Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140707_OR006_05 C20140707_OR006_05 TB411929.[MT7]-HNNMQSLEK[MT7].3y3_1.heavy 463.578 / 533.341 2016.0 20.243549823760986 34 17 2 7 8 3.012709544027711 33.19271192214214 0.029001235961914062 4 0.9716957351095551 7.318240992082577 2016.0 5.2882698374181025 1.0 - - - - - - - 129.83333333333334 16 12 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 3 1 C20140707_OR006_05 C20140707_OR006_05 TB411929.[MT7]-HNNMQSLEK[MT7].3b4_1.heavy 463.578 / 641.295 921.0 20.243549823760986 34 17 2 7 8 3.012709544027711 33.19271192214214 0.029001235961914062 4 0.9716957351095551 7.318240992082577 921.0 1.1401477987421385 2.0 - - - - - - - 109.7 2 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 5 1 C20140707_OR006_05 C20140707_OR006_05 TB411929.[MT7]-HNNMQSLEK[MT7].3y4_1.heavy 463.578 / 620.374 2304.0 20.243549823760986 34 17 2 7 8 3.012709544027711 33.19271192214214 0.029001235961914062 4 0.9716957351095551 7.318240992082577 2304.0 9.04661520888858 1.0 - - - - - - - 101.0 4 4 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 7 1 C20140707_OR006_05 C20140707_OR006_05 TB411929.[MT7]-HNNMQSLEK[MT7].3b3_1.heavy 463.578 / 510.254 2592.0 20.243549823760986 34 17 2 7 8 3.012709544027711 33.19271192214214 0.029001235961914062 4 0.9716957351095551 7.318240992082577 2592.0 10.005331230283911 0.0 - - - - - - - 172.71428571428572 5 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 9 2 C20140707_OR006_05 C20140707_OR006_05 TB450204.[MT7]-YLEHLVIDK[MT7].3y3_1.heavy 473.281 / 519.326 10095.0 34.74689865112305 44 16 10 10 8 2.421225952960061 32.669788694765494 0.0 4 0.9632375842877471 6.416834134888001 10095.0 105.95896946564885 1.0 - - - - - - - 218.33333333333334 20 6 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 11 2 C20140707_OR006_05 C20140707_OR006_05 TB450204.[MT7]-YLEHLVIDK[MT7].3b4_1.heavy 473.281 / 687.358 5638.0 34.74689865112305 44 16 10 10 8 2.421225952960061 32.669788694765494 0.0 4 0.9632375842877471 6.416834134888001 5638.0 83.0636641221374 1.0 - - - - - - - 157.2 11 5 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 13 2 C20140707_OR006_05 C20140707_OR006_05 TB450204.[MT7]-YLEHLVIDK[MT7].3y4_1.heavy 473.281 / 618.394 5244.0 34.74689865112305 44 16 10 10 8 2.421225952960061 32.669788694765494 0.0 4 0.9632375842877471 6.416834134888001 5244.0 50.4651603053435 0.0 - - - - - - - 262.0 10 6 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 15 2 C20140707_OR006_05 C20140707_OR006_05 TB450204.[MT7]-YLEHLVIDK[MT7].3b3_1.heavy 473.281 / 550.299 9702.0 34.74689865112305 44 16 10 10 8 2.421225952960061 32.669788694765494 0.0 4 0.9632375842877471 6.416834134888001 9702.0 104.05580152671754 0.0 - - - - - - - 224.57142857142858 19 7 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 17 3 C20140707_OR006_05 C20140707_OR006_05 TB450203.[MT7]-RVEEALVLAK[MT7].3b6_1.heavy 472.632 / 842.485 3888.0 30.217825889587402 35 11 10 6 8 1.6428164313369473 50.41234350342766 0.038700103759765625 4 0.8754505192852516 3.460008793900058 3888.0 48.33729729729729 0.0 - - - - - - - 152.625 7 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 19 3 C20140707_OR006_05 C20140707_OR006_05 TB450203.[MT7]-RVEEALVLAK[MT7].3y3_1.heavy 472.632 / 475.336 18886.0 30.217825889587402 35 11 10 6 8 1.6428164313369473 50.41234350342766 0.038700103759765625 4 0.8754505192852516 3.460008793900058 18886.0 190.56144144144142 0.0 - - - - - - - 249.75 37 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 21 3 C20140707_OR006_05 C20140707_OR006_05 TB450203.[MT7]-RVEEALVLAK[MT7].3b4_1.heavy 472.632 / 658.364 6221.0 30.217825889587402 35 11 10 6 8 1.6428164313369473 50.41234350342766 0.038700103759765625 4 0.8754505192852516 3.460008793900058 6221.0 65.15236486486485 0.0 - - - - - - - 288.6 12 5 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 23 3 C20140707_OR006_05 C20140707_OR006_05 TB450203.[MT7]-RVEEALVLAK[MT7].3b5_1.heavy 472.632 / 729.401 9665.0 30.217825889587402 35 11 10 6 8 1.6428164313369473 50.41234350342766 0.038700103759765625 4 0.8754505192852516 3.460008793900058 9665.0 86.20135135135135 1.0 - - - - - - - 148.0 22 3 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 25 4 C20140707_OR006_05 C20140707_OR006_05 TB450200.[MT7]-TSSDPTC[CAM]VEK[MT7].3y3_1.heavy 471.237 / 519.326 2017.0 19.43829917907715 50 20 10 10 10 6.424565362655933 15.565255290462128 0.0 3 0.9964834545869269 20.80543998214143 2017.0 14.885629733520338 0.0 - - - - - - - 151.35714285714286 4 14 XPO1 exportin 1 (CRM1 homolog, yeast) 27 4 C20140707_OR006_05 C20140707_OR006_05 TB450200.[MT7]-TSSDPTC[CAM]VEK[MT7].3b4_1.heavy 471.237 / 535.248 6000.0 19.43829917907715 50 20 10 10 10 6.424565362655933 15.565255290462128 0.0 3 0.9964834545869269 20.80543998214143 6000.0 59.24822518370905 0.0 - - - - - - - 158.46666666666667 12 15 XPO1 exportin 1 (CRM1 homolog, yeast) 29 4 C20140707_OR006_05 C20140707_OR006_05 TB450200.[MT7]-TSSDPTC[CAM]VEK[MT7].3b5_1.heavy 471.237 / 632.301 103.0 19.43829917907715 50 20 10 10 10 6.424565362655933 15.565255290462128 0.0 3 0.9964834545869269 20.80543998214143 103.0 -0.09999999999999998 34.0 - - - - - - - 0.0 1 0 XPO1 exportin 1 (CRM1 homolog, yeast) 31 4 C20140707_OR006_05 C20140707_OR006_05 TB450200.[MT7]-TSSDPTC[CAM]VEK[MT7].3y4_1.heavy 471.237 / 679.357 983.0 19.43829917907715 50 20 10 10 10 6.424565362655933 15.565255290462128 0.0 3 0.9964834545869269 20.80543998214143 983.0 13.792170372690258 0.0 - - - - - - - 0.0 1 0 XPO1 exportin 1 (CRM1 homolog, yeast) 33 5 C20140707_OR006_05 C20140707_OR006_05 TB411924.[MT7]-LYSLDPEQK[MT7].3y3_1.heavy 460.925 / 548.316 3588.0 31.74570083618164 32 12 0 10 10 1.0527988368643368 63.32327158075813 0.0 3 0.8918785813802411 3.7188913959560135 3588.0 26.349375 0.0 - - - - - - - 227.55555555555554 7 9 AP3B1 adaptor-related protein complex 3, beta 1 subunit 35 5 C20140707_OR006_05 C20140707_OR006_05 TB411924.[MT7]-LYSLDPEQK[MT7].3b5_1.heavy 460.925 / 736.4 2563.0 31.74570083618164 32 12 0 10 10 1.0527988368643368 63.32327158075813 0.0 3 0.8918785813802411 3.7188913959560135 2563.0 8.867681769091417 1.0 - - - - - - - 234.66666666666666 7 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 37 5 C20140707_OR006_05 C20140707_OR006_05 TB411924.[MT7]-LYSLDPEQK[MT7].3y4_1.heavy 460.925 / 645.369 2178.0 31.74570083618164 32 12 0 10 10 1.0527988368643368 63.32327158075813 0.0 3 0.8918785813802411 3.7188913959560135 2178.0 1.0749268292682927 3.0 - - - - - - - 192.0 105 8 AP3B1 adaptor-related protein complex 3, beta 1 subunit 39 5 C20140707_OR006_05 C20140707_OR006_05 TB411924.[MT7]-LYSLDPEQK[MT7].3b3_1.heavy 460.925 / 508.289 2819.0 31.74570083618164 32 12 0 10 10 1.0527988368643368 63.32327158075813 0.0 3 0.8918785813802411 3.7188913959560135 2819.0 27.8596484375 0.0 - - - - - - - 230.4 5 5 AP3B1 adaptor-related protein complex 3, beta 1 subunit 41 6 C20140707_OR006_05 C20140707_OR006_05 TB412175.[MT7]-AQRGPAGGPVLPQLK[MT7].3b10_1.heavy 593.028 / 1035.58 2979.0 30.31380033493042 30 9 10 3 8 0.5596909098967545 99.94464717763776 0.07630157470703125 4 0.8153014100490923 2.8262300006719094 2979.0 0.48009669621273166 3.0 - - - - - - - 248.0 5 5 RIN1 Ras and Rab interactor 1 43 6 C20140707_OR006_05 C20140707_OR006_05 TB412175.[MT7]-AQRGPAGGPVLPQLK[MT7].3b10_2.heavy 593.028 / 518.294 15638.0 30.31380033493042 30 9 10 3 8 0.5596909098967545 99.94464717763776 0.07630157470703125 4 0.8153014100490923 2.8262300006719094 15638.0 16.236467345207803 0.0 - - - - - - - 372.0 31 3 RIN1 Ras and Rab interactor 1 45 6 C20140707_OR006_05 C20140707_OR006_05 TB412175.[MT7]-AQRGPAGGPVLPQLK[MT7].3y4_1.heavy 593.028 / 629.41 21223.0 30.31380033493042 30 9 10 3 8 0.5596909098967545 99.94464717763776 0.07630157470703125 4 0.8153014100490923 2.8262300006719094 21223.0 41.44691970659994 1.0 - - - - - - - 372.0 42 1 RIN1 Ras and Rab interactor 1 47 6 C20140707_OR006_05 C20140707_OR006_05 TB412175.[MT7]-AQRGPAGGPVLPQLK[MT7].3b8_1.heavy 593.028 / 839.46 4096.0 30.31380033493042 30 9 10 3 8 0.5596909098967545 99.94464717763776 0.07630157470703125 4 0.8153014100490923 2.8262300006719094 4096.0 -0.5 3.0 - - - - - - - 173.6 9 5 RIN1 Ras and Rab interactor 1 49 7 C20140707_OR006_05 C20140707_OR006_05 TB412270.[MT7]-NEEDAAELVALAQAVNAR.2b4_1.heavy 1014.53 / 632.264 1789.0 43.164633433024086 40 15 10 5 10 2.673042934698596 37.41054762043158 0.043399810791015625 3 0.9590523816214126 6.077918191068337 1789.0 9.729897233201582 0.0 - - - - - - - 183.66666666666666 3 3 UBA1 ubiquitin-like modifier activating enzyme 1 51 7 C20140707_OR006_05 C20140707_OR006_05 TB412270.[MT7]-NEEDAAELVALAQAVNAR.2b6_1.heavy 1014.53 / 774.339 N/A 43.164633433024086 40 15 10 5 10 2.673042934698596 37.41054762043158 0.043399810791015625 3 0.9590523816214126 6.077918191068337 0.0 0.0 24.0 - - - - - - - 0.0 1 0 UBA1 ubiquitin-like modifier activating enzyme 1 53 7 C20140707_OR006_05 C20140707_OR006_05 TB412270.[MT7]-NEEDAAELVALAQAVNAR.2b7_1.heavy 1014.53 / 903.381 1789.0 43.164633433024086 40 15 10 5 10 2.673042934698596 37.41054762043158 0.043399810791015625 3 0.9590523816214126 6.077918191068337 1789.0 2.792509090909091 2.0 - - - - - - - 229.66666666666666 3 9 UBA1 ubiquitin-like modifier activating enzyme 1 55 7 C20140707_OR006_05 C20140707_OR006_05 TB412270.[MT7]-NEEDAAELVALAQAVNAR.2y11_1.heavy 1014.53 / 1125.67 1376.0 43.164633433024086 40 15 10 5 10 2.673042934698596 37.41054762043158 0.043399810791015625 3 0.9590523816214126 6.077918191068337 1376.0 2.1767272727272724 2.0 - - - - - - - 192.8 2 5 UBA1 ubiquitin-like modifier activating enzyme 1 57 8 C20140707_OR006_05 C20140707_OR006_05 TB412275.[MT7]-IVEEDC[CAM]NIPSTHDVIR.3b4_1.heavy 681.01 / 615.347 5021.0 30.081700325012207 44 18 10 6 10 1.8234177526349935 41.15535581828452 0.039600372314453125 3 0.984153802301037 9.79094629477026 5021.0 32.39763743535561 1.0 - - - - - - - 300.45454545454544 10 11 CCNG2 cyclin G2 59 8 C20140707_OR006_05 C20140707_OR006_05 TB412275.[MT7]-IVEEDC[CAM]NIPSTHDVIR.3b5_1.heavy 681.01 / 730.374 5144.0 30.081700325012207 44 18 10 6 10 1.8234177526349935 41.15535581828452 0.039600372314453125 3 0.984153802301037 9.79094629477026 5144.0 18.37142857142857 0.0 - - - - - - - 336.6666666666667 10 12 CCNG2 cyclin G2 61 8 C20140707_OR006_05 C20140707_OR006_05 TB412275.[MT7]-IVEEDC[CAM]NIPSTHDVIR.3y8_1.heavy 681.01 / 924.49 26085.0 30.081700325012207 44 18 10 6 10 1.8234177526349935 41.15535581828452 0.039600372314453125 3 0.984153802301037 9.79094629477026 26085.0 119.99317580492686 0.0 - - - - - - - 326.3333333333333 52 9 CCNG2 cyclin G2 63 8 C20140707_OR006_05 C20140707_OR006_05 TB412275.[MT7]-IVEEDC[CAM]NIPSTHDVIR.3b7_1.heavy 681.01 / 1004.45 8695.0 30.081700325012207 44 18 10 6 10 1.8234177526349935 41.15535581828452 0.039600372314453125 3 0.984153802301037 9.79094629477026 8695.0 23.77816326530612 1.0 - - - - - - - 306.07142857142856 17 14 CCNG2 cyclin G2 65 9 C20140707_OR006_05 C20140707_OR006_05 TB412173.[MT7]-LAGTQPLEVLEAVQR.3y6_1.heavy 590.008 / 715.41 15250.0 42.78160095214844 47 17 10 10 10 3.813059784745754 26.22565751527228 0.0 3 0.9779457523218207 8.294970181077689 15250.0 64.0351941747573 0.0 - - - - - - - 291.875 30 8 UBA1 ubiquitin-like modifier activating enzyme 1 67 9 C20140707_OR006_05 C20140707_OR006_05 TB412173.[MT7]-LAGTQPLEVLEAVQR.3b5_1.heavy 590.008 / 615.358 49322.0 42.78160095214844 47 17 10 10 10 3.813059784745754 26.22565751527228 0.0 3 0.9779457523218207 8.294970181077689 49322.0 136.40727802037844 0.0 - - - - - - - 329.7 98 10 UBA1 ubiquitin-like modifier activating enzyme 1 69 9 C20140707_OR006_05 C20140707_OR006_05 TB412173.[MT7]-LAGTQPLEVLEAVQR.3y8_1.heavy 590.008 / 943.521 15662.0 42.78160095214844 47 17 10 10 10 3.813059784745754 26.22565751527228 0.0 3 0.9779457523218207 8.294970181077689 15662.0 109.13370615122953 0.0 - - - - - - - 188.625 31 8 UBA1 ubiquitin-like modifier activating enzyme 1 71 9 C20140707_OR006_05 C20140707_OR006_05 TB412173.[MT7]-LAGTQPLEVLEAVQR.3y5_1.heavy 590.008 / 602.326 19509.0 42.78160095214844 47 17 10 10 10 3.813059784745754 26.22565751527228 0.0 3 0.9779457523218207 8.294970181077689 19509.0 86.3355039717564 0.0 - - - - - - - 652.75 39 8 UBA1 ubiquitin-like modifier activating enzyme 1 73 10 C20140707_OR006_05 C20140707_OR006_05 TB450087.[MT7]-VYNWFANR.2b3_1.heavy 607.315 / 521.284 3499.0 38.12409973144531 43 15 10 10 8 2.8542926398235204 27.77776423728705 0.0 4 0.957950452910494 5.997192855731659 3499.0 6.783775510204082 2.0 - - - - - - - 350.0 8 6 HNF1A;HNF1B;HMBOX1 HNF1 homeobox A;HNF1 homeobox B;homeobox containing 1 75 10 C20140707_OR006_05 C20140707_OR006_05 TB450087.[MT7]-VYNWFANR.2y5_1.heavy 607.315 / 693.347 5319.0 38.12409973144531 43 15 10 10 8 2.8542926398235204 27.77776423728705 0.0 4 0.957950452910494 5.997192855731659 5319.0 13.2975 0.0 - - - - - - - 350.0 10 8 HNF1A;HNF1B;HMBOX1 HNF1 homeobox A;HNF1 homeobox B;homeobox containing 1 77 10 C20140707_OR006_05 C20140707_OR006_05 TB450087.[MT7]-VYNWFANR.2y6_1.heavy 607.315 / 807.39 2939.0 38.12409973144531 43 15 10 10 8 2.8542926398235204 27.77776423728705 0.0 4 0.957950452910494 5.997192855731659 2939.0 -0.30622720790037267 3.0 - - - - - - - 264.44444444444446 8 9 HNF1A;HNF1B;HMBOX1 HNF1 homeobox A;HNF1 homeobox B;homeobox containing 1 79 10 C20140707_OR006_05 C20140707_OR006_05 TB450087.[MT7]-VYNWFANR.2y7_1.heavy 607.315 / 970.453 25614.0 38.12409973144531 43 15 10 10 8 2.8542926398235204 27.77776423728705 0.0 4 0.957950452910494 5.997192855731659 25614.0 68.60892857142858 0.0 - - - - - - - 326.6666666666667 51 6 HNF1A;HNF1B;HMBOX1 HNF1 homeobox A;HNF1 homeobox B;homeobox containing 1 81 11 C20140707_OR006_05 C20140707_OR006_05 TB411792.[MT7]-FQGQHVAK[MT7].3y3_1.heavy 401.568 / 461.32 36217.0 19.15267515182495 44 18 10 6 10 4.395868474378712 22.748633309401605 0.03909873962402344 3 0.9858108563507335 10.348309606222603 36217.0 385.7780856473327 0.0 - - - - - - - 170.46666666666667 72 15 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 83 11 C20140707_OR006_05 C20140707_OR006_05 TB411792.[MT7]-FQGQHVAK[MT7].3b4_1.heavy 401.568 / 605.316 38341.0 19.15267515182495 44 18 10 6 10 4.395868474378712 22.748633309401605 0.03909873962402344 3 0.9858108563507335 10.348309606222603 38341.0 337.20744413800867 0.0 - - - - - - - 141.4 76 15 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 85 11 C20140707_OR006_05 C20140707_OR006_05 TB411792.[MT7]-FQGQHVAK[MT7].3b5_1.heavy 401.568 / 742.375 1525.0 19.15267515182495 44 18 10 6 10 4.395868474378712 22.748633309401605 0.03909873962402344 3 0.9858108563507335 10.348309606222603 1525.0 35.24894910247671 0.0 - - - - - - - 128.07142857142858 3 14 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 87 11 C20140707_OR006_05 C20140707_OR006_05 TB411792.[MT7]-FQGQHVAK[MT7].3b3_1.heavy 401.568 / 477.258 12090.0 19.15267515182495 44 18 10 6 10 4.395868474378712 22.748633309401605 0.03909873962402344 3 0.9858108563507335 10.348309606222603 12090.0 55.48782778299501 0.0 - - - - - - - 181.4 24 15 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 89 12 C20140707_OR006_05 C20140707_OR006_05 TB411938.[MT7]-TIHEVNVQGTR.2y8_1.heavy 699.385 / 902.469 2350.0 21.407649993896484 41 15 10 6 10 2.345206983549957 33.73635365062053 0.032901763916015625 3 0.9505602495511294 5.527369629318819 2350.0 42.19456556082148 0.0 - - - - - - - 133.88888888888889 4 9 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 91 12 C20140707_OR006_05 C20140707_OR006_05 TB411938.[MT7]-TIHEVNVQGTR.2y9_1.heavy 699.385 / 1039.53 4157.0 21.407649993896484 41 15 10 6 10 2.345206983549957 33.73635365062053 0.032901763916015625 3 0.9505602495511294 5.527369629318819 4157.0 135.1025 0.0 - - - - - - - 181.0 8 5 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 93 12 C20140707_OR006_05 C20140707_OR006_05 TB411938.[MT7]-TIHEVNVQGTR.2y10_1.heavy 699.385 / 1152.61 1085.0 21.407649993896484 41 15 10 6 10 2.345206983549957 33.73635365062053 0.032901763916015625 3 0.9505602495511294 5.527369629318819 1085.0 16.995930232558138 0.0 - - - - - - - 172.0 2 7 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 95 12 C20140707_OR006_05 C20140707_OR006_05 TB411938.[MT7]-TIHEVNVQGTR.2y7_1.heavy 699.385 / 773.426 1326.0 21.407649993896484 41 15 10 6 10 2.345206983549957 33.73635365062053 0.032901763916015625 3 0.9505602495511294 5.527369629318819 1326.0 23.122809917355372 0.0 - - - - - - - 120.77777777777777 2 9 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 97 13 C20140707_OR006_05 C20140707_OR006_05 TB450078.[MT7]-EFQTYVK[MT7].2b3_1.heavy 601.837 / 549.279 2856.0 28.29840087890625 44 16 10 10 8 2.7115010812537497 29.47807715440984 0.0 4 0.9618965142978118 6.30218676840485 2856.0 3.27270970168399 3.0 - - - - - - - 190.25 9 8 AP3B1 adaptor-related protein complex 3, beta 1 subunit 99 13 C20140707_OR006_05 C20140707_OR006_05 TB450078.[MT7]-EFQTYVK[MT7].2y4_1.heavy 601.837 / 654.394 5045.0 28.29840087890625 44 16 10 10 8 2.7115010812537497 29.47807715440984 0.0 4 0.9618965142978118 6.30218676840485 5045.0 20.661143827609784 0.0 - - - - - - - 285.7 10 10 AP3B1 adaptor-related protein complex 3, beta 1 subunit 101 13 C20140707_OR006_05 C20140707_OR006_05 TB450078.[MT7]-EFQTYVK[MT7].2y3_1.heavy 601.837 / 553.347 4855.0 28.29840087890625 44 16 10 10 8 2.7115010812537497 29.47807715440984 0.0 4 0.9618965142978118 6.30218676840485 4855.0 7.2219011567544715 1.0 - - - - - - - 753.0909090909091 16 11 AP3B1 adaptor-related protein complex 3, beta 1 subunit 103 13 C20140707_OR006_05 C20140707_OR006_05 TB450078.[MT7]-EFQTYVK[MT7].2y6_1.heavy 601.837 / 929.521 7997.0 28.29840087890625 44 16 10 10 8 2.7115010812537497 29.47807715440984 0.0 4 0.9618965142978118 6.30218676840485 7997.0 82.24043835794677 0.0 - - - - - - - 247.5 15 10 AP3B1 adaptor-related protein complex 3, beta 1 subunit 105 14 C20140707_OR006_05 C20140707_OR006_05 TB436899.[MT7]-DPNQLIR.2y4_1.heavy 500.289 / 529.346 N/A 24.81606610616048 33 17 8 6 2 4.177569558055609 23.937363246811763 0.03560066223144531 11 0.9759937170560143 7.949269920464382 0.0 0.0 47.0 - - - - - - - 0.0 1 0 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 107 14 C20140707_OR006_05 C20140707_OR006_05 TB436899.[MT7]-DPNQLIR.2y5_1.heavy 500.289 / 643.389 554.0 24.81606610616048 33 17 8 6 2 4.177569558055609 23.937363246811763 0.03560066223144531 11 0.9759937170560143 7.949269920464382 554.0 3.28 11.0 - - - - - - - 184.6 7 10 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 109 14 C20140707_OR006_05 C20140707_OR006_05 TB436899.[MT7]-DPNQLIR.2b4_1.heavy 500.289 / 599.291 739.0 24.81606610616048 33 17 8 6 2 4.177569558055609 23.937363246811763 0.03560066223144531 11 0.9759937170560143 7.949269920464382 739.0 0.8010840108401084 5.0 - - - - - - - 0.0 1 0 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 111 14 C20140707_OR006_05 C20140707_OR006_05 TB436899.[MT7]-DPNQLIR.2y6_1.heavy 500.289 / 740.441 2493.0 24.81606610616048 33 17 8 6 2 4.177569558055609 23.937363246811763 0.03560066223144531 11 0.9759937170560143 7.949269920464382 2493.0 7.814366828539411 4.0 - - - - - - - 277.0 6 7 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 113 15 C20140707_OR006_05 C20140707_OR006_05 TB412089.[MT7]-EASADLSPYVRK[MT7].3y6_1.heavy 541.97 / 893.532 3457.0 26.852399826049805 44 14 10 10 10 1.3395691993819552 58.531728345737854 0.0 3 0.9435499407740394 5.1697042024143816 3457.0 21.60625 0.0 - - - - - - - 277.3333333333333 6 9 AP3B1 adaptor-related protein complex 3, beta 1 subunit 115 15 C20140707_OR006_05 C20140707_OR006_05 TB412089.[MT7]-EASADLSPYVRK[MT7].3y7_2.heavy 541.97 / 503.812 9025.0 26.852399826049805 44 14 10 10 10 1.3395691993819552 58.531728345737854 0.0 3 0.9435499407740394 5.1697042024143816 9025.0 8.468205279057347 1.0 - - - - - - - 302.7692307692308 19 13 AP3B1 adaptor-related protein complex 3, beta 1 subunit 117 15 C20140707_OR006_05 C20140707_OR006_05 TB412089.[MT7]-EASADLSPYVRK[MT7].3b5_1.heavy 541.97 / 618.285 13058.0 26.852399826049805 44 14 10 10 10 1.3395691993819552 58.531728345737854 0.0 3 0.9435499407740394 5.1697042024143816 13058.0 27.503113553113558 0.0 - - - - - - - 192.0 26 5 AP3B1 adaptor-related protein complex 3, beta 1 subunit 119 15 C20140707_OR006_05 C20140707_OR006_05 TB412089.[MT7]-EASADLSPYVRK[MT7].3y5_1.heavy 541.97 / 806.5 4897.0 26.852399826049805 44 14 10 10 10 1.3395691993819552 58.531728345737854 0.0 3 0.9435499407740394 5.1697042024143816 4897.0 20.40416666666667 0.0 - - - - - - - 192.0 9 16 AP3B1 adaptor-related protein complex 3, beta 1 subunit 121 16 C20140707_OR006_05 C20140707_OR006_05 TB412189.[MT7]-IFMDAILLSLTRK[MT7].4y5_1.heavy 453.028 / 748.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 123 16 C20140707_OR006_05 C20140707_OR006_05 TB412189.[MT7]-IFMDAILLSLTRK[MT7].4b4_1.heavy 453.028 / 651.329 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 125 16 C20140707_OR006_05 C20140707_OR006_05 TB412189.[MT7]-IFMDAILLSLTRK[MT7].4b5_1.heavy 453.028 / 722.366 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 127 16 C20140707_OR006_05 C20140707_OR006_05 TB412189.[MT7]-IFMDAILLSLTRK[MT7].4y7_2.heavy 453.028 / 487.828 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 129 17 C20140707_OR006_05 C20140707_OR006_05 TB411646.[MT7]-SVATEER.2y6_1.heavy 468.249 / 704.357 1060.0 15.922800064086914 45 15 10 10 10 1.6125641188404447 41.17275295230486 0.0 3 0.9581394389231803 6.010811385062616 1060.0 18.036665372670807 0.0 - - - - - - - 101.58333333333333 2 12 BAG3 BCL2-associated athanogene 3 131 17 C20140707_OR006_05 C20140707_OR006_05 TB411646.[MT7]-SVATEER.2y4_1.heavy 468.249 / 534.252 353.0 15.922800064086914 45 15 10 10 10 1.6125641188404447 41.17275295230486 0.0 3 0.9581394389231803 6.010811385062616 353.0 5.883333333333333 3.0 - - - - - - - 0.0 0 0 BAG3 BCL2-associated athanogene 3 133 17 C20140707_OR006_05 C20140707_OR006_05 TB411646.[MT7]-SVATEER.2b5_1.heavy 468.249 / 632.337 867.0 15.922800064086914 45 15 10 10 10 1.6125641188404447 41.17275295230486 0.0 3 0.9581394389231803 6.010811385062616 867.0 10.837499999999999 0.0 - - - - - - - 0.0 1 0 BAG3 BCL2-associated athanogene 3 135 17 C20140707_OR006_05 C20140707_OR006_05 TB411646.[MT7]-SVATEER.2y5_1.heavy 468.249 / 605.289 803.0 15.922800064086914 45 15 10 10 10 1.6125641188404447 41.17275295230486 0.0 3 0.9581394389231803 6.010811385062616 803.0 11.815732405008635 0.0 - - - - - - - 0.0 1 0 BAG3 BCL2-associated athanogene 3 137 18 C20140707_OR006_05 C20140707_OR006_05 TB412187.[MT7]-GVINMGSYNYLGFAR.3y7_1.heavy 602.642 / 840.436 7312.0 41.99250030517578 46 16 10 10 10 3.2024484168575493 31.22610795964873 0.0 3 0.9695827217130502 7.058219585060672 7312.0 23.643626555696834 0.0 - - - - - - - 263.75 14 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 139 18 C20140707_OR006_05 C20140707_OR006_05 TB412187.[MT7]-GVINMGSYNYLGFAR.3y6_1.heavy 602.642 / 726.393 8578.0 41.99250030517578 46 16 10 10 10 3.2024484168575493 31.22610795964873 0.0 3 0.9695827217130502 7.058219585060672 8578.0 30.303888954478758 0.0 - - - - - - - 312.6666666666667 17 9 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 141 18 C20140707_OR006_05 C20140707_OR006_05 TB412187.[MT7]-GVINMGSYNYLGFAR.3b4_1.heavy 602.642 / 528.326 28967.0 41.99250030517578 46 16 10 10 10 3.2024484168575493 31.22610795964873 0.0 3 0.9695827217130502 7.058219585060672 28967.0 87.11600722698253 0.0 - - - - - - - 343.77777777777777 57 9 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 143 18 C20140707_OR006_05 C20140707_OR006_05 TB412187.[MT7]-GVINMGSYNYLGFAR.3y5_1.heavy 602.642 / 563.33 19686.0 41.99250030517578 46 16 10 10 10 3.2024484168575493 31.22610795964873 0.0 3 0.9695827217130502 7.058219585060672 19686.0 24.96047962085308 0.0 - - - - - - - 321.42857142857144 39 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 145 19 C20140707_OR006_05 C20140707_OR006_05 TB411784.[MT7]-EILDTALK[MT7].2y4_1.heavy 595.865 / 576.384 20438.0 32.73849868774414 47 17 10 10 10 4.6248086328323135 21.622516289664997 0.0 3 0.9726292968099145 7.442585026620492 20438.0 29.152100668038827 0.0 - - - - - - - 201.33333333333334 40 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 147 19 C20140707_OR006_05 C20140707_OR006_05 TB411784.[MT7]-EILDTALK[MT7].2y5_1.heavy 595.865 / 691.411 8874.0 32.73849868774414 47 17 10 10 10 4.6248086328323135 21.622516289664997 0.0 3 0.9726292968099145 7.442585026620492 8874.0 11.546096654275093 0.0 - - - - - - - 710.7142857142857 17 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 149 19 C20140707_OR006_05 C20140707_OR006_05 TB411784.[MT7]-EILDTALK[MT7].2b4_1.heavy 595.865 / 615.347 14118.0 32.73849868774414 47 17 10 10 10 4.6248086328323135 21.622516289664997 0.0 3 0.9726292968099145 7.442585026620492 14118.0 21.578257751376412 0.0 - - - - - - - 238.77777777777777 28 9 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 151 19 C20140707_OR006_05 C20140707_OR006_05 TB411784.[MT7]-EILDTALK[MT7].2y6_1.heavy 595.865 / 804.495 6051.0 32.73849868774414 47 17 10 10 10 4.6248086328323135 21.622516289664997 0.0 3 0.9726292968099145 7.442585026620492 6051.0 49.64720773456139 0.0 - - - - - - - 241.8 12 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 153 20 C20140707_OR006_05 C20140707_OR006_05 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 173309.0 30.08500035603841 23 -3 10 6 10 null 0.0 0.039600372314453125 3 0.0 0.0 173309.0 357.73972309757903 0.0 - - - - - - - 295.6923076923077 346 13 155 20 C20140707_OR006_05 C20140707_OR006_05 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 71355.0 30.08500035603841 23 -3 10 6 10 null 0.0 0.039600372314453125 3 0.0 0.0 71355.0 438.29616935483875 0.0 - - - - - - - 265.7142857142857 142 7 157 20 C20140707_OR006_05 C20140707_OR006_05 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 67019.0 30.08500035603841 23 -3 10 6 10 null 0.0 0.039600372314453125 3 0.0 0.0 67019.0 183.36308239910312 0.0 - - - - - - - 788.0909090909091 134 11 159 21 C20140707_OR006_05 C20140707_OR006_05 TB437106.[MT7]-DTDSINLYK[MT7].3y3_1.heavy 452.913 / 567.362 1872.0 29.267499923706055 44 14 10 10 10 2.0276704457947865 38.60147703653639 0.0 3 0.931958084791704 4.704140435377044 1872.0 13.866666666666667 0.0 - - - - - - - 223.36363636363637 3 11 XPO1 exportin 1 (CRM1 homolog, yeast) 161 21 C20140707_OR006_05 C20140707_OR006_05 TB437106.[MT7]-DTDSINLYK[MT7].3b6_1.heavy 452.913 / 790.37 936.0 29.267499923706055 44 14 10 10 10 2.0276704457947865 38.60147703653639 0.0 3 0.931958084791704 4.704140435377044 936.0 16.0 0.0 - - - - - - - 0.0 1 0 XPO1 exportin 1 (CRM1 homolog, yeast) 163 21 C20140707_OR006_05 C20140707_OR006_05 TB437106.[MT7]-DTDSINLYK[MT7].3b4_1.heavy 452.913 / 563.243 5849.0 29.267499923706055 44 14 10 10 10 2.0276704457947865 38.60147703653639 0.0 3 0.931958084791704 4.704140435377044 5849.0 36.57707977207977 0.0 - - - - - - - 234.0 11 11 XPO1 exportin 1 (CRM1 homolog, yeast) 165 21 C20140707_OR006_05 C20140707_OR006_05 TB437106.[MT7]-DTDSINLYK[MT7].3b3_1.heavy 452.913 / 476.211 2808.0 29.267499923706055 44 14 10 10 10 2.0276704457947865 38.60147703653639 0.0 3 0.931958084791704 4.704140435377044 2808.0 9.440000000000001 1.0 - - - - - - - 257.4 7 10 XPO1 exportin 1 (CRM1 homolog, yeast) 167 22 C20140707_OR006_05 C20140707_OR006_05 TB436882.[MT7]-TEEVAK[MT7].2y4_1.heavy 482.781 / 590.363 2501.0 17.085949897766113 40 15 10 5 10 2.102012008449591 37.66025045639718 0.04409980773925781 3 0.9501282189027727 5.503174413088017 2501.0 55.14137678712147 0.0 - - - - - - - 111.14285714285714 5 14 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 169 22 C20140707_OR006_05 C20140707_OR006_05 TB436882.[MT7]-TEEVAK[MT7].2b3_1.heavy 482.781 / 504.242 2312.0 17.085949897766113 40 15 10 5 10 2.102012008449591 37.66025045639718 0.04409980773925781 3 0.9501282189027727 5.503174413088017 2312.0 21.29313585444703 0.0 - - - - - - - 132.0 4 15 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 171 22 C20140707_OR006_05 C20140707_OR006_05 TB436882.[MT7]-TEEVAK[MT7].2y5_1.heavy 482.781 / 719.406 1557.0 17.085949897766113 40 15 10 5 10 2.102012008449591 37.66025045639718 0.04409980773925781 3 0.9501282189027727 5.503174413088017 1557.0 11.574523809523807 0.0 - - - - - - - 165.1 3 10 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 173 22 C20140707_OR006_05 C20140707_OR006_05 TB436882.[MT7]-TEEVAK[MT7].2b4_1.heavy 482.781 / 603.311 1699.0 17.085949897766113 40 15 10 5 10 2.102012008449591 37.66025045639718 0.04409980773925781 3 0.9501282189027727 5.503174413088017 1699.0 21.68936170212766 0.0 - - - - - - - 137.27272727272728 3 11 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 175 23 C20140707_OR006_05 C20140707_OR006_05 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 35610.0 16.227500915527344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 35610.0 48.016439921786784 0.0 - - - - - - - 198.1 71 10 177 23 C20140707_OR006_05 C20140707_OR006_05 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 45802.0 16.227500915527344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 45802.0 1147.279322660363 0.0 - - - - - - - 153.28571428571428 91 7 179 23 C20140707_OR006_05 C20140707_OR006_05 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 29338.0 16.227500915527344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 29338.0 153.88894453190213 0.0 - - - - - - - 202.54545454545453 58 11 181 24 C20140707_OR006_05 C20140707_OR006_05 TB412093.[MT7]-DLAHFPAVDPEK[MT7].4b4_1.heavy 407.474 / 581.316 6391.0 31.823500156402588 33 8 10 5 10 0.5216605697788315 101.83282957366985 0.04440116882324219 3 0.7574609267884415 2.4534378723302392 6391.0 36.828207170924344 0.0 - - - - - - - 234.6 12 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 183 24 C20140707_OR006_05 C20140707_OR006_05 TB412093.[MT7]-DLAHFPAVDPEK[MT7].4b5_1.heavy 407.474 / 728.385 1565.0 31.823500156402588 33 8 10 5 10 0.5216605697788315 101.83282957366985 0.04440116882324219 3 0.7574609267884415 2.4534378723302392 1565.0 11.39272030651341 0.0 - - - - - - - 261.0 3 2 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 185 24 C20140707_OR006_05 C20140707_OR006_05 TB412093.[MT7]-DLAHFPAVDPEK[MT7].4y3_1.heavy 407.474 / 517.31 9130.0 31.823500156402588 33 8 10 5 10 0.5216605697788315 101.83282957366985 0.04440116882324219 3 0.7574609267884415 2.4534378723302392 9130.0 31.228619489815188 0.0 - - - - - - - 234.6 18 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 187 24 C20140707_OR006_05 C20140707_OR006_05 TB412093.[MT7]-DLAHFPAVDPEK[MT7].4b3_1.heavy 407.474 / 444.258 4826.0 31.823500156402588 33 8 10 5 10 0.5216605697788315 101.83282957366985 0.04440116882324219 3 0.7574609267884415 2.4534378723302392 4826.0 68.67769230769231 0.0 - - - - - - - 208.4 9 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 189 25 C20140707_OR006_05 C20140707_OR006_05 TB412092.[MT7]-DLAHFPAVDPEK[MT7].3y3_1.heavy 542.963 / 517.31 126759.0 31.8346004486084 50 20 10 10 10 13.988564246798365 7.148696480618983 0.0 3 0.9957151363664881 18.846845523568412 126759.0 223.26043062262838 0.0 - - - - - - - 303.3333333333333 253 3 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 191 25 C20140707_OR006_05 C20140707_OR006_05 TB412092.[MT7]-DLAHFPAVDPEK[MT7].3b4_1.heavy 542.963 / 581.316 35976.0 31.8346004486084 50 20 10 10 10 13.988564246798365 7.148696480618983 0.0 3 0.9957151363664881 18.846845523568412 35976.0 144.46827924617756 0.0 - - - - - - - 227.5 71 8 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 193 25 C20140707_OR006_05 C20140707_OR006_05 TB412092.[MT7]-DLAHFPAVDPEK[MT7].3b5_1.heavy 542.963 / 728.385 8702.0 31.8346004486084 50 20 10 10 10 13.988564246798365 7.148696480618983 0.0 3 0.9957151363664881 18.846845523568412 8702.0 64.73030769230769 1.0 - - - - - - - 227.5 17 4 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 195 25 C20140707_OR006_05 C20140707_OR006_05 TB412092.[MT7]-DLAHFPAVDPEK[MT7].3y4_1.heavy 542.963 / 632.337 11949.0 31.8346004486084 50 20 10 10 10 13.988564246798365 7.148696480618983 0.0 3 0.9957151363664881 18.846845523568412 11949.0 17.301135272040394 1.0 - - - - - - - 208.0 25 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 197 26 C20140707_OR006_05 C20140707_OR006_05 TB412392.[MT7]-ILQQAGFIQFAQLQFLEAK[MT7].3b6_1.heavy 827.808 / 755.453 3079.0 50.96839904785156 48 18 10 10 10 2.9615475693409277 26.916430810124815 0.0 3 0.9806908256765569 8.867051046630335 3079.0 43.15694939343181 0.0 - - - - - - - 161.25 6 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 199 26 C20140707_OR006_05 C20140707_OR006_05 TB412392.[MT7]-ILQQAGFIQFAQLQFLEAK[MT7].3b4_1.heavy 827.808 / 627.395 2285.0 50.96839904785156 48 18 10 10 10 2.9615475693409277 26.916430810124815 0.0 3 0.9806908256765569 8.867051046630335 2285.0 18.678647769046574 0.0 - - - - - - - 186.25 4 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 201 26 C20140707_OR006_05 C20140707_OR006_05 TB412392.[MT7]-ILQQAGFIQFAQLQFLEAK[MT7].3y5_1.heavy 827.808 / 751.447 2583.0 50.96839904785156 48 18 10 10 10 2.9615475693409277 26.916430810124815 0.0 3 0.9806908256765569 8.867051046630335 2583.0 15.839133696652276 0.0 - - - - - - - 269.7142857142857 5 7 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 203 26 C20140707_OR006_05 C20140707_OR006_05 TB412392.[MT7]-ILQQAGFIQFAQLQFLEAK[MT7].3b7_1.heavy 827.808 / 902.522 3973.0 50.96839904785156 48 18 10 10 10 2.9615475693409277 26.916430810124815 0.0 3 0.9806908256765569 8.867051046630335 3973.0 14.928324983457792 0.0 - - - - - - - 248.5 7 6 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 205 27 C20140707_OR006_05 C20140707_OR006_05 TB450464.[MT7]-VSDY[MT7]ISPLLNFAAEHVPR.4y5_1.heavy 579.82 / 637.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 207 27 C20140707_OR006_05 C20140707_OR006_05 TB450464.[MT7]-VSDY[MT7]ISPLLNFAAEHVPR.4y4_1.heavy 579.82 / 508.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 209 27 C20140707_OR006_05 C20140707_OR006_05 TB450464.[MT7]-VSDY[MT7]ISPLLNFAAEHVPR.4y7_1.heavy 579.82 / 779.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 211 27 C20140707_OR006_05 C20140707_OR006_05 TB450464.[MT7]-VSDY[MT7]ISPLLNFAAEHVPR.4y6_1.heavy 579.82 / 708.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 213 28 C20140707_OR006_05 C20140707_OR006_05 TB437511.[MT7]-RTAGILDMGGVSTQIAYEVPK[MT7].4b7_1.heavy 624.345 / 871.512 8198.0 39.00699996948242 35 5 10 10 10 0.6113190685864466 91.87455165721796 0.0 3 0.6872913791643461 2.146663422115139 8198.0 20.310898802553545 0.0 - - - - - - - 244.6 16 10 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 215 28 C20140707_OR006_05 C20140707_OR006_05 TB437511.[MT7]-RTAGILDMGGVSTQIAYEVPK[MT7].4b10_1.heavy 624.345 / 1116.6 5322.0 39.00699996948242 35 5 10 10 10 0.6113190685864466 91.87455165721796 0.0 3 0.6872913791643461 2.146663422115139 5322.0 39.73020833333334 1.0 - - - - - - - 201.6 39 10 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 217 28 C20140707_OR006_05 C20140707_OR006_05 TB437511.