 557.341 2717.0 26.461100578308105 36 13 10 5 8 1.9162501367703249 42.78447797384325 0.04260063171386719 4 0.9214770488182734 4.37502362993253 2717.0 7.333333333333334 1.0 - - - - - - - 309.0 15 8 HNF1B HNF1 homeobox B 2101 266 C20140707_OR006_04 C20140707_OR006_04 TB412267.[MT7]-EALVEEC[CAM]NRAEC[CAM]LQR.3y14_2.heavy 674.327 / 874.414 7287.0 26.461100578308105 36 13 10 5 8 1.9162501367703249 42.78447797384325 0.04260063171386719 4 0.9214770488182734 4.37502362993253 7287.0 25.650680874168586 0.0 - - - - - - - 309.0 14 4 HNF1B HNF1 homeobox B 2103 266 C20140707_OR006_04 C20140707_OR006_04 TB412267.[MT7]-EALVEEC[CAM]NRAEC[CAM]LQR.3y4_1.heavy 674.327 / 576.292 2470.0 26.461100578308105 36 13 10 5 8 1.9162501367703249 42.78447797384325 0.04260063171386719 4 0.9214770488182734 4.37502362993253 2470.0 11.977169811320756 0.0 - - - - - - - 262.875 4 8 HNF1B HNF1 homeobox B 2105 267 C20140707_OR006_04 C20140707_OR006_04 TB450095.[MT7]-DVLYPSLK[MT7].2y4_1.heavy 611.868 / 588.384 25632.0 33.18544960021973 40 15 10 5 10 1.0898189144551578 57.15338026331076 0.046100616455078125 3 0.9523837327132979 5.633083146217737 25632.0 49.65542378773286 0.0 - - - - - - - 234.71428571428572 51 7 PEX19 peroxisomal biogenesis factor 19 2107 267 C20140707_OR006_04 C20140707_OR006_04 TB450095.[MT7]-DVLYPSLK[MT7].2y5_1.heavy 611.868 / 751.447 7071.0 33.18544960021973 40 15 10 5 10 1.0898189144551578 57.15338026331076 0.046100616455078125 3 0.9523837327132979 5.633083146217737 7071.0 18.817247071909144 0.0 - - - - - - - 227.4 14 5 PEX19 peroxisomal biogenesis factor 19 2109 267 C20140707_OR006_04 C20140707_OR006_04 TB450095.[MT7]-DVLYPSLK[MT7].2b4_1.heavy 611.868 / 635.352 10354.0 33.18544960021973 40 15 10 5 10 1.0898189144551578 57.15338026331076 0.046100616455078125 3 0.9523837327132979 5.633083146217737 10354.0 14.35388404685539 0.0 - - - - - - - 294.8888888888889 20 9 PEX19 peroxisomal biogenesis factor 19 2111 267 C20140707_OR006_04 C20140707_OR006_04 TB450095.[MT7]-DVLYPSLK[MT7].2y6_1.heavy 611.868 / 864.531 2525.0 33.18544960021973 40 15 10 5 10 1.0898189144551578 57.15338026331076 0.046100616455078125 3 0.9523837327132979 5.633083146217737 2525.0 12.525065963060685 0.0 - - - - - - - 280.77777777777777 5 9 PEX19 peroxisomal biogenesis factor 19 2113 268 C20140707_OR006_04 C20140707_OR006_04 TB412269.[MT7]-TLFYVESLEEEVVPGMDFPGPHEK[MT7].3b9_1.heavy 1013.18 / 1226.64 1747.0 48.119399070739746 43 20 10 3 10 6.532665576840056 15.307687011336562 0.07300186157226562 3 0.994210682707968 16.212087851116717 1747.0 7.897039427087432 0.0 - - - - - - - 212.41666666666666 3 12 KLHL1 kelch-like 1 (Drosophila) 2115 268 C20140707_OR006_04 C20140707_OR006_04 TB412269.[MT7]-TLFYVESLEEEVVPGMDFPGPHEK[MT7].3y6_1.heavy 1013.18 / 808.443 7353.0 48.119399070739746 43 20 10 3 10 6.532665576840056 15.307687011336562 0.07300186157226562 3 0.994210682707968 16.212087851116717 7353.0 31.128260869565217 0.0 - - - - - - - 227.0 14 17 KLHL1 kelch-like 1 (Drosophila) 2117 268 C20140707_OR006_04 C20140707_OR006_04 TB412269.