[MT7]-RTAGILDMGGVSTQIAYEVPK[MT7].4b5_1.heavy 624.345 / 643.401 6760.0 39.00699996948242 35 5 10 10 10 0.6113190685864466 91.87455165721796 0.0 3 0.6872913791643461 2.146663422115139 6760.0 18.810434782608695 0.0 - - - - - - - 230.2 13 5 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 219 28 C20140707_OR006_05 C20140707_OR006_05 TB437511.[MT7]-RTAGILDMGGVSTQIAYEVPK[MT7].4b10_2.heavy 624.345 / 558.801 25746.0 39.00699996948242 35 5 10 10 10 0.6113190685864466 91.87455165721796 0.0 3 0.6872913791643461 2.146663422115139 25746.0 93.36493731380337 0.0 - - - - - - - 192.0 51 6 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 221 29 C20140707_OR006_05 C20140707_OR006_05 TB412293.[MT7]-DFVSLYQDFENFYTR.3y7_1.heavy 696.666 / 976.452 3562.0 51.95109939575195 45 15 10 10 10 1.860686332997907 36.43528914580101 0.0 3 0.9563974772519722 5.888650308497744 3562.0 69.08121212121212 0.0 - - - - - - - 99.0 7 1 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 223 29 C20140707_OR006_05 C20140707_OR006_05 TB412293.[MT7]-DFVSLYQDFENFYTR.3b4_1.heavy 696.666 / 593.305 4551.0 51.95109939575195 45 15 10 10 10 1.860686332997907 36.43528914580101 0.0 3 0.9563974772519722 5.888650308497744 4551.0 22.984848484848484 0.0 - - - - - - - 210.375 9 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 225 29 C20140707_OR006_05 C20140707_OR006_05 TB412293.[MT7]-DFVSLYQDFENFYTR.3b3_1.heavy 696.666 / 506.273 7519.0 51.95109939575195 45 15 10 10 10 1.860686332997907 36.43528914580101 0.0 3 0.9563974772519722 5.888650308497744 7519.0 24.303838383838382 0.0 - - - - - - - 297.0 15 3 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 227 29 C20140707_OR006_05 C20140707_OR006_05 TB412293.[MT7]-DFVSLYQDFENFYTR.3y5_1.heavy 696.666 / 700.341 7421.0 51.95109939575195 45 15 10 10 10 1.860686332997907 36.43528914580101 0.0 3 0.9563974772519722 5.888650308497744 7421.0 37.47979797979798 0.0 - - - - - - - 264.0 14 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 229 30 C20140707_OR006_05 C20140707_OR006_05 TB412150.[MT7]-EMNC[CAM]PETIAQIQR.2b3_1.heavy 867.425 / 519.235 2518.0 29.80590057373047 39 14 10 5 10 2.3993400069674484 31.616053912855595 0.042400360107421875 3 0.9450136536494409 5.238712260381327 2518.0 9.75725 0.0 - - - - - - - 360.0 5 4 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 231 30 C20140707_OR006_05 C20140707_OR006_05 TB412150.[MT7]-EMNC[CAM]PETIAQIQR.2b4_1.heavy 867.425 / 679.266 3836.0 29.80590057373047 39 14 10 5 10 2.3993400069674484 31.616053912855595 0.042400360107421875 3 0.9450136536494409 5.238712260381327 3836.0 25.40494000585309 1.0 - - - - - - - 222.85714285714286 9 7 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 233 30 C20140707_OR006_05 C20140707_OR006_05 TB412150.[MT7]-EMNC[CAM]PETIAQIQR.2y9_1.heavy 867.425 / 1055.58 11629.0 29.80590057373047 39 14 10 5 10 2.3993400069674484 31.616053912855595 0.042400360107421875 3 0.9450136536494409 5.238712260381327 11629.0 63.636472222222224 0.0 - - - - - - - 320.0 23 3 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 235 30 C20140707_OR006_05 C20140707_OR006_05 TB412150.[MT7]-EMNC[CAM]PETIAQIQR.2y10_1.heavy 867.425 / 1215.61 480.0 29.80590057373047 39 14 10 5 10 2.3993400069674484 31.616053912855595 0.042400360107421875 3 0.9450136536494409 5.238712260381327 480.0 2.013518776077886 6.0 - - - - - - - 0.0 1 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 237 31 C20140707_OR006_05 C20140707_OR006_05 TB450066.[MT7]-RIVGMIAK[MT7].2y5_1.heavy 588.38 / 663.398 1776.0 26.940099716186523 43 18 9 10 6 7.616795838322037 13.128880190916313 0.0 6 0.9811628668133968 8.97781930721001 1776.0 3.365252065103003 0.0 - - - - - - - 205.73684210526315 3 19 AP3B1 adaptor-related protein complex 3, beta 1 subunit 239 31 C20140707_OR006_05 C20140707_OR006_05 TB450066.[MT7]-RIVGMIAK[MT7].2y6_1.heavy 588.38 / 762.466 621.0 26.940099716186523 43 18 9 10 6 7.616795838322037 13.128880190916313 0.0 6 0.9811628668133968 8.97781930721001 621.0 1.2258223022344594 9.0 - - - - - - - 0.0 1 0 AP3B1 adaptor-related protein complex 3, beta 1 subunit 241 31 C20140707_OR006_05 C20140707_OR006_05 TB450066.[MT7]-RIVGMIAK[MT7].2b5_1.heavy 588.38 / 701.425 977.0 26.940099716186523 43 18 9 10 6 7.616795838322037 13.128880190916313 0.0 6 0.9811628668133968 8.97781930721001 977.0 3.894136749319676 3.0 - - - - - - - 233.1875 4 16 AP3B1 adaptor-related protein complex 3, beta 1 subunit 243 31 C20140707_OR006_05 C20140707_OR006_05 TB450066.[MT7]-RIVGMIAK[MT7].2y7_1.heavy 588.38 / 875.55 1332.0 26.940099716186523 43 18 9 10 6 7.616795838322037 13.128880190916313 0.0 6 0.9811628668133968 8.97781930721001 1332.0 6.493976066927882 1.0 - - - - - - - 234.1818181818182 2 11 AP3B1 adaptor-related protein complex 3, beta 1 subunit 245 32 C20140707_OR006_05 C20140707_OR006_05 TB450316.[MT7]-SFTGGLGQLVVPSK[MT7].4b7_1.heavy 420.25 / 764.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC22D4 TSC22 domain family, member 4 247 32 C20140707_OR006_05 C20140707_OR006_05 TB450316.[MT7]-SFTGGLGQLVVPSK[MT7].4b5_1.heavy 420.25 / 594.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC22D4 TSC22 domain family, member 4 249 32 C20140707_OR006_05 C20140707_OR006_05 TB450316.[MT7]-SFTGGLGQLVVPSK[MT7].4y3_1.heavy 420.25 / 475.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC22D4 TSC22 domain family, member 4 251 32 C20140707_OR006_05 C20140707_OR006_05 TB450316.[MT7]-SFTGGLGQLVVPSK[MT7].4b6_1.heavy 420.25 / 707.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC22D4 TSC22 domain family, member 4 253 33 C20140707_OR006_05 C20140707_OR006_05 TB411919.[MT7]-DLLGLC[CAM]EQK[MT7].2y4_1.heavy 682.378 / 708.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 255 33 C20140707_OR006_05 C20140707_OR006_05 TB411919.[MT7]-DLLGLC[CAM]EQK[MT7].2b4_1.heavy 682.378 / 543.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 257 33 C20140707_OR006_05 C20140707_OR006_05 TB411919.[MT7]-DLLGLC[CAM]EQK[MT7].2y3_1.heavy 682.378 / 548.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 259 33 C20140707_OR006_05 C20140707_OR006_05 TB411919.[MT7]-DLLGLC[CAM]EQK[MT7].2y6_1.heavy 682.378 / 878.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 261 34 C20140707_OR006_05 C20140707_OR006_05 TB437305.[MT7]-HWPTFISDIVGASR.3y7_1.heavy 577.31 / 717.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 263 34 C20140707_OR006_05 C20140707_OR006_05 TB437305.[MT7]-HWPTFISDIVGASR.3y6_1.heavy 577.31 / 602.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 265 34 C20140707_OR006_05 C20140707_OR006_05 TB437305.[MT7]-HWPTFISDIVGASR.3b5_1.heavy 577.31 / 813.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 267 34 C20140707_OR006_05 C20140707_OR006_05 TB437305.[MT7]-HWPTFISDIVGASR.3y8_1.heavy 577.31 / 804.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 269 35 C20140707_OR006_05 C20140707_OR006_05 TB450318.[MT7]-SFTGGLGQLVVPSK[MT7].2b8_1.heavy 839.492 / 892.464 2839.0 38.50399971008301 33 8 10 5 10 2.0475332812059786 34.48517551395907 0.044002532958984375 3 0.7816168832245904 2.591268024179218 2839.0 14.628180751173709 0.0 - - - - - - - 284.0 5 7 TSC22D4 TSC22 domain family, member 4 271 35 C20140707_OR006_05 C20140707_OR006_05 TB450318.[MT7]-SFTGGLGQLVVPSK[MT7].2b6_1.heavy 839.492 / 707.385 3407.0 38.50399971008301 33 8 10 5 10 2.0475332812059786 34.48517551395907 0.044002532958984375 3 0.7816168832245904 2.591268024179218 3407.0 11.653722334004023 0.0 - - - - - - - 252.44444444444446 6 9 TSC22D4 TSC22 domain family, member 4 273 35 C20140707_OR006_05 C20140707_OR006_05 TB450318.[MT7]-SFTGGLGQLVVPSK[MT7].2b5_1.heavy 839.492 / 594.3 568.0 38.50399971008301 33 8 10 5 10 2.0475332812059786 34.48517551395907 0.044002532958984375 3 0.7816168832245904 2.591268024179218 568.0 1.3299999999999998 8.0 - - - - - - - 284.0 2 6 TSC22D4 TSC22 domain family, member 4 275 35 C20140707_OR006_05 C20140707_OR006_05 TB450318.[MT7]-SFTGGLGQLVVPSK[MT7].2b9_1.heavy 839.492 / 1005.55 2555.0 38.50399971008301 33 8 10 5 10 2.0475332812059786 34.48517551395907 0.044002532958984375 3 0.7816168832245904 2.591268024179218 2555.0 14.718239436619717 0.0 - - - - - - - 307.6666666666667 5 6 TSC22D4 TSC22 domain family, member 4 277 36 C20140707_OR006_05 C20140707_OR006_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 245881.0 18.986600875854492 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 245881.0 1044.0039736493395 0.0 - - - - - - - 719.8571428571429 491 7 279 36 C20140707_OR006_05 C20140707_OR006_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 140709.0 18.986600875854492 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 140709.0 777.7815544871794 0.0 - - - - - - - 188.13333333333333 281 15 281 36 C20140707_OR006_05 C20140707_OR006_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 158588.0 18.986600875854492 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 158588.0 669.1094957493885 0.0 - - - - - - - 233.14285714285714 317 14 283 37 C20140707_OR006_05 C20140707_OR006_05 TB450450.[MT7]-ALPAVQQNNLDEDLIRK[MT7].3y7_1.heavy 742.421 / 1032.58 3936.0 33.871700286865234 47 17 10 10 10 3.269579796430662 30.584970004147962 0.0 3 0.9724633327505919 7.420019157001065 3936.0 10.124094488188977 0.0 - - - - - - - 211.66666666666666 7 6 UBA1 ubiquitin-like modifier activating enzyme 1 285 37 C20140707_OR006_05 C20140707_OR006_05 TB450450.[MT7]-ALPAVQQNNLDEDLIRK[MT7].3y6_1.heavy 742.421 / 917.554 4317.0 33.871700286865234 47 17 10 10 10 3.269579796430662 30.584970004147962 0.0 3 0.9724633327505919 7.420019157001065 4317.0 27.629933070866137 0.0 - - - - - - - 254.0 8 4 UBA1 ubiquitin-like modifier activating enzyme 1 287 37 C20140707_OR006_05 C20140707_OR006_05 TB450450.[MT7]-ALPAVQQNNLDEDLIRK[MT7].3b5_1.heavy 742.421 / 596.389 3555.0 33.871700286865234 47 17 10 10 10 3.269579796430662 30.584970004147962 0.0 3 0.9724633327505919 7.420019157001065 3555.0 11.243503937007873 0.0 - - - - - - - 282.22222222222223 7 9 UBA1 ubiquitin-like modifier activating enzyme 1 289 37 C20140707_OR006_05 C20140707_OR006_05 TB450450.[MT7]-ALPAVQQNNLDEDLIRK[MT7].3y4_1.heavy 742.421 / 673.484 3174.0 33.871700286865234 47 17 10 10 10 3.269579796430662 30.584970004147962 0.0 3 0.9724633327505919 7.420019157001065 3174.0 11.662992125984253 0.0 - - - - - - - 296.3333333333333 6 9 UBA1 ubiquitin-like modifier activating enzyme 1 291 38 C20140707_OR006_05 C20140707_OR006_05 TB437502.[MT7]-YMLLPNQVWDSIIQQATK[MT7].2y5_1.heavy 1218.66 / 719.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 293 38 C20140707_OR006_05 C20140707_OR006_05 TB437502.[MT7]-YMLLPNQVWDSIIQQATK[MT7].2b4_1.heavy 1218.66 / 665.381 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 295 38 C20140707_OR006_05 C20140707_OR006_05 TB437502.[MT7]-YMLLPNQVWDSIIQQATK[MT7].2y3_1.heavy 1218.66 / 463.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 297 38 C20140707_OR006_05 C20140707_OR006_05 TB437502.[MT7]-YMLLPNQVWDSIIQQATK[MT7].2y6_1.heavy 1218.66 / 832.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 299 39 C20140707_OR006_05 C20140707_OR006_05 TB450192.[MT7]-TIHEVNVQGTR.3y6_1.heavy 466.592 / 674.358 12347.0 21.407649993896484 44 20 10 6 8 28.28137160078596 3.535896398929284 0.032901763916015625 4 0.9975000906076772 24.677986335328047 12347.0 59.280581666508674 0.0 - - - - - - - 190.11764705882354 24 17 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 301 39 C20140707_OR006_05 C20140707_OR006_05 TB450192.[MT7]-TIHEVNVQGTR.3b4_1.heavy 466.592 / 625.343 4673.0 21.407649993896484 44 20 10 6 8 28.28137160078596 3.535896398929284 0.032901763916015625 4 0.9975000906076772 24.677986335328047 4673.0 101.37252441698226 0.0 - - - - - - - 178.36363636363637 9 11 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 303 39 C20140707_OR006_05 C20140707_OR006_05 TB450192.[MT7]-TIHEVNVQGTR.3b3_1.heavy 466.592 / 496.3 8597.0 21.407649993896484 44 20 10 6 8 28.28137160078596 3.535896398929284 0.032901763916015625 4 0.9975000906076772 24.677986335328047 8597.0 47.59090787878788 0.0 - - - - - - - 125.9090909090909 17 11 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 305 39 C20140707_OR006_05 C20140707_OR006_05 TB450192.[MT7]-TIHEVNVQGTR.3y5_1.heavy 466.592 / 560.315 6000.0 21.407649993896484 44 20 10 6 8 28.28137160078596 3.535896398929284 0.032901763916015625 4 0.9975000906076772 24.677986335328047 6000.0 69.33098768534806 1.0 - - - - - - - 192.22222222222223 21 18 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 307 40 C20140707_OR006_05 C20140707_OR006_05 TB411623.[MT7]-MYPIDFEK[MT7].3y3_1.heavy 444.237 / 567.326 982.0 36.53650093078613 41 16 10 5 10 2.982437244401169 26.144798417782585 0.04599761962890625 3 0.968730345212835 6.960855136280103 982.0 0.6302603105825393 1.0 - - - - - - - 0.0 1 0 UBA1 ubiquitin-like modifier activating enzyme 1 309 40 C20140707_OR006_05 C20140707_OR006_05 TB411623.[MT7]-MYPIDFEK[MT7].3b5_1.heavy 444.237 / 764.377 561.0 36.53650093078613 41 16 10 5 10 2.982437244401169 26.144798417782585 0.04599761962890625 3 0.968730345212835 6.960855136280103 561.0 8.010278571428572 1.0 - - - - - - - 0.0 1 0 UBA1 ubiquitin-like modifier activating enzyme 1 311 40 C20140707_OR006_05 C20140707_OR006_05 TB411623.[MT7]-MYPIDFEK[MT7].3b3_1.heavy 444.237 / 536.266 281.0 36.53650093078613 41 16 10 5 10 2.982437244401169 26.144798417782585 0.04599761962890625 3 0.968730345212835 6.960855136280103 281.0 0.7999999999999999 15.0 - - - - - - - 252.8 2 5 UBA1 ubiquitin-like modifier activating enzyme 1 313 40 C20140707_OR006_05 C20140707_OR006_05 TB411623.[MT7]-MYPIDFEK[MT7].3y4_1.heavy 444.237 / 682.353 1263.0 36.53650093078613 41 16 10 5 10 2.982437244401169 26.144798417782585 0.04599761962890625 3 0.968730345212835 6.960855136280103 1263.0 9.471695951107716 0.0 - - - - - - - 210.5 2 4 UBA1 ubiquitin-like modifier activating enzyme 1 315 41 C20140707_OR006_05 C20140707_OR006_05 TB449935.[MT7]-VGPDTER.2y6_1.heavy 459.244 / 674.31 2294.0 17.506574630737305 36 18 10 2 6 4.901769740476638 20.40079507901899 0.0821990966796875 5 0.9853160762174059 10.17204900039327 2294.0 31.520640573444076 0.0 - - - - - - - 176.30769230769232 4 13 UBA1 ubiquitin-like modifier activating enzyme 1 317 41 C20140707_OR006_05 C20140707_OR006_05 TB449935.[MT7]-VGPDTER.2b5_1.heavy 459.244 / 614.327 515.0 17.506574630737305 36 18 10 2 6 4.901769740476638 20.40079507901899 0.0821990966796875 5 0.9853160762174059 10.17204900039327 515.0 4.543331603528801 1.0 - - - - - - - 0.0 1 0 UBA1 ubiquitin-like modifier activating enzyme 1 319 41 C20140707_OR006_05 C20140707_OR006_05 TB449935.[MT7]-VGPDTER.2y5_1.heavy 459.244 / 617.289 468.0 17.506574630737305 36 18 10 2 6 4.901769740476638 20.40079507901899 0.0821990966796875 5 0.9853160762174059 10.17204900039327 468.0 5.151263961186638 4.0 - - - - - - - 0.0 0 0 UBA1 ubiquitin-like modifier activating enzyme 1 321 41 C20140707_OR006_05 C20140707_OR006_05 TB449935.[MT7]-VGPDTER.2b4_1.heavy 459.244 / 513.279 1217.0 17.506574630737305 36 18 10 2 6 4.901769740476638 20.40079507901899 0.0821990966796875 5 0.9853160762174059 10.17204900039327 1217.0 12.226191716571725 1.0 - - - - - - - 182.6 2 10 UBA1 ubiquitin-like modifier activating enzyme 1 323 42 C20140707_OR006_05 C20140707_OR006_05 TB437309.[MT7]-YYGLQILENVIK[MT7].2b3_1.heavy 871.011 / 528.258 3936.0 49.333900451660156 43 13 10 10 10 3.3021565159996142 23.89309542013422 0.0 3 0.9155554786775806 4.216693507287571 3936.0 16.46480543206226 0.0 - - - - - - - 187.0 7 3 XPO1 exportin 1 (CRM1 homolog, yeast) 325 42 C20140707_OR006_05 C20140707_OR006_05 TB437309.[MT7]-YYGLQILENVIK[MT7].2b4_1.heavy 871.011 / 641.341 4049.0 49.333900451660156 43 13 10 10 10 3.3021565159996142 23.89309542013422 0.0 3 0.9155554786775806 4.216693507287571 4049.0 25.46371111111111 0.0 - - - - - - - 281.1 8 10 XPO1 exportin 1 (CRM1 homolog, yeast) 327 42 C20140707_OR006_05 C20140707_OR006_05 TB437309.[MT7]-YYGLQILENVIK[MT7].2b6_1.heavy 871.011 / 882.484 2699.0 49.333900451660156 43 13 10 10 10 3.3021565159996142 23.89309542013422 0.0 3 0.9155554786775806 4.216693507287571 2699.0 12.734154302670621 0.0 - - - - - - - 205.83333333333334 5 6 XPO1 exportin 1 (CRM1 homolog, yeast) 329 42 C20140707_OR006_05 C20140707_OR006_05 TB437309.[MT7]-YYGLQILENVIK[MT7].2b5_1.heavy 871.011 / 769.4 2249.0 49.333900451660156 43 13 10 10 10 3.3021565159996142 23.89309542013422 0.0 3 0.9155554786775806 4.216693507287571 2249.0 18.553524921084033 1.0 - - - - - - - 149.66666666666666 7 3 XPO1 exportin 1 (CRM1 homolog, yeast) 331 43 C20140707_OR006_05 C20140707_OR006_05 TB450050.[MT7]-NAAHAIQK[MT7].2y4_1.heavy 570.84 / 603.395 2675.0 17.063899993896484 50 20 10 10 10 5.709538514572061 17.51455038700184 0.0 3 0.9922519889130283 14.011558487062901 2675.0 41.50703385127636 0.0 - - - - - - - 138.9090909090909 5 11 AP3B1 adaptor-related protein complex 3, beta 1 subunit 333 43 C20140707_OR006_05 C20140707_OR006_05 TB450050.[MT7]-NAAHAIQK[MT7].2y5_1.heavy 570.84 / 740.453 2844.0 17.063899993896484 50 20 10 10 10 5.709538514572061 17.51455038700184 0.0 3 0.9922519889130283 14.011558487062901 2844.0 35.158110236220466 0.0 - - - - - - - 120.08333333333333 5 12 AP3B1 adaptor-related protein complex 3, beta 1 subunit 335 43 C20140707_OR006_05 C20140707_OR006_05 TB450050.[MT7]-NAAHAIQK[MT7].2b4_1.heavy 570.84 / 538.285 2462.0 17.063899993896484 50 20 10 10 10 5.709538514572061 17.51455038700184 0.0 3 0.9922519889130283 14.011558487062901 2462.0 25.772176496805823 0.0 - - - - - - - 155.53333333333333 4 15 AP3B1 adaptor-related protein complex 3, beta 1 subunit 337 43 C20140707_OR006_05 C20140707_OR006_05 TB450050.[MT7]-NAAHAIQK[MT7].2y3_1.heavy 570.84 / 532.357 N/A 17.063899993896484 50 20 10 10 10 5.709538514572061 17.51455038700184 0.0 3 0.9922519889130283 14.011558487062901 1783.0 1.0006507609229258 1.0 - - - - - - - 233.41666666666666 4 12 AP3B1 adaptor-related protein complex 3, beta 1 subunit 339 44 C20140707_OR006_05 C20140707_OR006_05 TB436878.[MT7]-QSLC[CAM]HYTLK[MT7].3y3_1.heavy 479.93 / 505.347 13115.0 25.746400833129883 44 14 10 10 10 2.785597544185617 35.89894032206131 0.0 3 0.9327385702636152 4.731670167635669 13115.0 96.47816091954023 0.0 - - - - - - - 188.41666666666666 26 12 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 341 44 C20140707_OR006_05 C20140707_OR006_05 TB436878.[MT7]-QSLC[CAM]HYTLK[MT7].3b4_1.heavy 479.93 / 633.315 5038.0 25.746400833129883 44 14 10 10 10 2.785597544185617 35.89894032206131 0.0 3 0.9327385702636152 4.731670167635669 5038.0 27.304672783685003 0.0 - - - - - - - 210.08333333333334 10 12 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 343 44 C20140707_OR006_05 C20140707_OR006_05 TB436878.[MT7]-QSLC[CAM]HYTLK[MT7].3b5_1.heavy 479.93 / 770.374 1042.0 25.746400833129883 44 14 10 10 10 2.785597544185617 35.89894032206131 0.0 3 0.9327385702636152 4.731670167635669 1042.0 15.366505747126437 0.0 - - - - - - - 195.75 2 4 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 345 44 C20140707_OR006_05 C20140707_OR006_05 TB436878.[MT7]-QSLC[CAM]HYTLK[MT7].3y4_1.heavy 479.93 / 668.41 3648.0 25.746400833129883 44 14 10 10 10 2.785597544185617 35.89894032206131 0.0 3 0.9327385702636152 4.731670167635669 3648.0 27.7343842364532 0.0 - - - - - - - 173.83333333333334 7 12 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 347 45 C20140707_OR006_05 C20140707_OR006_05 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 211457.0 38.07870101928711 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 211457.0 164.77811466458658 0.0 - - - - - - - 213.5 422 2 349 45 C20140707_OR006_05 C20140707_OR006_05 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 149942.0 38.07870101928711 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 149942.0 340.6176580796253 0.0 - - - - - - - 313.2 299 5 351 45 C20140707_OR006_05 C20140707_OR006_05 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 234382.0 38.07870101928711 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 234382.0 398.860596491228 0.0 - - - - - - - 189.66666666666666 468 6 353 46 C20140707_OR006_05 C20140707_OR006_05 TB437027.[MT7]-YDQNYDIR.2b4_1.heavy 615.797 / 665.301 2508.0 25.82390022277832 40 10 10 10 10 1.7195231290261104 58.155658572988884 0.0 3 0.8377735602826928 3.0216733615613713 2508.0 20.41395348837209 0.0 - - - - - - - 204.0909090909091 5 11 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 355 46 C20140707_OR006_05 C20140707_OR006_05 TB437027.[MT7]-YDQNYDIR.2b6_1.heavy 615.797 / 943.391 14354.0 25.82390022277832 40 10 10 10 10 1.7195231290261104 58.155658572988884 0.0 3 0.8377735602826928 3.0216733615613713 14354.0 78.20586627089517 0.0 - - - - - - - 163.11111111111111 28 9 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 357 46 C20140707_OR006_05 C20140707_OR006_05 TB437027.[MT7]-YDQNYDIR.2y6_1.heavy 615.797 / 808.395 2335.0 25.82390022277832 40 10 10 10 10 1.7195231290261104 58.155658572988884 0.0 3 0.8377735602826928 3.0216733615613713 2335.0 10.183977577908214 0.0 - - - - - - - 212.6153846153846 4 13 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 359 46 C20140707_OR006_05 C20140707_OR006_05 TB437027.[MT7]-YDQNYDIR.2y7_1.heavy 615.797 / 923.422 3545.0 25.82390022277832 40 10 10 10 10 1.7195231290261104 58.155658572988884 0.0 3 0.8377735602826928 3.0216733615613713 3545.0 27.346826388733902 0.0 - - - - - - - 182.33333333333334 7 9 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 361 47 C20140707_OR006_05 C20140707_OR006_05 TB411695.[MT7]-QTLPFK[MT7].2y4_1.heavy 511.318 / 648.42 2947.0 29.76335048675537 43 20 10 5 8 3.9909379386852 18.06215302348187 0.04269981384277344 4 0.9986512105854163 33.600169551484264 2947.0 17.111402880876632 1.0 - - - - - - - 194.66666666666666 5 12 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 363 47 C20140707_OR006_05 C20140707_OR006_05 TB411695.[MT7]-QTLPFK[MT7].2y5_1.heavy 511.318 / 749.468 4788.0 29.76335048675537 43 20 10 5 8 3.9909379386852 18.06215302348187 0.04269981384277344 4 0.9986512105854163 33.600169551484264 4788.0 55.66536585365854 1.0 - - - - - - - 286.6666666666667 11 9 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 365 47 C20140707_OR006_05 C20140707_OR006_05 TB411695.[MT7]-QTLPFK[MT7].2y3_1.heavy 511.318 / 535.336 26396.0 29.76335048675537 43 20 10 5 8 3.9909379386852 18.06215302348187 0.04269981384277344 4 0.9986512105854163 33.600169551484264 26396.0 78.11127469484646 0.0 - - - - - - - 368.1111111111111 52 9 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 367 47 C20140707_OR006_05 C20140707_OR006_05 TB411695.[MT7]-QTLPFK[MT7].2b5_1.heavy 511.318 / 731.421 737.0 29.76335048675537 43 20 10 5 8 3.9909379386852 18.06215302348187 0.04269981384277344 4 0.9986512105854163 33.600169551484264 737.0 4.315317390958926 6.0 - - - - - - - 0.0 1 0 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 369 48 C20140707_OR006_05 C20140707_OR006_05 TB450243.[MT7]-LNMILVQILK[MT7].3y3_1.heavy 491.654 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 371 48 C20140707_OR006_05 C20140707_OR006_05 TB450243.[MT7]-LNMILVQILK[MT7].3b4_1.heavy 491.654 / 616.361 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 373 48 C20140707_OR006_05 C20140707_OR006_05 TB450243.[MT7]-LNMILVQILK[MT7].3b5_1.heavy 491.654 / 729.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 375 48 C20140707_OR006_05 C20140707_OR006_05 TB450243.[MT7]-LNMILVQILK[MT7].3b3_1.heavy 491.654 / 503.277 N/A N/A - - - - - - - - - 0.0 - - - - - - - XPO1 exportin 1 (CRM1 homolog, yeast) 377 49 C20140707_OR006_05 C20140707_OR006_05 TB437120.[MT7]-AQFSC[CAM]FNPK[MT7].3b4_1.heavy 462.907 / 578.305 3671.0 29.59025001525879 42 17 10 5 10 3.5617089142201017 28.07641006280738 0.043701171875 3 0.9749238446115851 7.777144279970264 3671.0 46.58413151684188 0.0 - - - - - - - 325.75 7 4 CA7 carbonic anhydrase VII 379 49 C20140707_OR006_05 C20140707_OR006_05 TB437120.[MT7]-AQFSC[CAM]FNPK[MT7].3b5_1.heavy 462.907 / 738.336 1302.0 29.59025001525879 42 17 10 5 10 3.5617089142201017 28.07641006280738 0.043701171875 3 0.9749238446115851 7.777144279970264 1302.0 5.293670886075949 1.0 - - - - - - - 236.66666666666666 2 3 CA7 carbonic anhydrase VII 381 49 C20140707_OR006_05 C20140707_OR006_05 TB437120.[MT7]-AQFSC[CAM]FNPK[MT7].3y4_1.heavy 462.907 / 649.379 710.0 29.59025001525879 42 17 10 5 10 3.5617089142201017 28.07641006280738 0.043701171875 3 0.9749238446115851 7.777144279970264 710.0 2.5172149225402 3.0 - - - - - - - 0.0 1 0 CA7 carbonic anhydrase VII 383 49 C20140707_OR006_05 C20140707_OR006_05 TB437120.[MT7]-AQFSC[CAM]FNPK[MT7].3b3_1.heavy 462.907 / 491.273 3789.0 29.59025001525879 42 17 10 5 10 3.5617089142201017 28.07641006280738 0.043701171875 3 0.9749238446115851 7.777144279970264 3789.0 30.679708860759494 0.0 - - - - - - - 186.0 7 7 CA7 carbonic anhydrase VII 385 50 C20140707_OR006_05 C20140707_OR006_05 TB437025.[MT7]-LTDALYMVR.2y8_1.heavy 613.34 / 968.487 58994.0 39.678199768066406 43 13 10 10 10 1.8275838178196373 42.43352476487655 0.0 3 0.9012734118222828 3.894984922951367 58994.0 360.077865864244 0.0 - - - - - - - 208.0 117 11 CA7 carbonic anhydrase VII 387 50 C20140707_OR006_05 C20140707_OR006_05 TB437025.[MT7]-LTDALYMVR.2b4_1.heavy 613.34 / 545.305 13284.0 39.678199768066406 43 13 10 10 10 1.8275838178196373 42.43352476487655 0.0 3 0.9012734118222828 3.894984922951367 13284.0 40.91597380388232 0.0 - - - - - - - 183.85714285714286 26 7 CA7 carbonic anhydrase VII 389 50 C20140707_OR006_05 C20140707_OR006_05 TB437025.[MT7]-LTDALYMVR.2y6_1.heavy 613.34 / 752.412 26426.0 39.678199768066406 43 13 10 10 10 1.8275838178196373 42.43352476487655 0.0 3 0.9012734118222828 3.894984922951367 26426.0 36.760517001911104 1.0 - - - - - - - 243.1 53 10 CA7 carbonic anhydrase VII 391 50 C20140707_OR006_05 C20140707_OR006_05 TB437025.[MT7]-LTDALYMVR.2b5_1.heavy 613.34 / 658.389 14998.0 39.678199768066406 43 13 10 10 10 1.8275838178196373 42.43352476487655 0.0 3 0.9012734118222828 3.894984922951367 14998.0 66.42470862470861 0.0 - - - - - - - 325.0 29 11 CA7 carbonic anhydrase VII 393 51 C20140707_OR006_05 C20140707_OR006_05 TB411967.[MT7]-SFTSEDDLVK[MT7].3b6_1.heavy 476.92 / 811.359 485.0 29.938400268554688 33 8 10 5 10 0.6667615536507977 75.26708269879555 0.04139900207519531 3 0.7897065573933033 2.6425732537549296 485.0 4.968181818181818 4.0 - - - - - - - 0.0 0 0 AP3B1 adaptor-related protein complex 3, beta 1 subunit 395 51 C20140707_OR006_05 C20140707_OR006_05 TB411967.[MT7]-SFTSEDDLVK[MT7].3y3_1.heavy 476.92 / 503.367 N/A 29.938400268554688 33 8 10 5 10 0.6667615536507977 75.26708269879555 0.04139900207519531 3 0.7897065573933033 2.6425732537549296 3155.0 15.590947632614299 1.0 - - - - - - - 242.6 6 10 AP3B1 adaptor-related protein complex 3, beta 1 subunit 397 51 C20140707_OR006_05 C20140707_OR006_05 TB411967.[MT7]-SFTSEDDLVK[MT7].3b7_1.heavy 476.92 / 926.386 1456.0 29.938400268554688 33 8 10 5 10 0.6667615536507977 75.26708269879555 0.04139900207519531 3 0.7897065573933033 2.6425732537549296 1456.0 12.752560279458125 0.0 - - - - - - - 222.33333333333334 2 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 399 51 C20140707_OR006_05 C20140707_OR006_05 TB411967.[MT7]-SFTSEDDLVK[MT7].3b3_1.heavy 476.92 / 480.258 2063.0 29.938400268554688 33 8 10 5 10 0.6667615536507977 75.26708269879555 0.04139900207519531 3 0.7897065573933033 2.6425732537549296 2063.0 2.126366059010267 1.0 - - - - - - - 214.46153846153845 4 13 AP3B1 adaptor-related protein complex 3, beta 1 subunit 401 52 C20140707_OR006_05 C20140707_OR006_05 TB411758.[MT7]-FTSSPGEK[MT7].2y4_1.heavy 570.811 / 574.332 32813.0 21.187625408172607 46 20 10 6 10 7.481997731087944 13.365414371150734 0.03190040588378906 3 0.9937870593606827 15.649074470600858 32813.0 212.96467290056177 0.0 - - - - - - - 202.14285714285714 65 14 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 403 52 C20140707_OR006_05 C20140707_OR006_05 TB411758.[MT7]-FTSSPGEK[MT7].2y5_1.heavy 570.811 / 661.364 8130.0 21.187625408172607 46 20 10 6 10 7.481997731087944 13.365414371150734 0.03190040588378906 3 0.9937870593606827 15.649074470600858 8130.0 38.604106356651606 0.0 - - - - - - - 151.64285714285714 16 14 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 405 52 C20140707_OR006_05 C20140707_OR006_05 TB411758.[MT7]-FTSSPGEK[MT7].2y6_1.heavy 570.811 / 748.396 8837.0 21.187625408172607 46 20 10 6 10 7.481997731087944 13.365414371150734 0.03190040588378906 3 0.9937870593606827 15.649074470600858 8837.0 220.17610169491525 0.0 - - - - - - - 134.0 17 11 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 407 52 C20140707_OR006_05 C20140707_OR006_05 TB411758.[MT7]-FTSSPGEK[MT7].2y7_1.heavy 570.811 / 849.443 15140.0 21.187625408172607 46 20 10 6 10 7.481997731087944 13.365414371150734 0.03190040588378906 3 0.9937870593606827 15.649074470600858 15140.0 141.19007520961532 0.0 - - - - - - - 149.4 30 15 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 409 53 C20140707_OR006_05 C20140707_OR006_05 TB450047.[MT7]-DIITLEMR.2y5_1.heavy 567.819 / 649.334 23317.0 36.905799865722656 43 18 10 5 10 3.106237205131347 25.781280020666937 0.04380035400390625 3 0.9813802696486659 9.030244169334829 23317.0 23.189642959142326 0.0 - - - - - - - 325.6666666666667 46 6 CASP2 caspase 2, apoptosis-related cysteine peptidase 411 53 C20140707_OR006_05 C20140707_OR006_05 TB450047.[MT7]-DIITLEMR.2b4_1.heavy 567.819 / 587.352 8098.0 36.905799865722656 43 18 10 5 10 3.106237205131347 25.781280020666937 0.04380035400390625 3 0.9813802696486659 9.030244169334829 8098.0 20.356448495872968 0.0 - - - - - - - 259.42857142857144 16 7 CASP2 caspase 2, apoptosis-related cysteine peptidase 413 53 C20140707_OR006_05 C20140707_OR006_05 TB450047.[MT7]-DIITLEMR.2y6_1.heavy 567.819 / 762.418 16196.0 36.905799865722656 43 18 10 5 10 3.106237205131347 25.781280020666937 0.04380035400390625 3 0.9813802696486659 9.030244169334829 16196.0 63.714574383452664 0.0 - - - - - - - 321.1 32 10 CASP2 caspase 2, apoptosis-related cysteine peptidase 415 53 C20140707_OR006_05 C20140707_OR006_05 TB450047.[MT7]-DIITLEMR.2y7_1.heavy 567.819 / 875.502 19687.0 36.905799865722656 43 18 10 5 10 3.106237205131347 25.781280020666937 0.04380035400390625 3 0.9813802696486659 9.030244169334829 19687.0 190.04053635432666 0.0 - - - - - - - 232.66666666666666 39 6 CASP2 caspase 2, apoptosis-related cysteine peptidase 417 54 C20140707_OR006_05 C20140707_OR006_05 TB412429.[MT7]-EMGFIIYGNEDSPVVPLMLYMPAK[MT7].3b6_1.heavy 1001.52 / 835.45 2510.0 52.38535022735596 39 13 10 6 10 2.889248982247188 34.61107042502873 0.039798736572265625 3 0.9176940977539111 4.271910392055419 2510.0 21.907456140350877 0.0 - - - - - - - 184.57142857142858 5 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 419 54 C20140707_OR006_05 C20140707_OR006_05 TB412429.[MT7]-EMGFIIYGNEDSPVVPLMLYMPAK[MT7].3b4_1.heavy 1001.52 / 609.282 1749.0 52.38535022735596 39 13 10 6 10 2.889248982247188 34.61107042502873 0.039798736572265625 3 0.9176940977539111 4.271910392055419 1749.0 5.753289473684211 1.0 - - - - - - - 228.0 3 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 421 54 C20140707_OR006_05 C20140707_OR006_05 TB412429.[MT7]-EMGFIIYGNEDSPVVPLMLYMPAK[MT7].3b5_1.heavy 1001.52 / 722.366 3346.0 52.38535022735596 39 13 10 6 10 2.889248982247188 34.61107042502873 0.039798736572265625 3 0.9176940977539111 4.271910392055419 3346.0 35.22105263157895 1.0 - - - - - - - 164.66666666666666 6 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 423 54 C20140707_OR006_05 C20140707_OR006_05 TB412429.[MT7]-EMGFIIYGNEDSPVVPLMLYMPAK[MT7].3y9_1.heavy 1001.52 / 1207.67 2205.0 52.38535022735596 39 13 10 6 10 2.889248982247188 34.61107042502873 0.039798736572265625 3 0.9176940977539111 4.271910392055419 2205.0 9.719407894736841 0.0 - - - - - - - 237.5 4 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 425 55 C20140707_OR006_05 C20140707_OR006_05 TB437123.[MT7]-EMLIEVIEK[MT7].2y4_1.heavy 696.407 / 632.41 2982.0 40.701101303100586 41 20 8 5 8 6.386881574122323 15.657093190074043 0.04360198974609375 4 0.9904988072111349 12.651116189187526 2982.0 22.05 0.0 - - - - - - - 243.42857142857142 5 7 AP3B1 adaptor-related protein complex 3, beta 1 subunit 427 55 C20140707_OR006_05 C20140707_OR006_05 TB437123.[MT7]-EMLIEVIEK[MT7].2b3_1.heavy 696.407 / 518.276 10934.0 40.701101303100586 41 20 8 5 8 6.386881574122323 15.657093190074043 0.04360198974609375 4 0.9904988072111349 12.651116189187526 10934.0 45.943333333333335 0.0 - - - - - - - 284.0 21 12 AP3B1 adaptor-related protein complex 3, beta 1 subunit 429 55 C20140707_OR006_05 C20140707_OR006_05 TB437123.[MT7]-EMLIEVIEK[MT7].2y5_1.heavy 696.407 / 761.453 5822.0 40.701101303100586 41 20 8 5 8 6.386881574122323 15.657093190074043 0.04360198974609375 4 0.9904988072111349 12.651116189187526 5822.0 19.065 0.0 - - - - - - - 304.2857142857143 11 7 AP3B1 adaptor-related protein complex 3, beta 1 subunit 431 55 C20140707_OR006_05 C20140707_OR006_05 TB437123.[MT7]-EMLIEVIEK[MT7].2y3_1.heavy 696.407 / 533.341 5822.0 40.701101303100586 41 20 8 5 8 6.386881574122323 15.657093190074043 0.04360198974609375 4 0.9904988072111349 12.651116189187526 5822.0 19.051333333333332 1.0 - - - - - - - 263.7142857142857 29 7 AP3B1 adaptor-related protein complex 3, beta 1 subunit 433 56 C20140707_OR006_05 C20140707_OR006_05 TB412422.[MT7]-LLVLC[CAM]DNSISLVNMLNLEPVPSGAR.3y7_1.heavy 956.853 / 683.383 6685.0 52.754798889160156 48 18 10 10 10 2.8859951164530515 27.01159960972997 0.0 3 0.9844225368216326 9.875261822750831 6685.0 8.152439024390244 1.0 - - - - - - - 754.625 13 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 435 56 C20140707_OR006_05 C20140707_OR006_05 TB412422.[MT7]-LLVLC[CAM]DNSISLVNMLNLEPVPSGAR.3b4_1.heavy 956.853 / 583.43 2726.0 52.754798889160156 48 18 10 10 10 2.8859951164530515 27.01159960972997 0.0 3 0.9844225368216326 9.875261822750831 2726.0 13.295600813283631 0.0 - - - - - - - 189.0 5 11 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 437 56 C20140707_OR006_05 C20140707_OR006_05 TB412422.[MT7]-LLVLC[CAM]DNSISLVNMLNLEPVPSGAR.3y8_1.heavy 956.853 / 812.426 1752.0 52.754798889160156 48 18 10 10 10 2.8859951164530515 27.01159960972997 0.0 3 0.9844225368216326 9.875261822750831 1752.0 6.125244215938304 0.0 - - - - - - - 202.52941176470588 3 17 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 439 56 C20140707_OR006_05 C20140707_OR006_05 TB412422.[MT7]-LLVLC[CAM]DNSISLVNMLNLEPVPSGAR.3y10_1.heavy 956.853 / 1039.55 3700.0 52.754798889160156 48 18 10 10 10 2.8859951164530515 27.01159960972997 0.0 3 0.9844225368216326 9.875261822750831 3700.0 23.395384615384614 0.0 - - - - - - - 239.76923076923077 7 13 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 441 57 C20140707_OR006_05 C20140707_OR006_05 TB411753.[MT7]-DHDEEAK[MT7].2y6_1.heavy 566.28 / 872.423 361.0 13.118799845377604 37 18 2 7 10 4.055523164593381 24.657731183253226 0.028499603271484375 3 0.9827213233547345 9.375184096880718 361.0 10.027777777777777 0.0 - - - - - - - 0.0 0 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 443 57 C20140707_OR006_05 C20140707_OR006_05 TB411753.[MT7]-DHDEEAK[MT7].2b3_1.heavy 566.28 / 512.222 N/A 13.118799845377604 37 18 2 7 10 4.055523164593381 24.657731183253226 0.028499603271484375 3 0.9827213233547345 9.375184096880718 767.0 2.429003528818686 20.0 - - - - - - - 252.3793103448276 3 29 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 445 57 C20140707_OR006_05 C20140707_OR006_05 TB411753.[MT7]-DHDEEAK[MT7].2y4_1.heavy 566.28 / 620.337 586.0 13.118799845377604 37 18 2 7 10 4.055523164593381 24.657731183253226 0.028499603271484375 3 0.9827213233547345 9.375184096880718 586.0 21.670943396226416 0.0 - - - - - - - 0.0 1 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 447 57 C20140707_OR006_05 C20140707_OR006_05 TB411753.[MT7]-DHDEEAK[MT7].2y5_1.heavy 566.28 / 735.364 316.0 13.118799845377604 37 18 2 7 10 4.055523164593381 24.657731183253226 0.028499603271484375 3 0.9827213233547345 9.375184096880718 316.0 17.555555555555557 0.0 - - - - - - - 0.0 0 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 449 58 C20140707_OR006_05 C20140707_OR006_05 TB437432.[MT7]-NNLMGDDIFC[CAM]YYFK[MT7].2b4_1.heavy 1044.49 / 617.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 451 58 C20140707_OR006_05 C20140707_OR006_05 TB437432.[MT7]-NNLMGDDIFC[CAM]YYFK[MT7].2y3_1.heavy 1044.49 / 601.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 453 58 C20140707_OR006_05 C20140707_OR006_05 TB437432.[MT7]-NNLMGDDIFC[CAM]YYFK[MT7].2y6_1.heavy 1044.49 / 1071.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 455 58 C20140707_OR006_05 C20140707_OR006_05 TB437432.[MT7]-NNLMGDDIFC[CAM]YYFK[MT7].2b7_1.heavy 1044.49 / 904.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 457 59 C20140707_OR006_05 C20140707_OR006_05 TB450447.[MT7]-SLVASLAEPDFVVTDFAK[MT7].3y3_1.heavy 733.071 / 509.32 12261.0 47.22710037231445 48 18 10 10 10 15.219126829657904 6.570679193311368 0.0 3 0.9895479474985149 12.060979495783288 12261.0 54.50197940906847 0.0 - - - - - - - 260.77777777777777 24 9 UBA1 ubiquitin-like modifier activating enzyme 1 459 59 C20140707_OR006_05 C20140707_OR006_05 TB450447.[MT7]-SLVASLAEPDFVVTDFAK[MT7].3b4_1.heavy 733.071 / 515.331 9913.0 47.22710037231445 48 18 10 10 10 15.219126829657904 6.570679193311368 0.0 3 0.9895479474985149 12.060979495783288 9913.0 55.90780076628353 0.0 - - - - - - - 173.66666666666666 19 3 UBA1 ubiquitin-like modifier activating enzyme 1 461 59 C20140707_OR006_05 C20140707_OR006_05 TB450447.[MT7]-SLVASLAEPDFVVTDFAK[MT7].3b8_1.heavy 733.071 / 915.527 10435.0 47.22710037231445 48 18 10 10 10 15.219126829657904 6.570679193311368 0.0 3 0.9895479474985149 12.060979495783288 10435.0 15.810511062642577 1.0 - - - - - - - 260.8 22 5 UBA1 ubiquitin-like modifier activating enzyme 1 463 59 C20140707_OR006_05 C20140707_OR006_05 TB450447.[MT7]-SLVASLAEPDFVVTDFAK[MT7].3y5_1.heavy 733.071 / 725.395 14087.0 47.22710037231445 48 18 10 10 10 15.219126829657904 6.570679193311368 0.0 3 0.9895479474985149 12.060979495783288 14087.0 152.58633185971115 0.0 - - - - - - - 179.0 28 8 UBA1 ubiquitin-like modifier activating enzyme 1 465 60 C20140707_OR006_05 C20140707_OR006_05 TB437430.[MT7]-LFQEYANLQVSEPQIR.2b3_1.heavy 1040.05 / 533.32 1709.0 40.75490188598633 46 16 10 10 10 2.5035814091444366 32.942454793642284 0.0 3 0.9682186450481435 6.904292765989178 1709.0 15.14494094390907 0.0 - - - - - - - 237.33333333333334 3 3 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 467 60 C20140707_OR006_05 C20140707_OR006_05 TB437430.[MT7]-LFQEYANLQVSEPQIR.2y4_1.heavy 1040.05 / 513.314 4130.0 40.75490188598633 46 16 10 10 10 2.5035814091444366 32.942454793642284 0.0 3 0.9682186450481435 6.904292765989178 4130.0 36.531366889863776 0.0 - - - - - - - 284.75 8 4 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 469 60 C20140707_OR006_05 C20140707_OR006_05 TB437430.[MT7]-LFQEYANLQVSEPQIR.2b4_1.heavy 1040.05 / 662.363 4415.0 40.75490188598633 46 16 10 10 10 2.5035814091444366 32.942454793642284 0.0 3 0.9682186450481435 6.904292765989178 4415.0 29.743157894736843 0.0 - - - - - - - 284.75 8 4 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 471 60 C20140707_OR006_05 C20140707_OR006_05 TB437430.[MT7]-LFQEYANLQVSEPQIR.2y10_1.heavy 1040.05 / 1183.64 1139.0 40.75490188598633 46 16 10 10 10 2.5035814091444366 32.942454793642284 0.0 3 0.9682186450481435 6.904292765989178 1139.0 1.4227772764306357 1.0 - - - - - - - 256.2 2 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 473 61 C20140707_OR006_05 C20140707_OR006_05 TB450445.[MT7]-ASILWLIGENC[CAM]ERVPK[MT7].3y7_1.heavy 725.073 / 1046.55 1000.0 42.91659927368164 40 12 10 10 8 0.9146656696718343 63.67257418945178 0.0 4 0.8984509195887829 3.8395363665402136 1000.0 -1.4010507880910685 4.0 - - - - - - - 250.0 2 4 AP3B1 adaptor-related protein complex 3, beta 1 subunit 475 61 C20140707_OR006_05 C20140707_OR006_05 TB450445.[MT7]-ASILWLIGENC[CAM]ERVPK[MT7].3b4_1.heavy 725.073 / 529.347 2999.0 42.91659927368164 40 12 10 10 8 0.9146656696718343 63.67257418945178 0.0 4 0.8984509195887829 3.8395363665402136 2999.0 -0.3676532399299477 0.0 - - - - - - - 200.0 5 5 AP3B1 adaptor-related protein complex 3, beta 1 subunit 477 61 C20140707_OR006_05 C20140707_OR006_05 TB450445.[MT7]-ASILWLIGENC[CAM]ERVPK[MT7].3b3_1.heavy 725.073 / 416.263 4427.0 42.91659927368164 40 12 10 10 8 0.9146656696718343 63.67257418945178 0.0 4 0.8984509195887829 3.8395363665402136 4427.0 -3.10122591943958 0.0 - - - - - - - 257.2 8 5 AP3B1 adaptor-related protein complex 3, beta 1 subunit 479 61 C20140707_OR006_05 C20140707_OR006_05 TB450445.[MT7]-ASILWLIGENC[CAM]ERVPK[MT7].3y9_1.heavy 725.073 / 1232.62 1285.0 42.91659927368164 40 12 10 10 8 0.9146656696718343 63.67257418945178 0.0 4 0.8984509195887829 3.8395363665402136 1285.0 -2.4018691588785046 1.0 - - - - - - - 285.875 9 8 AP3B1 adaptor-related protein complex 3, beta 1 subunit 481 62 C20140707_OR006_05 C20140707_OR006_05 TB411961.[MT7]-NTGSC[CAM]QEAAAK[MT7].2b8_1.heavy 712.856 / 992.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPTLC2 serine palmitoyltransferase, long chain base subunit 2 483 62 C20140707_OR006_05 C20140707_OR006_05 TB411961.[MT7]-NTGSC[CAM]QEAAAK[MT7].2y5_1.heavy 712.856 / 633.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPTLC2 serine palmitoyltransferase, long chain base subunit 2 485 62 C20140707_OR006_05 C20140707_OR006_05 TB411961.[MT7]-NTGSC[CAM]QEAAAK[MT7].2b6_1.heavy 712.856 / 792.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPTLC2 serine palmitoyltransferase, long chain base subunit 2 487 62 C20140707_OR006_05 C20140707_OR006_05 TB411961.[MT7]-NTGSC[CAM]QEAAAK[MT7].2y6_1.heavy 712.856 / 761.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPTLC2 serine palmitoyltransferase, long chain base subunit 2 489 63 C20140707_OR006_05 C20140707_OR006_05 TB450443.[MT7]-RNIGVVVVGFPATPIIESR.3y6_1.heavy 723.427 / 714.414 11760.0 40.668399810791016 46 16 10 10 10 2.226353522164725 35.248179979895376 0.0 3 0.9678327239290906 6.862527961692489 11760.0 31.249587695728714 0.0 - - - - - - - 272.3 23 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 491 63 C20140707_OR006_05 C20140707_OR006_05 TB450443.[MT7]-RNIGVVVVGFPATPIIESR.3b6_1.heavy 723.427 / 783.496 6454.0 40.668399810791016 46 16 10 10 10 2.226353522164725 35.248179979895376 0.0 3 0.9678327239290906 6.862527961692489 6454.0 26.98536585365854 0.0 - - - - - - - 258.0 12 5 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 493 63 C20140707_OR006_05 C20140707_OR006_05 TB450443.[MT7]-RNIGVVVVGFPATPIIESR.3b5_1.heavy 723.427 / 684.427 5450.0 40.668399810791016 46 16 10 10 10 2.226353522164725 35.248179979895376 0.0 3 0.9678327239290906 6.862527961692489 5450.0 22.464407179643793 0.0 - - - - - - - 286.75 10 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 495 63 C20140707_OR006_05 C20140707_OR006_05 TB450443.[MT7]-RNIGVVVVGFPATPIIESR.3y9_1.heavy 723.427 / 983.552 18644.0 40.668399810791016 46 16 10 10 10 2.226353522164725 35.248179979895376 0.0 3 0.9678327239290906 6.862527961692489 18644.0 62.82841994566314 1.0 - - - - - - - 250.75 40 4 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 497 64 C20140707_OR006_05 C20140707_OR006_05 TB437534.[MT7]-GVVEYFGLDPEDVDVMMGTFTK[MT7].4y5_1.heavy 685.089 / 697.4 4708.0 52.08150100708008 42 12 10 10 10 0.9049883646813338 63.59459011045092 0.0 3 0.8977952563717887 3.826983604067021 4708.0 36.42467150076906 0.0 - - - - - - - 212.4 9 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 499 64 C20140707_OR006_05 C20140707_OR006_05 TB437534.[MT7]-GVVEYFGLDPEDVDVMMGTFTK[MT7].4b7_1.heavy 685.089 / 896.463 2770.0 52.08150100708008 42 12 10 10 10 0.9049883646813338 63.59459011045092 0.0 3 0.8977952563717887 3.826983604067021 2770.0 57.80869565217392 0.0 - - - - - - - 153.66666666666666 5 3 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 501 64 C20140707_OR006_05 C20140707_OR006_05 TB437534.[MT7]-GVVEYFGLDPEDVDVMMGTFTK[MT7].4b4_1.heavy 685.089 / 529.31 4062.0 52.08150100708008 42 12 10 10 10 0.9049883646813338 63.59459011045092 0.0 3 0.8977952563717887 3.826983604067021 4062.0 3.646822268243077 1.0 - - - - - - - 243.36363636363637 8 11 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 503 64 C20140707_OR006_05 C20140707_OR006_05 TB437534.[MT7]-GVVEYFGLDPEDVDVMMGTFTK[MT7].4b5_1.heavy 685.089 / 692.374 4431.0 52.08150100708008 42 12 10 10 10 0.9049883646813338 63.59459011045092 0.0 3 0.8977952563717887 3.826983604067021 4431.0 15.162959550957737 0.0 - - - - - - - 240.0 8 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 505 65 C20140707_OR006_05 C20140707_OR006_05 TB437535.[MT7]-VTDSC[CAM]IVALLSHGVEGAIYGVDGK[MT7].4b8_1.heavy 687.867 / 990.505 1107.0 50.1781005859375 38 8 10 10 10 1.7074749496963118 58.566012940796476 0.0 3 0.7929342316495424 2.6638658251505247 1107.0 4.374771302404187 2.0 - - - - - - - 249.0 3 8 CASP2 caspase 2, apoptosis-related cysteine peptidase 507 65 C20140707_OR006_05 C20140707_OR006_05 TB437535.[MT7]-VTDSC[CAM]IVALLSHGVEGAIYGVDGK[MT7].4y5_1.heavy 687.867 / 619.353 4649.0 50.1781005859375 38 8 10 10 10 1.7074749496963118 58.566012940796476 0.0 3 0.7929342316495424 2.6638658251505247 4649.0 19.954292168674698 0.0 - - - - - - - 258.0 9 3 CASP2 caspase 2, apoptosis-related cysteine peptidase 509 65 C20140707_OR006_05 C20140707_OR006_05 TB437535.[MT7]-VTDSC[CAM]IVALLSHGVEGAIYGVDGK[MT7].4b5_1.heavy 687.867 / 707.315 886.0 50.1781005859375 38 8 10 10 10 1.7074749496963118 58.566012940796476 0.0 3 0.7929342316495424 2.6638658251505247 886.0 7.194619053442583 5.0 - - - - - - - 0.0 1 0 CASP2 caspase 2, apoptosis-related cysteine peptidase 511 65 C20140707_OR006_05 C20140707_OR006_05 TB437535.[MT7]-VTDSC[CAM]IVALLSHGVEGAIYGVDGK[MT7].4b6_1.heavy 687.867 / 820.399 1218.0 50.1781005859375 38 8 10 10 10 1.7074749496963118 58.566012940796476 0.0 3 0.7929342316495424 2.6638658251505247 1218.0 6.71865480019626 0.0 - - - - - - - 239.83333333333334 2 6 CASP2 caspase 2, apoptosis-related cysteine peptidase 513 66 C20140707_OR006_05 C20140707_OR006_05 TB412042.[MT7]-INDTEFFYWR.2b5_1.heavy 767.876 / 717.354 1505.0 43.65032482147217 37 16 10 1 10 3.7483452929628336 20.656574882997287 0.09129714965820312 3 0.9653928979640906 6.614838677781299 1505.0 6.978299611559311 1.0 - - - - - - - 328.8 3 5 CCNG2 cyclin G2 515 66 C20140707_OR006_05 C20140707_OR006_05 TB412042.[MT7]-INDTEFFYWR.2y5_1.heavy 767.876 / 818.398 821.0 43.65032482147217 37 16 10 1 10 3.7483452929628336 20.656574882997287 0.09129714965820312 3 0.9653928979640906 6.614838677781299 821.0 2.727810218978102 5.0 - - - - - - - 243.55555555555554 2 9 CCNG2 cyclin G2 517 66 C20140707_OR006_05 C20140707_OR006_05 TB412042.[MT7]-INDTEFFYWR.2b4_1.heavy 767.876 / 588.311 1095.0 43.65032482147217 37 16 10 1 10 3.7483452929628336 20.656574882997287 0.09129714965820312 3 0.9653928979640906 6.614838677781299 1095.0 5.778196599901253 3.0 - - - - - - - 234.85714285714286 2 7 CCNG2 cyclin G2 519 66 C20140707_OR006_05 C20140707_OR006_05 TB412042.[MT7]-INDTEFFYWR.2y7_1.heavy 767.876 / 1048.49 3010.0 43.65032482147217 37 16 10 1 10 3.7483452929628336 20.656574882997287 0.09129714965820312 3 0.9653928979640906 6.614838677781299 3010.0 13.841605839416058 0.0 - - - - - - - 256.875 6 8 CCNG2 cyclin G2 521 67 C20140707_OR006_05 C20140707_OR006_05 TB411682.[MT7]-VPSEGPK[MT7].2y4_1.heavy 501.297 / 574.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAG3 BCL2-associated athanogene 3 523 67 C20140707_OR006_05 C20140707_OR006_05 TB411682.[MT7]-VPSEGPK[MT7].2y5_1.heavy 501.297 / 661.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAG3 BCL2-associated athanogene 3 525 67 C20140707_OR006_05 C20140707_OR006_05 TB411682.[MT7]-VPSEGPK[MT7].2y6_1.heavy 501.297 / 758.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAG3 BCL2-associated athanogene 3 527 67 C20140707_OR006_05 C20140707_OR006_05 TB411682.[MT7]-VPSEGPK[MT7].2b5_1.heavy 501.297 / 614.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAG3 BCL2-associated athanogene 3 529 68 C20140707_OR006_05 C20140707_OR006_05 TB450137.[MT7]-VGVQVLDRK[MT7].3b4_1.heavy 434.61 / 528.326 11155.0 26.683500289916992 43 13 10 10 10 2.5966516591093605 38.51113400181661 0.0 3 0.9022786588540077 3.915307559809144 11155.0 17.37562404039231 1.0 - - - - - - - 154.0 23 11 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 531 68 C20140707_OR006_05 C20140707_OR006_05 TB450137.[MT7]-VGVQVLDRK[MT7].3y4_1.heavy 434.61 / 675.427 4901.0 26.683500289916992 43 13 10 10 10 2.5966516591093605 38.51113400181661 0.0 3 0.9022786588540077 3.915307559809144 4901.0 5.007956989247312 1.0 - - - - - - - 704.3333333333334 9 12 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 533 68 C20140707_OR006_05 C20140707_OR006_05 TB450137.[MT7]-VGVQVLDRK[MT7].3y8_2.heavy 434.61 / 529.826 25352.0 26.683500289916992 43 13 10 10 10 2.5966516591093605 38.51113400181661 0.0 3 0.9022786588540077 3.915307559809144 25352.0 198.01562130177516 0.0 - - - - - - - 183.33333333333334 50 6 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 535 68 C20140707_OR006_05 C20140707_OR006_05 TB450137.[MT7]-VGVQVLDRK[MT7].3y5_1.heavy 434.61 / 774.495 1521.0 26.683500289916992 43 13 10 10 10 2.5966516591093605 38.51113400181661 0.0 3 0.9022786588540077 3.915307559809144 1521.0 34.714588235294116 0.0 - - - - - - - 99.0 3 6 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 537 69 C20140707_OR006_05 C20140707_OR006_05 TB450138.[MT7]-NVEVIELAK[MT7].2y8_1.heavy 651.897 / 1044.64 1560.0 33.54012489318848 40 14 10 6 10 3.910571820546481 25.57170781894131 0.03910064697265625 3 0.9441706708301838 5.198638624496528 1560.0 11.236363636363636 5.0 - - - - - - - 260.0 4 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 539 69 C20140707_OR006_05 C20140707_OR006_05 TB450138.[MT7]-NVEVIELAK[MT7].2y5_1.heavy 651.897 / 717.463 5461.0 33.54012489318848 40 14 10 6 10 3.910571820546481 25.57170781894131 0.03910064697265625 3 0.9441706708301838 5.198638624496528 5461.0 16.803076923076922 0.0 - - - - - - - 208.0 10 10 AP3B1 adaptor-related protein complex 3, beta 1 subunit 541 69 C20140707_OR006_05 C20140707_OR006_05 TB450138.[MT7]-NVEVIELAK[MT7].2b4_1.heavy 651.897 / 586.332 7021.0 33.54012489318848 40 14 10 6 10 3.910571820546481 25.57170781894131 0.03910064697265625 3 0.9441706708301838 5.198638624496528 7021.0 18.632653846153847 0.0 - - - - - - - 325.0 14 2 AP3B1 adaptor-related protein complex 3, beta 1 subunit 543 69 C20140707_OR006_05 C20140707_OR006_05 TB450138.[MT7]-NVEVIELAK[MT7].2y6_1.heavy 651.897 / 816.531 3771.0 33.54012489318848 40 14 10 6 10 3.910571820546481 25.57170781894131 0.03910064697265625 3 0.9441706708301838 5.198638624496528 3771.0 19.580192307692307 0.0 - - - - - - - 260.0 7 7 AP3B1 adaptor-related protein complex 3, beta 1 subunit 545 70 C20140707_OR006_05 C20140707_OR006_05 TB411976.[MT7]-LQNFAQLPAHR.3b6_1.heavy 480.273 / 846.459 996.0 30.87529945373535 33 16 6 5 6 3.4950697062497325 28.6117326418939 0.04199981689453125 6 0.9648707703854165 6.56520693180188 996.0 9.625806451612904 1.0 - - - - - - - 0.0 1 0 CASP2 caspase 2, apoptosis-related cysteine peptidase 547 70 C20140707_OR006_05 C20140707_OR006_05 TB411976.[MT7]-LQNFAQLPAHR.3b4_1.heavy 480.273 / 647.363 3610.0 30.87529945373535 33 16 6 5 6 3.4950697062497325 28.6117326418939 0.04199981689453125 6 0.9648707703854165 6.56520693180188 3610.0 10.557476035024138 2.0 - - - - - - - 302.14285714285717 19 7 CASP2 caspase 2, apoptosis-related cysteine peptidase 549 70 C20140707_OR006_05 C20140707_OR006_05 TB411976.[MT7]-LQNFAQLPAHR.3b5_1.heavy 480.273 / 718.4 2863.0 30.87529945373535 33 16 6 5 6 3.4950697062497325 28.6117326418939 0.04199981689453125 6 0.9648707703854165 6.56520693180188 2863.0 20.236465863453816 0.0 - - - - - - - 174.0 5 5 CASP2 caspase 2, apoptosis-related cysteine peptidase 551 70 C20140707_OR006_05 C20140707_OR006_05 TB411976.[MT7]-LQNFAQLPAHR.3b3_1.heavy 480.273 / 500.295 10331.0 30.87529945373535 33 16 6 5 6 3.4950697062497325 28.6117326418939 0.04199981689453125 6 0.9648707703854165 6.56520693180188 10331.0 63.232700991634104 1.0 - - - - - - - 316.72727272727275 32 11 CASP2 caspase 2, apoptosis-related cysteine peptidase 553 71 C20140707_OR006_05 C20140707_OR006_05 TB411979.[MT7]-EGHILQDFEGR.3y7_1.heavy 482.248 / 864.421 1746.0 31.465150833129883 38 13 10 5 10 1.1366651794434188 53.11151753237732 0.04380035400390625 3 0.9282594990924187 4.579825722911123 1746.0 26.958239999999996 0.0 - - - - - - - 166.33333333333334 3 3 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 555 71 C20140707_OR006_05 C20140707_OR006_05 TB411979.[MT7]-EGHILQDFEGR.3y6_1.heavy 482.248 / 751.337 2120.0 31.465150833129883 38 13 10 5 10 1.1366651794434188 53.11151753237732 0.04380035400390625 3 0.9282594990924187 4.579825722911123 2120.0 20.352 0.0 - - - - - - - 125.0 4 2 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 557 71 C20140707_OR006_05 C20140707_OR006_05 TB411979.[MT7]-EGHILQDFEGR.3y4_1.heavy 482.248 / 508.251 5736.0 31.465150833129883 38 13 10 5 10 1.1366651794434188 53.11151753237732 0.04380035400390625 3 0.9282594990924187 4.579825722911123 5736.0 29.75358288770053 0.0 - - - - - - - 311.8333333333333 11 6 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 559 71 C20140707_OR006_05 C20140707_OR006_05 TB411979.[MT7]-EGHILQDFEGR.3y5_1.heavy 482.248 / 623.278 3491.0 31.465150833129883 38 13 10 5 10 1.1366651794434188 53.11151753237732 0.04380035400390625 3 0.9282594990924187 4.579825722911123 3491.0 35.39911336898396 0.0 - - - - - - - 249.3 6 10 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 561 72 C20140707_OR006_05 C20140707_OR006_05 TB437038.[MT7]-GLALVLSNVHFTGEK[MT7].3y6_1.heavy 625.031 / 862.454 17615.0 41.54880142211914 50 20 10 10 10 6.884911514633526 14.524514917505496 0.0 3 0.9938599527961611 15.741787608174242 17615.0 154.49562647754138 0.0 - - - - - - - 261.85714285714283 35 7 CASP2 caspase 2, apoptosis-related cysteine peptidase 563 72 C20140707_OR006_05 C20140707_OR006_05 TB437038.[MT7]-GLALVLSNVHFTGEK[MT7].3b5_1.heavy 625.031 / 598.404 39740.0 41.54880142211914 50 20 10 10 10 6.884911514633526 14.524514917505496 0.0 3 0.9938599527961611 15.741787608174242 39740.0 175.68274231678487 0.0 - - - - - - - 282.0 79 10 CASP2 caspase 2, apoptosis-related cysteine peptidase 565 72 C20140707_OR006_05 C20140707_OR006_05 TB437038.[MT7]-GLALVLSNVHFTGEK[MT7].3y4_1.heavy 625.031 / 578.327 43968.0 41.54880142211914 50 20 10 10 10 6.884911514633526 14.524514917505496 0.0 3 0.9938599527961611 15.741787608174242 43968.0 99.26581560283688 0.0 - - - - - - - 684.8571428571429 87 7 CASP2 caspase 2, apoptosis-related cysteine peptidase 567 72 C20140707_OR006_05 C20140707_OR006_05 TB437038.[MT7]-GLALVLSNVHFTGEK[MT7].3y5_1.heavy 625.031 / 725.395 39318.0 41.54880142211914 50 20 10 10 10 6.884911514633526 14.524514917505496 0.0 3 0.9938599527961611 15.741787608174242 39318.0 99.41040425531915 0.0 - - - - - - - 705.0 78 7 CASP2 caspase 2, apoptosis-related cysteine peptidase 569 73 C20140707_OR006_05 C20140707_OR006_05 TB411684.[MT7]-LAADGSLGR.2y8_1.heavy 502.286 / 746.379 2094.0 24.591875076293945 32 16 9 3 4 2.9757013399221464 33.60552306052875 0.07049942016601562 7 0.9638382138092141 6.470233144243276 2094.0 8.020496894409938 2.0 - - - - - - - 229.3846153846154 4 13 RIN1 Ras and Rab interactor 1 571 73 C20140707_OR006_05 C20140707_OR006_05 TB411684.[MT7]-LAADGSLGR.2b4_1.heavy 502.286 / 515.295 1047.0 24.591875076293945 32 16 9 3 4 2.9757013399221464 33.60552306052875 0.07049942016601562 7 0.9638382138092141 6.470233144243276 1047.0 13.332169312169313 2.0 - - - - - - - 220.26666666666668 2 15 RIN1 Ras and Rab interactor 1 573 73 C20140707_OR006_05 C20140707_OR006_05 TB411684.[MT7]-LAADGSLGR.2y6_1.heavy 502.286 / 604.305 564.0 24.591875076293945 32 16 9 3 4 2.9757013399221464 33.60552306052875 0.07049942016601562 7 0.9638382138092141 6.470233144243276 564.0 8.372854842420061 9.0 - - - - - - - 0.0 1 0 RIN1 Ras and Rab interactor 1 575 73 C20140707_OR006_05 C20140707_OR006_05 TB411684.[MT7]-LAADGSLGR.2y7_1.heavy 502.286 / 675.342 483.0 24.591875076293945 32 16 9 3 4 2.9757013399221464 33.60552306052875 0.07049942016601562 7 0.9638382138092141 6.470233144243276 483.0 1.4499999999999997 8.0 - - - - - - - 0.0 1 0 RIN1 Ras and Rab interactor 1 577 74 C20140707_OR006_05 C20140707_OR006_05 TB412419.[MT7]-GVVEYFGLDPEDVDVMMGTFTK[MT7].3b9_1.heavy 913.116 / 1124.57 10036.0 52.05980110168457 45 20 10 5 10 21.45677068660482 4.660533565865467 0.043399810791015625 3 0.9994026142357423 50.49092332809161 10036.0 122.85805785123966 0.0 - - - - - - - 187.0 20 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 579 74 C20140707_OR006_05 C20140707_OR006_05 TB412419.[MT7]-GVVEYFGLDPEDVDVMMGTFTK[MT7].3y6_1.heavy 913.116 / 828.441 5722.0 52.05980110168457 45 20 10 5 10 21.45677068660482 4.660533565865467 0.043399810791015625 3 0.9994026142357423 50.49092332809161 5722.0 31.194653409090904 0.0 - - - - - - - 249.33333333333334 11 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 581 74 C20140707_OR006_05 C20140707_OR006_05 TB412419.[MT7]-GVVEYFGLDPEDVDVMMGTFTK[MT7].3b4_1.heavy 913.116 / 529.31 11004.0 52.05980110168457 45 20 10 5 10 21.45677068660482 4.660533565865467 0.043399810791015625 3 0.9994026142357423 50.49092332809161 11004.0 56.865909090909085 0.0 - - - - - - - 288.0 22 11 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 583 74 C20140707_OR006_05 C20140707_OR006_05 TB412419.[MT7]-GVVEYFGLDPEDVDVMMGTFTK[MT7].3b5_1.heavy 913.116 / 692.374 7307.0 52.05980110168457 45 20 10 5 10 21.45677068660482 4.660533565865467 0.043399810791015625 3 0.9994026142357423 50.49092332809161 7307.0 26.91688446969697 0.0 - - - - - - - 240.0 14 11 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 585 75 C20140707_OR006_05 C20140707_OR006_05 TB411748.[MT7]-EVLTEDK[MT7].2y4_1.heavy 561.318 / 636.332 12213.0 22.76289939880371 44 14 10 10 10 1.2929721597404669 44.82137579721429 0.0 3 0.9364192634924089 4.868231550860869 12213.0 23.281608140281676 0.0 - - - - - - - 648.375 24 8 UBA1 ubiquitin-like modifier activating enzyme 1 587 75 C20140707_OR006_05 C20140707_OR006_05 TB411748.[MT7]-EVLTEDK[MT7].2y5_1.heavy 561.318 / 749.416 6763.0 22.76289939880371 44 14 10 10 10 1.2929721597404669 44.82137579721429 0.0 3 0.9364192634924089 4.868231550860869 6763.0 48.40522842639594 0.0 - - - - - - - 150.8235294117647 13 17 UBA1 ubiquitin-like modifier activating enzyme 1 589 75 C20140707_OR006_05 C20140707_OR006_05 TB411748.[MT7]-EVLTEDK[MT7].2y3_1.heavy 561.318 / 535.284 3874.0 22.76289939880371 44 14 10 10 10 1.2929721597404669 44.82137579721429 0.0 3 0.9364192634924089 4.868231550860869 3874.0 15.717025342108817 0.0 - - - - - - - 214.6 7 15 UBA1 ubiquitin-like modifier activating enzyme 1 591 75 C20140707_OR006_05 C20140707_OR006_05 TB411748.[MT7]-EVLTEDK[MT7].2y6_1.heavy 561.318 / 848.485 7420.0 22.76289939880371 44 14 10 10 10 1.2929721597404669 44.82137579721429 0.0 3 0.9364192634924089 4.868231550860869 7420.0 19.070552812236542 0.0 - - - - - - - 290.36842105263156 14 19 UBA1 ubiquitin-like modifier activating enzyme 1 593 76 C20140707_OR006_05 C20140707_OR006_05 TB437033.[MT7]-AFTLVSAVER.3y6_1.heavy 412.907 / 660.367 4311.0 37.496299743652344 38 8 10 10 10 0.5681664170214037 94.09242840615782 0.0 3 0.7674270374460774 2.5077362378230195 4311.0 44.95840592334495 0.0 - - - - - - - 359.0 8 2 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 595 76 C20140707_OR006_05 C20140707_OR006_05 TB437033.[MT7]-AFTLVSAVER.3b4_1.heavy 412.907 / 577.347 3449.0 37.496299743652344 38 8 10 10 10 0.5681664170214037 94.09242840615782 0.0 3 0.7674270374460774 2.5077362378230195 3449.0 15.616378124526587 0.0 - - - - - - - 287.3333333333333 6 3 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 597 76 C20140707_OR006_05 C20140707_OR006_05 TB437033.[MT7]-AFTLVSAVER.3b3_1.heavy 412.907 / 464.263 7042.0 37.496299743652344 38 8 10 10 10 0.5681664170214037 94.09242840615782 0.0 3 0.7674270374460774 2.5077362378230195 7042.0 93.89333333333335 0.0 - - - - - - - 144.0 14 1 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 599 76 C20140707_OR006_05 C20140707_OR006_05 TB437033.[MT7]-AFTLVSAVER.3y5_1.heavy 412.907 / 561.299 3593.0 37.496299743652344 38 8 10 10 10 0.5681664170214037 94.09242840615782 0.0 3 0.7674270374460774 2.5077362378230195 3593.0 24.75138888888889 1.0 - - - - - - - 431.0 7 1 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 601 77 C20140707_OR006_05 C20140707_OR006_05 TB436905.[MT7]-NELVQK[MT7].2y4_1.heavy 509.81 / 631.426 4077.0 21.424100875854492 31 17 0 10 4 3.460193162075476 28.900120691533445 0.0 7 0.9795373495945066 8.612675120030797 4077.0 13.236414027149321 3.0 - - - - - - - 209.15384615384616 13 13 CENPI;APBB1;YWHAZ centromere protein I;amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 603 77 C20140707_OR006_05 C20140707_OR006_05 TB436905.[MT7]-NELVQK[MT7].2b3_1.heavy 509.81 / 501.279 5498.0 21.424100875854492 31 17 0 10 4 3.460193162075476 28.900120691533445 0.0 7 0.9795373495945066 8.612675120030797 5498.0 12.839874761143687 2.0 - - - - - - - 741.4285714285714 25 7 CENPI;APBB1;YWHAZ centromere protein I;amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 605 77 C20140707_OR006_05 C20140707_OR006_05 TB436905.[MT7]-NELVQK[MT7].2b4_1.heavy 509.81 / 600.347 1977.0 21.424100875854492 31 17 0 10 4 3.460193162075476 28.900120691533445 0.0 7 0.9795373495945066 8.612675120030797 1977.0 12.812261965469514 4.0 - - - - - - - 192.58823529411765 94 17 CENPI;APBB1;YWHAZ centromere protein I;amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 607 77 C20140707_OR006_05 C20140707_OR006_05 TB436905.[MT7]-NELVQK[MT7].2y3_1.heavy 509.81 / 518.342 4818.0 21.424100875854492 31 17 0 10 4 3.460193162075476 28.900120691533445 0.0 7 0.9795373495945066 8.612675120030797 4818.0 20.465603413468358 0.0 - - - - - - - 263.46666666666664 9 15 CENPI;APBB1;YWHAZ centromere protein I;amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65);tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide 609 78 C20140707_OR006_05 C20140707_OR006_05 TB412411.[MT7]-RILQQAGFIQFAQLQFLEAK[MT7].4b8_1.heavy 660.133 / 1058.62 2634.0 46.838850021362305 24 7 4 5 8 1.2851689439463192 62.32396353980928 0.041698455810546875 4 0.7152963219776937 2.255680942497875 2634.0 26.335516595744682 1.0 - - - - - - - 235.125 15 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 611 78 C20140707_OR006_05 C20140707_OR006_05 TB412411.[MT7]-RILQQAGFIQFAQLQFLEAK[MT7].4b7_1.heavy 660.133 / 911.554 502.0 46.838850021362305 24 7 4 5 8 1.2851689439463192 62.32396353980928 0.041698455810546875 4 0.7152963219776937 2.255680942497875 502.0 2.6095999999999995 7.0 - - - - - - - 0.0 1 0 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 613 78 C20140707_OR006_05 C20140707_OR006_05 TB412411.[MT7]-RILQQAGFIQFAQLQFLEAK[MT7].4b9_1.heavy 660.133 / 1171.71 1254.0 46.838850021362305 24 7 4 5 8 1.2851689439463192 62.32396353980928 0.041698455810546875 4 0.7152963219776937 2.255680942497875 1254.0 9.8656 0.0 - - - - - - - 156.5 2 4 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 615 78 C20140707_OR006_05 C20140707_OR006_05 TB412411.[MT7]-RILQQAGFIQFAQLQFLEAK[MT7].4b10_2.heavy 660.133 / 650.386 4641.0 46.838850021362305 24 7 4 5 8 1.2851689439463192 62.32396353980928 0.041698455810546875 4 0.7152963219776937 2.255680942497875 4641.0 15.100403965533216 0.0 - - - - - - - 232.71428571428572 9 7 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 617 79 C20140707_OR006_05 C20140707_OR006_05 TB436904.[MT7]-LVWIVSR.2b3_1.heavy 508.822 / 543.341 1708.0 40.10860061645508 41 11 10 10 10 1.1210364926687226 79.15932372041996 0.0 3 0.8771127450923943 3.48383659028935 1708.0 4.556318586691534 1.0 - - - - - - - 177.75 3 4 CCNG2 cyclin G2 619 79 C20140707_OR006_05 C20140707_OR006_05 TB436904.[MT7]-LVWIVSR.2y5_1.heavy 508.822 / 660.383 5125.0 40.10860061645508 41 11 10 10 10 1.1210364926687226 79.15932372041996 0.0 3 0.8771127450923943 3.48383659028935 5125.0 38.84532605468879 0.0 - - - - - - - 237.16666666666666 10 6 CCNG2 cyclin G2 621 79 C20140707_OR006_05 C20140707_OR006_05 TB436904.[MT7]-LVWIVSR.2b4_1.heavy 508.822 / 656.425 3274.0 40.10860061645508 41 11 10 10 10 1.1210364926687226 79.15932372041996 0.0 3 0.8771127450923943 3.48383659028935 3274.0 10.345004162427157 0.0 - - - - - - - 237.33333333333334 6 3 CCNG2 cyclin G2 623 79 C20140707_OR006_05 C20140707_OR006_05 TB436904.[MT7]-LVWIVSR.2y6_1.heavy 508.822 / 759.451 3417.0 40.10860061645508 41 11 10 10 10 1.1210364926687226 79.15932372041996 0.0 3 0.8771127450923943 3.48383659028935 3417.0 6.9936842105263155 1.0 - - - - - - - 284.8 6 5 CCNG2 cyclin G2 625 80 C20140707_OR006_05 C20140707_OR006_05 TB436901.[MT7]-VIVATSK[MT7].2y4_1.heavy 503.331 / 550.332 8994.0 23.347700119018555 42 20 6 10 6 30.363968944874493 3.2933771003899093 0.0 5 0.9950134157539151 17.469487073125055 8994.0 23.411713665943605 0.0 - - - - - - - 262.6666666666667 17 12 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 627 80 C20140707_OR006_05 C20140707_OR006_05 TB436901.[MT7]-VIVATSK[MT7].2y5_1.heavy 503.331 / 649.4 8148.0 23.347700119018555 42 20 6 10 6 30.363968944874493 3.2933771003899093 0.0 5 0.9950134157539151 17.469487073125055 8148.0 30.120274390243907 0.0 - - - - - - - 192.25 16 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 629 80 C20140707_OR006_05 C20140707_OR006_05 TB436901.[MT7]-VIVATSK[MT7].2b4_1.heavy 503.331 / 527.367 2614.0 23.347700119018555 42 20 6 10 6 30.363968944874493 3.2933771003899093 0.0 5 0.9950134157539151 17.469487073125055 2614.0 10.722100368104659 2.0 - - - - - - - 206.5 9 16 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 631 80 C20140707_OR006_05 C20140707_OR006_05 TB436901.[MT7]-VIVATSK[MT7].2y6_1.heavy 503.331 / 762.484 7687.0 23.347700119018555 42 20 6 10 6 30.363968944874493 3.2933771003899093 0.0 5 0.9950134157539151 17.469487073125055 7687.0 29.32764226987966 2.0 - - - - - - - 192.25 27 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 633 81 C20140707_OR006_05 C20140707_OR006_05 TB437421.[MT7]-VGSFSQNVELLNLLPK[MT7].2b8_1.heavy 1023.6 / 963.502 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 635 81 C20140707_OR006_05 C20140707_OR006_05 TB437421.[MT7]-VGSFSQNVELLNLLPK[MT7].2b4_1.heavy 1023.6 / 535.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 637 81 C20140707_OR006_05 C20140707_OR006_05 TB437421.[MT7]-VGSFSQNVELLNLLPK[MT7].2b7_1.heavy 1023.6 / 864.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 639 81 C20140707_OR006_05 C20140707_OR006_05 TB437421.[MT7]-VGSFSQNVELLNLLPK[MT7].2b9_1.heavy 1023.6 / 1092.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 641 82 C20140707_OR006_05 C20140707_OR006_05 TB411880.[MT7]-SNLSDLLEK[MT7].3b6_1.heavy 436.253 / 774.411 1103.0 30.150100708007812 45 17 10 10 8 7.955180487870019 12.570425039693191 0.0 4 0.9783522568654122 8.37277596555235 1103.0 6.577167791392393 1.0 - - - - - - - 123.0 2 2 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 643 82 C20140707_OR006_05 C20140707_OR006_05 TB411880.[MT7]-SNLSDLLEK[MT7].3y3_1.heavy 436.253 / 533.341 24143.0 30.150100708007812 45 17 10 10 8 7.955180487870019 12.570425039693191 0.0 4 0.9783522568654122 8.37277596555235 24143.0 204.4331200937576 1.0 - - - - - - - 318.8 48 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 645 82 C20140707_OR006_05 C20140707_OR006_05 TB411880.[MT7]-SNLSDLLEK[MT7].3b5_1.heavy 436.253 / 661.327 1226.0 30.150100708007812 45 17 10 10 8 7.955180487870019 12.570425039693191 0.0 4 0.9783522568654122 8.37277596555235 1226.0 4.95404081632653 1.0 - - - - - - - 245.22222222222223 3 9 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 647 82 C20140707_OR006_05 C20140707_OR006_05 TB411880.[MT7]-SNLSDLLEK[MT7].3y4_1.heavy 436.253 / 646.426 5760.0 30.150100708007812 45 17 10 10 8 7.955180487870019 12.570425039693191 0.0 4 0.9783522568654122 8.37277596555235 5760.0 58.09218516674963 0.0 - - - - - - - 297.7142857142857 11 7 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 649 83 C20140707_OR006_05 C20140707_OR006_05 TB436998.[MT7]-QIQDLLASR.2y8_1.heavy 594.347 / 915.526 31548.0 34.92940139770508 43 17 8 10 8 2.680595713508441 29.704695451810455 0.0 4 0.9720317259957909 7.362276108424509 31548.0 68.35698080973135 0.0 - - - - - - - 293.4 63 10 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 651 83 C20140707_OR006_05 C20140707_OR006_05 TB436998.[MT7]-QIQDLLASR.2y5_1.heavy 594.347 / 559.356 23173.0 34.92940139770508 43 17 8 10 8 2.680595713508441 29.704695451810455 0.0 4 0.9720317259957909 7.362276108424509 23173.0 28.664518229166664 1.0 - - - - - - - 331.75 87 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 653 83 C20140707_OR006_05 C20140707_OR006_05 TB436998.[MT7]-QIQDLLASR.2b4_1.heavy 594.347 / 629.338 20241.0 34.92940139770508 43 17 8 10 8 2.680595713508441 29.704695451810455 0.0 4 0.9720317259957909 7.362276108424509 20241.0 84.55295022601192 0.0 - - - - - - - 314.0 40 4 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 655 83 C20140707_OR006_05 C20140707_OR006_05 TB436998.[MT7]-QIQDLLASR.2y7_1.heavy 594.347 / 802.442 12005.0 34.92940139770508 43 17 8 10 8 2.680595713508441 29.704695451810455 0.0 4 0.9720317259957909 7.362276108424509 12005.0 54.20503281264442 0.0 - - - - - - - 244.375 24 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 657 84 C20140707_OR006_05 C20140707_OR006_05 TB436997.[MT7]-MLLQREPR.2b3_1.heavy 593.846 / 502.318 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 659 84 C20140707_OR006_05 C20140707_OR006_05 TB436997.[MT7]-MLLQREPR.2b4_1.heavy 593.846 / 630.377 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 661 84 C20140707_OR006_05 C20140707_OR006_05 TB436997.[MT7]-MLLQREPR.2b5_1.heavy 593.846 / 786.