[MT7]-TLFYVESLEEEVVPGMDFPGPHEK[MT7].3b4_1.heavy 1013.18 / 669.373 7208.0 48.119399070739746 43 20 10 3 10 6.532665576840056 15.307687011336562 0.07300186157226562 3 0.994210682707968 16.212087851116717 7208.0 59.41033789954338 0.0 - - - - - - - 198.54545454545453 14 11 KLHL1 kelch-like 1 (Drosophila) 2119 268 C20140707_OR006_04 C20140707_OR006_04 TB412269.[MT7]-TLFYVESLEEEVVPGMDFPGPHEK[MT7].3b3_1.heavy 1013.18 / 506.31 5023.0 48.119399070739746 43 20 10 3 10 6.532665576840056 15.307687011336562 0.07300186157226562 3 0.994210682707968 16.212087851116717 5023.0 40.7707601987054 0.0 - - - - - - - 197.71428571428572 10 14 KLHL1 kelch-like 1 (Drosophila) 2121 269 C20140707_OR006_04 C20140707_OR006_04 TB412361.[MT7]-VQQAGEMQNWAQVHGVLK[MT7].4y5_1.heavy 578.561 / 697.448 14688.0 34.486698150634766 48 18 10 10 10 4.832682286929886 20.692442429011436 0.0 3 0.9890315625597397 11.773137787549288 14688.0 43.11815135253532 0.0 - - - - - - - 294.22222222222223 29 9 RTKN rhotekin 2123 269 C20140707_OR006_04 C20140707_OR006_04 TB412361.[MT7]-VQQAGEMQNWAQVHGVLK[MT7].4y4_1.heavy 578.561 / 560.389 22627.0 34.486698150634766 48 18 10 10 10 4.832682286929886 20.692442429011436 0.0 3 0.9890315625597397 11.773137787549288 22627.0 11.040194384449245 1.0 - - - - - - - 1279.4444444444443 45 9 RTKN rhotekin 2125 269 C20140707_OR006_04 C20140707_OR006_04 TB412361.[MT7]-VQQAGEMQNWAQVHGVLK[MT7].4b5_1.heavy 578.561 / 628.354 12570.0 34.486698150634766 48 18 10 10 10 4.832682286929886 20.692442429011436 0.0 3 0.9890315625597397 11.773137787549288 12570.0 27.561549837326236 0.0 - - - - - - - 566.8571428571429 25 7 RTKN rhotekin 2127 269 C20140707_OR006_04 C20140707_OR006_04 TB412361.[MT7]-VQQAGEMQNWAQVHGVLK[MT7].4b6_1.heavy 578.561 / 757.396 25273.0 34.486698150634766 48 18 10 10 10 4.832682286929886 20.692442429011436 0.0 3 0.9890315625597397 11.773137787549288 25273.0 180.32589027423262 0.0 - - - - - - - 694.625 50 8 RTKN rhotekin 2129 270 C20140707_OR006_04 C20140707_OR006_04 TB412126.[MT7]-LQQGAPGQGTQQPAR.3y7_1.heavy 560.968 / 757.395 23862.0 19.639999389648438 46 16 10 10 10 3.086619448359617 25.6536542890178 0.0 3 0.9688810992721381 6.977784209859424 23862.0 166.9321301229508 0.0 - - - - - - - 205.75 47 4 KLHL1 kelch-like 1 (Drosophila) 2131 270 C20140707_OR006_04 C20140707_OR006_04 TB412126.[MT7]-LQQGAPGQGTQQPAR.3b4_1.heavy 560.968 / 571.332 32091.0 19.639999389648438 46 16 10 10 10 3.086619448359617 25.6536542890178 0.0 3 0.9688810992721381 6.977784209859424 32091.0 383.2719699386101 0.0 - - - - - - - 198.0 64 6 KLHL1 kelch-like 1 (Drosophila) 2133 270 C20140707_OR006_04 C20140707_OR006_04 TB412126.[MT7]-LQQGAPGQGTQQPAR.3b5_1.heavy 560.968 / 642.369 51565.0 19.639999389648438 46 16 10 10 10 3.086619448359617 25.6536542890178 0.0 3 0.9688810992721381 6.977784209859424 51565.0 390.09630639356214 0.0 - - - - - - - 274.22222222222223 103 9 KLHL1 kelch-like 1 (Drosophila) 2135 270 C20140707_OR006_04 C20140707_OR006_04 TB412126.[MT7]-LQQGAPGQGTQQPAR.3y9_1.heavy 560.968 / 942.475 11885.0 19.639999389648438 46 16 10 10 10 3.086619448359617 25.6536542890178 0.0 3 0.9688810992721381 6.977784209859424 11885.0 245.53626373626372 0.0 - - - - - - - 152.0 23 6 KLHL1 kelch-like 1 (Drosophila) 2137 271 C20140707_OR006_04 C20140707_OR006_04 TB412121.[MT7]-GADALWMATLPIK[MT7].3b6_1.heavy 558.988 / 758.395 11972.0 44.97380065917969 46 16 10 10 10 2.8096977865657333 28.1739476348086 0.0 3 0.9640514168375115 6.489508379863315 11972.0 55.909847715736035 0.0 - - - - - - - 215.0 23 11 LRDD leucine-rich repeats and death domain containing 2139 271 C20140707_OR006_04 C20140707_OR006_04 TB412121.[MT7]-GADALWMATLPIK[MT7].3y3_1.heavy 558.988 / 501.352 42058.0 44.97380065917969 46 16 10 10 10 2.8096977865657333 28.1739476348086 0.0 3 0.9640514168375115 6.489508379863315 42058.0 300.86971603443635 0.0 - - - - - - - 189.13333333333333 84 15 LRDD leucine-rich repeats and death domain containing 2141 271 C20140707_OR006_04 C20140707_OR006_04 TB412121.[MT7]-GADALWMATLPIK[MT7].3b5_1.heavy 558.988 / 572.316 28827.0 44.97380065917969 46 16 10 10 10 2.8096977865657333 28.1739476348086 0.0 3 0.9640514168375115 6.489508379863315 28827.0 61.00285492645577 0.0 - - - - - - - 269.25 57 12 LRDD leucine-rich repeats and death domain containing 2143 271 C20140707_OR006_04 C20140707_OR006_04 TB412121.[MT7]-GADALWMATLPIK[MT7].3b7_1.heavy 558.988 / 889.436 2599.0 44.97380065917969 46 16 10 10 10 2.8096977865657333 28.1739476348086 0.0 3 0.9640514168375115 6.489508379863315 2599.0 31.253797468354428 0.0 - - - - - - - 157.66666666666666 5 6 LRDD leucine-rich repeats and death domain containing 2145 272 C20140707_OR006_04 C20140707_OR006_04 TB412122.[MT7]-GADALWMATLPIK[MT7].2b8_1.heavy 837.978 / 960.473 786.0 44.99205017089844 41 17 10 6 8 4.613441426881351 21.675792699420743 0.0364990234375 4 0.9781745041878548 8.338486687752562 786.0 3.084432689193566 0.0 - - - - - - - 0.0 1 0 LRDD leucine-rich repeats and death domain containing 2147 272 C20140707_OR006_04 C20140707_OR006_04 TB412122.[MT7]-GADALWMATLPIK[MT7].2b6_1.heavy 837.978 / 758.395 1258.0 44.99205017089844 41 17 10 6 8 4.613441426881351 21.675792699420743 0.0364990234375 4 0.9781745041878548 8.338486687752562 1258.0 17.136104168346368 0.0 - - - - - - - 193.0 2 11 LRDD leucine-rich repeats and death domain containing 2149 272 C20140707_OR006_04 C20140707_OR006_04 TB412122.[MT7]-GADALWMATLPIK[MT7].2y3_1.heavy 837.978 / 501.352 3617.0 44.99205017089844 41 17 10 6 8 4.613441426881351 21.675792699420743 0.0364990234375 4 0.9781745041878548 8.338486687752562 3617.0 17.075507237984944 0.0 - - - - - - - 209.66666666666666 7 12 LRDD leucine-rich repeats and death domain containing 2151 272 C20140707_OR006_04 C20140707_OR006_04 TB412122.[MT7]-GADALWMATLPIK[MT7].2b5_1.heavy 837.978 / 572.316 3066.0 44.99205017089844 41 17 10 6 8 4.613441426881351 21.675792699420743 0.0364990234375 4 0.9781745041878548 8.338486687752562 3066.0 71.79873417721518 2.0 - - - - - - - 166.11111111111111 6 9 LRDD leucine-rich repeats and death domain containing 2153 273 C20140707_OR006_04 C20140707_OR006_04 TB412129.[MT7]-GYVPSVFIPISTIR.2y8_1.heavy 846.994 / 946.572 1999.0 45.2004508972168 40 14 10 6 10 3.1896781832854395 31.351125177461565 0.035400390625 3 0.9372072825796361 4.89901267099069 1999.0 8.733465352614289 0.0 - - - - - - - 167.9090909090909 3 11 STAT4 signal transducer and activator of transcription 4 2155 273 C20140707_OR006_04 C20140707_OR006_04 TB412129.