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 663 85 C20140707_OR006_05 C20140707_OR006_05 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1257360.0 35.065399169921875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1257360.0 986.3599003658117 0.0 - - - - - - - 232.83333333333334 2514 12 665 85 C20140707_OR006_05 C20140707_OR006_05 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 247992.0 35.065399169921875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 247992.0 294.2191749691468 0.0 - - - - - - - 681.25 495 8 667 85 C20140707_OR006_05 C20140707_OR006_05 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 419981.0 35.065399169921875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 419981.0 414.3232040400385 0.0 - - - - - - - 314.125 839 8 669 86 C20140707_OR006_05 C20140707_OR006_05 TB450436.[MT7]-GRILGIIDAIQDAVGPPK[MT7].3b9_1.heavy 707.759 / 1053.65 1349.0 44.842498779296875 21 7 0 10 4 1.0015671580343826 65.26988905294604 0.0 10 0.7236046172108821 2.291102533698239 1349.0 7.827530864197531 1.0 - - - - - - - 247.5 5 6 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 671 86 C20140707_OR006_05 C20140707_OR006_05 TB450436.[MT7]-GRILGIIDAIQDAVGPPK[MT7].3b6_1.heavy 707.759 / 754.506 674.0 44.842498779296875 21 7 0 10 4 1.0015671580343826 65.26988905294604 0.0 10 0.7236046172108821 2.291102533698239 674.0 2.130172839506173 5.0 - - - - - - - 216.0 4 5 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 673 86 C20140707_OR006_05 C20140707_OR006_05 TB450436.[MT7]-GRILGIIDAIQDAVGPPK[MT7].3y4_1.heavy 707.759 / 542.342 135.0 44.842498779296875 21 7 0 10 4 1.0015671580343826 65.26988905294604 0.0 10 0.7236046172108821 2.291102533698239 135.0 0.2754953397598586 39.0 - - - - - - - 289.2857142857143 13 7 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 675 86 C20140707_OR006_05 C20140707_OR006_05 TB450436.[MT7]-GRILGIIDAIQDAVGPPK[MT7].3b8_1.heavy 707.759 / 982.617 809.0 44.842498779296875 21 7 0 10 4 1.0015671580343826 65.26988905294604 0.0 10 0.7236046172108821 2.291102533698239 809.0 5.213555555555556 3.0 - - - - - - - 243.0 3 10 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 677 87 C20140707_OR006_05 C20140707_OR006_05 TB411689.[MT7]-SPYILK[MT7].2y4_1.heavy 504.82 / 680.446 4289.0 29.267499923706055 40 20 2 10 8 8.765925455870965 11.407808622536843 0.0 4 0.9926684526317304 14.404522039997975 4289.0 47.575462184873956 0.0 - - - - - - - 198.33333333333334 8 9 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 679 87 C20140707_OR006_05 C20140707_OR006_05 TB411689.[MT7]-SPYILK[MT7].2y5_1.heavy 504.82 / 777.499 14416.0 29.267499923706055 40 20 2 10 8 8.765925455870965 11.407808622536843 0.0 4 0.9926684526317304 14.404522039997975 14416.0 130.12253511476533 0.0 - - - - - - - 268.0 28 4 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 681 87 C20140707_OR006_05 C20140707_OR006_05 TB411689.[MT7]-SPYILK[MT7].2b4_1.heavy 504.82 / 605.341 2025.0 29.267499923706055 40 20 2 10 8 8.765925455870965 11.407808622536843 0.0 4 0.9926684526317304 14.404522039997975 2025.0 7.604712232493352 4.0 - - - - - - - 253.125 4 8 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 683 87 C20140707_OR006_05 C20140707_OR006_05 TB411689.[MT7]-SPYILK[MT7].2y3_1.heavy 504.82 / 517.383 9531.0 29.267499923706055 40 20 2 10 8 8.765925455870965 11.407808622536843 0.0 4 0.9926684526317304 14.404522039997975 9531.0 17.13074842051967 1.0 - - - - - - - 333.6 84 10 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 685 88 C20140707_OR006_05 C20140707_OR006_05 TB450433.[MT7]-ETLVYLTHLDYVDTER.3y7_1.heavy 704.364 / 897.395 8778.0 40.19409942626953 43 13 10 10 10 2.840408238368318 24.644654138845027 0.0 3 0.9238617042747639 4.443917274810721 8778.0 34.14373020471225 0.0 - - - - - - - 192.0 17 3 XPO1 exportin 1 (CRM1 homolog, yeast) 687 88 C20140707_OR006_05 C20140707_OR006_05 TB450433.[MT7]-ETLVYLTHLDYVDTER.3b4_1.heavy 704.364 / 587.352 8778.0 40.19409942626953 43 13 10 10 10 2.840408238368318 24.644654138845027 0.0 3 0.9238617042747639 4.443917274810721 8778.0 -0.7787092481703259 1.0 - - - - - - - 432.0 27 4 XPO1 exportin 1 (CRM1 homolog, yeast) 689 88 C20140707_OR006_05 C20140707_OR006_05 TB450433.[MT7]-ETLVYLTHLDYVDTER.3b5_1.heavy 704.364 / 750.415 9354.0 40.19409942626953 43 13 10 10 10 2.840408238368318 24.644654138845027 0.0 3 0.9238617042747639 4.443917274810721 9354.0 -3.247916666666665 0.0 - - - - - - - 201.6 18 5 XPO1 exportin 1 (CRM1 homolog, yeast) 691 88 C20140707_OR006_05 C20140707_OR006_05 TB450433.[MT7]-ETLVYLTHLDYVDTER.3y8_1.heavy 704.364 / 1010.48 12664.0 40.19409942626953 43 13 10 10 10 2.840408238368318 24.644654138845027 0.0 3 0.9238617042747639 4.443917274810721 12664.0 -3.5177777777777735 0.0 - - - - - - - 288.0 25 5 XPO1 exportin 1 (CRM1 homolog, yeast) 693 89 C20140707_OR006_05 C20140707_OR006_05 TB436991.[MT7]-LYPIAQGDR.2y8_1.heavy 588.828 / 919.463 31766.0 29.3966007232666 50 20 10 10 10 23.161079066550755 4.317588127593764 0.0 3 0.997182023290028 23.242970517801133 31766.0 54.56287464289942 0.0 - - - - - - - 305.5 63 8 CA7 carbonic anhydrase VII 695 89 C20140707_OR006_05 C20140707_OR006_05 TB436991.[MT7]-LYPIAQGDR.2y5_1.heavy 588.828 / 546.263 7941.0 29.3966007232666 50 20 10 10 10 23.161079066550755 4.317588127593764 0.0 3 0.997182023290028 23.242970517801133 7941.0 11.640769899115423 0.0 - - - - - - - 244.28571428571428 15 7 CA7 carbonic anhydrase VII 697 89 C20140707_OR006_05 C20140707_OR006_05 TB436991.[MT7]-LYPIAQGDR.2y6_1.heavy 588.828 / 659.347 2810.0 29.3966007232666 50 20 10 10 10 23.161079066550755 4.317588127593764 0.0 3 0.997182023290028 23.242970517801133 2810.0 5.57199064474517 2.0 - - - - - - - 244.3 8 10 CA7 carbonic anhydrase VII 699 89 C20140707_OR006_05 C20140707_OR006_05 TB436991.[MT7]-LYPIAQGDR.2y7_1.heavy 588.828 / 756.4 45938.0 29.3966007232666 50 20 10 10 10 23.161079066550755 4.317588127593764 0.0 3 0.997182023290028 23.242970517801133 45938.0 751.199262295082 0.0 - - - - - - - 244.1 91 10 CA7 carbonic anhydrase VII 701 90 C20140707_OR006_05 C20140707_OR006_05 TB437285.[MT7]-SFTGGLGQLVVPSK[MT7].3b6_1.heavy 559.997 / 707.385 21293.0 38.5260009765625 40 10 10 10 10 1.5319954365132176 44.7203751033785 0.0 3 0.8225779642287975 2.8854779836465547 21293.0 70.72979130434783 0.0 - - - - - - - 259.2 42 5 TSC22D4 TSC22 domain family, member 4 703 90 C20140707_OR006_05 C20140707_OR006_05 TB437285.[MT7]-SFTGGLGQLVVPSK[MT7].3b5_1.heavy 559.997 / 594.3 15107.0 38.5260009765625 40 10 10 10 10 1.5319954365132176 44.7203751033785 0.0 3 0.8225779642287975 2.8854779836465547 15107.0 9.145008101063706 1.0 - - - - - - - 360.0 32 6 TSC22D4 TSC22 domain family, member 4 705 90 C20140707_OR006_05 C20140707_OR006_05 TB437285.[MT7]-SFTGGLGQLVVPSK[MT7].3y4_1.heavy 559.997 / 574.368 30501.0 38.5260009765625 40 10 10 10 10 1.5319954365132176 44.7203751033785 0.0 3 0.8225779642287975 2.8854779836465547 30501.0 54.14996318400837 0.0 - - - - - - - 683.0 61 8 TSC22D4 TSC22 domain family, member 4 707 90 C20140707_OR006_05 C20140707_OR006_05 TB437285.[MT7]-SFTGGLGQLVVPSK[MT7].3b8_1.heavy 559.997 / 892.464 25466.0 38.5260009765625 40 10 10 10 10 1.5319954365132176 44.7203751033785 0.0 3 0.8225779642287975 2.8854779836465547 25466.0 258.19694444444445 0.0 - - - - - - - 324.0 50 4 TSC22D4 TSC22 domain family, member 4 709 91 C20140707_OR006_05 C20140707_OR006_05 TB411673.[MT7]-ADVVLPAR.2y5_1.heavy 492.802 / 555.361 15688.0 26.896799087524414 48 18 10 10 10 3.5531892850809035 22.700596967854135 0.0 3 0.984644539657549 9.946576922438513 15688.0 51.07548305866314 1.0 - - - - - - - 306.0 32 3 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 711 91 C20140707_OR006_05 C20140707_OR006_05 TB411673.[MT7]-ADVVLPAR.2b4_1.heavy 492.802 / 529.31 18439.0 26.896799087524414 48 18 10 10 10 3.5531892850809035 22.700596967854135 0.0 3 0.984644539657549 9.946576922438513 18439.0 101.79337139278314 0.0 - - - - - - - 254.75 36 8 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 713 91 C20140707_OR006_05 C20140707_OR006_05 TB411673.[MT7]-ADVVLPAR.2y6_1.heavy 492.802 / 654.43 17318.0 26.896799087524414 48 18 10 10 10 3.5531892850809035 22.700596967854135 0.0 3 0.984644539657549 9.946576922438513 17318.0 165.53970588235293 0.0 - - - - - - - 183.6 34 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 715 91 C20140707_OR006_05 C20140707_OR006_05 TB411673.[MT7]-ADVVLPAR.2y7_1.heavy 492.802 / 769.457 14975.0 26.896799087524414 48 18 10 10 10 3.5531892850809035 22.700596967854135 0.0 3 0.984644539657549 9.946576922438513 14975.0 102.85257383051501 0.0 - - - - - - - 186.83333333333334 29 6 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 717 92 C20140707_OR006_05 C20140707_OR006_05 TB450221.[MT7]-DILLLPLQLPR.3y6_1.heavy 478.977 / 723.451 1488.0 49.28990173339844 37 7 10 10 10 0.5932396460429288 89.6123088377498 0.0 3 0.730369962975213 2.321123667923026 1488.0 0.0 0.0 - - - - - - - 248.0 2 1 RIN1 Ras and Rab interactor 1 719 92 C20140707_OR006_05 C20140707_OR006_05 TB450221.[MT7]-DILLLPLQLPR.3b4_1.heavy 478.977 / 599.388 2852.0 49.28990173339844 37 7 10 10 10 0.5932396460429288 89.6123088377498 0.0 3 0.730369962975213 2.321123667923026 2852.0 0.0 0.0 - - - - - - - 248.0 5 2 RIN1 Ras and Rab interactor 1 721 92 C20140707_OR006_05 C20140707_OR006_05 TB450221.[MT7]-DILLLPLQLPR.3y4_1.heavy 478.977 / 513.314 6075.0 49.28990173339844 37 7 10 10 10 0.5932396460429288 89.6123088377498 0.0 3 0.730369962975213 2.321123667923026 6075.0 63.689516129032256 0.0 - - - - - - - 248.0 12 3 RIN1 Ras and Rab interactor 1 723 92 C20140707_OR006_05 C20140707_OR006_05 TB450221.[MT7]-DILLLPLQLPR.3b3_1.heavy 478.977 / 486.304 2356.0 49.28990173339844 37 7 10 10 10 0.5932396460429288 89.6123088377498 0.0 3 0.730369962975213 2.321123667923026 2356.0 -3.799999999999999 1.0 - - - - - - - 310.0 4 2 RIN1 Ras and Rab interactor 1 725 93 C20140707_OR006_05 C20140707_OR006_05 TB437002.[MT7]-YVVGLIIK[MT7].2y5_1.heavy 596.899 / 687.489 4555.0 40.033875465393066 43 18 10 5 10 3.734095707450843 26.780245562657807 0.042697906494140625 3 0.982934265576035 9.433661901698372 4555.0 25.650696799425727 0.0 - - - - - - - 268.77777777777777 9 9 XPO1 exportin 1 (CRM1 homolog, yeast) 727 93 C20140707_OR006_05 C20140707_OR006_05 TB437002.[MT7]-YVVGLIIK[MT7].2b4_1.heavy 596.899 / 563.331 4128.0 40.033875465393066 43 18 10 5 10 3.734095707450843 26.780245562657807 0.042697906494140625 3 0.982934265576035 9.433661901698372 4128.0 11.266568819120607 0.0 - - - - - - - 302.375 8 8 XPO1 exportin 1 (CRM1 homolog, yeast) 729 93 C20140707_OR006_05 C20140707_OR006_05 TB437002.[MT7]-YVVGLIIK[MT7].2y3_1.heavy 596.899 / 517.383 3132.0 40.033875465393066 43 18 10 5 10 3.734095707450843 26.780245562657807 0.042697906494140625 3 0.982934265576035 9.433661901698372 3132.0 5.449620496035665 2.0 - - - - - - - 806.5555555555555 6 9 XPO1 exportin 1 (CRM1 homolog, yeast) 731 93 C20140707_OR006_05 C20140707_OR006_05 TB437002.[MT7]-YVVGLIIK[MT7].2y6_1.heavy 596.899 / 786.557 4413.0 40.033875465393066 43 18 10 5 10 3.734095707450843 26.780245562657807 0.042697906494140625 3 0.982934265576035 9.433661901698372 4413.0 24.66197183098592 1.0 - - - - - - - 325.2857142857143 8 7 XPO1 exportin 1 (CRM1 homolog, yeast) 733 94 C20140707_OR006_05 C20140707_OR006_05 TB437141.[MT7]-RVEEALVLAK[MT7].2b4_1.heavy 708.445 / 658.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 735 94 C20140707_OR006_05 C20140707_OR006_05 TB437141.[MT7]-RVEEALVLAK[MT7].2b6_1.heavy 708.445 / 842.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 737 94 C20140707_OR006_05 C20140707_OR006_05 TB437141.[MT7]-RVEEALVLAK[MT7].2b7_1.heavy 708.445 / 941.554 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 739 94 C20140707_OR006_05 C20140707_OR006_05 TB437141.[MT7]-RVEEALVLAK[MT7].2b5_1.heavy 708.445 / 729.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 741 95 C20140707_OR006_05 C20140707_OR006_05 TB411876.[MT7]-RPLDEQQK[MT7].2y4_1.heavy 651.374 / 676.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 743 95 C20140707_OR006_05 C20140707_OR006_05 TB411876.[MT7]-RPLDEQQK[MT7].2b4_1.heavy 651.374 / 626.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 745 95 C20140707_OR006_05 C20140707_OR006_05 TB411876.[MT7]-RPLDEQQK[MT7].2y3_1.heavy 651.374 / 547.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 747 95 C20140707_OR006_05 C20140707_OR006_05 TB411876.[MT7]-RPLDEQQK[MT7].2y7_1.heavy 651.374 / 1001.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 749 96 C20140707_OR006_05 C20140707_OR006_05 TB450228.[MT7]-SAWMFEVFHR.3b4_1.heavy 485.244 / 620.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 751 96 C20140707_OR006_05 C20140707_OR006_05 TB450228.[MT7]-SAWMFEVFHR.3y4_1.heavy 485.244 / 558.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 753 96 C20140707_OR006_05 C20140707_OR006_05 TB450228.[MT7]-SAWMFEVFHR.3b3_1.heavy 485.244 / 489.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 755 96 C20140707_OR006_05 C20140707_OR006_05 TB450228.[MT7]-SAWMFEVFHR.3y5_1.heavy 485.244 / 687.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 757 97 C20140707_OR006_05 C20140707_OR006_05 TB411878.[MT7]-NVEVIELAK[MT7].3b4_1.heavy 434.934 / 586.332 24790.0 33.55987548828125 46 20 10 6 10 5.984746392690667 16.709145791396057 0.0399017333984375 3 0.9903435022342878 12.548807202172275 24790.0 260.76859025032934 0.0 - - - - - - - 236.0 49 7 AP3B1 adaptor-related protein complex 3, beta 1 subunit 759 97 C20140707_OR006_05 C20140707_OR006_05 TB411878.[MT7]-NVEVIELAK[MT7].3b5_1.heavy 434.934 / 699.416 3305.0 33.55987548828125 46 20 10 6 10 5.984746392690667 16.709145791396057 0.0399017333984375 3 0.9903435022342878 12.548807202172275 3305.0 35.00861528326745 0.0 - - - - - - - 275.3333333333333 6 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 761 97 C20140707_OR006_05 C20140707_OR006_05 TB411878.[MT7]-NVEVIELAK[MT7].3y4_1.heavy 434.934 / 604.379 8539.0 33.55987548828125 46 20 10 6 10 5.984746392690667 16.709145791396057 0.0399017333984375 3 0.9903435022342878 12.548807202172275 8539.0 113.2345652173913 0.0 - - - - - - - 172.25 17 8 AP3B1 adaptor-related protein complex 3, beta 1 subunit 763 97 C20140707_OR006_05 C20140707_OR006_05 TB411878.[MT7]-NVEVIELAK[MT7].3b3_1.heavy 434.934 / 487.263 24102.0 33.55987548828125 46 20 10 6 10 5.984746392690667 16.709145791396057 0.0399017333984375 3 0.9903435022342878 12.548807202172275 24102.0 93.20284483857218 0.0 - - - - - - - 275.1666666666667 48 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 765 98 C20140707_OR006_05 C20140707_OR006_05 TB437282.[MT7]-ETPLYILC[CAM]TAGMR.3y7_1.heavy 556.957 / 808.38 4040.0 43.4189510345459 38 16 9 5 8 2.204998082045483 38.18192530837271 0.043498992919921875 4 0.9657791151886155 6.6522783527433305 4040.0 24.518587360594793 0.0 - - - - - - - 314.3333333333333 8 6 ENTPD7;ENTPD4 ectonucleoside triphosphate diphosphohydrolase 7;ectonucleoside triphosphate diphosphohydrolase 4 767 98 C20140707_OR006_05 C20140707_OR006_05 TB437282.[MT7]-ETPLYILC[CAM]TAGMR.3y6_1.heavy 556.957 / 695.296 5117.0 43.4189510345459 38 16 9 5 8 2.204998082045483 38.18192530837271 0.043498992919921875 4 0.9657791151886155 6.6522783527433305 5117.0 71.638 0.0 - - - - - - - 215.6 10 5 ENTPD7;ENTPD4 ectonucleoside triphosphate diphosphohydrolase 7;ectonucleoside triphosphate diphosphohydrolase 4 769 98 C20140707_OR006_05 C20140707_OR006_05 TB437282.[MT7]-ETPLYILC[CAM]TAGMR.3b4_1.heavy 556.957 / 585.336 4578.0 43.4189510345459 38 16 9 5 8 2.204998082045483 38.18192530837271 0.043498992919921875 4 0.9657791151886155 6.6522783527433305 4578.0 8.352303174626991 2.0 - - - - - - - 202.0 12 6 ENTPD7;ENTPD4 ectonucleoside triphosphate diphosphohydrolase 7;ectonucleoside triphosphate diphosphohydrolase 4 771 98 C20140707_OR006_05 C20140707_OR006_05 TB437282.[MT7]-ETPLYILC[CAM]TAGMR.3b5_1.heavy 556.957 / 748.4 4040.0 43.4189510345459 38 16 9 5 8 2.204998082045483 38.18192530837271 0.043498992919921875 4 0.9657791151886155 6.6522783527433305 4040.0 4.663918120842876 1.0 - - - - - - - 242.6 9 5 ENTPD7;ENTPD4 ectonucleoside triphosphate diphosphohydrolase 7;ectonucleoside triphosphate diphosphohydrolase 4 773 99 C20140707_OR006_05 C20140707_OR006_05 TB411877.[MT7]-VGVQVLDRK[MT7].2y6_1.heavy 651.411 / 902.554 995.0 26.694000720977783 34 14 10 2 8 4.152555439398843 24.08155687729404 0.08160018920898438 4 0.9345410963339009 4.797113730659412 995.0 2.925 0.0 - - - - - - - 0.0 1 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 775 99 C20140707_OR006_05 C20140707_OR006_05 TB411877.[MT7]-VGVQVLDRK[MT7].2y4_1.heavy 651.411 / 675.427 199.0 26.694000720977783 34 14 10 2 8 4.152555439398843 24.08155687729404 0.08160018920898438 4 0.9345410963339009 4.797113730659412 199.0 0.10000000000000003 32.0 - - - - - - - 0.0 1 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 777 99 C20140707_OR006_05 C20140707_OR006_05 TB411877.[MT7]-VGVQVLDRK[MT7].2y8_1.heavy 651.411 / 1058.64 3882.0 26.694000720977783 34 14 10 2 8 4.152555439398843 24.08155687729404 0.08160018920898438 4 0.9345410963339009 4.797113730659412 3882.0 14.675018234987649 0.0 - - - - - - - 276.6666666666667 7 9 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 779 99 C20140707_OR006_05 C20140707_OR006_05 TB411877.[MT7]-VGVQVLDRK[MT7].2b4_1.heavy 651.411 / 528.326 1095.0 26.694000720977783 34 14 10 2 8 4.152555439398843 24.08155687729404 0.08160018920898438 4 0.9345410963339009 4.797113730659412 1095.0 3.308296864523478 3.0 - - - - - - - 217.45454545454547 4 11 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 781 100 C20140707_OR006_05 C20140707_OR006_05 TB412055.[MT7]-TIQMFLVYEDR.2y8_1.heavy 779.906 / 1072.51 1097.0 43.287649154663086 32 17 2 5 8 2.5102989868067898 27.338824590847544 0.043498992919921875 4 0.9797593253245153 8.659934544966433 1097.0 5.204744525547445 5.0 - - - - - - - 215.28571428571428 3 7 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 783 100 C20140707_OR006_05 C20140707_OR006_05 TB412055.[MT7]-TIQMFLVYEDR.2b4_1.heavy 779.906 / 618.34 1508.0 43.287649154663086 32 17 2 5 8 2.5102989868067898 27.338824590847544 0.043498992919921875 4 0.9797593253245153 8.659934544966433 1508.0 4.437559932949597 1.0 - - - - - - - 301.4 3 5 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 785 100 C20140707_OR006_05 C20140707_OR006_05 TB412055.[MT7]-TIQMFLVYEDR.2y9_1.heavy 779.906 / 1200.57 1508.0 43.287649154663086 32 17 2 5 8 2.5102989868067898 27.338824590847544 0.043498992919921875 4 0.9797593253245153 8.659934544966433 1508.0 9.872768664781955 2.0 - - - - - - - 258.77777777777777 9 9 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 787 100 C20140707_OR006_05 C20140707_OR006_05 TB412055.[MT7]-TIQMFLVYEDR.2y7_1.heavy 779.906 / 941.473 1782.0 43.287649154663086 32 17 2 5 8 2.5102989868067898 27.338824590847544 0.043498992919921875 4 0.9797593253245153 8.659934544966433 1782.0 4.005693430656934 1.0 - - - - - - - 239.75 3 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 789 101 C20140707_OR006_05 C20140707_OR006_05 TB450029.[MT7]-SVELLEILLLVK[MT7].3y3_1.heavy 553.03 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNG2 cyclin G2 791 101 C20140707_OR006_05 C20140707_OR006_05 TB450029.[MT7]-SVELLEILLLVK[MT7].3b6_1.heavy 553.03 / 815.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNG2 cyclin G2 793 101 C20140707_OR006_05 C20140707_OR006_05 TB450029.[MT7]-SVELLEILLLVK[MT7].3b4_1.heavy 553.03 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNG2 cyclin G2 795 101 C20140707_OR006_05 C20140707_OR006_05 TB450029.[MT7]-SVELLEILLLVK[MT7].3b5_1.heavy 553.03 / 686.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - CCNG2 cyclin G2 797 102 C20140707_OR006_05 C20140707_OR006_05 TB412309.[MT7]-LEILTNLANEANISTLLR.3b6_1.heavy 714.747 / 828.495 7570.0 52.31435012817383 43 18 10 5 10 7.193142383168245 13.902129927804188 0.04070281982421875 3 0.9829045041521643 9.425423304554382 7570.0 44.89637794655083 0.0 - - - - - - - 205.75 15 12 AP3B1 adaptor-related protein complex 3, beta 1 subunit 799 102 C20140707_OR006_05 C20140707_OR006_05 TB412309.[MT7]-LEILTNLANEANISTLLR.3b4_1.heavy 714.747 / 613.404 8804.0 52.31435012817383 43 18 10 5 10 7.193142383168245 13.902129927804188 0.04070281982421875 3 0.9829045041521643 9.425423304554382 8804.0 30.91289598792399 0.0 - - - - - - - 201.9090909090909 17 11 AP3B1 adaptor-related protein complex 3, beta 1 subunit 801 102 C20140707_OR006_05 C20140707_OR006_05 TB412309.[MT7]-LEILTNLANEANISTLLR.3b3_1.heavy 714.747 / 500.32 20488.0 52.31435012817383 43 18 10 5 10 7.193142383168245 13.902129927804188 0.04070281982421875 3 0.9829045041521643 9.425423304554382 20488.0 277.22205685122543 0.0 - - - - - - - 192.0 40 15 AP3B1 adaptor-related protein complex 3, beta 1 subunit 803 102 C20140707_OR006_05 C20140707_OR006_05 TB412309.[MT7]-LEILTNLANEANISTLLR.3y10_1.heavy 714.747 / 1130.62 8639.0 52.31435012817383 43 18 10 5 10 7.193142383168245 13.902129927804188 0.04070281982421875 3 0.9829045041521643 9.425423304554382 8639.0 34.650402520212154 0.0 - - - - - - - 164.54545454545453 17 11 AP3B1 adaptor-related protein complex 3, beta 1 subunit 805 103 C20140707_OR006_05 C20140707_OR006_05 TB412407.[MT7]-AAPSTAPAEATPPK[MT7]PGEAEAPPK[MT7].4y9_1.heavy 655.11 / 1039.55 2752.0 23.41562509536743 37 14 10 3 10 1.5484099356588439 44.7118220622407 0.06789970397949219 3 0.935310979310044 4.825892422566343 2752.0 18.941957446808512 0.0 - - - - - - - 746.1428571428571 5 7 BAG3 BCL2-associated athanogene 3 807 103 C20140707_OR006_05 C20140707_OR006_05 TB412407.[MT7]-AAPSTAPAEATPPK[MT7]PGEAEAPPK[MT7].4y12_2.heavy 655.11 / 753.432 8256.0 23.41562509536743 37 14 10 3 10 1.5484099356588439 44.7118220622407 0.06789970397949219 3 0.935310979310044 4.825892422566343 8256.0 24.132213771150944 0.0 - - - - - - - 395.0 16 5 BAG3 BCL2-associated athanogene 3 809 103 C20140707_OR006_05 C20140707_OR006_05 TB412407.[MT7]-AAPSTAPAEATPPK[MT7]PGEAEAPPK[MT7].4b5_1.heavy 655.11 / 572.316 2188.0 23.41562509536743 37 14 10 3 10 1.5484099356588439 44.7118220622407 0.06789970397949219 3 0.935310979310044 4.825892422566343 2188.0 4.133762457359817 0.0 - - - - - - - 272.73333333333335 4 15 BAG3 BCL2-associated athanogene 3 811 103 C20140707_OR006_05 C20140707_OR006_05 TB412407.[MT7]-AAPSTAPAEATPPK[MT7]PGEAEAPPK[MT7].4b6_1.heavy 655.11 / 643.353 7903.0 23.41562509536743 37 14 10 3 10 1.5484099356588439 44.7118220622407 0.06789970397949219 3 0.935310979310044 4.825892422566343 7903.0 19.273178982300884 0.0 - - - - - - - 670.5 15 8 BAG3 BCL2-associated athanogene 3 813 104 C20140707_OR006_05 C20140707_OR006_05 TB437551.[MT7]-EMGFIIYGNEDSPVVPLMLYMPAK[MT7].4y4_1.heavy 751.388 / 590.345 2021.0 52.40524959564209 42 16 10 6 10 2.4478023001603355 33.92862220527264 0.039798736572265625 3 0.9641713556053465 6.500427173581974 2021.0 28.368594628993254 0.0 - - - - - - - 251.55555555555554 4 9 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 815 104 C20140707_OR006_05 C20140707_OR006_05 TB437551.[MT7]-EMGFIIYGNEDSPVVPLMLYMPAK[MT7].4b4_1.heavy 751.388 / 609.282 3072.0 52.40524959564209 42 16 10 6 10 2.4478023001603355 33.92862220527264 0.039798736572265625 3 0.9641713556053465 6.500427173581974 3072.0 37.933745704467356 0.0 - - - - - - - 183.8181818181818 6 11 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 817 104 C20140707_OR006_05 C20140707_OR006_05 TB437551.[MT7]-EMGFIIYGNEDSPVVPLMLYMPAK[MT7].4b5_1.heavy 751.388 / 722.366 4446.0 52.40524959564209 42 16 10 6 10 2.4478023001603355 33.92862220527264 0.039798736572265625 3 0.9641713556053465 6.500427173581974 4446.0 39.154074074074074 0.0 - - - - - - - 202.375 8 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 819 104 C20140707_OR006_05 C20140707_OR006_05 TB437551.[MT7]-EMGFIIYGNEDSPVVPLMLYMPAK[MT7].4b6_1.heavy 751.388 / 835.45 2425.0 52.40524959564209 42 16 10 6 10 2.4478023001603355 33.92862220527264 0.039798736572265625 3 0.9641713556053465 6.500427173581974 2425.0 7.983539094650206 0.0 - - - - - - - 145.8 4 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 821 105 C20140707_OR006_05 C20140707_OR006_05 TB437415.[MT7]-NEEDAAELVALAQAVNAR.3b6_1.heavy 676.687 / 774.339 7786.0 43.157400131225586 42 17 10 5 10 6.046808993898212 16.5376482208896 0.043399810791015625 3 0.9767884651302028 8.084753607854783 7786.0 26.666336996336998 0.0 - - - - - - - 250.66666666666666 15 6 UBA1 ubiquitin-like modifier activating enzyme 1 823 105 C20140707_OR006_05 C20140707_OR006_05 TB437415.[MT7]-NEEDAAELVALAQAVNAR.3b4_1.heavy 676.687 / 632.264 6420.0 43.157400131225586 42 17 10 5 10 6.046808993898212 16.5376482208896 0.043399810791015625 3 0.9767884651302028 8.084753607854783 6420.0 15.869323265938089 0.0 - - - - - - - 258.22222222222223 12 9 UBA1 ubiquitin-like modifier activating enzyme 1 825 105 C20140707_OR006_05 C20140707_OR006_05 TB437415.[MT7]-NEEDAAELVALAQAVNAR.3b5_1.heavy 676.687 / 703.302 7103.0 43.157400131225586 42 17 10 5 10 6.046808993898212 16.5376482208896 0.043399810791015625 3 0.9767884651302028 8.084753607854783 7103.0 55.66819761438491 0.0 - - - - - - - 227.83333333333334 14 6 UBA1 ubiquitin-like modifier activating enzyme 1 827 105 C20140707_OR006_05 C20140707_OR006_05 TB437415.[MT7]-NEEDAAELVALAQAVNAR.3b7_1.heavy 676.687 / 903.381 20488.0 43.157400131225586 42 17 10 5 10 6.046808993898212 16.5376482208896 0.043399810791015625 3 0.9767884651302028 8.084753607854783 20488.0 132.83428571428573 0.0 - - - - - - - 195.28571428571428 40 7 UBA1 ubiquitin-like modifier activating enzyme 1 829 106 C20140707_OR006_05 C20140707_OR006_05 TB412402.[MT7]-AK[MT7]PSVLALC[CAM]LLNLEVETLK[MT7].4y5_1.heavy 636.636 / 733.458 3448.0 50.74275016784668 33 10 10 3 10 2.1461165908847977 32.62044073046894 0.050296783447265625 3 0.824214468282223 2.899301273141622 3448.0 20.12748768472906 0.0 - - - - - - - 253.625 6 8 CCNG2 cyclin G2 831 106 C20140707_OR006_05 C20140707_OR006_05 TB412402.[MT7]-AK[MT7]PSVLALC[CAM]LLNLEVETLK[MT7].4y4_1.heavy 636.636 / 634.389 710.0 50.74275016784668 33 10 10 3 10 2.1461165908847977 32.62044073046894 0.050296783447265625 3 0.824214468282223 2.899301273141622 710.0 9.477978832365995 0.0 - - - - - - - 0.0 1 0 CCNG2 cyclin G2 833 106 C20140707_OR006_05 C20140707_OR006_05 TB412402.[MT7]-AK[MT7]PSVLALC[CAM]LLNLEVETLK[MT7].4y3_1.heavy 636.636 / 505.347 2738.0 50.74275016784668 33 10 10 3 10 2.1461165908847977 32.62044073046894 0.050296783447265625 3 0.824214468282223 2.899301273141622 2738.0 21.549238397718433 0.0 - - - - - - - 231.71428571428572 5 7 CCNG2 cyclin G2 835 106 C20140707_OR006_05 C20140707_OR006_05 TB412402.[MT7]-AK[MT7]PSVLALC[CAM]LLNLEVETLK[MT7].4b9_2.heavy 636.636 / 614.87 4260.0 50.74275016784668 33 10 10 3 10 2.1461165908847977 32.62044073046894 0.050296783447265625 3 0.824214468282223 2.899301273141622 4260.0 46.1487879822465 0.0 - - - - - - - 219.66666666666666 8 6 CCNG2 cyclin G2 837 107 C20140707_OR006_05 C20140707_OR006_05 TB450422.[MT7]-VGSFSQNVELLNLLPK[MT7].3b9_1.heavy 682.733 / 1092.54 6218.0 46.69129943847656 38 13 9 10 6 1.6412933557004907 48.45486765644364 0.0 5 0.9142189072201331 4.183232955353386 6218.0 7.695363292012875 1.0 - - - - - - - 220.66666666666666 14 6 CASP2 caspase 2, apoptosis-related cysteine peptidase 839 107 C20140707_OR006_05 C20140707_OR006_05 TB450422.[MT7]-VGSFSQNVELLNLLPK[MT7].3b6_1.heavy 682.733 / 750.39 3836.0 46.69129943847656 38 13 9 10 6 1.6412933557004907 48.45486765644364 0.0 5 0.9142189072201331 4.183232955353386 3836.0 12.949168656935656 0.0 - - - - - - - 248.125 7 8 CASP2 caspase 2, apoptosis-related cysteine peptidase 841 107 C20140707_OR006_05 C20140707_OR006_05 TB450422.[MT7]-VGSFSQNVELLNLLPK[MT7].3b7_1.heavy 682.733 / 864.433 3969.0 46.69129943847656 38 13 9 10 6 1.6412933557004907 48.45486765644364 0.0 5 0.9142189072201331 4.183232955353386 3969.0 -0.30302798987052415 3.0 - - - - - - - 154.16666666666666 11 6 CASP2 caspase 2, apoptosis-related cysteine peptidase 843 107 C20140707_OR006_05 C20140707_OR006_05 TB450422.[MT7]-VGSFSQNVELLNLLPK[MT7].3b4_1.heavy 682.733 / 535.3 3572.0 46.69129943847656 38 13 9 10 6 1.6412933557004907 48.45486765644364 0.0 5 0.9142189072201331 4.183232955353386 3572.0 6.724674093501951 0.0 - - - - - - - 264.6 7 5 CASP2 caspase 2, apoptosis-related cysteine peptidase 845 108 C20140707_OR006_05 C20140707_OR006_05 TB450161.[MT7]-IEQAMDLVK[MT7].2b3_1.heavy 667.883 / 515.295 5184.0 35.45539855957031 35 15 0 10 10 1.7896746327614776 39.05691918954348 0.0 3 0.959444369109758 6.107422925521948 5184.0 30.808393562427792 0.0 - - - - - - - 323.75 10 8 TSC22D3;TSC22D4;TSC22D1;TSC22D2 TSC22 domain family, member 3;TSC22 domain family, member 4;TSC22 domain family, member 1;TSC22 domain family, member 2 847 108 C20140707_OR006_05 C20140707_OR006_05 TB450161.[MT7]-IEQAMDLVK[MT7].2b4_1.heavy 667.883 / 586.332 2728.0 35.45539855957031 35 15 0 10 10 1.7896746327614776 39.05691918954348 0.0 3 0.959444369109758 6.107422925521948 2728.0 9.415500399125655 2.0 - - - - - - - 289.75 5 8 TSC22D3;TSC22D4;TSC22D1;TSC22D2 TSC22 domain family, member 3;TSC22 domain family, member 4;TSC22 domain family, member 1;TSC22 domain family, member 2 849 108 C20140707_OR006_05 C20140707_OR006_05 TB450161.[MT7]-IEQAMDLVK[MT7].2y3_1.heavy 667.883 / 503.367 N/A 35.45539855957031 35 15 0 10 10 1.7896746327614776 39.05691918954348 0.0 3 0.959444369109758 6.107422925521948 0.0 0.0 46.0 - - - - - - - 257.55555555555554 41 9 TSC22D3;TSC22D4;TSC22D1;TSC22D2 TSC22 domain family, member 3;TSC22 domain family, member 4;TSC22 domain family, member 1;TSC22 domain family, member 2 851 108 C20140707_OR006_05 C20140707_OR006_05 TB450161.[MT7]-IEQAMDLVK[MT7].2b6_1.heavy 667.883 / 832.399 4229.0 35.45539855957031 35 15 0 10 10 1.7896746327614776 39.05691918954348 0.0 3 0.959444369109758 6.107422925521948 4229.0 17.052046714491702 0.0 - - - - - - - 218.0 8 10 TSC22D3;TSC22D4;TSC22D1;TSC22D2 TSC22 domain family, member 3;TSC22 domain family, member 4;TSC22 domain family, member 1;TSC22 domain family, member 2 853 109 C20140707_OR006_05 C20140707_OR006_05 TB437290.[MT7]-VYVATFLGFGGNAAR.3y6_1.heavy 562.974 / 545.279 12417.0 44.77910041809082 37 12 10 5 10 1.0121652434971629 62.04164064455815 0.043201446533203125 3 0.8930518729779591 3.7396158080857522 12417.0 24.259995035631356 0.0 - - - - - - - 301.77777777777777 24 9 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 855 109 C20140707_OR006_05 C20140707_OR006_05 TB437290.[MT7]-VYVATFLGFGGNAAR.3b4_1.heavy 562.974 / 577.347 4656.0 44.77910041809082 37 12 10 5 10 1.0121652434971629 62.04164064455815 0.043201446533203125 3 0.8930518729779591 3.7396158080857522 4656.0 11.335026767914343 0.0 - - - - - - - 291.0 9 4 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 857 109 C20140707_OR006_05 C20140707_OR006_05 TB437290.[MT7]-VYVATFLGFGGNAAR.3b3_1.heavy 562.974 / 506.31 5950.0 44.77910041809082 37 12 10 5 10 1.0121652434971629 62.04164064455815 0.043201446533203125 3 0.8930518729779591 3.7396158080857522 5950.0 10.750241545893719 0.0 - - - - - - - 301.77777777777777 11 9 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 859 109 C20140707_OR006_05 C20140707_OR006_05 TB437290.[MT7]-VYVATFLGFGGNAAR.3y8_1.heavy 562.974 / 749.369 5433.0 44.77910041809082 37 12 10 5 10 1.0121652434971629 62.04164064455815 0.043201446533203125 3 0.8930518729779591 3.7396158080857522 5433.0 3.3895917250122456 1.0 - - - - - - - 206.8 10 5 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 861 110 C20140707_OR006_05 C20140707_OR006_05 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 28716.0 22.72719955444336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 28716.0 415.87342646366346 0.0 - - - - - - - 231.16666666666666 57 12 863 110 C20140707_OR006_05 C20140707_OR006_05 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 37664.0 22.72719955444336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 37664.0 519.9794425863992 0.0 - - - - - - - 148.35714285714286 75 14 865 110 C20140707_OR006_05 C20140707_OR006_05 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 124646.0 22.72719955444336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 124646.0 471.975352115376 0.0 - - - - - - - 173.3 249 10 867 111 C20140707_OR006_05 C20140707_OR006_05 TB450426.[MT7]-FLVYTSSMEVVGPNTK[MT7].3y6_1.heavy 687.371 / 759.448 11225.0 39.63410186767578 44 14 10 10 10 1.925784480521022 41.21802036467076 0.0 3 0.9337222219206182 4.767053614234301 11225.0 29.933333333333334 0.0 - - - - - - - 630.0 22 8 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 869 111 C20140707_OR006_05 C20140707_OR006_05 TB450426.[MT7]-FLVYTSSMEVVGPNTK[MT7].3b4_1.heavy 687.371 / 667.394 7627.0 39.63410186767578 44 14 10 10 10 1.925784480521022 41.21802036467076 0.0 3 0.9337222219206182 4.767053614234301 7627.0 9.47358315971659 0.0 - - - - - - - 719.7142857142857 15 7 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 871 111 C20140707_OR006_05 C20140707_OR006_05 TB450426.[MT7]-FLVYTSSMEVVGPNTK[MT7].3b3_1.heavy 687.371 / 504.33 14104.0 39.63410186767578 44 14 10 10 10 1.925784480521022 41.21802036467076 0.0 3 0.9337222219206182 4.767053614234301 14104.0 31.051680185399768 0.0 - - - - - - - 791.375 28 8 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 873 111 C20140707_OR006_05 C20140707_OR006_05 TB450426.[MT7]-FLVYTSSMEVVGPNTK[MT7].3y5_1.heavy 687.371 / 660.38 24177.0 39.63410186767578 44 14 10 10 10 1.925784480521022 41.21802036467076 0.0 3 0.9337222219206182 4.767053614234301 24177.0 62.553262356400126 0.0 - - - - - - - 316.8 48 5 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 875 112 C20140707_OR006_05 C20140707_OR006_05 TB450425.[MT7]-IDPQTGWPFFVDHNSR.3y7_1.heavy 687.342 / 874.417 5606.0 41.31842517852783 39 18 10 1 10 4.43754320435897 22.534991862562745 0.09109878540039062 3 0.986053521742925 10.43816258872755 5606.0 1.9499130434782606 0.0 - - - - - - - 215.5 11 2 BAG3 BCL2-associated athanogene 3 877 112 C20140707_OR006_05 C20140707_OR006_05 TB450425.[MT7]-IDPQTGWPFFVDHNSR.3b6_1.heavy 687.342 / 756.401 4743.0 41.31842517852783 39 18 10 1 10 4.43754320435897 22.534991862562745 0.09109878540039062 3 0.986053521742925 10.43816258872755 4743.0 -0.30000000000000004 1.0 - - - - - - - 359.0 12 2 BAG3 BCL2-associated athanogene 3 879 112 C20140707_OR006_05 C20140707_OR006_05 TB450425.[MT7]-IDPQTGWPFFVDHNSR.3y4_1.heavy 687.342 / 513.253 9774.0 41.31842517852783 39 18 10 1 10 4.43754320435897 22.534991862562745 0.09109878540039062 3 0.986053521742925 10.43816258872755 9774.0 1.0364326375711574 1.0 - - - - - - - 144.0 19 2 BAG3 BCL2-associated athanogene 3 881 112 C20140707_OR006_05 C20140707_OR006_05 TB450425.[MT7]-IDPQTGWPFFVDHNSR.3y9_1.heavy 687.342 / 1118.54 6037.0 41.31842517852783 39 18 10 1 10 4.43754320435897 22.534991862562745 0.09109878540039062 3 0.986053521742925 10.43816258872755 6037.0 0.0 0.0 - - - - - - - 239.33333333333334 12 3 BAG3 BCL2-associated athanogene 3 883 113 C20140707_OR006_05 C20140707_OR006_05 TB437555.[MT7]-FLGVEAAMAYGMGFATNSMNIPALVGK[MT7].3b9_1.heavy 1016.86 / 1034.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPTLC2 serine palmitoyltransferase, long chain base subunit 2 885 113 C20140707_OR006_05 C20140707_OR006_05 TB437555.