[MT7]-GYVPSVFIPISTIR.2y6_1.heavy 846.994 / 686.42 3459.0 45.2004508972168 40 14 10 6 10 3.1896781832854395 31.351125177461565 0.035400390625 3 0.9372072825796361 4.89901267099069 3459.0 33.99103896103896 0.0 - - - - - - - 225.28571428571428 6 14 STAT4 signal transducer and activator of transcription 4 2157 273 C20140707_OR006_04 C20140707_OR006_04 TB412129.[MT7]-GYVPSVFIPISTIR.2y11_1.heavy 846.994 / 1229.73 6919.0 45.2004508972168 40 14 10 6 10 3.1896781832854395 31.351125177461565 0.035400390625 3 0.9372072825796361 4.89901267099069 6919.0 21.168620944293167 0.0 - - - - - - - 225.66666666666666 13 15 STAT4 signal transducer and activator of transcription 4 2159 273 C20140707_OR006_04 C20140707_OR006_04 TB412129.[MT7]-GYVPSVFIPISTIR.2y7_1.heavy 846.994 / 799.504 1076.0 45.2004508972168 40 14 10 6 10 3.1896781832854395 31.351125177461565 0.035400390625 3 0.9372072825796361 4.89901267099069 1076.0 0.0 0.0 - - - - - - - 192.33333333333334 2 12 STAT4 signal transducer and activator of transcription 4 2161 274 C20140707_OR006_04 C20140707_OR006_04 TB436960.[MT7]-C[CAM]FLDFK[MT7].2y4_1.heavy 559.301 / 666.394 1502.0 37.27510070800781 31 18 4 1 8 3.497215125018939 28.594180347844187 0.09239959716796875 4 0.9842343567075247 9.815994076494327 1502.0 6.388506666666666 2.0 - - - - - - - 203.125 5 8 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 2163 274 C20140707_OR006_04 C20140707_OR006_04 TB436960.[MT7]-C[CAM]FLDFK[MT7].2y5_1.heavy 559.301 / 813.463 2753.0 37.27510070800781 31 18 4 1 8 3.497215125018939 28.594180347844187 0.09239959716796875 4 0.9842343567075247 9.815994076494327 2753.0 15.571759281437124 0.0 - - - - - - - 187.5 5 6 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 2165 274 C20140707_OR006_04 C20140707_OR006_04 TB436960.[MT7]-C[CAM]FLDFK[MT7].2b4_1.heavy 559.301 / 680.319 3253.0 37.27510070800781 31 18 4 1 8 3.497215125018939 28.594180347844187 0.09239959716796875 4 0.9842343567075247 9.815994076494327 3253.0 24.460897124600642 0.0 - - - - - - - 166.66666666666666 6 6 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 2167 274 C20140707_OR006_04 C20140707_OR006_04 TB436960.[MT7]-C[CAM]FLDFK[MT7].2y3_1.heavy 559.301 / 553.31 N/A 37.27510070800781 31 18 4 1 8 3.497215125018939 28.594180347844187 0.09239959716796875 4 0.9842343567075247 9.815994076494327 3253.0 7.363595497647813 3.0 - - - - - - - 270.8333333333333 11 6 SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 2169 275 C20140707_OR006_04 C20140707_OR006_04 TB437087.[MT7]-EEYGESPLQDAEEAK[MT7].3b6_1.heavy 661.653 / 839.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 2171 275 C20140707_OR006_04 C20140707_OR006_04 TB437087.[MT7]-EEYGESPLQDAEEAK[MT7].3b4_1.heavy 661.653 / 623.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 2173 275 C20140707_OR006_04 C20140707_OR006_04 TB437087.[MT7]-EEYGESPLQDAEEAK[MT7].3b5_1.heavy 661.653 / 752.