[MT7]-FLGVEAAMAYGMGFATNSMNIPALVGK[MT7].3b6_1.heavy 1016.86 / 761.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPTLC2 serine palmitoyltransferase, long chain base subunit 2 887 113 C20140707_OR006_05 C20140707_OR006_05 TB437555.[MT7]-FLGVEAAMAYGMGFATNSMNIPALVGK[MT7].3y6_1.heavy 1016.86 / 728.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPTLC2 serine palmitoyltransferase, long chain base subunit 2 889 113 C20140707_OR006_05 C20140707_OR006_05 TB437555.[MT7]-FLGVEAAMAYGMGFATNSMNIPALVGK[MT7].3b5_1.heavy 1016.86 / 690.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPTLC2 serine palmitoyltransferase, long chain base subunit 2 891 114 C20140707_OR006_05 C20140707_OR006_05 TB450423.[MT7]-VGSFSQNVELLNLLPK[MT7].4b7_1.heavy 512.301 / 864.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 893 114 C20140707_OR006_05 C20140707_OR006_05 TB450423.[MT7]-VGSFSQNVELLNLLPK[MT7].4b4_1.heavy 512.301 / 535.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 895 114 C20140707_OR006_05 C20140707_OR006_05 TB450423.[MT7]-VGSFSQNVELLNLLPK[MT7].4b9_1.heavy 512.301 / 1092.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 897 114 C20140707_OR006_05 C20140707_OR006_05 TB450423.[MT7]-VGSFSQNVELLNLLPK[MT7].4b6_1.heavy 512.301 / 750.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 899 115 C20140707_OR006_05 C20140707_OR006_05 TB412060.[MT7]-LLTQYILNLGK[MT7].2y4_1.heavy 782.489 / 575.363 3543.0 46.43960189819336 50 20 10 10 10 6.382956487734827 15.666721243072086 0.0 3 0.9938763060896637 15.762814305491505 3543.0 24.086798418972336 0.0 - - - - - - - 227.8 7 5 AP3B1 adaptor-related protein complex 3, beta 1 subunit 901 115 C20140707_OR006_05 C20140707_OR006_05 TB412060.[MT7]-LLTQYILNLGK[MT7].2y5_1.heavy 782.489 / 688.447 3796.0 46.43960189819336 50 20 10 10 10 6.382956487734827 15.666721243072086 0.0 3 0.9938763060896637 15.762814305491505 3796.0 15.147072087802442 0.0 - - - - - - - 263.9166666666667 7 12 AP3B1 adaptor-related protein complex 3, beta 1 subunit 903 115 C20140707_OR006_05 C20140707_OR006_05 TB412060.[MT7]-LLTQYILNLGK[MT7].2b4_1.heavy 782.489 / 600.384 2657.0 46.43960189819336 50 20 10 10 10 6.382956487734827 15.666721243072086 0.0 3 0.9938763060896637 15.762814305491505 2657.0 6.286491696333242 0.0 - - - - - - - 316.5 5 4 AP3B1 adaptor-related protein complex 3, beta 1 subunit 905 115 C20140707_OR006_05 C20140707_OR006_05 TB412060.[MT7]-LLTQYILNLGK[MT7].2y6_1.heavy 782.489 / 801.531 2530.0 46.43960189819336 50 20 10 10 10 6.382956487734827 15.666721243072086 0.0 3 0.9938763060896637 15.762814305491505 2530.0 3.8571831780976575 1.0 - - - - - - - 227.8 7 5 AP3B1 adaptor-related protein complex 3, beta 1 subunit 907 116 C20140707_OR006_05 C20140707_OR006_05 TB411660.[MT7]-C[CAM]LLPASR.2y4_1.heavy 480.774 / 430.241 7213.0 26.435524940490723 42 18 10 6 8 2.553246222360519 31.0420045364434 0.039501190185546875 4 0.9819701946904841 9.177241558389044 7213.0 14.219575597869206 0.0 - - - - - - - 269.3636363636364 14 11 CA7 carbonic anhydrase VII 909 116 C20140707_OR006_05 C20140707_OR006_05 TB411660.[MT7]-C[CAM]LLPASR.2b3_1.heavy 480.774 / 531.308 5138.0 26.435524940490723 42 18 10 6 8 2.553246222360519 31.0420045364434 0.039501190185546875 4 0.9819701946904841 9.177241558389044 5138.0 12.09706329113924 0.0 - - - - - - - 263.55555555555554 10 9 CA7 carbonic anhydrase VII 911 116 C20140707_OR006_05 C20140707_OR006_05 TB411660.[MT7]-C[CAM]LLPASR.2y5_1.heavy 480.774 / 543.325 3458.0 26.435524940490723 42 18 10 6 8 2.553246222360519 31.0420045364434 0.039501190185546875 4 0.9819701946904841 9.177241558389044 3458.0 21.788326508326506 1.0 - - - - - - - 205.30769230769232 6 13 CA7 carbonic anhydrase VII 913 116 C20140707_OR006_05 C20140707_OR006_05 TB411660.[MT7]-C[CAM]LLPASR.2y6_1.heavy 480.774 / 656.409 3656.0 26.435524940490723 42 18 10 6 8 2.553246222360519 31.0420045364434 0.039501190185546875 4 0.9819701946904841 9.177241558389044 3656.0 6.478987341772151 1.0 - - - - - - - 208.77777777777777 8 9 CA7 carbonic anhydrase VII 915 117 C20140707_OR006_05 C20140707_OR006_05 TB411954.[MT7]-QFAAATIQTIGR.3b4_1.heavy 474.272 / 562.311 3820.0 33.40107536315918 40 17 10 3 10 4.098764102135096 24.39759827795622 0.0792999267578125 3 0.9775461173357283 8.220545663922827 3820.0 19.30989010989011 0.0 - - - - - - - 289.75 7 8 AP3B1 adaptor-related protein complex 3, beta 1 subunit 917 117 C20140707_OR006_05 C20140707_OR006_05 TB411954.[MT7]-QFAAATIQTIGR.3b5_1.heavy 474.272 / 633.348 1501.0 33.40107536315918 40 17 10 3 10 4.098764102135096 24.39759827795622 0.0792999267578125 3 0.9775461173357283 8.220545663922827 1501.0 5.49267032967033 1.0 - - - - - - - 238.5 6 4 AP3B1 adaptor-related protein complex 3, beta 1 subunit 919 117 C20140707_OR006_05 C20140707_OR006_05 TB411954.[MT7]-QFAAATIQTIGR.3b3_1.heavy 474.272 / 491.273 2728.0 33.40107536315918 40 17 10 3 10 4.098764102135096 24.39759827795622 0.0792999267578125 3 0.9775461173357283 8.220545663922827 2728.0 23.257058823529412 1.0 - - - - - - - 204.33333333333334 5 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 921 117 C20140707_OR006_05 C20140707_OR006_05 TB411954.[MT7]-QFAAATIQTIGR.3y5_1.heavy 474.272 / 574.331 4365.0 33.40107536315918 40 17 10 3 10 4.098764102135096 24.39759827795622 0.0792999267578125 3 0.9775461173357283 8.220545663922827 4365.0 13.990384615384617 0.0 - - - - - - - 194.71428571428572 8 7 AP3B1 adaptor-related protein complex 3, beta 1 subunit 923 118 C20140707_OR006_05 C20140707_OR006_05 TB450016.[MT7]-SEAGIISK[MT7].2b4_1.heavy 546.829 / 489.242 N/A 23.870899200439453 36 20 0 10 6 5.138981621791274 19.459108313592957 0.0 6 0.9918719482673718 13.679635856152045 5341.0 8.923961126216778 2.0 - - - - - - - 236.5 40 12 AP3B1 adaptor-related protein complex 3, beta 1 subunit 925 118 C20140707_OR006_05 C20140707_OR006_05 TB450016.[MT7]-SEAGIISK[MT7].2y6_1.heavy 546.829 / 732.474 2704.0 23.870899200439453 36 20 0 10 6 5.138981621791274 19.459108313592957 0.0 6 0.9918719482673718 13.679635856152045 2704.0 18.682809706257977 1.0 - - - - - - - 198.5625 9 16 AP3B1 adaptor-related protein complex 3, beta 1 subunit 927 118 C20140707_OR006_05 C20140707_OR006_05 TB450016.[MT7]-SEAGIISK[MT7].2b5_1.heavy 546.829 / 602.327 3313.0 23.870899200439453 36 20 0 10 6 5.138981621791274 19.459108313592957 0.0 6 0.9918719482673718 13.679635856152045 3313.0 4.1664594566330315 0.0 - - - - - - - 156.4375 6 16 AP3B1 adaptor-related protein complex 3, beta 1 subunit 929 118 C20140707_OR006_05 C20140707_OR006_05 TB450016.[MT7]-SEAGIISK[MT7].2y7_1.heavy 546.829 / 861.516 1690.0 23.870899200439453 36 20 0 10 6 5.138981621791274 19.459108313592957 0.0 6 0.9918719482673718 13.679635856152045 1690.0 11.266666666666667 2.0 - - - - - - - 135.26666666666668 3 15 AP3B1 adaptor-related protein complex 3, beta 1 subunit 931 119 C20140707_OR006_05 C20140707_OR006_05 TB450017.[MT7]-ELLMGDK[MT7].2b3_1.heavy 547.312 / 500.32 13990.0 29.460399627685547 45 20 10 5 10 8.889420141876014 11.249327673120431 0.042999267578125 3 0.9938419213191378 15.718700267032583 13990.0 36.12828333424406 0.0 - - - - - - - 712.7142857142857 27 7 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 933 119 C20140707_OR006_05 C20140707_OR006_05 TB450017.[MT7]-ELLMGDK[MT7].2y4_1.heavy 547.312 / 594.304 20171.0 29.460399627685547 45 20 10 5 10 8.889420141876014 11.249327673120431 0.042999267578125 3 0.9938419213191378 15.718700267032583 20171.0 42.01974201102969 0.0 - - - - - - - 203.25 40 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 935 119 C20140707_OR006_05 C20140707_OR006_05 TB450017.[MT7]-ELLMGDK[MT7].2y5_1.heavy 547.312 / 707.388 10628.0 29.460399627685547 45 20 10 5 10 8.889420141876014 11.249327673120431 0.042999267578125 3 0.9938419213191378 15.718700267032583 10628.0 31.19645507054149 0.0 - - - - - - - 216.66666666666666 21 9 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 937 119 C20140707_OR006_05 C20140707_OR006_05 TB450017.[MT7]-ELLMGDK[MT7].2y6_1.heavy 547.312 / 820.472 7374.0 29.460399627685547 45 20 10 5 10 8.889420141876014 11.249327673120431 0.042999267578125 3 0.9938419213191378 15.718700267032583 7374.0 26.515653578655602 0.0 - - - - - - - 281.8 14 10 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 939 120 C20140707_OR006_05 C20140707_OR006_05 TB437408.[MT7]-VFDQHLGPWLEELK[MT7].3y5_1.heavy 667.035 / 775.468 9100.0 42.93899917602539 45 20 10 5 10 5.435281515208955 18.398311057151485 0.0447998046875 3 0.990016894780629 12.341489606214928 9100.0 9.335673134940489 0.0 - - - - - - - 295.7142857142857 18 7 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 941 120 C20140707_OR006_05 C20140707_OR006_05 TB437408.[MT7]-VFDQHLGPWLEELK[MT7].3b4_1.heavy 667.035 / 634.332 21096.0 42.93899917602539 45 20 10 5 10 5.435281515208955 18.398311057151485 0.0447998046875 3 0.990016894780629 12.341489606214928 21096.0 94.9098220319892 0.0 - - - - - - - 193.2 42 5 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 943 120 C20140707_OR006_05 C20140707_OR006_05 TB437408.[MT7]-VFDQHLGPWLEELK[MT7].3b3_1.heavy 667.035 / 506.273 17649.0 42.93899917602539 45 20 10 5 10 5.435281515208955 18.398311057151485 0.0447998046875 3 0.990016894780629 12.341489606214928 17649.0 58.72618495156567 0.0 - - - - - - - 276.0 35 3 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 945 120 C20140707_OR006_05 C20140707_OR006_05 TB437408.[MT7]-VFDQHLGPWLEELK[MT7].3y4_1.heavy 667.035 / 662.384 11720.0 42.93899917602539 45 20 10 5 10 5.435281515208955 18.398311057151485 0.0447998046875 3 0.990016894780629 12.341489606214928 11720.0 2.4751793901462777 1.0 - - - - - - - 310.5 23 8 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 947 121 C20140707_OR006_05 C20140707_OR006_05 TB437010.[MT7]-IAPDVLRK[MT7].2y4_1.heavy 600.389 / 659.469 1582.0 27.649999618530273 34 16 0 10 8 4.843135095942524 20.647782483659782 0.0 4 0.9669377596481757 6.768498676684353 1582.0 8.622274881516587 1.0 - - - - - - - 228.25 3 12 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 949 121 C20140707_OR006_05 C20140707_OR006_05 TB437010.[MT7]-IAPDVLRK[MT7].2b4_1.heavy 600.389 / 541.31 1477.0 27.649999618530273 34 16 0 10 8 4.843135095942524 20.647782483659782 0.0 4 0.9669377596481757 6.768498676684353 1477.0 2.094593495934959 12.0 - - - - - - - 297.09090909090907 45 11 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 951 121 C20140707_OR006_05 C20140707_OR006_05 TB437010.[MT7]-IAPDVLRK[MT7].2y6_1.heavy 600.389 / 871.548 4009.0 27.649999618530273 34 16 0 10 8 4.843135095942524 20.647782483659782 0.0 4 0.9669377596481757 6.768498676684353 4009.0 52.98828571428571 0.0 - - - - - - - 210.7 8 10 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 953 121 C20140707_OR006_05 C20140707_OR006_05 TB437010.[MT7]-IAPDVLRK[MT7].2y7_1.heavy 600.389 / 942.585 2637.0 27.649999618530273 34 16 0 10 8 4.843135095942524 20.647782483659782 0.0 4 0.9669377596481757 6.768498676684353 2637.0 15.309597156398105 0.0 - - - - - - - 245.83333333333334 5 6 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 955 122 C20140707_OR006_05 C20140707_OR006_05 TB437159.[MT7]-DILLLPLQLPR.2y8_1.heavy 717.962 / 949.619 9337.0 49.28990173339844 48 18 10 10 10 3.174245264808804 25.39724366768605 0.0 3 0.9840735362670113 9.766177265921923 9337.0 61.499585190003785 0.0 - - - - - - - 232.5 18 6 RIN1 Ras and Rab interactor 1 957 122 C20140707_OR006_05 C20140707_OR006_05 TB437159.[MT7]-DILLLPLQLPR.2y9_1.heavy 717.962 / 1062.7 5151.0 49.28990173339844 48 18 10 10 10 3.174245264808804 25.39724366768605 0.0 3 0.9840735362670113 9.766177265921923 5151.0 46.718372093023255 0.0 - - - - - - - 268.5 10 4 RIN1 Ras and Rab interactor 1 959 122 C20140707_OR006_05 C20140707_OR006_05 TB437159.[MT7]-DILLLPLQLPR.2y6_1.heavy 717.962 / 723.451 15883.0 49.28990173339844 48 18 10 10 10 3.174245264808804 25.39724366768605 0.0 3 0.9840735362670113 9.766177265921923 15883.0 52.737744056486775 0.0 - - - - - - - 226.44444444444446 31 9 RIN1 Ras and Rab interactor 1 961 122 C20140707_OR006_05 C20140707_OR006_05 TB437159.[MT7]-DILLLPLQLPR.2y7_1.heavy 717.962 / 836.535 6225.0 49.28990173339844 48 18 10 10 10 3.174245264808804 25.39724366768605 0.0 3 0.9840735362670113 9.766177265921923 6225.0 39.67652332077433 0.0 - - - - - - - 250.5 12 6 RIN1 Ras and Rab interactor 1 963 123 C20140707_OR006_05 C20140707_OR006_05 TB437011.[MT7]-NRAEVSQPR.3y7_1.heavy 400.89 / 786.41 329.0 15.161499977111816 46 16 10 10 10 4.37712445951953 22.84604902712244 0.0 3 0.9679793820048419 6.878310652998254 329.0 3.982258655036881 1.0 - - - - - - - 129.63636363636363 3 11 UBA1 ubiquitin-like modifier activating enzyme 1 965 123 C20140707_OR006_05 C20140707_OR006_05 TB437011.[MT7]-NRAEVSQPR.3y5_1.heavy 400.89 / 586.331 3185.0 15.161499977111816 46 16 10 10 10 4.37712445951953 22.84604902712244 0.0 3 0.9679793820048419 6.878310652998254 3185.0 31.534379078648424 0.0 - - - - - - - 109.6470588235294 6 17 UBA1 ubiquitin-like modifier activating enzyme 1 967 123 C20140707_OR006_05 C20140707_OR006_05 TB437011.[MT7]-NRAEVSQPR.3b4_1.heavy 400.89 / 615.333 1620.0 15.161499977111816 46 16 10 10 10 4.37712445951953 22.84604902712244 0.0 3 0.9679793820048419 6.878310652998254 1620.0 13.509818181818183 0.0 - - - - - - - 85.27777777777777 3 18 UBA1 ubiquitin-like modifier activating enzyme 1 969 123 C20140707_OR006_05 C20140707_OR006_05 TB437011.[MT7]-NRAEVSQPR.3y4_1.heavy 400.89 / 487.262 8347.0 15.161499977111816 46 16 10 10 10 4.37712445951953 22.84604902712244 0.0 3 0.9679793820048419 6.878310652998254 8347.0 75.97639762921642 0.0 - - - - - - - 135.72222222222223 16 18 UBA1 ubiquitin-like modifier activating enzyme 1 971 124 C20140707_OR006_05 C20140707_OR006_05 TB411760.[MT7]-K[MT7]PVNELR.2b3_1.heavy 572.358 / 613.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 973 124 C20140707_OR006_05 C20140707_OR006_05 TB411760.[MT7]-K[MT7]PVNELR.2y4_1.heavy 572.358 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 975 124 C20140707_OR006_05 C20140707_OR006_05 TB411760.[MT7]-K[MT7]PVNELR.2b6_1.heavy 572.358 / 969.597 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 977 124 C20140707_OR006_05 C20140707_OR006_05 TB411760.[MT7]-K[MT7]PVNELR.2b5_1.heavy 572.358 / 856.513 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 979 125 C20140707_OR006_05 C20140707_OR006_05 TB411862.[MT7]-LPHGLGEPYR.3y7_1.heavy 428.239 / 791.405 1750.0 28.51870059967041 36 10 10 6 10 1.0727221094706079 60.448379487688854 0.03940010070800781 3 0.8435640766638128 3.0786673460211027 1750.0 3.1963470319634704 0.0 - - - - - - - 196.8 3 5 TSC22D4 TSC22 domain family, member 4 981 125 C20140707_OR006_05 C20140707_OR006_05 TB411862.[MT7]-LPHGLGEPYR.3y3_1.heavy 428.239 / 435.235 7655.0 28.51870059967041 36 10 10 6 10 1.0727221094706079 60.448379487688854 0.03940010070800781 3 0.8435640766638128 3.0786673460211027 7655.0 33.02812778973378 0.0 - - - - - - - 234.28571428571428 15 7 TSC22D4 TSC22 domain family, member 4 983 125 C20140707_OR006_05 C20140707_OR006_05 TB411862.[MT7]-LPHGLGEPYR.3b4_1.heavy 428.239 / 549.326 1968.0 28.51870059967041 36 10 10 6 10 1.0727221094706079 60.448379487688854 0.03940010070800781 3 0.8435640766638128 3.0786673460211027 1968.0 6.2904109589041095 1.0 - - - - - - - 291.55555555555554 3 9 TSC22D4 TSC22 domain family, member 4 985 125 C20140707_OR006_05 C20140707_OR006_05 TB411862.[MT7]-LPHGLGEPYR.3y5_1.heavy 428.239 / 621.299 2406.0 28.51870059967041 36 10 10 6 10 1.0727221094706079 60.448379487688854 0.03940010070800781 3 0.8435640766638128 3.0786673460211027 2406.0 22.669231876236733 0.0 - - - - - - - 255.0 4 3 TSC22D4 TSC22 domain family, member 4 987 126 C20140707_OR006_05 C20140707_OR006_05 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 146902.0 32.38090133666992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 146902.0 206.70935017783427 0.0 - - - - - - - 231.0 293 4 989 126 C20140707_OR006_05 C20140707_OR006_05 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 151254.0 32.38090133666992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 151254.0 193.34094027156567 0.0 - - - - - - - 158.4 302 5 991 126 C20140707_OR006_05 C20140707_OR006_05 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 309101.0 32.38090133666992 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 309101.0 219.26435298616119 0.0 - - - - - - - 242.0 618 6 993 127 C20140707_OR006_05 C20140707_OR006_05 TB437542.[MT7]-LAYVAAGDLAPINAFIGGLAAQEVMK[MT7].3b4_1.heavy 964.536 / 591.362 3085.0 54.47167491912842 39 11 10 8 10 0.7686507183052138 74.46742480795453 0.017498016357421875 3 0.8511088900373 3.1578100385473555 3085.0 8.850836588070784 1.0 - - - - - - - 147.4 8 30 UBA1 ubiquitin-like modifier activating enzyme 1 995 127 C20140707_OR006_05 C20140707_OR006_05 TB437542.[MT7]-LAYVAAGDLAPINAFIGGLAAQEVMK[MT7].3b10_1.heavy 964.536 / 1089.61 7583.0 54.47167491912842 39 11 10 8 10 0.7686507183052138 74.46742480795453 0.017498016357421875 3 0.8511088900373 3.1578100385473555 7583.0 25.57694018304356 0.0 - - - - - - - 727.4285714285714 15 7 UBA1 ubiquitin-like modifier activating enzyme 1 997 127 C20140707_OR006_05 C20140707_OR006_05 TB437542.[MT7]-LAYVAAGDLAPINAFIGGLAAQEVMK[MT7].3b5_1.heavy 964.536 / 662.399 3420.0 54.47167491912842 39 11 10 8 10 0.7686507183052138 74.46742480795453 0.017498016357421875 3 0.8511088900373 3.1578100385473555 3420.0 7.9031811478616785 0.0 - - - - - - - 172.3030303030303 6 33 UBA1 ubiquitin-like modifier activating enzyme 1 999 127 C20140707_OR006_05 C20140707_OR006_05 TB437542.[MT7]-LAYVAAGDLAPINAFIGGLAAQEVMK[MT7].3b8_1.heavy 964.536 / 905.485 3122.0 54.47167491912842 39 11 10 8 10 0.7686507183052138 74.46742480795453 0.017498016357421875 3 0.8511088900373 3.1578100385473555 3122.0 -0.8258737340545641 2.0 - - - - - - - 162.5142857142857 6 35 UBA1 ubiquitin-like modifier activating enzyme 1 1001 128 C20140707_OR006_05 C20140707_OR006_05 TB437543.[MT7]-LAYVAAGDLAPINAFIGGLAAQEVMK[MT7].4b8_1.heavy 723.654 / 905.485 3532.0 54.47167491912842 34 16 2 8 8 1.9470792667290657 34.79281306997414 0.017498016357421875 4 0.963512755659709 6.441134924894504 3532.0 19.88634962049336 0.0 - - - - - - - 157.04347826086956 7 23 UBA1 ubiquitin-like modifier activating enzyme 1 1003 128 C20140707_OR006_05 C20140707_OR006_05 TB437543.[MT7]-LAYVAAGDLAPINAFIGGLAAQEVMK[MT7].4b4_1.heavy 723.654 / 591.362 5715.0 54.47167491912842 34 16 2 8 8 1.9470792667290657 34.79281306997414 0.017498016357421875 4 0.963512755659709 6.441134924894504 5715.0 19.42593510032202 1.0 - - - - - - - 151.79310344827587 34 29 UBA1 ubiquitin-like modifier activating enzyme 1 1005 128 C20140707_OR006_05 C20140707_OR006_05 TB437543.[MT7]-LAYVAAGDLAPINAFIGGLAAQEVMK[MT7].4b5_1.heavy 723.654 / 662.399 4644.0 54.47167491912842 34 16 2 8 8 1.9470792667290657 34.79281306997414 0.017498016357421875 4 0.963512755659709 6.441134924894504 4644.0 12.748113657615024 1.0 - - - - - - - 170.04761904761904 9 21 UBA1 ubiquitin-like modifier activating enzyme 1 1007 128 C20140707_OR006_05 C20140707_OR006_05 TB437543.[MT7]-LAYVAAGDLAPINAFIGGLAAQEVMK[MT7].4y3_1.heavy 723.654 / 521.324 2699.0 54.47167491912842 34 16 2 8 8 1.9470792667290657 34.79281306997414 0.017498016357421875 4 0.963512755659709 6.441134924894504 2699.0 2.883453237410072 2.0 - - - - - - - 146.0909090909091 26 22 UBA1 ubiquitin-like modifier activating enzyme 1 1009 129 C20140707_OR006_05 C20140707_OR006_05 TB437544.[MT7]-EHPDAWTRVDTILEFSQNMNTK[MT7].4y5_1.heavy 730.868 / 751.389 1139.0 41.59469985961914 38 18 2 10 8 26.721151878493874 3.7423536400945174 0.0 4 0.9847688434251468 9.987186242682686 1139.0 1.7528671775223499 5.0 - - - - - - - 320.25 7 4 XPO1 exportin 1 (CRM1 homolog, yeast) 1011 129 C20140707_OR006_05 C20140707_OR006_05 TB437544.[MT7]-EHPDAWTRVDTILEFSQNMNTK[MT7].4b11_2.heavy 730.868 / 726.853 1709.0 41.59469985961914 38 18 2 10 8 26.721151878493874 3.7423536400945174 0.0 4 0.9847688434251468 9.987186242682686 1709.0 3.841573691550667 2.0 - - - - - - - 403.3333333333333 3 6 XPO1 exportin 1 (CRM1 homolog, yeast) 1013 129 C20140707_OR006_05 C20140707_OR006_05 TB437544.[MT7]-EHPDAWTRVDTILEFSQNMNTK[MT7].4b12_2.heavy 730.868 / 783.395 1851.0 41.59469985961914 38 18 2 10 8 26.721151878493874 3.7423536400945174 0.0 4 0.9847688434251468 9.987186242682686 1851.0 6.418569633353045 2.0 - - - - - - - 270.4 3 10 XPO1 exportin 1 (CRM1 homolog, yeast) 1015 129 C20140707_OR006_05 C20140707_OR006_05 TB437544.[MT7]-EHPDAWTRVDTILEFSQNMNTK[MT7].4y3_1.heavy 730.868 / 506.306 1851.0 41.59469985961914 38 18 2 10 8 26.721151878493874 3.7423536400945174 0.0 4 0.9847688434251468 9.987186242682686 1851.0 5.97 2.0 - - - - - - - 272.75 3 12 XPO1 exportin 1 (CRM1 homolog, yeast) 1017 130 C20140707_OR006_05 C20140707_OR006_05 TB450414.[MT7]-VFDQHLGPWLEELK[MT7].4b4_1.heavy 500.528 / 634.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 1019 130 C20140707_OR006_05 C20140707_OR006_05 TB450414.[MT7]-VFDQHLGPWLEELK[MT7].4b5_1.heavy 500.528 / 771.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 1021 130 C20140707_OR006_05 C20140707_OR006_05 TB450414.[MT7]-VFDQHLGPWLEELK[MT7].4y3_1.heavy 500.528 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 1023 130 C20140707_OR006_05 C20140707_OR006_05 TB450414.[MT7]-VFDQHLGPWLEELK[MT7].4b3_1.heavy 500.528 / 506.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 1025 131 C20140707_OR006_05 C20140707_OR006_05 TB450401.[MT7]-SFPSELHLVHWNAK[MT7].4y4_1.heavy 489.02 / 662.374 525.0 33.80246607462565 12 3 2 5 2 0.40342008543957625 101.06544547940246 0.04070281982421875 14 0.5929453712601604 1.864499388566079 525.0 4.00763358778626 13.0 - - - - - - - 160.33333333333334 8 9 CA7 carbonic anhydrase VII 1027 131 C20140707_OR006_05 C20140707_OR006_05 TB450401.[MT7]-SFPSELHLVHWNAK[MT7].4b4_1.heavy 489.02 / 563.295 3282.0 33.80246607462565 12 3 2 5 2 0.40342008543957625 101.06544547940246 0.04070281982421875 14 0.5929453712601604 1.864499388566079 3282.0 12.245025380710658 2.0 - - - - - - - 196.83333333333334 6 6 CA7 carbonic anhydrase VII 1029 131 C20140707_OR006_05 C20140707_OR006_05 TB450401.[MT7]-SFPSELHLVHWNAK[MT7].4b5_1.heavy 489.02 / 692.337 919.0 33.80246607462565 12 3 2 5 2 0.40342008543957625 101.06544547940246 0.04070281982421875 14 0.5929453712601604 1.864499388566079 919.0 2.792009523809524 4.0 - - - - - - - 618.7142857142857 14 7 CA7 carbonic anhydrase VII 1031 131 C20140707_OR006_05 C20140707_OR006_05 TB450401.[MT7]-SFPSELHLVHWNAK[MT7].4b6_1.heavy 489.02 / 805.421 N/A 33.80246607462565 12 3 2 5 2 0.40342008543957625 101.06544547940246 0.04070281982421875 14 0.5929453712601604 1.864499388566079 0.0 0.0 23.0 - - - - - - - 175.0 5 3 CA7 carbonic anhydrase VII 1033 132 C20140707_OR006_05 C20140707_OR006_05 TB437474.[MT7]-NAAVVMAVAQLYWHISPK[MT7].4y4_1.heavy 572.322 / 588.384 3345.0 49.090599060058594 30 5 10 5 10 0.7610879640589133 70.99664647436933 0.0447998046875 3 0.672636645816458 2.0951574419276238 3345.0 5.848518157803335 1.0 - - - - - - - 317.0 6 4 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1035 132 C20140707_OR006_05 C20140707_OR006_05 TB437474.[MT7]-NAAVVMAVAQLYWHISPK[MT7].4b4_1.heavy 572.322 / 500.295 807.0 49.090599060058594 30 5 10 5 10 0.7610879640589133 70.99664647436933 0.0447998046875 3 0.672636645816458 2.0951574419276238 807.0 5.662610539749268 7.0 - - - - - - - 253.6 2 5 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1037 132 C20140707_OR006_05 C20140707_OR006_05 TB437474.[MT7]-NAAVVMAVAQLYWHISPK[MT7].4b5_1.heavy 572.322 / 599.363 3114.0 49.090599060058594 30 5 10 5 10 0.7610879640589133 70.99664647436933 0.0447998046875 3 0.672636645816458 2.0951574419276238 3114.0 3.4631282495667244 1.0 - - - - - - - 201.625 6 8 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1039 132 C20140707_OR006_05 C20140707_OR006_05 TB437474.[MT7]-NAAVVMAVAQLYWHISPK[MT7].4b6_1.heavy 572.322 / 730.404 1615.0 49.090599060058594 30 5 10 5 10 0.7610879640589133 70.99664647436933 0.0447998046875 3 0.672636645816458 2.0951574419276238 1615.0 15.06786184829663 0.0 - - - - - - - 253.6 3 5 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1041 133 C20140707_OR006_05 C20140707_OR006_05 TB450507.[MT7]-IYDDDFFQNLDGVANALDNVDAR.3y6_1.heavy 915.436 / 689.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1043 133 C20140707_OR006_05 C20140707_OR006_05 TB450507.[MT7]-IYDDDFFQNLDGVANALDNVDAR.3b6_1.heavy 915.436 / 913.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1045 133 C20140707_OR006_05 C20140707_OR006_05 TB450507.[MT7]-IYDDDFFQNLDGVANALDNVDAR.3b5_1.heavy 915.436 / 766.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1047 133 C20140707_OR006_05 C20140707_OR006_05 TB450507.[MT7]-IYDDDFFQNLDGVANALDNVDAR.3y10_1.heavy 915.436 / 1058.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1049 134 C20140707_OR006_05 C20140707_OR006_05 TB437579.[MT7]-HYWTYPGSLTTPPLSESVTWIVLREPIC[CAM]ISER.4y20_2.heavy 983.76 / 1192.64 3676.0 48.63772392272949 40 15 10 5 10 4.53883055759214 22.032106889896816 0.04869842529296875 3 0.9542666203487034 5.7487910037046515 3676.0 19.206067415730335 0.0 - - - - - - - 272.9 7 10 CA7 carbonic anhydrase VII 1051 134 C20140707_OR006_05 C20140707_OR006_05 TB437579.[MT7]-HYWTYPGSLTTPPLSESVTWIVLREPIC[CAM]ISER.4b5_1.heavy 983.76 / 895.422 2134.0 48.63772392272949 40 15 10 5 10 4.53883055759214 22.032106889896816 0.04869842529296875 3 0.9542666203487034 5.7487910037046515 2134.0 19.73814672580668 0.0 - - - - - - - 266.75 4 4 CA7 carbonic anhydrase VII 1053 134 C20140707_OR006_05 C20140707_OR006_05 TB437579.[MT7]-HYWTYPGSLTTPPLSESVTWIVLREPIC[CAM]ISER.4y7_1.heavy 983.76 / 874.445 711.0 48.63772392272949 40 15 10 5 10 4.53883055759214 22.032106889896816 0.04869842529296875 3 0.9542666203487034 5.7487910037046515 711.0 3.75 2.0 - - - - - - - 0.0 1 0 CA7 carbonic anhydrase VII 1055 134 C20140707_OR006_05 C20140707_OR006_05 TB437579.[MT7]-HYWTYPGSLTTPPLSESVTWIVLREPIC[CAM]ISER.4y21_2.heavy 983.76 / 1241.16 8656.0 48.63772392272949 40 15 10 5 10 4.53883055759214 22.032106889896816 0.04869842529296875 3 0.9542666203487034 5.7487910037046515 8656.0 43.82442512031446 0.0 - - - - - - - 237.2 17 5 CA7 carbonic anhydrase VII 1057 135 C20140707_OR006_05 C20140707_OR006_05 TB450275.[MT7]-IYLDMLNVYK[MT7].3y3_1.heavy 520.63 / 553.347 2109.0 44.12777519226074 41 16 10 5 10 2.381836184888178 35.31814971031247 0.04290008544921875 3 0.9622386455065681 6.330855456868663 2109.0 19.540309266915397 0.0 - - - - - - - 246.25 4 4 XPO1 exportin 1 (CRM1 homolog, yeast) 1059 135 C20140707_OR006_05 C20140707_OR006_05 TB450275.[MT7]-IYLDMLNVYK[MT7].3b4_1.heavy 520.63 / 649.368 8997.0 44.12777519226074 41 16 10 5 10 2.381836184888178 35.31814971031247 0.04290008544921875 3 0.9622386455065681 6.330855456868663 8997.0 -4.263981042654027 0.0 - - - - - - - 281.3333333333333 17 3 XPO1 exportin 1 (CRM1 homolog, yeast) 1061 135 C20140707_OR006_05 C20140707_OR006_05 TB450275.[MT7]-IYLDMLNVYK[MT7].3y4_1.heavy 520.63 / 667.39 3374.0 44.12777519226074 41 16 10 5 10 2.381836184888178 35.31814971031247 0.04290008544921875 3 0.9622386455065681 6.330855456868663 3374.0 41.63659574468085 0.0 - - - - - - - 141.0 6 5 XPO1 exportin 1 (CRM1 homolog, yeast) 1063 135 C20140707_OR006_05 C20140707_OR006_05 TB450275.[MT7]-IYLDMLNVYK[MT7].3b3_1.heavy 520.63 / 534.341 1125.0 44.12777519226074 41 16 10 5 10 2.381836184888178 35.31814971031247 0.04290008544921875 3 0.9622386455065681 6.330855456868663 1125.0 3.0928385441058013 3.0 - - - - - - - 422.0 2 1 XPO1 exportin 1 (CRM1 homolog, yeast) 1065 136 C20140707_OR006_05 C20140707_OR006_05 TB411850.[MT7]-QLLDFSQK[MT7].2y4_1.heavy 633.868 / 653.374 10641.0 34.042198181152344 42 12 10 10 10 1.2303259487470952 54.186182722193905 0.0 3 0.8901657233714644 3.689230850303221 10641.0 33.71349233126924 0.0 - - - - - - - 214.88888888888889 21 9 XPO1 exportin 1 (CRM1 homolog, yeast) 1067 136 C20140707_OR006_05 C20140707_OR006_05 TB411850.[MT7]-QLLDFSQK[MT7].2b4_1.heavy 633.868 / 614.363 11608.0 34.042198181152344 42 12 10 10 10 1.2303259487470952 54.186182722193905 0.0 3 0.8901657233714644 3.689230850303221 11608.0 23.644251000682758 0.0 - - - - - - - 310.75 23 4 XPO1 exportin 1 (CRM1 homolog, yeast) 1069 136 C20140707_OR006_05 C20140707_OR006_05 TB411850.[MT7]-QLLDFSQK[MT7].2y3_1.heavy 633.868 / 506.306 3040.0 34.042198181152344 42 12 10 10 10 1.2303259487470952 54.186182722193905 0.0 3 0.8901657233714644 3.689230850303221 3040.0 6.86933016439922 2.0 - - - - - - - 311.0 7 8 XPO1 exportin 1 (CRM1 homolog, yeast) 1071 136 C20140707_OR006_05 C20140707_OR006_05 TB411850.[MT7]-QLLDFSQK[MT7].2y7_1.heavy 633.868 / 994.569 14786.0 34.042198181152344 42 12 10 10 10 1.2303259487470952 54.186182722193905 0.0 3 0.8901657233714644 3.689230850303221 14786.0 82.06526907630523 0.0 - - - - - - - 207.14285714285714 29 14 XPO1 exportin 1 (CRM1 homolog, yeast) 1073 137 C20140707_OR006_05 C20140707_OR006_05 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 283444.0 26.602699279785156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 283444.0 65.2709350079278 0.0 - - - - - - - 1627.0 566 1 1075 137 C20140707_OR006_05 C20140707_OR006_05 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 378332.0 26.602699279785156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 378332.0 100.4638192012512 0.0 - - - - - - - 2441.0 756 1 1077 137 C20140707_OR006_05 C20140707_OR006_05 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 440065.0 26.602699279785156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 440065.0 53.07258881267899 0.0 - - - - - - - 1526.0 880 1 1079 138 C20140707_OR006_05 C20140707_OR006_05 TB437476.[MT7]-MPDVELFVNLGDWPLEK[MT7].4y4_1.heavy 573.306 / 630.394 3230.0 48.97779846191406 30 10 10 10 0 1.0916446589235516 80.54721541237738 0.0 23 0.8223319916200841 2.8834166328084194 3230.0 9.764214318167065 0.0 - - - - - - - 195.72727272727272 6 11 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1081 138 C20140707_OR006_05 C20140707_OR006_05 TB437476.[MT7]-MPDVELFVNLGDWPLEK[MT7].4b5_1.heavy 573.306 / 716.341 2071.0 48.97779846191406 30 10 10 10 0 1.0916446589235516 80.54721541237738 0.0 23 0.8223319916200841 2.8834166328084194 2071.0 24.187267174547774 0.0 - - - - - - - 132.6 4 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1083 138 C20140707_OR006_05 C20140707_OR006_05 TB437476.[MT7]-MPDVELFVNLGDWPLEK[MT7].4y3_1.heavy 573.306 / 533.341 83.0 48.97779846191406 30 10 10 10 0 1.0916446589235516 80.54721541237738 0.0 23 0.8223319916200841 2.8834166328084194 83.0 0.1858620689655172 29.0 - - - - - - - 0.0 1 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1085 138 C20140707_OR006_05 C20140707_OR006_05 TB437476.[MT7]-MPDVELFVNLGDWPLEK[MT7].4b6_1.heavy 573.306 / 829.425 83.0 48.97779846191406 30 10 10 10 0 1.0916446589235516 80.54721541237738 0.0 23 0.8223319916200841 2.8834166328084194 83.0 0.4 14.0 - - - - - - - 0.0 1 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1087 139 C20140707_OR006_05 C20140707_OR006_05 TB436934.[MT7]-GGIVSQVK[MT7].2y4_1.heavy 538.339 / 605.374 4356.0 24.19219970703125 42 16 10 6 10 2.6145049189585263 30.314366922074882 0.0355987548828125 3 0.9654619880149469 6.621490167672076 4356.0 8.47813953488372 0.0 - - - - - - - 208.41666666666666 8 12 UBA1 ubiquitin-like modifier activating enzyme 1 1089 139 C20140707_OR006_05 C20140707_OR006_05 TB436934.[MT7]-GGIVSQVK[MT7].2y5_1.heavy 538.339 / 704.442 4679.0 24.19219970703125 42 16 10 6 10 2.6145049189585263 30.314366922074882 0.0355987548828125 3 0.9654619880149469 6.621490167672076 4679.0 72.07789205183144 0.0 - - - - - - - 228.66666666666666 9 12 UBA1 ubiquitin-like modifier activating enzyme 1 1091 139 C20140707_OR006_05 C20140707_OR006_05 TB436934.[MT7]-GGIVSQVK[MT7].2b6_1.heavy 538.339 / 686.395 2985.0 24.19219970703125 42 16 10 6 10 2.6145049189585263 30.314366922074882 0.0355987548828125 3 0.9654619880149469 6.621490167672076 2985.0 35.22670807453416 0.0 - - - - - - - 211.0 5 13 UBA1 ubiquitin-like modifier activating enzyme 1 1093 139 C20140707_OR006_05 C20140707_OR006_05 TB436934.[MT7]-GGIVSQVK[MT7].2b5_1.heavy 538.339 / 558.337 968.0 24.19219970703125 42 16 10 6 10 2.6145049189585263 30.314366922074882 0.0355987548828125 3 0.9654619880149469 6.621490167672076 968.0 1.0853097345132743 7.0 - - - - - - - 215.08333333333334 2 12 UBA1 ubiquitin-like modifier activating enzyme 1 1095 140 C20140707_OR006_05 C20140707_OR006_05 TB437475.[MT7]-IADRFLLYAMDSYWHSR.4y4_1.heavy 572.791 / 585.289 8442.0 46.85969924926758 46 18 10 10 8 8.43610118790495 11.853817038535825 0.0 4 0.987531519331747 11.040870530272395 8442.0 64.897875 0.0 - - - - - - - 192.0 16 6 LMO4 LIM domain only 4 1097 140 C20140707_OR006_05 C20140707_OR006_05 TB437475.[MT7]-IADRFLLYAMDSYWHSR.4b8_2.heavy 572.791 / 568.833 4349.0 46.85969924926758 46 18 10 10 8 8.43610118790495 11.853817038535825 0.0 4 0.987531519331747 11.040870530272395 4349.0 -0.34084800185284947 2.0 - - - - - - - 256.0 10 3 LMO4 LIM domain only 4 1099 140 C20140707_OR006_05 C20140707_OR006_05 TB437475.[MT7]-IADRFLLYAMDSYWHSR.4b7_1.heavy 572.791 / 973.595 2686.0 46.85969924926758 46 18 10 10 8 8.43610118790495 11.853817038535825 0.0 4 0.987531519331747 11.040870530272395 2686.0 9.792708333333334 0.0 - - - - - - - 288.0 5 4 LMO4 LIM domain only 4 1101 140 C20140707_OR006_05 C20140707_OR006_05 TB437475.[MT7]-IADRFLLYAMDSYWHSR.4b9_2.heavy 572.791 / 604.351 4221.0 46.85969924926758 46 18 10 10 8 8.43610118790495 11.853817038535825 0.0 4 0.987531519331747 11.040870530272395 4221.0 21.984375 1.0 - - - - - - - 256.0 8 3 LMO4 LIM domain only 4 1103 141 C20140707_OR006_05 C20140707_OR006_05 TB437478.[MT7]-DIVMPTYDLTDSVLETMGR.2y8_1.heavy 1150.57 / 892.456 1265.0 48.77783330281576 17 0 10 5 2 0.28790860263500956 146.36073215107402 0.047901153564453125 11 0.31811723913714757 1.3995625288052334 1265.0 5.15 2.0 - - - - - - - 172.5 2 2 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1105 141 C20140707_OR006_05 C20140707_OR006_05 TB437478.[MT7]-DIVMPTYDLTDSVLETMGR.2y11_1.heavy 1150.57 / 1221.61 345.0 48.77783330281576 17 0 10 5 2 0.28790860263500956 146.36073215107402 0.047901153564453125 11 0.31811723913714757 1.3995625288052334 345.0 1.8900000000000001 10.0 - - - - - - - 0.0 1 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1107 141 C20140707_OR006_05 C20140707_OR006_05 TB437478.[MT7]-DIVMPTYDLTDSVLETMGR.2b4_1.heavy 1150.57 / 603.329 10814.0 48.77783330281576 17 0 10 5 2 0.28790860263500956 146.36073215107402 0.047901153564453125 11 0.31811723913714757 1.3995625288052334 10814.0 120.99142028985507 0.0 - - - - - - - 249.16666666666666 21 6 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1109 141 C20140707_OR006_05 C20140707_OR006_05 TB437478.[MT7]-DIVMPTYDLTDSVLETMGR.2y7_1.heavy 1150.57 / 805.424 N/A 48.77783330281576 17 0 10 5 2 0.28790860263500956 146.36073215107402 0.047901153564453125 11 0.31811723913714757 1.3995625288052334 0.0 0.0 14.0 - - - - - - - 0.0 1 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1111 142 C20140707_OR006_05 C20140707_OR006_05 TB437477.