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 2175 275 C20140707_OR006_04 C20140707_OR006_04 TB437087.[MT7]-EEYGESPLQDAEEAK[MT7].3b3_1.heavy 661.653 / 566.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100134291;DUSP22 dual specificity protein phosphatase 22-like;dual specificity phosphatase 22 2177 276 C20140707_OR006_04 C20140707_OR006_04 TB449944.[MT7]-DTVDGQR.2y4_1.heavy 467.739 / 475.226 1436.0 14.974100112915039 50 20 10 10 10 5.382802968610972 18.57768166197711 0.0 3 0.9911075665470794 13.077649817431437 1436.0 6.674624216540019 1.0 - - - - - - - 157.94117647058823 2 17 GRIPAP1 GRIP1 associated protein 1 2179 276 C20140707_OR006_04 C20140707_OR006_04 TB449944.[MT7]-DTVDGQR.2y5_1.heavy 467.739 / 574.294 895.0 14.974100112915039 50 20 10 10 10 5.382802968610972 18.57768166197711 0.0 3 0.9911075665470794 13.077649817431437 895.0 19.593763440860215 0.0 - - - - - - - 0.0 1 0 GRIPAP1 GRIP1 associated protein 1 2181 276 C20140707_OR006_04 C20140707_OR006_04 TB449944.[MT7]-DTVDGQR.2b4_1.heavy 467.739 / 575.279 4549.0 14.974100112915039 50 20 10 10 10 5.382802968610972 18.57768166197711 0.0 3 0.9911075665470794 13.077649817431437 4549.0 70.9042096692112 0.0 - - - - - - - 114.0 9 18 GRIPAP1 GRIP1 associated protein 1 2183 276 C20140707_OR006_04 C20140707_OR006_04 TB449944.[MT7]-DTVDGQR.2y6_1.heavy 467.739 / 675.342 3897.0 14.974100112915039 50 20 10 10 10 5.382802968610972 18.57768166197711 0.0 3 0.9911075665470794 13.077649817431437 3897.0 70.70421082949309 0.0 - - - - - - - 82.57894736842105 7 19 GRIPAP1 GRIP1 associated protein 1 2185 277 C20140707_OR006_04 C20140707_OR006_04 TB437200.[MT7]-AQEAAATQLGLK[MT7].2y4_1.heavy 744.935 / 574.404 1765.0 28.966500282287598 41 16 10 5 10 2.933139823285634 27.128722296262204 0.04260063171386719 3 0.9628193320401925 6.380414527366147 1765.0 8.895039682539682 0.0 - - - - - - - 201.6 3 5 PPOX protoporphyrinogen oxidase 2187 277 C20140707_OR006_04 C20140707_OR006_04 TB437200.[MT7]-AQEAAATQLGLK[MT7].2b4_1.heavy 744.935 / 544.285 2269.0 28.966500282287598 41 16 10 5 10 2.933139823285634 27.128722296262204 0.04260063171386719 3 0.9628193320401925 6.380414527366147 2269.0 12.845661375661376 0.0 - - - - - - - 224.0 4 9 PPOX protoporphyrinogen oxidase 2189 277 C20140707_OR006_04 C20140707_OR006_04 TB437200.[MT7]-AQEAAATQLGLK[MT7].2y6_1.heavy 744.935 / 803.511 630.0 28.966500282287598 41 16 10 5 10 2.933139823285634 27.128722296262204 0.04260063171386719 3 0.9628193320401925 6.380414527366147 630.0 0.7499999999999998 3.0 - - - - - - - 0.0 1 0 PPOX protoporphyrinogen oxidase 2191 277 C20140707_OR006_04 C20140707_OR006_04 TB437200.[MT7]-AQEAAATQLGLK[MT7].2b5_1.heavy 744.935 / 615.322 2773.0 28.966500282287598 41 16 10 5 10 2.933139823285634 27.128722296262204 0.04260063171386719 3 0.9628193320401925 6.380414527366147 2773.0 18.27025529100529 0.0 - - - - - - - 294.0 5 6 PPOX protoporphyrinogen oxidase 2193 278 C20140707_OR006_04 C20140707_OR006_04 TB436964.[MT7]-RSPGDTAK[MT7].2y6_1.heavy 560.322 / 732.401 169.0 13.946624994277954 41 18 10 3 10 2.431219233328256 31.56704469348715 0.06499958038330078 3 0.98771862575482 11.124830558679289 169.0 7.276388888888889 1.0 - - - - - - - 0.0 0 0 PEX19 peroxisomal biogenesis factor 19 2195 278 C20140707_OR006_04 C20140707_OR006_04 TB436964.