[MT7]-MPDVELFVNLGDWPLEK[MT7].3b6_1.heavy 764.073 / 829.425 3098.0 52.415199279785156 43 13 10 10 10 1.000056312245327 57.30556872969413 0.0 3 0.9188125809709647 4.301649210651626 3098.0 42.44061833688699 0.0 - - - - - - - 251.33333333333334 6 3 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1113 142 C20140707_OR006_05 C20140707_OR006_05 TB437477.[MT7]-MPDVELFVNLGDWPLEK[MT7].3b4_1.heavy 764.073 / 587.298 1005.0 52.415199279785156 43 13 10 10 10 1.000056312245327 57.30556872969413 0.0 3 0.9188125809709647 4.301649210651626 1005.0 6.803904382470119 0.0 - - - - - - - 209.375 2 8 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1115 142 C20140707_OR006_05 C20140707_OR006_05 TB437477.[MT7]-MPDVELFVNLGDWPLEK[MT7].3b5_1.heavy 764.073 / 716.341 1842.0 52.415199279785156 43 13 10 10 10 1.000056312245327 57.30556872969413 0.0 3 0.9188125809709647 4.301649210651626 1842.0 11.124733239092107 0.0 - - - - - - - 167.5 3 6 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1117 142 C20140707_OR006_05 C20140707_OR006_05 TB437477.[MT7]-MPDVELFVNLGDWPLEK[MT7].3y4_1.heavy 764.073 / 630.394 3935.0 52.415199279785156 43 13 10 10 10 1.000056312245327 57.30556872969413 0.0 3 0.9188125809709647 4.301649210651626 3935.0 54.84248933901919 0.0 - - - - - - - 184.2 7 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1119 143 C20140707_OR006_05 C20140707_OR006_05 TB450503.[MT7]-LDINLLDNVVNC[CAM]LYHGEGAQQR.3y7_1.heavy 895.789 / 745.359 1871.0 44.031150817871094 30 11 10 5 4 4.831468657199238 20.69764021981034 0.04290008544921875 9 0.8783013043255349 3.501170681700356 1871.0 7.514056224899599 0.0 - - - - - - - 327.25 3 8 XPO1 exportin 1 (CRM1 homolog, yeast) 1121 143 C20140707_OR006_05 C20140707_OR006_05 TB450503.[MT7]-LDINLLDNVVNC[CAM]LYHGEGAQQR.3b4_1.heavy 895.789 / 600.347 624.0 44.031150817871094 30 11 10 5 4 4.831468657199238 20.69764021981034 0.04290008544921875 9 0.8783013043255349 3.501170681700356 624.0 -0.03315508021390373 11.0 - - - - - - - 0.0 1 0 XPO1 exportin 1 (CRM1 homolog, yeast) 1123 143 C20140707_OR006_05 C20140707_OR006_05 TB450503.[MT7]-LDINLLDNVVNC[CAM]LYHGEGAQQR.3b5_1.heavy 895.789 / 713.431 1247.0 44.031150817871094 30 11 10 5 4 4.831468657199238 20.69764021981034 0.04290008544921875 9 0.8783013043255349 3.501170681700356 1247.0 1.1666445189844927 1.0 - - - - - - - 249.44444444444446 2 9 XPO1 exportin 1 (CRM1 homolog, yeast) 1125 143 C20140707_OR006_05 C20140707_OR006_05 TB450503.[MT7]-LDINLLDNVVNC[CAM]LYHGEGAQQR.3y9_1.heavy 895.789 / 1045.48 1123.0 44.031150817871094 30 11 10 5 4 4.831468657199238 20.69764021981034 0.04290008544921875 9 0.8783013043255349 3.501170681700356 1123.0 8.987600801603207 0.0 - - - - - - - 249.42857142857142 2 7 XPO1 exportin 1 (CRM1 homolog, yeast) 1127 144 C20140707_OR006_05 C20140707_OR006_05 TB437074.[MT7]-EDIDTALLK[MT7].2b3_1.heavy 653.379 / 502.263 3713.0 32.92934989929199 28 7 8 5 8 0.8428458530330017 76.39215215092943 0.040897369384765625 4 0.7161959703333646 2.25944273520306 3713.0 9.932387127527614 1.0 - - - - - - - 687.6 7 10 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1129 144 C20140707_OR006_05 C20140707_OR006_05 TB437074.[MT7]-EDIDTALLK[MT7].2b4_1.heavy 653.379 / 617.29 5776.0 32.92934989929199 28 7 8 5 8 0.8428458530330017 76.39215215092943 0.040897369384765625 4 0.7161959703333646 2.25944273520306 5776.0 6.201073593073593 1.0 - - - - - - - 733.5555555555555 11 9 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1131 144 C20140707_OR006_05 C20140707_OR006_05 TB437074.[MT7]-EDIDTALLK[MT7].2y3_1.heavy 653.379 / 517.383 2063.0 32.92934989929199 28 7 8 5 8 0.8428458530330017 76.39215215092943 0.040897369384765625 4 0.7161959703333646 2.25944273520306 2063.0 1.9504727272727271 3.0 - - - - - - - 325.27272727272725 11 11 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1133 144 C20140707_OR006_05 C20140707_OR006_05 TB437074.[MT7]-EDIDTALLK[MT7].2b6_1.heavy 653.379 / 789.375 21591.0 32.92934989929199 28 7 8 5 8 0.8428458530330017 76.39215215092943 0.040897369384765625 4 0.7161959703333646 2.25944273520306 21591.0 13.610924718457472 1.0 - - - - - - - 687.75 54 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1135 145 C20140707_OR006_05 C20140707_OR006_05 TB437277.[MT7]-EIDEVGDLLQLK[MT7].2b3_1.heavy 830.474 / 502.263 5591.0 43.00550079345703 43 13 10 10 10 1.7362118820995638 45.78831678041456 0.0 3 0.911672036066544 4.121577789812487 5591.0 18.891538400716477 1.0 - - - - - - - 166.44444444444446 14 9 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1137 145 C20140707_OR006_05 C20140707_OR006_05 TB437277.[MT7]-EIDEVGDLLQLK[MT7].2y8_2.heavy 830.474 / 515.325 818.0 43.00550079345703 43 13 10 10 10 1.7362118820995638 45.78831678041456 0.0 3 0.911672036066544 4.121577789812487 818.0 1.7008440366972477 10.0 - - - - - - - 242.22222222222223 4 9 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1139 145 C20140707_OR006_05 C20140707_OR006_05 TB437277.[MT7]-EIDEVGDLLQLK[MT7].2b4_1.heavy 830.474 / 631.305 8591.0 43.00550079345703 43 13 10 10 10 1.7362118820995638 45.78831678041456 0.0 3 0.911672036066544 4.121577789812487 8591.0 24.577577685705833 0.0 - - - - - - - 194.57142857142858 17 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1141 145 C20140707_OR006_05 C20140707_OR006_05 TB437277.[MT7]-EIDEVGDLLQLK[MT7].2b7_1.heavy 830.474 / 902.422 4500.0 43.00550079345703 43 13 10 10 10 1.7362118820995638 45.78831678041456 0.0 3 0.911672036066544 4.121577789812487 4500.0 23.966791155055212 0.0 - - - - - - - 221.5 9 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1143 146 C20140707_OR006_05 C20140707_OR006_05 TB437077.[MT7]-VSAPEEQFTR.2y8_1.heavy 654.339 / 977.469 17371.0 26.852399826049805 50 20 10 10 10 16.8606399073045 5.9309729968598175 0.0 3 0.9935120520109767 15.313469696719896 17371.0 199.97542955326463 0.0 - - - - - - - 223.1 34 10 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1145 146 C20140707_OR006_05 C20140707_OR006_05 TB437077.[MT7]-VSAPEEQFTR.2y5_1.heavy 654.339 / 680.336 9510.0 26.852399826049805 50 20 10 10 10 16.8606399073045 5.9309729968598175 0.0 3 0.9935120520109767 15.313469696719896 9510.0 105.74447717231222 0.0 - - - - - - - 234.41666666666666 19 12 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1147 146 C20140707_OR006_05 C20140707_OR006_05 TB437077.[MT7]-VSAPEEQFTR.2y9_1.heavy 654.339 / 1064.5 95007.0 26.852399826049805 50 20 10 10 10 16.8606399073045 5.9309729968598175 0.0 3 0.9935120520109767 15.313469696719896 95007.0 669.9462680412371 0.0 - - - - - - - 237.11111111111111 190 9 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1149 146 C20140707_OR006_05 C20140707_OR006_05 TB437077.[MT7]-VSAPEEQFTR.2y7_1.heavy 654.339 / 906.432 59780.0 26.852399826049805 50 20 10 10 10 16.8606399073045 5.9309729968598175 0.0 3 0.9935120520109767 15.313469696719896 59780.0 637.858762886598 0.0 - - - - - - - 278.875 119 8 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1151 147 C20140707_OR006_05 C20140707_OR006_05 TB437278.[MT7]-SFGASGGYIGGK[MT7]K[MT7].3b4_1.heavy 554.318 / 507.268 2662.0 25.065950393676758 46 20 10 6 10 8.37396762753075 11.941770549868632 0.0373992919921875 3 0.9959163418186456 19.30588767671082 2662.0 7.1499999999999995 0.0 - - - - - - - 260.94117647058823 5 17 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1153 147 C20140707_OR006_05 C20140707_OR006_05 TB437278.[MT7]-SFGASGGYIGGK[MT7]K[MT7].3y4_1.heavy 554.318 / 677.455 8954.0 25.065950393676758 46 20 10 6 10 8.37396762753075 11.941770549868632 0.0373992919921875 3 0.9959163418186456 19.30588767671082 8954.0 84.46341614906832 0.0 - - - - - - - 180.35294117647058 17 17 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1155 147 C20140707_OR006_05 C20140707_OR006_05 TB437278.[MT7]-SFGASGGYIGGK[MT7]K[MT7].3y5_1.heavy 554.318 / 790.539 2501.0 25.065950393676758 46 20 10 6 10 8.37396762753075 11.941770549868632 0.0373992919921875 3 0.9959163418186456 19.30588767671082 2501.0 40.20662909286098 0.0 - - - - - - - 161.4 5 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1157 147 C20140707_OR006_05 C20140707_OR006_05 TB437278.[MT7]-SFGASGGYIGGK[MT7]K[MT7].3b7_1.heavy 554.318 / 708.343 3711.0 25.065950393676758 46 20 10 6 10 8.37396762753075 11.941770549868632 0.0373992919921875 3 0.9959163418186456 19.30588767671082 3711.0 27.651619992910316 0.0 - - - - - - - 173.76923076923077 7 13 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1159 148 C20140707_OR006_05 C20140707_OR006_05 TB437373.[MT7]-QPAENVNQYLTDPK[MT7].3b6_1.heavy 635.67 / 783.412 4083.0 31.036699295043945 36 18 0 10 8 6.347485781041381 15.754269241323737 0.0 4 0.9871956247075871 10.894785268953088 4083.0 34.95228934506354 0.0 - - - - - - - 185.5 8 8 UBA1 ubiquitin-like modifier activating enzyme 1 1161 148 C20140707_OR006_05 C20140707_OR006_05 TB437373.[MT7]-QPAENVNQYLTDPK[MT7].3b4_1.heavy 635.67 / 570.3 4701.0 31.036699295043945 36 18 0 10 8 6.347485781041381 15.754269241323737 0.0 4 0.9871956247075871 10.894785268953088 4701.0 8.148052546177322 1.0 - - - - - - - 232.125 113 8 UBA1 ubiquitin-like modifier activating enzyme 1 1163 148 C20140707_OR006_05 C20140707_OR006_05 TB437373.[MT7]-QPAENVNQYLTDPK[MT7].3b5_1.heavy 635.67 / 684.343 8908.0 31.036699295043945 36 18 0 10 8 6.347485781041381 15.754269241323737 0.0 4 0.9871956247075871 10.894785268953088 8908.0 8.018879675878155 0.0 - - - - - - - 247.57142857142858 17 7 UBA1 ubiquitin-like modifier activating enzyme 1 1165 148 C20140707_OR006_05 C20140707_OR006_05 TB437373.[MT7]-QPAENVNQYLTDPK[MT7].3b7_1.heavy 635.67 / 897.455 3217.0 31.036699295043945 36 18 0 10 8 6.347485781041381 15.754269241323737 0.0 4 0.9871956247075871 10.894785268953088 3217.0 15.100603428541529 0.0 - - - - - - - 288.5 6 6 UBA1 ubiquitin-like modifier activating enzyme 1 1167 149 C20140707_OR006_05 C20140707_OR006_05 TB437076.[MT7]-SNLSDLLEK[MT7].2y4_1.heavy 653.876 / 646.426 8398.0 35.53950119018555 46 16 10 10 10 2.181896267509395 36.49395803024914 0.0 3 0.9626999146178593 6.370128516895548 8398.0 21.81480476190476 0.0 - - - - - - - 280.0 16 11 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1169 149 C20140707_OR006_05 C20140707_OR006_05 TB437076.[MT7]-SNLSDLLEK[MT7].2y3_1.heavy 653.876 / 533.341 3779.0 35.53950119018555 46 16 10 10 10 2.181896267509395 36.49395803024914 0.0 3 0.9626999146178593 6.370128516895548 3779.0 15.02602380952381 2.0 - - - - - - - 280.0 15 9 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1171 149 C20140707_OR006_05 C20140707_OR006_05 TB437076.[MT7]-SNLSDLLEK[MT7].2y6_1.heavy 653.876 / 848.485 4479.0 35.53950119018555 46 16 10 10 10 2.181896267509395 36.49395803024914 0.0 3 0.9626999146178593 6.370128516895548 4479.0 25.434292858418598 1.0 - - - - - - - 160.0 11 7 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1173 149 C20140707_OR006_05 C20140707_OR006_05 TB437076.[MT7]-SNLSDLLEK[MT7].2b5_1.heavy 653.876 / 661.327 9238.0 35.53950119018555 46 16 10 10 10 2.181896267509395 36.49395803024914 0.0 3 0.9626999146178593 6.370128516895548 9238.0 62.02657142857142 0.0 - - - - - - - 280.0 18 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1175 150 C20140707_OR006_05 C20140707_OR006_05 TB411855.[MT7]-DEFEGLFK[MT7].2b3_1.heavy 636.839 / 536.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1177 150 C20140707_OR006_05 C20140707_OR006_05 TB411855.[MT7]-DEFEGLFK[MT7].2y4_1.heavy 636.839 / 608.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1179 150 C20140707_OR006_05 C20140707_OR006_05 TB411855.[MT7]-DEFEGLFK[MT7].2y5_1.heavy 636.839 / 737.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1181 150 C20140707_OR006_05 C20140707_OR006_05 TB411855.[MT7]-DEFEGLFK[MT7].2b4_1.heavy 636.839 / 665.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1183 151 C20140707_OR006_05 C20140707_OR006_05 TB411856.[MT7]-AIHHAATHK[MT7].2y4_1.heavy 637.372 / 600.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIN1 Ras and Rab interactor 1 1185 151 C20140707_OR006_05 C20140707_OR006_05 TB411856.[MT7]-AIHHAATHK[MT7].2y5_1.heavy 637.372 / 671.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIN1 Ras and Rab interactor 1 1187 151 C20140707_OR006_05 C20140707_OR006_05 TB411856.[MT7]-AIHHAATHK[MT7].2y3_1.heavy 637.372 / 529.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIN1 Ras and Rab interactor 1 1189 151 C20140707_OR006_05 C20140707_OR006_05 TB411856.[MT7]-AIHHAATHK[MT7].2y6_1.heavy 637.372 / 808.455 N/A N/A - - - - - - - - - 0.0 - - - - - - - RIN1 Ras and Rab interactor 1 1191 152 C20140707_OR006_05 C20140707_OR006_05 TB450277.[MT7]-LLTQYILNLGK[MT7].3b4_1.heavy 521.995 / 600.384 4401.0 46.43960189819336 38 8 10 10 10 0.7043434489072824 74.81289552147146 0.0 3 0.7517021142372801 2.4235395195226546 4401.0 63.93031578947369 0.0 - - - - - - - 133.0 8 3 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1193 152 C20140707_OR006_05 C20140707_OR006_05 TB450277.[MT7]-LLTQYILNLGK[MT7].3b5_1.heavy 521.995 / 763.447 5201.0 46.43960189819336 38 8 10 10 10 0.7043434489072824 74.81289552147146 0.0 3 0.7517021142372801 2.4235395195226546 5201.0 38.875923805490324 1.0 - - - - - - - 222.33333333333334 10 3 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1195 152 C20140707_OR006_05 C20140707_OR006_05 TB450277.[MT7]-LLTQYILNLGK[MT7].3y4_1.heavy 521.995 / 575.363 11869.0 46.43960189819336 38 8 10 10 10 0.7043434489072824 74.81289552147146 0.0 3 0.7517021142372801 2.4235395195226546 11869.0 119.44871223001323 0.0 - - - - - - - 266.7142857142857 23 7 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1197 152 C20140707_OR006_05 C20140707_OR006_05 TB450277.[MT7]-LLTQYILNLGK[MT7].3y5_1.heavy 521.995 / 688.447 6935.0 46.43960189819336 38 8 10 10 10 0.7043434489072824 74.81289552147146 0.0 3 0.7517021142372801 2.4235395195226546 6935.0 28.18108161350844 0.0 - - - - - - - 222.16666666666666 13 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1199 153 C20140707_OR006_05 C20140707_OR006_05 TB437276.[MT7]-EIDEVGDLLQLK[MT7].3b4_1.heavy 553.985 / 631.305 30772.0 43.02720069885254 39 14 10 5 10 1.3581621682887828 49.08593997332689 0.043399810791015625 3 0.946166433638801 5.295024487903993 30772.0 152.4362932970545 0.0 - - - - - - - 181.33333333333334 61 3 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1201 153 C20140707_OR006_05 C20140707_OR006_05 TB437276.[MT7]-EIDEVGDLLQLK[MT7].3b3_1.heavy 553.985 / 502.263 20424.0 43.02720069885254 39 14 10 5 10 1.3581621682887828 49.08593997332689 0.043399810791015625 3 0.946166433638801 5.295024487903993 20424.0 62.89472316926771 0.0 - - - - - - - 233.14285714285714 40 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1203 153 C20140707_OR006_05 C20140707_OR006_05 TB437276.[MT7]-EIDEVGDLLQLK[MT7].3y8_2.heavy 553.985 / 515.325 34448.0 43.02720069885254 39 14 10 5 10 1.3581621682887828 49.08593997332689 0.043399810791015625 3 0.946166433638801 5.295024487903993 34448.0 72.91467524948305 0.0 - - - - - - - 272.0 68 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1205 153 C20140707_OR006_05 C20140707_OR006_05 TB437276.[MT7]-EIDEVGDLLQLK[MT7].3b7_1.heavy 553.985 / 902.422 23964.0 43.02720069885254 39 14 10 5 10 1.3581621682887828 49.08593997332689 0.043399810791015625 3 0.946166433638801 5.295024487903993 23964.0 280.1673529411765 0.0 - - - - - - - 204.0 47 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1207 154 C20140707_OR006_05 C20140707_OR006_05 TB412439.[MT7]-LLQLQEVFQLFDNANC[CAM]PSLQNK[MT7]PK[MT7].4b7_1.heavy 819.95 / 968.59 2782.0 51.42450141906738 43 18 10 5 10 12.694913934251401 7.8771703784612415 0.047000885009765625 3 0.9888488554872807 11.676111853611909 2782.0 12.978063177490352 0.0 - - - - - - - 231.8 5 10 CASP2 caspase 2, apoptosis-related cysteine peptidase 1209 154 C20140707_OR006_05 C20140707_OR006_05 TB412439.[MT7]-LLQLQEVFQLFDNANC[CAM]PSLQNK[MT7]PK[MT7].4b4_1.heavy 819.95 / 612.42 3153.0 51.42450141906738 43 18 10 5 10 12.694913934251401 7.8771703784612415 0.047000885009765625 3 0.9888488554872807 11.676111853611909 3153.0 19.216736799239854 0.0 - - - - - - - 222.4 6 10 CASP2 caspase 2, apoptosis-related cysteine peptidase 1211 154 C20140707_OR006_05 C20140707_OR006_05 TB412439.[MT7]-LLQLQEVFQLFDNANC[CAM]PSLQNK[MT7]PK[MT7].4b5_1.heavy 819.95 / 740.479 1669.0 51.42450141906738 43 18 10 5 10 12.694913934251401 7.8771703784612415 0.047000885009765625 3 0.9888488554872807 11.676111853611909 1669.0 25.702599999999997 0.0 - - - - - - - 216.33333333333334 3 6 CASP2 caspase 2, apoptosis-related cysteine peptidase 1213 154 C20140707_OR006_05 C20140707_OR006_05 TB412439.[MT7]-LLQLQEVFQLFDNANC[CAM]PSLQNK[MT7]PK[MT7].4b6_1.heavy 819.95 / 869.521 4822.0 51.42450141906738 43 18 10 5 10 12.694913934251401 7.8771703784612415 0.047000885009765625 3 0.9888488554872807 11.676111853611909 4822.0 36.32781758577985 0.0 - - - - - - - 238.28571428571428 9 7 CASP2 caspase 2, apoptosis-related cysteine peptidase 1215 155 C20140707_OR006_05 C20140707_OR006_05 TB411858.[MT7]-SEIWGPGLK[MT7].3y3_1.heavy 425.583 / 461.32 23096.0 33.80924987792969 45 20 10 5 10 11.725557790311766 8.528378929881265 0.04070281982421875 3 0.9923541405078994 14.104968214535083 23096.0 162.84779636363635 0.0 - - - - - - - 274.625 46 8 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1217 155 C20140707_OR006_05 C20140707_OR006_05 TB411858.[MT7]-SEIWGPGLK[MT7].3b5_1.heavy 425.583 / 717.369 5774.0 33.80924987792969 45 20 10 5 10 11.725557790311766 8.528378929881265 0.04070281982421875 3 0.9923541405078994 14.104968214535083 5774.0 84.24982481751825 0.0 - - - - - - - 137.0 11 2 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1219 155 C20140707_OR006_05 C20140707_OR006_05 TB411858.[MT7]-SEIWGPGLK[MT7].3y4_1.heavy 425.583 / 558.373 8936.0 33.80924987792969 45 20 10 5 10 11.725557790311766 8.528378929881265 0.04070281982421875 3 0.9923541405078994 14.104968214535083 8936.0 27.929656731815548 0.0 - - - - - - - 215.57142857142858 17 7 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1221 155 C20140707_OR006_05 C20140707_OR006_05 TB411858.[MT7]-SEIWGPGLK[MT7].3b3_1.heavy 425.583 / 474.268 14710.0 33.80924987792969 45 20 10 5 10 11.725557790311766 8.528378929881265 0.04070281982421875 3 0.9923541405078994 14.104968214535083 14710.0 37.978545454545454 1.0 - - - - - - - 648.0 29 7 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1223 156 C20140707_OR006_05 C20140707_OR006_05 TB437463.[MT7]-ELISLYPFLLPTSSSFTR.3b6_1.heavy 739.076 / 863.5 5740.0 52.20989990234375 50 20 10 10 10 5.625943959720115 17.77479489948117 0.0 3 0.9928083793867444 14.544150778385482 5740.0 38.905223171889844 0.0 - - - - - - - 250.8 11 10 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1225 156 C20140707_OR006_05 C20140707_OR006_05 TB437463.[MT7]-ELISLYPFLLPTSSSFTR.3b5_1.heavy 739.076 / 700.436 3072.0 52.20989990234375 50 20 10 10 10 5.625943959720115 17.77479489948117 0.0 3 0.9928083793867444 14.544150778385482 3072.0 16.496968641755817 0.0 - - - - - - - 292.2307692307692 6 13 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1227 156 C20140707_OR006_05 C20140707_OR006_05 TB437463.[MT7]-ELISLYPFLLPTSSSFTR.3b3_1.heavy 739.076 / 500.32 4689.0 52.20989990234375 50 20 10 10 10 5.625943959720115 17.77479489948117 0.0 3 0.9928083793867444 14.544150778385482 4689.0 33.57555555555556 0.0 - - - - - - - 209.47058823529412 9 17 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1229 156 C20140707_OR006_05 C20140707_OR006_05 TB437463.[MT7]-ELISLYPFLLPTSSSFTR.3y8_1.heavy 739.076 / 882.432 11237.0 52.20989990234375 50 20 10 10 10 5.625943959720115 17.77479489948117 0.0 3 0.9928083793867444 14.544150778385482 11237.0 31.19867099104514 0.0 - - - - - - - 278.6666666666667 22 9 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1231 157 C20140707_OR006_05 C20140707_OR006_05 TB412444.[MT7]-ARSPQELDQGTGAALC[CAM]FFNPLFPGDLGPTK[MT7].4y4_1.heavy 873.951 / 546.337 7785.0 46.55407524108887 38 15 10 5 8 4.912348243759832 20.356862957961145 0.04129791259765625 4 0.9560631094800881 5.8660345375495915 7785.0 29.94063808480636 1.0 - - - - - - - 215.57142857142858 18 7 RIN1 Ras and Rab interactor 1 1233 157 C20140707_OR006_05 C20140707_OR006_05 TB412444.[MT7]-ARSPQELDQGTGAALC[CAM]FFNPLFPGDLGPTK[MT7].4b8_1.heavy 873.951 / 1041.54 4897.0 46.55407524108887 38 15 10 5 8 4.912348243759832 20.356862957961145 0.04129791259765625 4 0.9560631094800881 5.8660345375495915 4897.0 13.067790727636716 0.0 - - - - - - - 251.33333333333334 9 6 RIN1 Ras and Rab interactor 1 1235 157 C20140707_OR006_05 C20140707_OR006_05 TB412444.[MT7]-ARSPQELDQGTGAALC[CAM]FFNPLFPGDLGPTK[MT7].4y8_1.heavy 873.951 / 928.522 13938.0 46.55407524108887 38 15 10 5 8 4.912348243759832 20.356862957961145 0.04129791259765625 4 0.9560631094800881 5.8660345375495915 13938.0 110.4442435806705 1.0 - - - - - - - 157.25 31 4 RIN1 Ras and Rab interactor 1 1237 157 C20140707_OR006_05 C20140707_OR006_05 TB412444.[MT7]-ARSPQELDQGTGAALC[CAM]FFNPLFPGDLGPTK[MT7].4b14_2.heavy 873.951 / 763.888 5902.0 46.55407524108887 38 15 10 5 8 4.912348243759832 20.356862957961145 0.04129791259765625 4 0.9560631094800881 5.8660345375495915 5902.0 21.926804964051836 0.0 - - - - - - - 293.3333333333333 11 3 RIN1 Ras and Rab interactor 1 1239 158 C20140707_OR006_05 C20140707_OR006_05 TB450280.[MT7]-RFLMSYLNEVR.2b8_1.heavy 786.428 / 1169.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1241 158 C20140707_OR006_05 C20140707_OR006_05 TB450280.[MT7]-RFLMSYLNEVR.2y8_1.heavy 786.428 / 1011.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1243 158 C20140707_OR006_05 C20140707_OR006_05 TB450280.[MT7]-RFLMSYLNEVR.2y9_1.heavy 786.428 / 1124.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1245 158 C20140707_OR006_05 C20140707_OR006_05 TB450280.[MT7]-RFLMSYLNEVR.2b6_1.heavy 786.428 / 942.499 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1247 159 C20140707_OR006_05 C20140707_OR006_05 TB437460.[MT7]-SLVASLAEPDFVVTDFAK[MT7].2b3_1.heavy 1099.1 / 444.294 4255.0 47.22710037231445 48 18 10 10 10 4.669104222545319 21.417384413296716 0.0 3 0.9873953127324472 10.980929305580384 4255.0 40.47648776105996 0.0 - - - - - - - 278.0 8 7 UBA1 ubiquitin-like modifier activating enzyme 1 1249 159 C20140707_OR006_05 C20140707_OR006_05 TB437460.[MT7]-SLVASLAEPDFVVTDFAK[MT7].2b4_1.heavy 1099.1 / 515.331 2431.0 47.22710037231445 48 18 10 10 10 4.669104222545319 21.417384413296716 0.0 3 0.9873953127324472 10.980929305580384 2431.0 8.003292181069959 0.0 - - - - - - - 213.0 4 4 UBA1 ubiquitin-like modifier activating enzyme 1 1251 159 C20140707_OR006_05 C20140707_OR006_05 TB437460.[MT7]-SLVASLAEPDFVVTDFAK[MT7].2y3_1.heavy 1099.1 / 509.32 2431.0 47.22710037231445 48 18 10 10 10 4.669104222545319 21.417384413296716 0.0 3 0.9873953127324472 10.980929305580384 2431.0 39.69304918032786 0.0 - - - - - - - 283.6666666666667 4 3 UBA1 ubiquitin-like modifier activating enzyme 1 1253 159 C20140707_OR006_05 C20140707_OR006_05 TB437460.[MT7]-SLVASLAEPDFVVTDFAK[MT7].2b5_1.heavy 1099.1 / 602.363 2067.0 47.22710037231445 48 18 10 10 10 4.669104222545319 21.417384413296716 0.0 3 0.9873953127324472 10.980929305580384 2067.0 4.38873858056278 1.0 - - - - - - - 279.7 5 10 UBA1 ubiquitin-like modifier activating enzyme 1 1255 160 C20140707_OR006_05 C20140707_OR006_05 TB450283.[MT7]-QLYVLGHEAMK[MT7].3b6_1.heavy 526.297 / 818.489 6605.0 31.99389934539795 42 17 10 5 10 2.3470251476844073 30.553131476630497 0.04599952697753906 3 0.9735767207064513 7.575443356234898 6605.0 45.09747222222222 0.0 - - - - - - - 173.33333333333334 13 9 UBA1 ubiquitin-like modifier activating enzyme 1 1257 160 C20140707_OR006_05 C20140707_OR006_05 TB450283.[MT7]-QLYVLGHEAMK[MT7].3b4_1.heavy 526.297 / 648.384 16212.0 31.99389934539795 42 17 10 5 10 2.3470251476844073 30.553131476630497 0.04599952697753906 3 0.9735767207064513 7.575443356234898 16212.0 53.6732063106796 0.0 - - - - - - - 300.0 32 8 UBA1 ubiquitin-like modifier activating enzyme 1 1259 160 C20140707_OR006_05 C20140707_OR006_05 TB450283.[MT7]-QLYVLGHEAMK[MT7].3y4_1.heavy 526.297 / 622.335 21736.0 31.99389934539795 42 17 10 5 10 2.3470251476844073 30.553131476630497 0.04599952697753906 3 0.9735767207064513 7.575443356234898 21736.0 208.3033333333333 0.0 - - - - - - - 200.0 43 9 UBA1 ubiquitin-like modifier activating enzyme 1 1261 160 C20140707_OR006_05 C20140707_OR006_05 TB450283.[MT7]-QLYVLGHEAMK[MT7].3b3_1.heavy 526.297 / 549.315 18614.0 31.99389934539795 42 17 10 5 10 2.3470251476844073 30.553131476630497 0.04599952697753906 3 0.9735767207064513 7.575443356234898 18614.0 47.80575104094379 0.0 - - - - - - - 240.0 37 6 UBA1 ubiquitin-like modifier activating enzyme 1 1263 161 C20140707_OR006_05 C20140707_OR006_05 TB412340.[MT7]-AAVATFLQSVQVPEFTPK[MT7].4b7_1.heavy 556.067 / 818.489 N/A 46.37709999084473 34 9 10 5 10 1.1258713472769672 35.5280379918576 0.042598724365234375 2 0.8138312612136134 2.8146784492531443 381.0 2.1 2.0 - - - - - - - 0.0 1 0 UBA1 ubiquitin-like modifier activating enzyme 1 1265 161 C20140707_OR006_05 C20140707_OR006_05 TB412340.[MT7]-AAVATFLQSVQVPEFTPK[MT7].4y6_1.heavy 556.067 / 862.479 2540.0 46.37709999084473 34 9 10 5 10 1.1258713472769672 35.5280379918576 0.042598724365234375 2 0.8138312612136134 2.8146784492531443 2540.0 10.333333333333334 0.0 - - - - - - - 381.0 5 2 UBA1 ubiquitin-like modifier activating enzyme 1 1267 161 C20140707_OR006_05 C20140707_OR006_05 TB412340.[MT7]-AAVATFLQSVQVPEFTPK[MT7].4b6_1.heavy 556.067 / 705.405 N/A 46.37709999084473 34 9 10 5 10 1.1258713472769672 35.5280379918576 0.042598724365234375 2 0.8138312612136134 2.8146784492531443 254.0 1.0666666666666667 6.0 - - - - - - - 0.0 1 0 UBA1 ubiquitin-like modifier activating enzyme 1 1269 161 C20140707_OR006_05 C20140707_OR006_05 TB412340.[MT7]-AAVATFLQSVQVPEFTPK[MT7].4b3_1.heavy 556.067 / 386.252 2413.0 46.37709999084473 34 9 10 5 10 1.1258713472769672 35.5280379918576 0.042598724365234375 2 0.8138312612136134 2.8146784492531443 2413.0 10.526863636363638 0.0 - - - - - - - 254.0 4 5 UBA1 ubiquitin-like modifier activating enzyme 1 1271 162 C20140707_OR006_05 C20140707_OR006_05 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 276150.0 37.71120071411133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 276150.0 186.02287452098673 0.0 - - - - - - - 258.2 552 5 1273 162 C20140707_OR006_05 C20140707_OR006_05 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 604524.0 37.71120071411133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 604524.0 186.21315896536336 0.0 - - - - - - - 286.57142857142856 1209 7 1275 162 C20140707_OR006_05 C20140707_OR006_05 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 627285.0 37.71120071411133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 627285.0 198.3616089965762 0.0 - - - - - - - 701.1111111111111 1254 9 1277 163 C20140707_OR006_05 C20140707_OR006_05 TB450000.[MT7]-IAVEIPK[MT7].2y4_1.heavy 529.347 / 630.394 5885.0 32.440667470296226 39 20 4 5 10 9.620830477805102 10.394113089373757 0.0446014404296875 3 0.9969694134398384 22.41244731752438 5885.0 15.428156198694005 0.0 - - - - - - - 275.4 11 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1279 163 C20140707_OR006_05 C20140707_OR006_05 TB450000.[MT7]-IAVEIPK[MT7].2b4_1.heavy 529.347 / 557.341 19657.0 32.440667470296226 39 20 4 5 10 9.620830477805102 10.394113089373757 0.0446014404296875 3 0.9969694134398384 22.41244731752438 19657.0 72.58572854291418 0.0 - - - - - - - 208.5 39 6 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1281 163 C20140707_OR006_05 C20140707_OR006_05 TB450000.[MT7]-IAVEIPK[MT7].2y3_1.heavy 529.347 / 501.352 N/A 32.440667470296226 39 20 4 5 10 9.620830477805102 10.394113089373757 0.0446014404296875 3 0.9969694134398384 22.41244731752438 16527.0 16.110941073117168 1.0 - - - - - - - 792.6666666666666 73 3 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1283 163 C20140707_OR006_05 C20140707_OR006_05 TB450000.[MT7]-IAVEIPK[MT7].2y6_1.heavy 529.347 / 800.5 10893.0 32.440667470296226 39 20 4 5 10 9.620830477805102 10.394113089373757 0.0446014404296875 3 0.9969694134398384 22.41244731752438 10893.0 103.87703952095808 0.0 - - - - - - - 200.2 21 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1285 164 C20140707_OR006_05 C20140707_OR006_05 TB412344.[MT7]-IFLAQK[MT7]PAPLLESPFK[MT7].3y3_1.heavy 744.456 / 535.336 6458.0 41.54880142211914 45 20 9 10 6 34.29514990078549 2.91586420497639 0.0 5 0.9953487454298179 18.088761666703757 6458.0 22.545159402047766 0.0 - - - - - - - 260.7142857142857 12 7 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1287 164 C20140707_OR006_05 C20140707_OR006_05 TB412344.[MT7]-IFLAQK[MT7]PAPLLESPFK[MT7].3b3_1.heavy 744.456 / 518.346 3089.0 41.54880142211914 45 20 9 10 6 34.29514990078549 2.91586420497639 0.0 5 0.9953487454298179 18.088761666703757 3089.0 15.115213523131672 2.0 - - - - - - - 280.7142857142857 15 7 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1289 164 C20140707_OR006_05 C20140707_OR006_05 TB412344.[MT7]-IFLAQK[MT7]PAPLLESPFK[MT7].3y4_1.heavy 744.456 / 622.368 4071.0 41.54880142211914 45 20 9 10 6 34.29514990078549 2.91586420497639 0.0 5 0.9953487454298179 18.088761666703757 4071.0 15.939740154352034 0.0 - - - - - - - 315.875 8 8 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1291 164 C20140707_OR006_05 C20140707_OR006_05 TB412344.[MT7]-IFLAQK[MT7]PAPLLESPFK[MT7].3y8_1.heavy 744.456 / 1074.63 2246.0 41.54880142211914 45 20 9 10 6 34.29514990078549 2.91586420497639 0.0 5 0.9953487454298179 18.088761666703757 2246.0 10.403087885985748 0.0 - - - - - - - 257.1666666666667 4 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1293 165 C20140707_OR006_05 C20140707_OR006_05 TB412345.[MT7]-HPELIDAAFTNFFFFK[MT7].4b8_1.heavy 558.799 / 991.533 1669.0 51.599398612976074 39 14 10 5 10 2.808260264854637 35.60923510242248 0.046001434326171875 3 0.9372332595930235 4.900037191298888 1669.0 -0.3589247311827961 0.0 - - - - - - - 123.66666666666667 3 3 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1295 165 C20140707_OR006_05 C20140707_OR006_05 TB412345.[MT7]-HPELIDAAFTNFFFFK[MT7].4y3_1.heavy 558.799 / 585.352 4451.0 51.599398612976074 39 14 10 5 10 2.808260264854637 35.60923510242248 0.046001434326171875 3 0.9372332595930235 4.900037191298888 4451.0 44.7505945945946 0.0 - - - - - - - 148.2 8 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1297 165 C20140707_OR006_05 C20140707_OR006_05 TB412345.[MT7]-HPELIDAAFTNFFFFK[MT7].4b6_1.heavy 558.799 / 849.459 927.0 51.599398612976074 39 14 10 5 10 2.808260264854637 35.60923510242248 0.046001434326171875 3 0.9372332595930235 4.900037191298888 927.0 12.267039387879315 0.0 - - - - - - - 0.0 1 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1299 165 C20140707_OR006_05 C20140707_OR006_05 TB412345.[MT7]-HPELIDAAFTNFFFFK[MT7].4b3_1.heavy 558.799 / 508.264 1855.0 51.599398612976074 39 14 10 5 10 2.808260264854637 35.60923510242248 0.046001434326171875 3 0.9372332595930235 4.900037191298888 1855.0 10.676258992805755 0.0 - - - - - - - 200.83333333333334 3 6 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1301 166 C20140707_OR006_05 C20140707_OR006_05 TB436947.[MT7]-NIILGGVK[MT7].2y4_1.heavy 551.365 / 504.326 44467.0 32.062801361083984 48 18 10 10 10 4.106857438685086 24.349518212645215 0.0 3 0.9865904549343967 10.645568101394634 44467.0 91.82882002964648 0.0 - - - - - - - 199.5 88 4 UBA1 ubiquitin-like modifier activating enzyme 1 1303 166 C20140707_OR006_05 C20140707_OR006_05 TB436947.[MT7]-NIILGGVK[MT7].2y5_1.heavy 551.365 / 617.41 30621.0 32.062801361083984 48 18 10 10 10 4.106857438685086 24.349518212645215 0.0 3 0.9865904549343967 10.645568101394634 30621.0 61.20124459622943 0.0 - - - - - - - 332.5 61 10 UBA1 ubiquitin-like modifier activating enzyme 1 1305 166 C20140707_OR006_05 C20140707_OR006_05 TB436947.[MT7]-NIILGGVK[MT7].2y6_1.heavy 551.365 / 730.494 10651.0 32.062801361083984 48 18 10 10 10 4.106857438685086 24.349518212645215 0.0 3 0.9865904549343967 10.645568101394634 10651.0 23.615713445454887 0.0 - - - - - - - 232.75 21 8 UBA1 ubiquitin-like modifier activating enzyme 1 1307 166 C20140707_OR006_05 C20140707_OR006_05 TB436947.[MT7]-NIILGGVK[MT7].2y7_1.heavy 551.365 / 843.578 6124.0 32.062801361083984 48 18 10 10 10 4.106857438685086 24.349518212645215 0.0 3 0.9865904549343967 10.645568101394634 6124.0 18.4122822701309 1.0 - - - - - - - 249.375 12 8 UBA1 ubiquitin-like modifier activating enzyme 1 1309 167 C20140707_OR006_05 C20140707_OR006_05 TB437464.[MT7]-ALPAVQQNNLDEDLIRK[MT7].4y4_1.heavy 557.068 / 673.484 3143.0 33.850650787353516 36 13 10 5 8 2.0100128538695 49.75092562591766 0.0420989990234375 4 0.9230170216881194 4.419149872321283 3143.0 10.347780997527842 1.0 - - - - - - - 722.4285714285714 14 7 UBA1 ubiquitin-like modifier activating enzyme 1 1311 167 C20140707_OR006_05 C20140707_OR006_05 TB437464.[MT7]-ALPAVQQNNLDEDLIRK[MT7].4b5_1.heavy 557.068 / 596.389 15307.0 33.850650787353516 36 13 10 5 8 2.0100128538695 49.75092562591766 0.0420989990234375 4 0.9230170216881194 4.419149872321283 15307.0 29.648851849020062 0.0 - - - - - - - 765.5 30 10 UBA1 ubiquitin-like modifier activating enzyme 1 1313 167 C20140707_OR006_05 C20140707_OR006_05 TB437464.[MT7]-ALPAVQQNNLDEDLIRK[MT7].4y7_1.heavy 557.068 / 1032.58 9020.0 33.850650787353516 36 13 10 5 8 2.0100128538695 49.75092562591766 0.0420989990234375 4 0.9230170216881194 4.419149872321283 9020.0 79.49547445255476 0.0 - - - - - - - 273.375 18 8 UBA1 ubiquitin-like modifier activating enzyme 1 1315 167 C20140707_OR006_05 C20140707_OR006_05 TB437464.[MT7]-ALPAVQQNNLDEDLIRK[MT7].4y6_1.heavy 557.068 / 917.554 2870.0 33.850650787353516 36 13 10 5 8 2.0100128538695 49.75092562591766 0.0420989990234375 4 0.9230170216881194 4.419149872321283 2870.0 1.37548032936871 1.0 - - - - - - - 666.375 5 8 UBA1 ubiquitin-like modifier activating enzyme 1 1317 168 C20140707_OR006_05 C20140707_OR006_05 TB450381.[MT7]-YFLVGAGAIGC[CAM]ELLK[MT7].3y6_1.heavy 633.693 / 863.478 16520.0 46.60580062866211 43 13 10 10 10 1.1591488406293464 54.024168543299055 0.0 3 0.9229825929552375 4.418148980282704 16520.0 186.31578947368422 0.0 - - - - - - - 199.5 33 2 UBA1 ubiquitin-like modifier activating enzyme 1 1319 168 C20140707_OR006_05 C20140707_OR006_05 TB450381.[MT7]-YFLVGAGAIGC[CAM]ELLK[MT7].3b5_1.heavy 633.693 / 724.415 9592.0 46.60580062866211 43 13 10 10 10 1.1591488406293464 54.024168543299055 0.0 3 0.9229825929552375 4.418148980282704 9592.0 95.19879699248119 0.0 - - - - - - - 182.875 19 8 UBA1 ubiquitin-like modifier activating enzyme 1 1321 168 C20140707_OR006_05 C20140707_OR006_05 TB450381.[MT7]-YFLVGAGAIGC[CAM]ELLK[MT7].3b3_1.heavy 633.693 / 568.325 12657.0 46.60580062866211 43 13 10 10 10 1.1591488406293464 54.024168543299055 0.0 3 0.9229825929552375 4.418148980282704 12657.0 12.569267996777139 1.0 - - - - - - - 279.6 27 10 UBA1 ubiquitin-like modifier activating enzyme 1 1323 168 C20140707_OR006_05 C20140707_OR006_05 TB450381.