[MT7]-RSPGDTAK[MT7].2b7_1.heavy 560.322 / 829.428 121.0 13.946624994277954 41 18 10 3 10 2.431219233328256 31.56704469348715 0.06499958038330078 3 0.98771862575482 11.124830558679289 121.0 3.428333333333333 2.0 - - - - - - - 0.0 0 0 PEX19 peroxisomal biogenesis factor 19 2197 278 C20140707_OR006_04 C20140707_OR006_04 TB436964.[MT7]-RSPGDTAK[MT7].2b5_1.heavy 560.322 / 657.344 699.0 13.946624994277954 41 18 10 3 10 2.431219233328256 31.56704469348715 0.06499958038330078 3 0.98771862575482 11.124830558679289 699.0 16.380075187969926 0.0 - - - - - - - 0.0 1 0 PEX19 peroxisomal biogenesis factor 19 2199 278 C20140707_OR006_04 C20140707_OR006_04 TB436964.[MT7]-RSPGDTAK[MT7].2y7_1.heavy 560.322 / 819.433 326.0 13.946624994277954 41 18 10 3 10 2.431219233328256 31.56704469348715 0.06499958038330078 3 0.98771862575482 11.124830558679289 326.0 16.3 0.0 - - - - - - - 0.0 0 0 PEX19 peroxisomal biogenesis factor 19 2201 279 C20140707_OR006_04 C20140707_OR006_04 TB449941.[MT7]-IETPAPR.2b3_1.heavy 464.273 / 488.284 1197.0 22.202233632405598 39 18 10 5 6 3.204800821214046 31.20318721152783 0.04000091552734375 6 0.9862164305145966 10.499809275993808 1197.0 3.891365932876218 3.0 - - - - - - - 190.5 3 12 RTKN rhotekin 2203 279 C20140707_OR006_04 C20140707_OR006_04 TB449941.[MT7]-IETPAPR.2y5_1.heavy 464.273 / 541.309 4352.0 22.202233632405598 39 18 10 5 6 3.204800821214046 31.20318721152783 0.04000091552734375 6 0.9862164305145966 10.499809275993808 4352.0 39.1935553454681 0.0 - - - - - - - 285.625 8 8 RTKN rhotekin 2205 279 C20140707_OR006_04 C20140707_OR006_04 TB449941.[MT7]-IETPAPR.2y6_1.heavy 464.273 / 670.352 N/A 22.202233632405598 39 18 10 5 6 3.204800821214046 31.20318721152783 0.04000091552734375 6 0.9862164305145966 10.499809275993808 0.0 0.0 29.0 - - - - - - - 163.33333333333334 8 6 RTKN rhotekin 2207 279 C20140707_OR006_04 C20140707_OR006_04 TB449941.[MT7]-IETPAPR.2b5_1.heavy 464.273 / 656.374 1197.0 22.202233632405598 39 18 10 5 6 3.204800821214046 31.20318721152783 0.04000091552734375 6 0.9862164305145966 10.499809275993808 1197.0 2.9374233128834355 2.0 - - - - - - - 178.0909090909091 4 11 RTKN rhotekin 2209 280 C20140707_OR006_04 C20140707_OR006_04 TB437206.[MT7]-LQFGVAVIDDK[MT7].3y3_1.heavy 498.292 / 521.269 4493.0 38.99959945678711 43 13 10 10 10 1.963875250882654 36.165646949521516 0.0 3 0.9105288504914857 4.094758836561925 4493.0 16.93858906662525 0.0 - - - - - - - 261.2307692307692 8 13 KLHL1 kelch-like 1 (Drosophila) 2211 280 C20140707_OR006_04 C20140707_OR006_04 TB437206.[MT7]-LQFGVAVIDDK[MT7].3b6_1.heavy 498.292 / 760.447 3069.0 38.99959945678711 43 13 10 10 10 1.963875250882654 36.165646949521516 0.0 3 0.9105288504914857 4.094758836561925 3069.0 7.144940505949405 0.0 - - - - - - - 328.6 6 5 KLHL1 kelch-like 1 (Drosophila) 2213 280 C20140707_OR006_04 C20140707_OR006_04 TB437206.