[MT7]-YFLVGAGAIGC[CAM]ELLK[MT7].3b7_1.heavy 633.693 / 852.474 11857.0 46.60580062866211 43 13 10 10 10 1.1591488406293464 54.024168543299055 0.0 3 0.9229825929552375 4.418148980282704 11857.0 53.45677326524567 0.0 - - - - - - - 199.5 23 4 UBA1 ubiquitin-like modifier activating enzyme 1 1325 169 C20140707_OR006_05 C20140707_OR006_05 TB437063.[MT7]-VDTILEFSQNMNTK[MT7].3y3_1.heavy 643.339 / 506.306 16850.0 40.15140151977539 50 20 10 10 10 16.476962676525645 6.06907971834322 0.0 3 0.9952285531341353 17.85930228260702 16850.0 19.26075023941899 0.0 - - - - - - - 306.14285714285717 33 7 XPO1 exportin 1 (CRM1 homolog, yeast) 1327 169 C20140707_OR006_05 C20140707_OR006_05 TB437063.[MT7]-VDTILEFSQNMNTK[MT7].3b6_1.heavy 643.339 / 815.463 17849.0 40.15140151977539 50 20 10 10 10 16.476962676525645 6.06907971834322 0.0 3 0.9952285531341353 17.85930228260702 17849.0 139.82433409727525 0.0 - - - - - - - 265.2857142857143 35 7 XPO1 exportin 1 (CRM1 homolog, yeast) 1329 169 C20140707_OR006_05 C20140707_OR006_05 TB437063.[MT7]-VDTILEFSQNMNTK[MT7].3b4_1.heavy 643.339 / 573.336 20991.0 40.15140151977539 50 20 10 10 10 16.476962676525645 6.06907971834322 0.0 3 0.9952285531341353 17.85930228260702 20991.0 86.8352165034965 0.0 - - - - - - - 196.5 41 8 XPO1 exportin 1 (CRM1 homolog, yeast) 1331 169 C20140707_OR006_05 C20140707_OR006_05 TB437063.[MT7]-VDTILEFSQNMNTK[MT7].3b5_1.heavy 643.339 / 686.42 13851.0 40.15140151977539 50 20 10 10 10 16.476962676525645 6.06907971834322 0.0 3 0.9952285531341353 17.85930228260702 13851.0 90.41786684727177 0.0 - - - - - - - 333.1666666666667 27 6 XPO1 exportin 1 (CRM1 homolog, yeast) 1333 170 C20140707_OR006_05 C20140707_OR006_05 TB412206.[MT7]-GLALVLSNVHFTGEK[MT7].4y4_1.heavy 469.025 / 578.327 6899.0 41.56027603149414 35 10 10 5 10 0.9217520846049609 62.906226991791264 0.0458984375 3 0.8457215887226741 3.1007108482731174 6899.0 32.69668246445497 0.0 - - - - - - - 281.5 13 2 CASP2 caspase 2, apoptosis-related cysteine peptidase 1335 170 C20140707_OR006_05 C20140707_OR006_05 TB412206.[MT7]-GLALVLSNVHFTGEK[MT7].4y5_1.heavy 469.025 / 725.395 2112.0 41.56027603149414 35 10 10 5 10 0.9217520846049609 62.906226991791264 0.0458984375 3 0.8457215887226741 3.1007108482731174 2112.0 20.97021276595745 0.0 - - - - - - - 234.66666666666666 4 3 CASP2 caspase 2, apoptosis-related cysteine peptidase 1337 170 C20140707_OR006_05 C20140707_OR006_05 TB412206.[MT7]-GLALVLSNVHFTGEK[MT7].4b4_1.heavy 469.025 / 499.336 3097.0 41.56027603149414 35 10 10 5 10 0.9217520846049609 62.906226991791264 0.0458984375 3 0.8457215887226741 3.1007108482731174 3097.0 32.178049645390075 0.0 - - - - - - - 281.8333333333333 6 6 CASP2 caspase 2, apoptosis-related cysteine peptidase 1339 170 C20140707_OR006_05 C20140707_OR006_05 TB412206.[MT7]-GLALVLSNVHFTGEK[MT7].4y6_1.heavy 469.025 / 862.454 1267.0 41.56027603149414 35 10 10 5 10 0.9217520846049609 62.906226991791264 0.0458984375 3 0.8457215887226741 3.1007108482731174 1267.0 5.992316085442108 0.0 - - - - - - - 281.5 2 2 CASP2 caspase 2, apoptosis-related cysteine peptidase 1341 171 C20140707_OR006_05 C20140707_OR006_05 TB437065.[MT7]-EQIRELAER.2b8_1.heavy 644.36 / 1113.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC22D4 TSC22 domain family, member 4 1343 171 C20140707_OR006_05 C20140707_OR006_05 TB437065.[MT7]-EQIRELAER.2b3_1.heavy 644.36 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC22D4 TSC22 domain family, member 4 1345 171 C20140707_OR006_05 C20140707_OR006_05 TB437065.[MT7]-EQIRELAER.2y8_2.heavy 644.36 / 507.788 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC22D4 TSC22 domain family, member 4 1347 171 C20140707_OR006_05 C20140707_OR006_05 TB437065.[MT7]-EQIRELAER.2y5_1.heavy 644.36 / 617.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSC22D4 TSC22 domain family, member 4 1349 172 C20140707_OR006_05 C20140707_OR006_05 TB437362.[MT7]-SGGDVDHSTLVTLFK[MT7].4b5_1.heavy 466.757 / 560.28 719.0 37.30154991149902 32 7 10 5 10 0.6906528981011606 79.53846176434246 0.042102813720703125 3 0.7074503239599582 2.223598061728127 719.0 2.3300925925925924 3.0 - - - - - - - 360.0 4 4 CASP2 caspase 2, apoptosis-related cysteine peptidase 1351 172 C20140707_OR006_05 C20140707_OR006_05 TB437362.[MT7]-SGGDVDHSTLVTLFK[MT7].4y3_1.heavy 466.757 / 551.367 2302.0 37.30154991149902 32 7 10 5 10 0.6906528981011606 79.53846176434246 0.042102813720703125 3 0.7074503239599582 2.223598061728127 2302.0 6.851644047224981 1.0 - - - - - - - 288.0 4 6 CASP2 caspase 2, apoptosis-related cysteine peptidase 1353 172 C20140707_OR006_05 C20140707_OR006_05 TB437362.[MT7]-SGGDVDHSTLVTLFK[MT7].4b9_2.heavy 466.757 / 500.726 1295.0 37.30154991149902 32 7 10 5 10 0.6906528981011606 79.53846176434246 0.042102813720703125 3 0.7074503239599582 2.223598061728127 1295.0 9.622569444444446 0.0 - - - - - - - 288.0 2 5 CASP2 caspase 2, apoptosis-related cysteine peptidase 1355 172 C20140707_OR006_05 C20140707_OR006_05 TB437362.[MT7]-SGGDVDHSTLVTLFK[MT7].4b6_1.heavy 466.757 / 675.307 1870.0 37.30154991149902 32 7 10 5 10 0.6906528981011606 79.53846176434246 0.042102813720703125 3 0.7074503239599582 2.223598061728127 1870.0 13.635416666666666 0.0 - - - - - - - 216.0 3 4 CASP2 caspase 2, apoptosis-related cysteine peptidase 1357 173 C20140707_OR006_05 C20140707_OR006_05 TB437163.[MT7]-AGPEPQELQGIR.2y8_1.heavy 719.892 / 940.521 9853.0 28.774900436401367 39 13 10 10 6 5.6638742972292855 17.65575907094532 0.0 5 0.9015756582002173 3.901062753875937 9853.0 59.38191964285714 0.0 - - - - - - - 201.6 19 10 RIN1 Ras and Rab interactor 1 1359 173 C20140707_OR006_05 C20140707_OR006_05 TB437163.[MT7]-AGPEPQELQGIR.2y5_1.heavy 719.892 / 586.367 1232.0 28.774900436401367 39 13 10 10 6 5.6638742972292855 17.65575907094532 0.0 5 0.9015756582002173 3.901062753875937 1232.0 8.8 4.0 - - - - - - - 234.1818181818182 2 11 RIN1 Ras and Rab interactor 1 1361 173 C20140707_OR006_05 C20140707_OR006_05 TB437163.[MT7]-AGPEPQELQGIR.2y10_1.heavy 719.892 / 1166.62 1456.0 28.774900436401367 39 13 10 10 6 5.6638742972292855 17.65575907094532 0.0 5 0.9015756582002173 3.901062753875937 1456.0 13.953333333333333 1.0 - - - - - - - 261.3333333333333 11 9 RIN1 Ras and Rab interactor 1 1363 173 C20140707_OR006_05 C20140707_OR006_05 TB437163.[MT7]-AGPEPQELQGIR.2y11_1.heavy 719.892 / 1223.64 1232.0 28.774900436401367 39 13 10 10 6 5.6638742972292855 17.65575907094532 0.0 5 0.9015756582002173 3.901062753875937 1232.0 7.53076923076923 1.0 - - - - - - - 112.0 2 8 RIN1 Ras and Rab interactor 1 1365 174 C20140707_OR006_05 C20140707_OR006_05 TB437264.[MT7]-GVYILVPLPLEK[MT7].3y3_1.heavy 543.679 / 533.341 9771.0 46.648101806640625 44 14 10 10 10 1.5183237175379432 47.02651836602982 0.0 3 0.9490651414663812 5.444950853613668 9771.0 77.84365145228216 0.0 - - - - - - - 265.4 19 5 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1367 174 C20140707_OR006_05 C20140707_OR006_05 TB437264.[MT7]-GVYILVPLPLEK[MT7].3b4_1.heavy 543.679 / 577.347 12907.0 46.648101806640625 44 14 10 10 10 1.5183237175379432 47.02651836602982 0.0 3 0.9490651414663812 5.444950853613668 12907.0 157.01207708926304 0.0 - - - - - - - 217.2 25 5 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1369 174 C20140707_OR006_05 C20140707_OR006_05 TB437264.[MT7]-GVYILVPLPLEK[MT7].3b5_1.heavy 543.679 / 690.431 18094.0 46.648101806640625 44 14 10 10 10 1.5183237175379432 47.02651836602982 0.0 3 0.9490651414663812 5.444950853613668 18094.0 218.5594618154384 0.0 - - - - - - - 211.25 36 4 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1371 174 C20140707_OR006_05 C20140707_OR006_05 TB437264.[MT7]-GVYILVPLPLEK[MT7].3y4_1.heavy 543.679 / 630.394 20627.0 46.648101806640625 44 14 10 10 10 1.5183237175379432 47.02651836602982 0.0 3 0.9490651414663812 5.444950853613668 20627.0 56.80253690397809 1.0 - - - - - - - 201.16666666666666 46 6 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1373 175 C20140707_OR006_05 C20140707_OR006_05 TB450106.[MT7]-AFTLVSAVER.2y8_1.heavy 618.857 / 874.499 30092.0 37.496299743652344 50 20 10 10 10 5.2206466841592825 15.19291708393444 0.0 3 0.994361716935673 16.42799887844133 30092.0 77.68648979591838 0.0 - - - - - - - 210.0 60 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1375 175 C20140707_OR006_05 C20140707_OR006_05 TB450106.[MT7]-AFTLVSAVER.2y9_1.heavy 618.857 / 1021.57 52205.0 37.496299743652344 50 20 10 10 10 5.2206466841592825 15.19291708393444 0.0 3 0.994361716935673 16.42799887844133 52205.0 701.0385714285715 0.0 - - - - - - - 248.88888888888889 104 9 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1377 175 C20140707_OR006_05 C20140707_OR006_05 TB450106.[MT7]-AFTLVSAVER.2y6_1.heavy 618.857 / 660.367 31771.0 37.496299743652344 50 20 10 10 10 5.2206466841592825 15.19291708393444 0.0 3 0.994361716935673 16.42799887844133 31771.0 82.54786607142857 0.0 - - - - - - - 248.88888888888889 63 9 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1379 175 C20140707_OR006_05 C20140707_OR006_05 TB450106.[MT7]-AFTLVSAVER.2y7_1.heavy 618.857 / 773.452 25053.0 37.496299743652344 50 20 10 10 10 5.2206466841592825 15.19291708393444 0.0 3 0.994361716935673 16.42799887844133 25053.0 82.43629999999999 0.0 - - - - - - - 252.0 50 10 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1381 176 C20140707_OR006_05 C20140707_OR006_05 TB437162.[MT7]-AVGHPFVIQLGR.3y6_1.heavy 479.953 / 685.435 9031.0 34.61130142211914 47 20 9 10 8 8.1388390743746 12.286764621609644 0.0 4 0.9960526736253577 19.636672161834294 9031.0 45.46686187050359 0.0 - - - - - - - 250.2 18 5 XPO1 exportin 1 (CRM1 homolog, yeast) 1383 176 C20140707_OR006_05 C20140707_OR006_05 TB437162.[MT7]-AVGHPFVIQLGR.3y5_1.heavy 479.953 / 586.367 5280.0 34.61130142211914 47 20 9 10 8 8.1388390743746 12.286764621609644 0.0 4 0.9960526736253577 19.636672161834294 5280.0 44.82302158273381 0.0 - - - - - - - 139.0 10 3 XPO1 exportin 1 (CRM1 homolog, yeast) 1385 176 C20140707_OR006_05 C20140707_OR006_05 TB437162.[MT7]-AVGHPFVIQLGR.3b4_1.heavy 479.953 / 509.295 7086.0 34.61130142211914 47 20 9 10 8 8.1388390743746 12.286764621609644 0.0 4 0.9960526736253577 19.636672161834294 7086.0 20.45597960375155 1.0 - - - - - - - 301.1666666666667 62 6 XPO1 exportin 1 (CRM1 homolog, yeast) 1387 176 C20140707_OR006_05 C20140707_OR006_05 TB437162.[MT7]-AVGHPFVIQLGR.3b8_2.heavy 479.953 / 483.288 N/A 34.61130142211914 47 20 9 10 8 8.1388390743746 12.286764621609644 0.0 4 0.9960526736253577 19.636672161834294 25009.0 118.8677170263789 0.0 - - - - - - - 278.0 50 7 XPO1 exportin 1 (CRM1 homolog, yeast) 1389 177 C20140707_OR006_05 C20140707_OR006_05 TB436919.[MT7]-QLGSILK[MT7].2y4_1.heavy 523.844 / 604.415 915.0 31.508949756622314 34 17 6 5 6 5.03997002152786 19.84138786001849 0.04379844665527344 6 0.9778844732069256 8.28342744663257 915.0 3.85498035421065 16.0 - - - - - - - 196.08333333333334 9 12 XPO1 exportin 1 (CRM1 homolog, yeast) 1391 177 C20140707_OR006_05 C20140707_OR006_05 TB436919.[MT7]-QLGSILK[MT7].2y5_1.heavy 523.844 / 661.437 3267.0 31.508949756622314 34 17 6 5 6 5.03997002152786 19.84138786001849 0.04379844665527344 6 0.9778844732069256 8.28342744663257 3267.0 9.33348894720412 0.0 - - - - - - - 163.5 6 8 XPO1 exportin 1 (CRM1 homolog, yeast) 1393 177 C20140707_OR006_05 C20140707_OR006_05 TB436919.[MT7]-QLGSILK[MT7].2b4_1.heavy 523.844 / 530.305 784.0 31.508949756622314 34 17 6 5 6 5.03997002152786 19.84138786001849 0.04379844665527344 6 0.9778844732069256 8.28342744663257 784.0 3.113716475095785 12.0 - - - - - - - 313.7 3 10 XPO1 exportin 1 (CRM1 homolog, yeast) 1395 177 C20140707_OR006_05 C20140707_OR006_05 TB436919.[MT7]-QLGSILK[MT7].2y6_1.heavy 523.844 / 774.521 2875.0 31.508949756622314 34 17 6 5 6 5.03997002152786 19.84138786001849 0.04379844665527344 6 0.9778844732069256 8.28342744663257 2875.0 27.816711131017293 0.0 - - - - - - - 261.2857142857143 5 7 XPO1 exportin 1 (CRM1 homolog, yeast) 1397 178 C20140707_OR006_05 C20140707_OR006_05 TB450253.[MT7]-EC[CAM]VQQLAENTR.2b3_1.heavy 746.371 / 533.251 5148.0 25.940099716186523 42 12 10 10 10 6.935624833024378 14.418311602416011 0.0 3 0.8940880795286634 3.7582026080847246 5148.0 63.22711409395973 0.0 - - - - - - - 158.625 10 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1399 178 C20140707_OR006_05 C20140707_OR006_05 TB450253.[MT7]-EC[CAM]VQQLAENTR.2y8_1.heavy 746.371 / 959.49 5670.0 25.940099716186523 42 12 10 10 10 6.935624833024378 14.418311602416011 0.0 3 0.8940880795286634 3.7582026080847246 5670.0 71.54093959731543 0.0 - - - - - - - 181.14285714285714 11 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1401 178 C20140707_OR006_05 C20140707_OR006_05 TB450253.[MT7]-EC[CAM]VQQLAENTR.2y9_1.heavy 746.371 / 1058.56 3954.0 25.940099716186523 42 12 10 10 10 6.935624833024378 14.418311602416011 0.0 3 0.8940880795286634 3.7582026080847246 3954.0 51.21624161073825 0.0 - - - - - - - 209.0 7 5 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1403 178 C20140707_OR006_05 C20140707_OR006_05 TB450253.[MT7]-EC[CAM]VQQLAENTR.2y10_1.heavy 746.371 / 1218.59 2014.0 25.940099716186523 42 12 10 10 10 6.935624833024378 14.418311602416011 0.0 3 0.8940880795286634 3.7582026080847246 2014.0 32.260044742729306 0.0 - - - - - - - 136.83333333333334 4 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1405 179 C20140707_OR006_05 C20140707_OR006_05 TB437451.[MT7]-AFTLVSAVERELLMGDK[MT7].3b4_1.heavy 723.073 / 577.347 755.0 50.36360168457031 41 13 10 10 8 1.232940472007875 47.82209598572166 0.0 4 0.9089746351488345 4.059106447954117 755.0 4.077932098765432 4.0 - - - - - - - 0.0 1 0 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1407 179 C20140707_OR006_05 C20140707_OR006_05 TB437451.[MT7]-AFTLVSAVERELLMGDK[MT7].3y4_1.heavy 723.073 / 594.304 647.0 50.36360168457031 41 13 10 10 8 1.232940472007875 47.82209598572166 0.0 4 0.9089746351488345 4.059106447954117 647.0 -0.2533017813435644 5.0 - - - - - - - 231.28571428571428 2 7 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1409 179 C20140707_OR006_05 C20140707_OR006_05 TB437451.[MT7]-AFTLVSAVERELLMGDK[MT7].3y13_2.heavy 723.073 / 795.936 1186.0 50.36360168457031 41 13 10 10 8 1.232940472007875 47.82209598572166 0.0 4 0.9089746351488345 4.059106447954117 1186.0 7.888364197530864 1.0 - - - - - - - 270.0 2 2 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1411 179 C20140707_OR006_05 C20140707_OR006_05 TB437451.[MT7]-AFTLVSAVERELLMGDK[MT7].3y16_2.heavy 723.073 / 976.536 1618.0 50.36360168457031 41 13 10 10 8 1.232940472007875 47.82209598572166 0.0 4 0.9089746351488345 4.059106447954117 1618.0 19.02648148148148 0.0 - - - - - - - 197.83333333333334 3 6 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1413 180 C20140707_OR006_05 C20140707_OR006_05 TB412210.[MT7]-TVVTGGPLEGPYRLK[MT7].4b5_1.heavy 469.529 / 602.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - CA7 carbonic anhydrase VII 1415 180 C20140707_OR006_05 C20140707_OR006_05 TB412210.[MT7]-TVVTGGPLEGPYRLK[MT7].4y6_1.heavy 469.529 / 877.538 N/A N/A - - - - - - - - - 0.0 - - - - - - - CA7 carbonic anhydrase VII 1417 180 C20140707_OR006_05 C20140707_OR006_05 TB412210.[MT7]-TVVTGGPLEGPYRLK[MT7].4y7_2.heavy 469.529 / 503.794 N/A N/A - - - - - - - - - 0.0 - - - - - - - CA7 carbonic anhydrase VII 1419 180 C20140707_OR006_05 C20140707_OR006_05 TB412210.[MT7]-TVVTGGPLEGPYRLK[MT7].4b6_1.heavy 469.529 / 659.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - CA7 carbonic anhydrase VII 1421 181 C20140707_OR006_05 C20140707_OR006_05 TB412312.[MT7]-AYLYLDEAHSIGALGPTGR.4b7_1.heavy 537.786 / 1012.51 2724.0 38.24885082244873 23 8 4 5 6 0.45484468666657946 105.40118490856455 0.045398712158203125 5 0.7805718454049728 2.584845143432136 2724.0 38.0979020979021 0.0 - - - - - - - 286.5 5 4 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1423 181 C20140707_OR006_05 C20140707_OR006_05 TB412312.[MT7]-AYLYLDEAHSIGALGPTGR.4b4_1.heavy 537.786 / 655.357 1147.0 38.24885082244873 23 8 4 5 6 0.45484468666657946 105.40118490856455 0.045398712158203125 5 0.7805718454049728 2.584845143432136 1147.0 8.018184254769622 3.0 - - - - - - - 215.0 2 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1425 181 C20140707_OR006_05 C20140707_OR006_05 TB412312.[MT7]-AYLYLDEAHSIGALGPTGR.4y13_2.heavy 537.786 / 633.333 287.0 38.24885082244873 23 8 4 5 6 0.45484468666657946 105.40118490856455 0.045398712158203125 5 0.7805718454049728 2.584845143432136 287.0 1.2004651162790698 32.0 - - - - - - - 329.8 3 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1427 181 C20140707_OR006_05 C20140707_OR006_05 TB412312.[MT7]-AYLYLDEAHSIGALGPTGR.4b3_1.heavy 537.786 / 492.294 2437.0 38.24885082244873 23 8 4 5 6 0.45484468666657946 105.40118490856455 0.045398712158203125 5 0.7805718454049728 2.584845143432136 2437.0 4.968679778498908 2.0 - - - - - - - 358.3333333333333 10 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1429 182 C20140707_OR006_05 C20140707_OR006_05 TB411731.[MT7]-YTGNIIK[MT7].2y5_1.heavy 548.834 / 688.447 5125.0 26.940099716186523 47 17 10 10 10 2.827335400307561 28.03525364576329 0.0 3 0.9724734528770751 7.421389338214334 5125.0 46.09950248756219 0.0 - - - - - - - 190.6 10 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1431 182 C20140707_OR006_05 C20140707_OR006_05 TB411731.[MT7]-YTGNIIK[MT7].2b4_1.heavy 548.834 / 580.285 7637.0 26.940099716186523 47 17 10 10 10 2.827335400307561 28.03525364576329 0.0 3 0.9724734528770751 7.421389338214334 7637.0 20.1373631840796 0.0 - - - - - - - 190.6 15 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1433 182 C20140707_OR006_05 C20140707_OR006_05 TB411731.[MT7]-YTGNIIK[MT7].2y6_1.heavy 548.834 / 789.495 9647.0 26.940099716186523 47 17 10 10 10 2.827335400307561 28.03525364576329 0.0 3 0.9724734528770751 7.421389338214334 9647.0 32.04983388704319 0.0 - - - - - - - 190.5 19 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1435 182 C20140707_OR006_05 C20140707_OR006_05 TB411731.[MT7]-YTGNIIK[MT7].2b5_1.heavy 548.834 / 693.369 6130.0 26.940099716186523 47 17 10 10 10 2.827335400307561 28.03525364576329 0.0 3 0.9724734528770751 7.421389338214334 6130.0 37.55768656716418 0.0 - - - - - - - 200.85714285714286 12 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1437 183 C20140707_OR006_05 C20140707_OR006_05 TB436915.[MT7]-QMNPHIR.2y4_1.heavy 520.283 / 522.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1439 183 C20140707_OR006_05 C20140707_OR006_05 TB436915.[MT7]-QMNPHIR.2b3_1.heavy 520.283 / 518.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1441 183 C20140707_OR006_05 C20140707_OR006_05 TB436915.[MT7]-QMNPHIR.2y5_1.heavy 520.283 / 636.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1443 183 C20140707_OR006_05 C20140707_OR006_05 TB436915.[MT7]-QMNPHIR.2y6_1.heavy 520.283 / 767.398 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1445 184 C20140707_OR006_05 C20140707_OR006_05 TB437457.[MT7]-GC[CAM]LILSDELNHASLVLGAR.3y7_1.heavy 728.064 / 715.446 3748.0 42.58190155029297 42 17 10 5 10 2.4208299550406753 28.705914744989222 0.04380035400390625 3 0.9784510619779132 8.392018879065105 3748.0 7.064057623049219 0.0 - - - - - - - 185.33333333333334 7 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1447 184 C20140707_OR006_05 C20140707_OR006_05 TB437457.[MT7]-GC[CAM]LILSDELNHASLVLGAR.3b4_1.heavy 728.064 / 588.33 3193.0 42.58190155029297 42 17 10 5 10 2.4208299550406753 28.705914744989222 0.04380035400390625 3 0.9784510619779132 8.392018879065105 3193.0 17.458129496402876 0.0 - - - - - - - 218.42857142857142 6 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1449 184 C20140707_OR006_05 C20140707_OR006_05 TB437457.[MT7]-GC[CAM]LILSDELNHASLVLGAR.3b5_1.heavy 728.064 / 701.414 1805.0 42.58190155029297 42 17 10 5 10 2.4208299550406753 28.705914744989222 0.04380035400390625 3 0.9784510619779132 8.392018879065105 1805.0 5.627617953656284 1.0 - - - - - - - 323.8333333333333 3 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1451 184 C20140707_OR006_05 C20140707_OR006_05 TB437457.[MT7]-GC[CAM]LILSDELNHASLVLGAR.3y8_1.heavy 728.064 / 786.483 3609.0 42.58190155029297 42 17 10 5 10 2.4208299550406753 28.705914744989222 0.04380035400390625 3 0.9784510619779132 8.392018879065105 3609.0 3.4612424071483767 0.0 - - - - - - - 198.42857142857142 7 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1453 185 C20140707_OR006_05 C20140707_OR006_05 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 128725.0 40.49530029296875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 128725.0 330.58676390098327 0.0 - - - - - - - 242.0 257 10 1455 185 C20140707_OR006_05 C20140707_OR006_05 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 226835.0 40.49530029296875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 226835.0 523.5642255213805 0.0 - - - - - - - 427.0 453 6 1457 185 C20140707_OR006_05 C20140707_OR006_05 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 386176.0 40.49530029296875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 386176.0 846.1592226588459 0.0 - - - - - - - 355.8333333333333 772 6 1459 186 C20140707_OR006_05 C20140707_OR006_05 TB436918.[MT7]-LLQAIAK[MT7].2y4_1.heavy 522.855 / 546.373 1247.0 33.65962600708008 42 20 10 6 6 7.627724400336698 13.110069891301508 0.0399017333984375 5 0.9924134739477791 14.160087752999406 1247.0 2.0194805194805197 8.0 - - - - - - - 246.66666666666666 4 9 SLC12A4;SLC12A6 solute carrier family 12 (potassium/chloride transporters), member 4;solute carrier family 12 (potassium/chloride transporters), member 6 1461 186 C20140707_OR006_05 C20140707_OR006_05 TB436918.[MT7]-LLQAIAK[MT7].2y5_1.heavy 522.855 / 674.432 4296.0 33.65962600708008 42 20 10 6 6 7.627724400336698 13.110069891301508 0.0399017333984375 5 0.9924134739477791 14.160087752999406 4296.0 15.04375451263538 0.0 - - - - - - - 208.0 8 4 SLC12A4;SLC12A6 solute carrier family 12 (potassium/chloride transporters), member 4;solute carrier family 12 (potassium/chloride transporters), member 6 1463 186 C20140707_OR006_05 C20140707_OR006_05 TB436918.[MT7]-LLQAIAK[MT7].2b4_1.heavy 522.855 / 570.373 693.0 33.65962600708008 42 20 10 6 6 7.627724400336698 13.110069891301508 0.0399017333984375 5 0.9924134739477791 14.160087752999406 693.0 2.6751272216051096 17.0 - - - - - - - 246.44444444444446 4 9 SLC12A4;SLC12A6 solute carrier family 12 (potassium/chloride transporters), member 4;solute carrier family 12 (potassium/chloride transporters), member 6 1465 186 C20140707_OR006_05 C20140707_OR006_05 TB436918.[MT7]-LLQAIAK[MT7].2y6_1.heavy 522.855 / 787.516 5404.0 33.65962600708008 42 20 10 6 6 7.627724400336698 13.110069891301508 0.0399017333984375 5 0.9924134739477791 14.160087752999406 5404.0 24.70517911691197 1.0 - - - - - - - 277.4 10 5 SLC12A4;SLC12A6 solute carrier family 12 (potassium/chloride transporters), member 4;solute carrier family 12 (potassium/chloride transporters), member 6 1467 187 C20140707_OR006_05 C20140707_OR006_05 TB412219.[MT7]-HTAAGQLVQDLLTQVR.3y7_1.heavy 632.026 / 844.489 9202.0 44.714298248291016 50 20 10 10 10 11.258715944986694 8.88200754763053 0.0 3 0.9973741661044038 24.07873498454254 9202.0 85.1748044689585 0.0 - - - - - - - 200.0 18 6 RIN1 Ras and Rab interactor 1 1469 187 C20140707_OR006_05 C20140707_OR006_05 TB412219.[MT7]-HTAAGQLVQDLLTQVR.3y6_1.heavy 632.026 / 729.462 7868.0 44.714298248291016 50 20 10 10 10 11.258715944986694 8.88200754763053 0.0 3 0.9973741661044038 24.07873498454254 7868.0 20.186906441525952 0.0 - - - - - - - 218.0909090909091 15 11 RIN1 Ras and Rab interactor 1 1471 187 C20140707_OR006_05 C20140707_OR006_05 TB412219.[MT7]-HTAAGQLVQDLLTQVR.3b6_1.heavy 632.026 / 710.37 22405.0 44.714298248291016 50 20 10 10 10 11.258715944986694 8.88200754763053 0.0 3 0.9973741661044038 24.07873498454254 22405.0 59.002635709818634 0.0 - - - - - - - 222.0 44 3 RIN1 Ras and Rab interactor 1 1473 187 C20140707_OR006_05 C20140707_OR006_05 TB412219.[MT7]-HTAAGQLVQDLLTQVR.3y8_1.heavy 632.026 / 972.547 16537.0 44.714298248291016 50 20 10 10 10 11.258715944986694 8.88200754763053 0.0 3 0.9973741661044038 24.07873498454254 16537.0 58.6396435272045 0.0 - - - - - - - 177.66666666666666 33 6 RIN1 Ras and Rab interactor 1 1475 188 C20140707_OR006_05 C20140707_OR006_05 TB437055.[MT7]-SEIWGPGLK[MT7].2y4_1.heavy 637.871 / 558.373 18526.0 33.78889846801758 46 16 10 10 10 2.2558185917858733 35.29656714412209 0.0 3 0.9663884894498097 6.712655312408475 18526.0 23.375607875139785 0.0 - - - - - - - 172.75 37 4 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1477 188 C20140707_OR006_05 C20140707_OR006_05 TB437055.[MT7]-SEIWGPGLK[MT7].2y5_1.heavy 637.871 / 615.395 26544.0 33.78889846801758 46 16 10 10 10 2.2558185917858733 35.29656714412209 0.0 3 0.9663884894498097 6.712655312408475 26544.0 35.55575875718384 1.0 - - - - - - - 691.2 62 10 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1479 188 C20140707_OR006_05 C20140707_OR006_05 TB437055.[MT7]-SEIWGPGLK[MT7].2y6_1.heavy 637.871 / 801.474 23779.0 33.78889846801758 46 16 10 10 10 2.2558185917858733 35.29656714412209 0.0 3 0.9663884894498097 6.712655312408475 23779.0 103.41811110779604 0.0 - - - - - - - 199.66666666666666 47 9 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1481 188 C20140707_OR006_05 C20140707_OR006_05 TB437055.[MT7]-SEIWGPGLK[MT7].2b5_1.heavy 637.871 / 717.369 9678.0 33.78889846801758 46 16 10 10 10 2.2558185917858733 35.29656714412209 0.0 3 0.9663884894498097 6.712655312408475 9678.0 13.140119509633509 0.0 - - - - - - - 230.33333333333334 19 6 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1483 189 C20140707_OR006_05 C20140707_OR006_05 TB411734.[MT7]-TVIGSVLLR.2y8_1.heavy 551.359 / 856.562 3309.0 38.481998443603516 43 13 10 10 10 1.2042132670823429 49.46539476043595 0.0 3 0.9217348390999904 4.382319885889262 3309.0 22.519583333333333 0.0 - - - - - - - 316.8 6 5 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1485 189 C20140707_OR006_05 C20140707_OR006_05 TB411734.[MT7]-TVIGSVLLR.2y6_1.heavy 551.359 / 644.409 7914.0 38.481998443603516 43 13 10 10 10 1.2042132670823429 49.46539476043595 0.0 3 0.9217348390999904 4.382319885889262 7914.0 11.306245232448534 0.0 - - - - - - - 216.0 15 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1487 189 C20140707_OR006_05 C20140707_OR006_05 TB411734.[MT7]-TVIGSVLLR.2b5_1.heavy 551.359 / 602.363 1583.0 38.481998443603516 43 13 10 10 10 1.2042132670823429 49.46539476043595 0.0 3 0.9217348390999904 4.382319885889262 1583.0 3.412586926286509 3.0 - - - - - - - 360.0 4 4 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1489 189 C20140707_OR006_05 C20140707_OR006_05 TB411734.[MT7]-TVIGSVLLR.2y7_1.heavy 551.359 / 757.493 4029.0 38.481998443603516 43 13 10 10 10 1.2042132670823429 49.46539476043595 0.0 3 0.9217348390999904 4.382319885889262 4029.0 11.026948759880078 1.0 - - - - - - - 270.0 9 8 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1491 190 C20140707_OR006_05 C20140707_OR006_05 TB437396.[MT7]-ALASPEQLAQLPSSGVPR.3y7_1.heavy 655.701 / 699.378 66774.0 36.949899673461914 42 17 10 5 10 5.6450086445640695 17.71476472339794 0.044399261474609375 3 0.9799811680299533 8.707947923219233 66774.0 107.1552970357856 0.0 - - - - - - - 307.7142857142857 133 7 TSC22D4 TSC22 domain family, member 4 1493 190 C20140707_OR006_05 C20140707_OR006_05 TB437396.[MT7]-ALASPEQLAQLPSSGVPR.3b6_1.heavy 655.701 / 713.395 12062.0 36.949899673461914 42 17 10 5 10 5.6450086445640695 17.71476472339794 0.044399261474609375 3 0.9799811680299533 8.707947923219233 12062.0 68.57262163189083 0.0 - - - - - - - 335.1666666666667 24 6 TSC22D4 TSC22 domain family, member 4 1495 190 C20140707_OR006_05 C20140707_OR006_05 TB437396.[MT7]-ALASPEQLAQLPSSGVPR.3y8_1.heavy 655.701 / 812.463 9190.0 36.949899673461914 42 17 10 5 10 5.6450086445640695 17.71476472339794 0.044399261474609375 3 0.9799811680299533 8.707947923219233 9190.0 71.80970554105019 0.0 - - - - - - - 369.42857142857144 18 7 TSC22D4 TSC22 domain family, member 4 1497 190 C20140707_OR006_05 C20140707_OR006_05 TB437396.[MT7]-ALASPEQLAQLPSSGVPR.3b7_1.heavy 655.701 / 841.454 14791.0 36.949899673461914 42 17 10 5 10 5.6450086445640695 17.71476472339794 0.044399261474609375 3 0.9799811680299533 8.707947923219233 14791.0 49.24613689095128 0.0 - - - - - - - 287.42857142857144 29 7 TSC22D4 TSC22 domain family, member 4 1499 191 C20140707_OR006_05 C20140707_OR006_05 TB437053.[MT7]-GMFEPYLK[MT7].3y3_1.heavy 424.902 / 567.362 4451.0 36.960999488830566 42 17 10 5 10 3.2390622955555184 30.873132677076036 0.044399261474609375 3 0.9734659160410727 7.559539033000337 4451.0 31.001912891986066 0.0 - - - - - - - 287.0 8 3 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 1501 191 C20140707_OR006_05 C20140707_OR006_05 TB437053.[MT7]-GMFEPYLK[MT7].3b4_1.heavy 424.902 / 609.282 5887.0 36.960999488830566 42 17 10 5 10 3.2390622955555184 30.873132677076036 0.044399261474609375 3 0.9734659160410727 7.559539033000337 5887.0 2.5317865429234336 1.0 - - - - - - - 258.8 11 5 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 1503 191 C20140707_OR006_05 C20140707_OR006_05 TB437053.[MT7]-GMFEPYLK[MT7].3y4_1.heavy 424.902 / 664.415 2154.0 36.960999488830566 42 17 10 5 10 3.2390622955555184 30.873132677076036 0.044399261474609375 3 0.9734659160410727 7.559539033000337 2154.0 28.720000000000002 0.0 - - - - - - - 287.5 4 2 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 1505 191 C20140707_OR006_05 C20140707_OR006_05 TB437053.[MT7]-GMFEPYLK[MT7].3b3_1.heavy 424.902 / 480.24 5600.0 36.960999488830566 42 17 10 5 10 3.2390622955555184 30.873132677076036 0.044399261474609375 3 0.9734659160410727 7.559539033000337 5600.0 19.31219512195122 1.0 - - - - - - - 359.0 11 2 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 1507 192 C20140707_OR006_05 C20140707_OR006_05 TB412319.[MT7]-AFTLVSAVERELLMGDK[MT7].4y5_1.heavy 542.556 / 707.388 528.0 50.33985137939453 42 17 10 5 10 2.201527430544972 32.70172486123522 0.0475006103515625 3 0.9725452436463623 7.43113091833353 528.0 5.2879924671331 2.0 - - - - - - - 158.5 3 2 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1509 192 C20140707_OR006_05 C20140707_OR006_05 TB412319.[MT7]-AFTLVSAVERELLMGDK[MT7].4y4_1.heavy 542.556 / 594.304 1583.0 50.33985137939453 42 17 10 5 10 2.201527430544972 32.70172486123522 0.0475006103515625 3 0.9725452436463623 7.43113091833353 1583.0 13.71326198950157 1.0 - - - - - - - 148.2 3 5 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1511 192 C20140707_OR006_05 C20140707_OR006_05 TB412319.[MT7]-AFTLVSAVERELLMGDK[MT7].4y12_2.heavy 542.556 / 746.401 1794.0 50.33985137939453 42 17 10 5 10 2.201527430544972 32.70172486123522 0.0475006103515625 3 0.9725452436463623 7.43113091833353 1794.0 25.426897970133236 0.0 - - - - - - - 264.0 3 2 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1513 192 C20140707_OR006_05 C20140707_OR006_05 TB412319.[MT7]-AFTLVSAVERELLMGDK[MT7].4b4_1.heavy 542.556 / 577.347 1477.0 50.33985137939453 42 17 10 5 10 2.201527430544972 32.70172486123522 0.0475006103515625 3 0.9725452436463623 7.43113091833353 1477.0 17.19547645973454 0.0 - - - - - - - 237.75 2 4 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1515 193 C20140707_OR006_05 C20140707_OR006_05 TB412010.[MT7]-LNMILVQILK[MT7].2b3_1.heavy 736.977 / 503.277 5036.0 50.2804012298584 41 16 10 5 10 3.5260675337221117 28.360205538786193 0.04759979248046875 3 0.9690855411877607 7.000939399327897 5036.0 70.40621359223302 0.0 - - - - - - - 154.5 10 6 XPO1 exportin 1 (CRM1 homolog, yeast) 1517 193 C20140707_OR006_05 C20140707_OR006_05 TB412010.[MT7]-LNMILVQILK[MT7].2b4_1.heavy 736.977 / 616.361 2672.0 50.2804012298584 41 16 10 5 10 3.5260675337221117 28.360205538786193 0.04759979248046875 3 0.9690855411877607 7.000939399327897 2672.0 17.132599154324048 0.0 - - - - - - - 282.75 5 4 XPO1 exportin 1 (CRM1 homolog, yeast) 1519 193 C20140707_OR006_05 C20140707_OR006_05 TB412010.[MT7]-LNMILVQILK[MT7].2y6_1.heavy 736.977 / 857.594 1850.0 50.2804012298584 41 16 10 5 10 3.5260675337221117 28.360205538786193 0.04759979248046875 3 0.9690855411877607 7.000939399327897 1850.0 15.571194788437632 0.0 - - - - - - - 240.0 3 3 XPO1 exportin 1 (CRM1 homolog, yeast) 1521 193 C20140707_OR006_05 C20140707_OR006_05 TB412010.[MT7]-LNMILVQILK[MT7].2b5_1.heavy 736.977 / 729.445 2364.0 50.2804012298584 41 16 10 5 10 3.5260675337221117 28.360205538786193 0.04759979248046875 3 0.9690855411877607 7.000939399327897 2364.0 22.744535982773602 2.0 - - - - - - - 205.66666666666666 5 3 XPO1 exportin 1 (CRM1 homolog, yeast) 1523 194 C20140707_OR006_05 C20140707_OR006_05 TB412318.[MT7]-DLGAEHLAGHEGVQLLGLLNVYLEQEER.3b14_2.heavy 1082.9 / 779.89 3291.0 49.60419845581055 38 10 10 10 8 0.8197428198294081 74.99534251885075 0.0 4 0.8248793088595769 2.9049717233162764 3291.0 36.86742321707444 0.0 - - - - - - - 397.0 6 2 CCNG2 cyclin G2 1525 194 C20140707_OR006_05 C20140707_OR006_05 TB412318.[MT7]-DLGAEHLAGHEGVQLLGLLNVYLEQEER.3b6_1.heavy 1082.9 / 767.38 794.0 49.60419845581055 38 10 10 10 8 0.8197428198294081 74.99534251885075 0.0 4 0.8248793088595769 2.9049717233162764 794.0 13.139646017699114 1.0 - - - - - - - 0.0 1 0 CCNG2 cyclin G2 1527 194 C20140707_OR006_05 C20140707_OR006_05 TB412318.[MT7]-DLGAEHLAGHEGVQLLGLLNVYLEQEER.3b5_1.heavy 1082.9 / 630.321 1021.0 49.60419845581055 38 10 10 10 8 0.8197428198294081 74.99534251885075 0.0 4 0.8248793088595769 2.9049717233162764 1021.0 5.491413708214563 1.0 - - - - - - - 226.71428571428572 2 7 CCNG2 cyclin G2 1529 194 C20140707_OR006_05 C20140707_OR006_05 TB412318.[MT7]-DLGAEHLAGHEGVQLLGLLNVYLEQEER.3y9_1.heavy 1082.9 / 1179.56 1475.0 49.60419845581055 38 10 10 10 8 0.8197428198294081 74.99534251885075 0.0 4 0.8248793088595769 2.9049717233162764 1475.0 5.0357929515418505 1.0 - - - - - - - 214.11111111111111 3 9 CCNG2 cyclin G2 1531 195 C20140707_OR006_05 C20140707_OR006_05 TB437051.[MT7]-QLLDFSQK[MT7].3y3_1.heavy 422.915 / 506.306 13300.0 34.042198181152344 43 13 10 10 10 2.2110959105450387 45.226441568222086 0.0 3 0.9089296729845514 4.058088584672258 13300.0 183.71223021582733 0.0 - - - - - - - 231.33333333333334 26 3 XPO1 exportin 1 (CRM1 homolog, yeast) 1533 195 C20140707_OR006_05 C20140707_OR006_05 TB437051.[MT7]-QLLDFSQK[MT7].3b4_1.heavy 422.915 / 614.363 13300.0 34.042198181152344 43 13 10 10 10 2.2110959105450387 45.226441568222086 0.0 3 0.9089296729845514 4.058088584672258 13300.0 134.09500558398048 0.0 - - - - - - - 185.0 26 3 XPO1 exportin 1 (CRM1 homolog, yeast) 1535 195 C20140707_OR006_05 C20140707_OR006_05 TB437051.[MT7]-QLLDFSQK[MT7].3b5_1.heavy 422.915 / 761.431 1662.0 34.042198181152344 43 13 10 10 10 2.2110959105450387 45.226441568222086 0.0 3 0.9089296729845514 4.058088584672258 1662.0 22.957122302158275 0.0 - - - - - - - 173.5 3 4 XPO1 exportin 1 (CRM1 homolog, yeast) 1537 195 C20140707_OR006_05 C20140707_OR006_05 TB437051.[MT7]-QLLDFSQK[MT7].3b3_1.heavy 422.915 / 499.336 7065.0 34.042198181152344 43 13 10 10 10 2.2110959105450387 45.226441568222086 0.0 3 0.9089296729845514 4.058088584672258 7065.0 61.06620263356103 0.0 - - - - - - - 305.0 14 5 XPO1 exportin 1 (CRM1 homolog, yeast) 1539 196 C20140707_OR006_05 C20140707_OR006_05 TB411737.