[MT7]-LQFGVAVIDDK[MT7].3b4_1.heavy 498.292 / 590.342 1973.0 38.99959945678711 43 13 10 10 10 1.963875250882654 36.165646949521516 0.0 3 0.9105288504914857 4.094758836561925 1973.0 10.806851396927177 0.0 - - - - - - - 182.83333333333334 3 12 KLHL1 kelch-like 1 (Drosophila) 2215 280 C20140707_OR006_04 C20140707_OR006_04 TB437206.[MT7]-LQFGVAVIDDK[MT7].3b5_1.heavy 498.292 / 689.41 2740.0 38.99959945678711 43 13 10 10 10 1.963875250882654 36.165646949521516 0.0 3 0.9105288504914857 4.094758836561925 2740.0 8.474566320339315 1.0 - - - - - - - 172.57142857142858 5 7 KLHL1 kelch-like 1 (Drosophila) 2217 281 C20140707_OR006_04 C20140707_OR006_04 TB436962.[MT7]-NVNLLEK[MT7].2y4_1.heavy 559.345 / 646.426 7005.0 29.40329933166504 50 20 10 10 10 39.80794291730187 2.512061479985107 0.0 3 0.9967607883652522 21.678309243705574 7005.0 22.216 1.0 - - - - - - - 187.5 14 8 FAM48A family with sequence similarity 48, member A 2219 281 C20140707_OR006_04 C20140707_OR006_04 TB436962.[MT7]-NVNLLEK[MT7].2y5_1.heavy 559.345 / 760.469 12634.0 29.40329933166504 50 20 10 10 10 39.80794291730187 2.512061479985107 0.0 3 0.9967607883652522 21.678309243705574 12634.0 192.03680000000003 0.0 - - - - - - - 156.25 25 4 FAM48A family with sequence similarity 48, member A 2221 281 C20140707_OR006_04 C20140707_OR006_04 TB436962.[MT7]-NVNLLEK[MT7].2b4_1.heavy 559.345 / 585.348 11509.0 29.40329933166504 50 20 10 10 10 39.80794291730187 2.512061479985107 0.0 3 0.9967607883652522 21.678309243705574 11509.0 36.64293113695091 1.0 - - - - - - - 229.16666666666666 24 6 FAM48A family with sequence similarity 48, member A 2223 281 C20140707_OR006_04 C20140707_OR006_04 TB436962.[MT7]-NVNLLEK[MT7].2y3_1.heavy 559.345 / 533.341 17638.0 29.40329933166504 50 20 10 10 10 39.80794291730187 2.512061479985107 0.0 3 0.9967607883652522 21.678309243705574 17638.0 49.82793715046605 0.0 - - - - - - - 688.0 35 8 FAM48A family with sequence similarity 48, member A 2225 282 C20140707_OR006_04 C20140707_OR006_04 TB436963.[MT7]-MTILPEK[MT7].2y4_1.heavy 560.338 / 630.394 6260.0 31.73902463912964 39 20 10 3 6 4.6860278621471965 21.340035301066 0.07989883422851562 6 0.9902352877811813 12.47896637342909 6260.0 7.060474920868411 0.0 - - - - - - - 718.625 12 8 SYT4 synaptotagmin IV 2227 282 C20140707_OR006_04 C20140707_OR006_04 TB436963.[MT7]-MTILPEK[MT7].2b4_1.heavy 560.338 / 603.366 5493.0 31.73902463912964 39 20 10 3 6 4.6860278621471965 21.340035301066 0.07989883422851562 6 0.9902352877811813 12.47896637342909 5493.0 1.0318722604884156 4.0 - - - - - - - 328.57142857142856 18 7 SYT4 synaptotagmin IV 2229 282 C20140707_OR006_04 C20140707_OR006_04 TB436963.[MT7]-MTILPEK[MT7].2y3_1.heavy 560.338 / 517.31 26700.0 31.73902463912964 39 20 10 3 6 4.6860278621471965 21.340035301066 0.07989883422851562 6 0.9902352877811813 12.47896637342909 26700.0 55.359099824273 0.0 - - - - - - - 675.4285714285714 53 7 SYT4 synaptotagmin IV 2231 282 C20140707_OR006_04 C20140707_OR006_04 TB436963.[MT7]-MTILPEK[MT7].2y6_1.heavy 560.338 / 844.526 5493.0 31.73902463912964 39 20 10 3 6 4.6860278621471965 21.340035301066 0.07989883422851562 6 0.9902352877811813 12.47896637342909 5493.0 5.715156555772994 0.0 - - - - - - - 298.22222222222223 10 9 SYT4 synaptotagmin IV