[MT7]-EILSLDK[MT7].2b3_1.heavy 553.339 / 500.32 6951.0 32.108699798583984 47 17 10 10 10 6.383251130051625 15.66599808821735 0.0 3 0.9781236080426899 8.328745546916798 6951.0 22.806553248929433 0.0 - - - - - - - 349.3333333333333 13 3 CCNG2 cyclin G2 1541 196 C20140707_OR006_05 C20140707_OR006_05 TB411737.[MT7]-EILSLDK[MT7].2y4_1.heavy 553.339 / 606.358 16524.0 32.108699798583984 47 17 10 10 10 6.383251130051625 15.66599808821735 0.0 3 0.9781236080426899 8.328745546916798 16524.0 42.19657684321442 1.0 - - - - - - - 670.5555555555555 33 9 CCNG2 cyclin G2 1543 196 C20140707_OR006_05 C20140707_OR006_05 TB411737.[MT7]-EILSLDK[MT7].2y5_1.heavy 553.339 / 719.442 9442.0 32.108699798583984 47 17 10 10 10 6.383251130051625 15.66599808821735 0.0 3 0.9781236080426899 8.328745546916798 9442.0 68.47251908396946 1.0 - - - - - - - 262.0 18 5 CCNG2 cyclin G2 1545 196 C20140707_OR006_05 C20140707_OR006_05 TB411737.[MT7]-EILSLDK[MT7].2y6_1.heavy 553.339 / 832.526 5639.0 32.108699798583984 47 17 10 10 10 6.383251130051625 15.66599808821735 0.0 3 0.9781236080426899 8.328745546916798 5639.0 34.436641221374046 1.0 - - - - - - - 209.6 19 5 CCNG2 cyclin G2 1547 197 C20140707_OR006_05 C20140707_OR006_05 TB412014.[MT7]-SPDPFGAVAAQK[MT7].2y4_1.heavy 738.408 / 561.348 1955.0 31.99389934539795 37 12 10 5 10 1.9520698775398508 51.227674352532766 0.04599952697753906 3 0.8871730046923155 3.6390273701449933 1955.0 4.55 1.0 - - - - - - - 228.125 3 8 TSC22D4 TSC22 domain family, member 4 1549 197 C20140707_OR006_05 C20140707_OR006_05 TB412014.[MT7]-SPDPFGAVAAQK[MT7].2y11_1.heavy 738.408 / 1244.68 1173.0 31.99389934539795 37 12 10 5 10 1.9520698775398508 51.227674352532766 0.04599952697753906 3 0.8871730046923155 3.6390273701449933 1173.0 6.228723939373884 0.0 - - - - - - - 208.6 2 5 TSC22D4 TSC22 domain family, member 4 1551 197 C20140707_OR006_05 C20140707_OR006_05 TB412014.[MT7]-SPDPFGAVAAQK[MT7].2y9_1.heavy 738.408 / 1032.6 11078.0 31.99389934539795 37 12 10 5 10 1.9520698775398508 51.227674352532766 0.04599952697753906 3 0.8871730046923155 3.6390273701449933 11078.0 94.54202548371873 0.0 - - - - - - - 275.22222222222223 22 9 TSC22D4 TSC22 domain family, member 4 1553 197 C20140707_OR006_05 C20140707_OR006_05 TB412014.[MT7]-SPDPFGAVAAQK[MT7].2y7_1.heavy 738.408 / 788.475 1825.0 31.99389934539795 37 12 10 5 10 1.9520698775398508 51.227674352532766 0.04599952697753906 3 0.8871730046923155 3.6390273701449933 1825.0 14.317883508046656 0.0 - - - - - - - 239.0 3 6 TSC22D4 TSC22 domain family, member 4 1555 198 C20140707_OR006_05 C20140707_OR006_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 175967.0 35.53950119018555 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 175967.0 704.927990704744 0.0 - - - - - - - 311.1666666666667 351 6 1557 198 C20140707_OR006_05 C20140707_OR006_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 38322.0 35.53950119018555 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 38322.0 97.47407665505227 1.0 - - - - - - - 287.375 100 8 1559 198 C20140707_OR006_05 C20140707_OR006_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 31863.0 35.53950119018555 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 31863.0 127.95996572269334 0.0 - - - - - - - 201.3 63 10 1561 199 C20140707_OR006_05 C20140707_OR006_05 TB449992.[MT7]-RLQTSSVLVSGLR.3b6_1.heavy 520.65 / 817.465 8628.0 31.38759994506836 44 14 10 10 10 2.106851421141122 47.4641918250873 0.0 3 0.9332393817439095 4.749587783278379 8628.0 20.128769511229507 0.0 - - - - - - - 221.5 17 8 UBA1 ubiquitin-like modifier activating enzyme 1 1563 199 C20140707_OR006_05 C20140707_OR006_05 TB449992.[MT7]-RLQTSSVLVSGLR.3y6_1.heavy 520.65 / 644.409 35929.0 31.38759994506836 44 14 10 10 10 2.106851421141122 47.4641918250873 0.0 3 0.9332393817439095 4.749587783278379 35929.0 99.0266244780126 0.0 - - - - - - - 726.0 71 7 UBA1 ubiquitin-like modifier activating enzyme 1 1565 199 C20140707_OR006_05 C20140707_OR006_05 TB449992.[MT7]-RLQTSSVLVSGLR.3b7_1.heavy 520.65 / 916.533 6500.0 31.38759994506836 44 14 10 10 10 2.106851421141122 47.4641918250873 0.0 3 0.9332393817439095 4.749587783278379 6500.0 78.4957627118644 0.0 - - - - - - - 188.9 13 10 UBA1 ubiquitin-like modifier activating enzyme 1 1567 199 C20140707_OR006_05 C20140707_OR006_05 TB449992.[MT7]-RLQTSSVLVSGLR.3y5_1.heavy 520.65 / 531.325 53539.0 31.38759994506836 44 14 10 10 10 2.106851421141122 47.4641918250873 0.0 3 0.9332393817439095 4.749587783278379 53539.0 92.06635747275979 0.0 - - - - - - - 255.83333333333334 107 6 UBA1 ubiquitin-like modifier activating enzyme 1 1569 200 C20140707_OR006_05 C20140707_OR006_05 TB437250.[MT7]-EVQWTLGAILYR.2b3_1.heavy 796.949 / 501.279 4067.0 46.90140151977539 43 13 10 10 10 2.841472080655758 29.555669917514827 0.0 3 0.9287869939505947 4.596963985393561 4067.0 18.133946110410612 0.0 - - - - - - - 287.3333333333333 8 6 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1571 200 C20140707_OR006_05 C20140707_OR006_05 TB437250.[MT7]-EVQWTLGAILYR.2y8_1.heavy 796.949 / 906.541 2341.0 46.90140151977539 43 13 10 10 10 2.841472080655758 29.555669917514827 0.0 3 0.9287869939505947 4.596963985393561 2341.0 11.690932484977022 1.0 - - - - - - - 123.0 4 3 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1573 200 C20140707_OR006_05 C20140707_OR006_05 TB437250.[MT7]-EVQWTLGAILYR.2y9_1.heavy 796.949 / 1092.62 2958.0 46.90140151977539 43 13 10 10 10 2.841472080655758 29.555669917514827 0.0 3 0.9287869939505947 4.596963985393561 2958.0 8.795675675675676 0.0 - - - - - - - 281.57142857142856 5 7 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1575 200 C20140707_OR006_05 C20140707_OR006_05 TB437250.[MT7]-EVQWTLGAILYR.2y10_1.heavy 796.949 / 1220.68 616.0 46.90140151977539 43 13 10 10 10 2.841472080655758 29.555669917514827 0.0 3 0.9287869939505947 4.596963985393561 616.0 5.4087804878048775 6.0 - - - - - - - 0.0 1 0 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1577 201 C20140707_OR006_05 C20140707_OR006_05 TB437398.[MT7]-QLLLSELLEHLLEK[MT7].4y5_1.heavy 492.301 / 783.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 1579 201 C20140707_OR006_05 C20140707_OR006_05 TB437398.[MT7]-QLLLSELLEHLLEK[MT7].4y4_1.heavy 492.301 / 646.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 1581 201 C20140707_OR006_05 C20140707_OR006_05 TB437398.[MT7]-QLLLSELLEHLLEK[MT7].4y3_1.heavy 492.301 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 1583 201 C20140707_OR006_05 C20140707_OR006_05 TB437398.[MT7]-QLLLSELLEHLLEK[MT7].4b3_1.heavy 492.301 / 499.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 1585 202 C20140707_OR006_05 C20140707_OR006_05 TB450113.[MT7]-LQILNLGAK[MT7].2y4_1.heavy 629.41 / 532.357 6165.0 38.66874885559082 43 18 10 5 10 5.417284748679831 18.459432102838896 0.04180145263671875 3 0.9860313779162623 10.429866387459805 6165.0 8.63945381265635 0.0 - - - - - - - 171.8 12 5 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1587 202 C20140707_OR006_05 C20140707_OR006_05 TB450113.[MT7]-LQILNLGAK[MT7].2y5_1.heavy 629.41 / 646.4 9462.0 38.66874885559082 43 18 10 5 10 5.417284748679831 18.459432102838896 0.04180145263671875 3 0.9860313779162623 10.429866387459805 9462.0 15.291793718699944 0.0 - - - - - - - 266.2857142857143 18 7 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1589 202 C20140707_OR006_05 C20140707_OR006_05 TB450113.[MT7]-LQILNLGAK[MT7].2y6_1.heavy 629.41 / 759.484 9319.0 38.66874885559082 43 18 10 5 10 5.417284748679831 18.459432102838896 0.04180145263671875 3 0.9860313779162623 10.429866387459805 9319.0 25.099224639070357 0.0 - - - - - - - 238.88888888888889 18 9 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1591 202 C20140707_OR006_05 C20140707_OR006_05 TB450113.[MT7]-LQILNLGAK[MT7].2y7_1.heavy 629.41 / 872.569 7312.0 38.66874885559082 43 18 10 5 10 5.417284748679831 18.459432102838896 0.04180145263671875 3 0.9860313779162623 10.429866387459805 7312.0 27.384313973781403 0.0 - - - - - - - 286.6666666666667 14 9 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1593 203 C20140707_OR006_05 C20140707_OR006_05 TB411832.[MT7]-SGGDVDHSTLVTLFK[MT7].3y3_1.heavy 622.007 / 551.367 3886.0 37.322601318359375 44 14 10 10 10 2.646000253977464 37.79289130818492 0.0 3 0.9350113525304273 4.8146316528478845 3886.0 4.419935175918497 2.0 - - - - - - - 264.0 14 6 CASP2 caspase 2, apoptosis-related cysteine peptidase 1595 203 C20140707_OR006_05 C20140707_OR006_05 TB411832.[MT7]-SGGDVDHSTLVTLFK[MT7].3b6_1.heavy 622.007 / 675.307 12521.0 37.322601318359375 44 14 10 10 10 2.646000253977464 37.79289130818492 0.0 3 0.9350113525304273 4.8146316528478845 12521.0 8.270737824277205 0.0 - - - - - - - 192.0 25 3 CASP2 caspase 2, apoptosis-related cysteine peptidase 1597 203 C20140707_OR006_05 C20140707_OR006_05 TB411832.[MT7]-SGGDVDHSTLVTLFK[MT7].3y4_1.heavy 622.007 / 652.415 11801.0 37.322601318359375 44 14 10 10 10 2.646000253977464 37.79289130818492 0.0 3 0.9350113525304273 4.8146316528478845 11801.0 48.679125000000006 0.0 - - - - - - - 234.0 23 8 CASP2 caspase 2, apoptosis-related cysteine peptidase 1599 203 C20140707_OR006_05 C20140707_OR006_05 TB411832.[MT7]-SGGDVDHSTLVTLFK[MT7].3y5_1.heavy 622.007 / 751.483 7484.0 37.322601318359375 44 14 10 10 10 2.646000253977464 37.79289130818492 0.0 3 0.9350113525304273 4.8146316528478845 7484.0 15.191540755040755 0.0 - - - - - - - 288.0 14 3 CASP2 caspase 2, apoptosis-related cysteine peptidase 1601 204 C20140707_OR006_05 C20140707_OR006_05 TB411994.[MT7]-MAQEVLTHLK[MT7].3y3_1.heavy 486.618 / 541.358 16440.0 35.15549850463867 48 20 10 10 8 11.93436851039194 8.37916140371602 0.0 4 0.9983916098563204 30.76864998895803 16440.0 46.92926391382405 1.0 - - - - - - - 296.25 45 8 XPO1 exportin 1 (CRM1 homolog, yeast) 1603 204 C20140707_OR006_05 C20140707_OR006_05 TB411994.[MT7]-MAQEVLTHLK[MT7].3b4_1.heavy 486.618 / 604.288 45002.0 35.15549850463867 48 20 10 10 8 11.93436851039194 8.37916140371602 0.0 4 0.9983916098563204 30.76864998895803 45002.0 255.1926965409614 0.0 - - - - - - - 215.1818181818182 90 11 XPO1 exportin 1 (CRM1 homolog, yeast) 1605 204 C20140707_OR006_05 C20140707_OR006_05 TB411994.[MT7]-MAQEVLTHLK[MT7].3b5_1.heavy 486.618 / 703.357 20063.0 35.15549850463867 48 20 10 10 8 11.93436851039194 8.37916140371602 0.0 4 0.9983916098563204 30.76864998895803 20063.0 186.08568896079308 0.0 - - - - - - - 250.6 40 5 XPO1 exportin 1 (CRM1 homolog, yeast) 1607 204 C20140707_OR006_05 C20140707_OR006_05 TB411994.[MT7]-MAQEVLTHLK[MT7].3y4_1.heavy 486.618 / 642.406 10728.0 35.15549850463867 48 20 10 10 8 11.93436851039194 8.37916140371602 0.0 4 0.9983916098563204 30.76864998895803 10728.0 61.357919432011116 0.0 - - - - - - - 250.8 21 5 XPO1 exportin 1 (CRM1 homolog, yeast) 1609 205 C20140707_OR006_05 C20140707_OR006_05 TB450121.[MT7]-VFVYC[CAM]WPR.2y4_1.heavy 635.83 / 618.282 2014.0 40.0445499420166 45 20 10 5 10 12.027106675462162 8.314551678835702 0.042697906494140625 3 0.9980708275850211 28.09357475217422 2014.0 0.8328575181020255 14.0 - - - - - - - 288.0 8 5 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1611 205 C20140707_OR006_05 C20140707_OR006_05 TB450121.[MT7]-VFVYC[CAM]WPR.2y5_1.heavy 635.83 / 781.345 3740.0 40.0445499420166 45 20 10 5 10 12.027106675462162 8.314551678835702 0.042697906494140625 3 0.9980708275850211 28.09357475217422 3740.0 7.402457648546144 0.0 - - - - - - - 252.0 7 4 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1613 205 C20140707_OR006_05 C20140707_OR006_05 TB450121.[MT7]-VFVYC[CAM]WPR.2y6_1.heavy 635.83 / 880.413 2877.0 40.0445499420166 45 20 10 5 10 12.027106675462162 8.314551678835702 0.042697906494140625 3 0.9980708275850211 28.09357475217422 2877.0 5.175605640423032 1.0 - - - - - - - 267.42857142857144 5 7 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1615 205 C20140707_OR006_05 C20140707_OR006_05 TB450121.[MT7]-VFVYC[CAM]WPR.2y7_1.heavy 635.83 / 1027.48 11509.0 40.0445499420166 45 20 10 5 10 12.027106675462162 8.314551678835702 0.042697906494140625 3 0.9980708275850211 28.09357475217422 11509.0 29.116241456445398 0.0 - - - - - - - 216.0 23 6 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1617 206 C20140707_OR006_05 C20140707_OR006_05 TB437441.[MT7]-FRVTQPNTFGLFLYK[MT7].3y6_1.heavy 707.07 / 884.536 2912.0 42.450401306152344 37 14 10 5 8 3.9200203562194464 25.510071610046992 0.04380035400390625 4 0.9335572310223608 4.761064054527475 2912.0 5.6 0.0 - - - - - - - 332.8 5 5 RIN1 Ras and Rab interactor 1 1619 206 C20140707_OR006_05 C20140707_OR006_05 TB437441.[MT7]-FRVTQPNTFGLFLYK[MT7].3y3_1.heavy 707.07 / 567.362 7212.0 42.450401306152344 37 14 10 5 8 3.9200203562194464 25.510071610046992 0.04380035400390625 4 0.9335572310223608 4.761064054527475 7212.0 33.43363762318275 0.0 - - - - - - - 733.1428571428571 14 7 RIN1 Ras and Rab interactor 1 1621 206 C20140707_OR006_05 C20140707_OR006_05 TB437441.[MT7]-FRVTQPNTFGLFLYK[MT7].3b5_1.heavy 707.07 / 776.453 2774.0 42.450401306152344 37 14 10 5 8 3.9200203562194464 25.510071610046992 0.04380035400390625 4 0.9335572310223608 4.761064054527475 2774.0 20.29264665190924 0.0 - - - - - - - 249.6 5 5 RIN1 Ras and Rab interactor 1 1623 206 C20140707_OR006_05 C20140707_OR006_05 TB437441.[MT7]-FRVTQPNTFGLFLYK[MT7].3y4_1.heavy 707.07 / 714.431 3190.0 42.450401306152344 37 14 10 5 8 3.9200203562194464 25.510071610046992 0.04380035400390625 4 0.9335572310223608 4.761064054527475 3190.0 18.57105317967231 1.0 - - - - - - - 252.1818181818182 7 11 RIN1 Ras and Rab interactor 1 1625 207 C20140707_OR006_05 C20140707_OR006_05 TB411990.[MT7]-SLLFTSEDDER.2y8_1.heavy 728.358 / 998.406 5257.0 34.253501892089844 43 13 10 10 10 2.784146806480189 35.91764621292486 0.0 3 0.925199524832851 4.483995452665801 5257.0 7.163052930310563 1.0 - - - - - - - 304.4 10 5 CA7 carbonic anhydrase VII 1627 207 C20140707_OR006_05 C20140707_OR006_05 TB411990.[MT7]-SLLFTSEDDER.2y9_1.heavy 728.358 / 1111.49 692.0 34.253501892089844 43 13 10 10 10 2.784146806480189 35.91764621292486 0.0 3 0.925199524832851 4.483995452665801 692.0 0.2769744160177975 10.0 - - - - - - - 711.7142857142857 3 7 CA7 carbonic anhydrase VII 1629 207 C20140707_OR006_05 C20140707_OR006_05 TB411990.[MT7]-SLLFTSEDDER.2y10_1.heavy 728.358 / 1224.57 968.0 34.253501892089844 43 13 10 10 10 2.784146806480189 35.91764621292486 0.0 3 0.925199524832851 4.483995452665801 968.0 3.2188915662650603 4.0 - - - - - - - 0.0 1 0 CA7 carbonic anhydrase VII 1631 207 C20140707_OR006_05 C20140707_OR006_05 TB411990.[MT7]-SLLFTSEDDER.2y7_1.heavy 728.358 / 851.338 3320.0 34.253501892089844 43 13 10 10 10 2.784146806480189 35.91764621292486 0.0 3 0.925199524832851 4.483995452665801 3320.0 1.5700225486626689 1.0 - - - - - - - 671.7142857142857 6 7 CA7 carbonic anhydrase VII 1633 208 C20140707_OR006_05 C20140707_OR006_05 TB437191.[MT7]-HISFFDFFK[MT7].2y4_1.heavy 738.4 / 700.379 514.0 45.637699127197266 39 17 10 10 2 5.212055117095169 19.18628981339954 0.0 15 0.9795167943155941 8.608337688044148 514.0 4.622015503875969 21.0 - - - - - - - 257.42857142857144 2 7 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1635 208 C20140707_OR006_05 C20140707_OR006_05 TB437191.[MT7]-HISFFDFFK[MT7].2y8_1.heavy 738.4 / 1194.63 514.0 45.637699127197266 39 17 10 10 2 5.212055117095169 19.18628981339954 0.0 15 0.9795167943155941 8.608337688044148 514.0 2.265284974093264 8.0 - - - - - - - 0.0 1 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1637 208 C20140707_OR006_05 C20140707_OR006_05 TB437191.[MT7]-HISFFDFFK[MT7].2y3_1.heavy 738.4 / 585.352 1928.0 45.637699127197266 39 17 10 10 2 5.212055117095169 19.18628981339954 0.0 15 0.9795167943155941 8.608337688044148 1928.0 6.494002782201973 0.0 - - - - - - - 202.28571428571428 3 7 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1639 208 C20140707_OR006_05 C20140707_OR006_05 TB437191.[MT7]-HISFFDFFK[MT7].2y7_1.heavy 738.4 / 1081.55 1799.0 45.637699127197266 39 17 10 10 2 5.212055117095169 19.18628981339954 0.0 15 0.9795167943155941 8.608337688044148 1799.0 13.621240310077518 1.0 - - - - - - - 236.0 3 6 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1641 209 C20140707_OR006_05 C20140707_OR006_05 TB437190.[MT7]-SPDPFGAVAAQK[MT7].3b6_1.heavy 492.608 / 745.364 3925.0 31.97089958190918 28 8 2 10 8 0.7892414288212865 67.51491927323337 0.0 4 0.786766797179679 2.6235964448449245 3925.0 16.433291492125583 0.0 - - - - - - - 243.28571428571428 7 7 TSC22D4 TSC22 domain family, member 4 1643 209 C20140707_OR006_05 C20140707_OR006_05 TB437190.[MT7]-SPDPFGAVAAQK[MT7].3b4_1.heavy 492.608 / 541.274 7196.0 31.97089958190918 28 8 2 10 8 0.7892414288212865 67.51491927323337 0.0 4 0.786766797179679 2.6235964448449245 7196.0 19.17048296992767 1.0 - - - - - - - 196.5 109 8 TSC22D4 TSC22 domain family, member 4 1645 209 C20140707_OR006_05 C20140707_OR006_05 TB437190.[MT7]-SPDPFGAVAAQK[MT7].3y4_1.heavy 492.608 / 561.348 18579.0 31.97089958190918 28 8 2 10 8 0.7892414288212865 67.51491927323337 0.0 4 0.786766797179679 2.6235964448449245 18579.0 42.60462921035796 0.0 - - - - - - - 196.5 37 4 TSC22D4 TSC22 domain family, member 4 1647 209 C20140707_OR006_05 C20140707_OR006_05 TB437190.[MT7]-SPDPFGAVAAQK[MT7].3b7_1.heavy 492.608 / 816.401 4972.0 31.97089958190918 28 8 2 10 8 0.7892414288212865 67.51491927323337 0.0 4 0.786766797179679 2.6235964448449245 4972.0 34.02544529262087 1.0 - - - - - - - 196.5 14 6 TSC22D4 TSC22 domain family, member 4 1649 210 C20140707_OR006_05 C20140707_OR006_05 TB437445.[MT7]-LEILTNLANEANISTLLR.2b3_1.heavy 1071.62 / 500.32 7281.0 52.29399871826172 47 17 10 10 10 6.343799698745692 15.763423302878271 0.0 3 0.9760789656353833 7.963479002126416 7281.0 159.32541176470588 0.0 - - - - - - - 225.83333333333334 14 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1651 210 C20140707_OR006_05 C20140707_OR006_05 TB437445.[MT7]-LEILTNLANEANISTLLR.2b4_1.heavy 1071.62 / 613.404 3979.0 52.29399871826172 47 17 10 10 10 6.343799698745692 15.763423302878271 0.0 3 0.9760789656353833 7.963479002126416 3979.0 46.62376565083865 1.0 - - - - - - - 135.6 8 5 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1653 210 C20140707_OR006_05 C20140707_OR006_05 TB437445.[MT7]-LEILTNLANEANISTLLR.2y10_1.heavy 1071.62 / 1130.62 2201.0 52.29399871826172 47 17 10 10 10 6.343799698745692 15.763423302878271 0.0 3 0.9760789656353833 7.963479002126416 2201.0 3.4604379547493265 0.0 - - - - - - - 192.36363636363637 4 11 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1655 210 C20140707_OR006_05 C20140707_OR006_05 TB437445.[MT7]-LEILTNLANEANISTLLR.2y11_1.heavy 1071.62 / 1201.65 1439.0 52.29399871826172 47 17 10 10 10 6.343799698745692 15.763423302878271 0.0 3 0.9760789656353833 7.963479002126416 1439.0 19.692551448898143 0.0 - - - - - - - 141.22222222222223 2 9 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1657 211 C20140707_OR006_05 C20140707_OR006_05 TB450513.[MT7]-RIGRQEFLLAGPGGLGMFATVAGISQR.4y5_1.heavy 737.411 / 560.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1659 211 C20140707_OR006_05 C20140707_OR006_05 TB450513.[MT7]-RIGRQEFLLAGPGGLGMFATVAGISQR.4y8_1.heavy 737.411 / 831.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1661 211 C20140707_OR006_05 C20140707_OR006_05 TB450513.[MT7]-RIGRQEFLLAGPGGLGMFATVAGISQR.4b16_2.heavy 737.411 / 884.011 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1663 211 C20140707_OR006_05 C20140707_OR006_05 TB450513.[MT7]-RIGRQEFLLAGPGGLGMFATVAGISQR.4y6_1.heavy 737.411 / 631.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1665 212 C20140707_OR006_05 C20140707_OR006_05 TB450514.[MT7]-NFPNAIEHTLQWARDEFEGLFK[MT7].4y4_1.heavy 738.383 / 608.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1667 212 C20140707_OR006_05 C20140707_OR006_05 TB450514.[MT7]-NFPNAIEHTLQWARDEFEGLFK[MT7].4b7_1.heavy 738.383 / 930.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1669 212 C20140707_OR006_05 C20140707_OR006_05 TB450514.[MT7]-NFPNAIEHTLQWARDEFEGLFK[MT7].4b4_1.heavy 738.383 / 617.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1671 212 C20140707_OR006_05 C20140707_OR006_05 TB450514.[MT7]-NFPNAIEHTLQWARDEFEGLFK[MT7].4b5_1.heavy 738.383 / 688.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1673 213 C20140707_OR006_05 C20140707_OR006_05 TB437582.[MT7]-AIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADK[MT7].4b7_1.heavy 1057.54 / 825.459 1413.0 52.91710090637207 40 20 10 6 4 5.6429347790104725 17.721275172621382 0.035999298095703125 7 0.9947023524819552 16.948408597781896 1413.0 0.7200000000000001 0.0 - - - - - - - 171.54545454545453 2 11 BAG3 BCL2-associated athanogene 3 1675 213 C20140707_OR006_05 C20140707_OR006_05 TB437582.[MT7]-AIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADK[MT7].4y10_1.heavy 1057.54 / 1166.57 471.0 52.91710090637207 40 20 10 6 4 5.6429347790104725 17.721275172621382 0.035999298095703125 7 0.9947023524819552 16.948408597781896 471.0 0.18452497551420177 12.0 - - - - - - - 202.14285714285714 2 14 BAG3 BCL2-associated athanogene 3 1677 213 C20140707_OR006_05 C20140707_OR006_05 TB437582.[MT7]-AIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADK[MT7].4b4_1.heavy 1057.54 / 543.326 3847.0 52.91710090637207 40 20 10 6 4 5.6429347790104725 17.721275172621382 0.035999298095703125 7 0.9947023524819552 16.948408597781896 3847.0 4.622734462286915 0.0 - - - - - - - 229.16666666666666 7 12 BAG3 BCL2-associated athanogene 3 1679 213 C20140707_OR006_05 C20140707_OR006_05 TB437582.[MT7]-AIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADK[MT7].4b9_1.heavy 1057.54 / 1052.59 628.0 52.91710090637207 40 20 10 6 4 5.6429347790104725 17.721275172621382 0.035999298095703125 7 0.9947023524819552 16.948408597781896 628.0 2.0 7.0 - - - - - - - 280.57142857142856 2 14 BAG3 BCL2-associated athanogene 3 1681 214 C20140707_OR006_05 C20140707_OR006_05 TB437442.[MT7]-LVYLVTGGC[CAM]GFLGEHVVR.3y7_1.heavy 707.386 / 809.463 11653.0 43.57160186767578 47 17 10 10 10 2.8218508633767128 28.5221947384638 0.0 3 0.971803377905966 7.332263123616974 11653.0 88.40481481481481 0.0 - - - - - - - 209.1818181818182 23 11 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 1683 214 C20140707_OR006_05 C20140707_OR006_05 TB437442.[MT7]-LVYLVTGGC[CAM]GFLGEHVVR.3y6_1.heavy 707.386 / 696.379 22763.0 43.57160186767578 47 17 10 10 10 2.8218508633767128 28.5221947384638 0.0 3 0.971803377905966 7.332263123616974 22763.0 82.85088684503496 0.0 - - - - - - - 251.28571428571428 45 7 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 1685 214 C20140707_OR006_05 C20140707_OR006_05 TB437442.[MT7]-LVYLVTGGC[CAM]GFLGEHVVR.3b4_1.heavy 707.386 / 633.409 29403.0 43.57160186767578 47 17 10 10 10 2.8218508633767128 28.5221947384638 0.0 3 0.971803377905966 7.332263123616974 29403.0 48.04645636544992 0.0 - - - - - - - 257.1 58 10 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 1687 214 C20140707_OR006_05 C20140707_OR006_05 TB437442.[MT7]-LVYLVTGGC[CAM]GFLGEHVVR.3b3_1.heavy 707.386 / 520.325 24118.0 43.57160186767578 47 17 10 10 10 2.8218508633767128 28.5221947384638 0.0 3 0.971803377905966 7.332263123616974 24118.0 47.98384378843788 0.0 - - - - - - - 330.8888888888889 48 9 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 1689 215 C20140707_OR006_05 C20140707_OR006_05 TB412223.[MT7]-ILGIIDAIQDAVGPPK[MT7].3b5_1.heavy 636.718 / 654.467 1399.0 52.405250549316406 40 17 10 3 10 2.8928222383584195 34.5683183273462 0.07960128784179688 3 0.9705594534455477 7.174937935314727 1399.0 16.5609756097561 1.0 - - - - - - - 237.77777777777777 2 9 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 1691 215 C20140707_OR006_05 C20140707_OR006_05 TB412223.[MT7]-ILGIIDAIQDAVGPPK[MT7].3y4_1.heavy 636.718 / 542.342 3456.0 52.405250549316406 40 17 10 3 10 2.8928222383584195 34.5683183273462 0.07960128784179688 3 0.9705594534455477 7.174937935314727 3456.0 2.7983805668016193 0.0 - - - - - - - 170.76923076923077 6 13 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 1693 215 C20140707_OR006_05 C20140707_OR006_05 TB412223.[MT7]-ILGIIDAIQDAVGPPK[MT7].3y5_1.heavy 636.718 / 641.41 987.0 52.405250549316406 40 17 10 3 10 2.8928222383584195 34.5683183273462 0.07960128784179688 3 0.9705594534455477 7.174937935314727 987.0 3.54 1.0 - - - - - - - 0.0 1 0 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 1695 215 C20140707_OR006_05 C20140707_OR006_05 TB412223.[MT7]-ILGIIDAIQDAVGPPK[MT7].3b7_1.heavy 636.718 / 840.531 1975.0 52.405250549316406 40 17 10 3 10 2.8928222383584195 34.5683183273462 0.07960128784179688 3 0.9705594534455477 7.174937935314727 1975.0 23.90070012200823 1.0 - - - - - - - 257.25 4 8 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 1697 216 C20140707_OR006_05 C20140707_OR006_05 TB436928.[MT7]-ELIDYLR.2b3_1.heavy 533.307 / 500.32 6287.0 39.722999572753906 46 16 10 10 10 2.9724884953023296 33.64184593415191 0.0 3 0.9624395762281374 6.347874210588886 6287.0 25.49972027972028 0.0 - - - - - - - 297.9166666666667 12 12 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1699 216 C20140707_OR006_05 C20140707_OR006_05 TB436928.[MT7]-ELIDYLR.2y5_1.heavy 533.307 / 679.377 5573.0 39.722999572753906 46 16 10 10 10 2.9724884953023296 33.64184593415191 0.0 3 0.9624395762281374 6.347874210588886 5573.0 27.280419580419583 0.0 - - - - - - - 309.8333333333333 11 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1701 216 C20140707_OR006_05 C20140707_OR006_05 TB436928.[MT7]-ELIDYLR.2b4_1.heavy 533.307 / 615.347 22576.0 39.722999572753906 46 16 10 10 10 2.9724884953023296 33.64184593415191 0.0 3 0.9624395762281374 6.347874210588886 22576.0 87.35701631701632 0.0 - - - - - - - 268.125 45 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1703 216 C20140707_OR006_05 C20140707_OR006_05 TB436928.[MT7]-ELIDYLR.2y6_1.heavy 533.307 / 792.461 8716.0 39.722999572753906 46 16 10 10 10 2.9724884953023296 33.64184593415191 0.0 3 0.9624395762281374 6.347874210588886 8716.0 48.575982320966425 1.0 - - - - - - - 262.1666666666667 18 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1705 217 C20140707_OR006_05 C20140707_OR006_05 TB437447.[MT7]-AYLYLDEAHSIGALGPTGR.3b6_1.heavy 716.712 / 883.468 13797.0 38.26020050048828 48 18 10 10 10 3.3914712397285935 25.3203640801421 0.0 3 0.9818533577141245 9.14756040092067 13797.0 35.21276102088167 0.0 - - - - - - - 359.1666666666667 27 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1707 217 C20140707_OR006_05 C20140707_OR006_05 TB437447.[MT7]-AYLYLDEAHSIGALGPTGR.3b4_1.heavy 716.712 / 655.357 14516.0 38.26020050048828 48 18 10 10 10 3.3914712397285935 25.3203640801421 0.0 3 0.9818533577141245 9.14756040092067 14516.0 53.8877030162413 0.0 - - - - - - - 316.2 29 5 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1709 217 C20140707_OR006_05 C20140707_OR006_05 TB437447.[MT7]-AYLYLDEAHSIGALGPTGR.3y8_1.heavy 716.712 / 728.405 20265.0 38.26020050048828 48 18 10 10 10 3.3914712397285935 25.3203640801421 0.0 3 0.9818533577141245 9.14756040092067 20265.0 26.016195654102326 1.0 - - - - - - - 233.5 41 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1711 217 C20140707_OR006_05 C20140707_OR006_05 TB437447.[MT7]-AYLYLDEAHSIGALGPTGR.3y10_1.heavy 716.712 / 928.521 26014.0 38.26020050048828 48 18 10 10 10 3.3914712397285935 25.3203640801421 0.0 3 0.9818533577141245 9.14756040092067 26014.0 197.94430839133798 0.0 - - - - - - - 261.27272727272725 52 11 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1713 218 C20140707_OR006_05 C20140707_OR006_05 TB437446.[MT7]-ILGVC[CAM]GMHPHHQETLK[MT7].4y4_1.heavy 537.038 / 634.389 3080.0 25.89169979095459 39 16 9 6 8 7.646232469277087 13.078336344311346 0.038799285888671875 4 0.9616656176253859 6.283055735305189 3080.0 5.736111111111111 0.0 - - - - - - - 149.6 6 10 CASP2 caspase 2, apoptosis-related cysteine peptidase 1715 218 C20140707_OR006_05 C20140707_OR006_05 TB437446.[MT7]-ILGVC[CAM]GMHPHHQETLK[MT7].4b4_1.heavy 537.038 / 527.367 2904.0 25.89169979095459 39 16 9 6 8 7.646232469277087 13.078336344311346 0.038799285888671875 4 0.9616656176253859 6.283055735305189 2904.0 2.619375 0.0 - - - - - - - 280.0 5 11 CASP2 caspase 2, apoptosis-related cysteine peptidase 1717 218 C20140707_OR006_05 C20140707_OR006_05 TB437446.[MT7]-ILGVC[CAM]GMHPHHQETLK[MT7].4y3_1.heavy 537.038 / 505.347 5191.0 25.89169979095459 39 16 9 6 8 7.646232469277087 13.078336344311346 0.038799285888671875 4 0.9616656176253859 6.283055735305189 5191.0 4.424147727272728 2.0 - - - - - - - 666.2857142857143 12 7 CASP2 caspase 2, apoptosis-related cysteine peptidase 1719 218 C20140707_OR006_05 C20140707_OR006_05 TB437446.[MT7]-ILGVC[CAM]GMHPHHQETLK[MT7].4b6_1.heavy 537.038 / 744.419 4047.0 25.89169979095459 39 16 9 6 8 7.646232469277087 13.078336344311346 0.038799285888671875 4 0.9616656176253859 6.283055735305189 4047.0 31.042329545454542 0.0 - - - - - - - 212.66666666666666 8 12 CASP2 caspase 2, apoptosis-related cysteine peptidase 1721 219 C20140707_OR006_05 C20140707_OR006_05 TB412227.[MT7]-LQGAGLPMESAILHGK[MT7].3b6_1.heavy 637.364 / 684.416 14392.0 37.28049850463867 44 14 10 10 10 1.6667792275457443 55.14795469116832 0.0 3 0.9410712521478047 5.0587432540623345 14392.0 8.770819333196458 1.0 - - - - - - - 432.0 28 4 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1723 219 C20140707_OR006_05 C20140707_OR006_05 TB412227.[MT7]-LQGAGLPMESAILHGK[MT7].3b4_1.heavy 637.364 / 514.311 2735.0 37.28049850463867 44 14 10 10 10 1.6667792275457443 55.14795469116832 0.0 3 0.9410712521478047 5.0587432540623345 2735.0 0.4805740745597647 3.0 - - - - - - - 360.0 9 4 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1725 219 C20140707_OR006_05 C20140707_OR006_05 TB412227.[MT7]-LQGAGLPMESAILHGK[MT7].3b5_1.heavy 637.364 / 571.332 10794.0 37.28049850463867 44 14 10 10 10 1.6667792275457443 55.14795469116832 0.0 3 0.9410712521478047 5.0587432540623345 10794.0 15.475485581951293 0.0 - - - - - - - 308.57142857142856 21 7 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1727 219 C20140707_OR006_05 C20140707_OR006_05 TB412227.[MT7]-LQGAGLPMESAILHGK[MT7].3y4_1.heavy 637.364 / 598.379 10219.0 37.28049850463867 44 14 10 10 10 1.6667792275457443 55.14795469116832 0.0 3 0.9410712521478047 5.0587432540623345 10219.0 17.421026350792744 1.0 - - - - - - - 336.0 20 3 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1729 220 C20140707_OR006_05 C20140707_OR006_05 TB437247.[MT7]-YLMIEEYLTK[MT7].3y3_1.heavy 530.961 / 505.347 4907.0 45.38589859008789 42 12 10 10 10 1.2339824938415576 52.890438385268396 0.0 3 0.895518355480763 3.7843078823060416 4907.0 45.646511627906975 0.0 - - - - - - - 258.0 9 3 BAG3 BCL2-associated athanogene 3 1731 220 C20140707_OR006_05 C20140707_OR006_05 TB437247.[MT7]-YLMIEEYLTK[MT7].3b4_1.heavy 530.961 / 665.381 2841.0 45.38589859008789 42 12 10 10 10 1.2339824938415576 52.890438385268396 0.0 3 0.895518355480763 3.7843078823060416 2841.0 27.89612403100775 0.0 - - - - - - - 258.0 5 3 BAG3 BCL2-associated athanogene 3 1733 220 C20140707_OR006_05 C20140707_OR006_05 TB437247.[MT7]-YLMIEEYLTK[MT7].3b5_1.heavy 530.961 / 794.424 2453.0 45.38589859008789 42 12 10 10 10 1.2339824938415576 52.890438385268396 0.0 3 0.895518355480763 3.7843078823060416 2453.0 30.42480620155039 0.0 - - - - - - - 129.0 4 1 BAG3 BCL2-associated athanogene 3 1735 220 C20140707_OR006_05 C20140707_OR006_05 TB437247.[MT7]-YLMIEEYLTK[MT7].3b3_1.heavy 530.961 / 552.297 3486.0 45.38589859008789 42 12 10 10 10 1.2339824938415576 52.890438385268396 0.0 3 0.895518355480763 3.7843078823060416 3486.0 8.28111859740636 1.0 - - - - - - - 387.0 7 2 BAG3 BCL2-associated athanogene 3 1737 221 C20140707_OR006_05 C20140707_OR006_05 TB437386.[MT7]-IK[MT7]PGISEFATSPEK[MT7].3y3_1.heavy 646.042 / 517.31 50581.0 30.285099983215332 44 20 10 6 8 11.096865571331342 9.01155370020424 0.03780174255371094 4 0.9954512713934849 18.291637890558345 50581.0 58.39150001570116 0.0 - - - - - - - 415.6 101 5 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1739 221 C20140707_OR006_05 C20140707_OR006_05 TB437386.[MT7]-IK[MT7]PGISEFATSPEK[MT7].3b7_1.heavy 646.042 / 1013.62 8552.0 30.285099983215332 44 20 10 6 8 11.096865571331342 9.01155370020424 0.03780174255371094 4 0.9954512713934849 18.291637890558345 8552.0 21.076102189990664 0.0 - - - - - - - 244.28571428571428 17 7 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1741 221 C20140707_OR006_05 C20140707_OR006_05 TB437386.[MT7]-IK[MT7]PGISEFATSPEK[MT7].3y5_1.heavy 646.042 / 705.39 12340.0 30.285099983215332 44 20 10 6 8 11.096865571331342 9.01155370020424 0.03780174255371094 4 0.9954512713934849 18.291637890558345 12340.0 18.176759410801964 1.0 - - - - - - - 244.33333333333334 28 9 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1743 221 C20140707_OR006_05 C20140707_OR006_05 TB437386.[MT7]-IK[MT7]PGISEFATSPEK[MT7].3b7_2.heavy 646.042 / 507.315 33598.0 30.285099983215332 44 20 10 6 8 11.096865571331342 9.01155370020424 0.03780174255371094 4 0.9954512713934849 18.291637890558345 33598.0 95.52762530046999 0.0 - - - - - - - 326.0 67 6 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1745 222 C20140707_OR006_05 C20140707_OR006_05 TB412024.[MT7]-TVVTGGPLEGPYR.2y12_1.heavy 745.41 / 1244.66 774.0 31.74570083618164 43 13 10 10 10 1.9904758964449647 43.201006255584204 0.0 3 0.9171198180344569 4.256874443026127 774.0 0.6399999999999999 6.0 - - - - - - - 0.0 1 0 CA7 carbonic anhydrase VII 1747 222 C20140707_OR006_05 C20140707_OR006_05 TB412024.[MT7]-TVVTGGPLEGPYR.2y9_1.heavy 745.41 / 945.479 4903.0 31.74570083618164 43 13 10 10 10 1.9904758964449647 43.201006255584204 0.0 3 0.9171198180344569 4.256874443026127 4903.0 15.773217054263565 0.0 - - - - - - - 258.0 9 4 CA7 carbonic anhydrase VII 1749 222 C20140707_OR006_05 C20140707_OR006_05 TB412024.[MT7]-TVVTGGPLEGPYR.2y10_1.heavy 745.41 / 1046.53 4258.0 31.74570083618164 43 13 10 10 10 1.9904758964449647 43.201006255584204 0.0 3 0.9171198180344569 4.256874443026127 4258.0 8.051937984496124 1.0 - - - - - - - 322.5 8 2 CA7 carbonic anhydrase VII 1751 222 C20140707_OR006_05 C20140707_OR006_05 TB412024.[MT7]-TVVTGGPLEGPYR.2y11_1.heavy 745.41 / 1145.59 1548.0 31.74570083618164 43 13 10 10 10 1.9904758964449647 43.201006255584204 0.0 3 0.9171198180344569 4.256874443026127 1548.0 2.28 0.0 - - - - - - - 209.625 3 8 CA7 carbonic anhydrase VII 1753 223 C20140707_OR006_05 C20140707_OR006_05 TB437045.[MT7]-LQILNLGAK[MT7].3b4_1.heavy 419.943 / 612.42 4456.0 38.70009994506836 40 10 10 10 10 0.8198187332733825 78.70736631611351 0.0 3 0.8240130425112525 2.8975895796318425 4456.0 38.074044444444446 0.0 - - - - - - - 287.3333333333333 8 3 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1755 223 C20140707_OR006_05 C20140707_OR006_05 TB437045.[MT7]-LQILNLGAK[MT7].3b5_1.heavy 419.943 / 726.463 3450.0 38.70009994506836 40 10 10 10 10 0.8198187332733825 78.70736631611351 0.0 3 0.8240130425112525 2.8975895796318425 3450.0 26.395905923344948 0.0 - - - - - - - 144.0 6 1 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1757 223 C20140707_OR006_05 C20140707_OR006_05 TB437045.[MT7]-LQILNLGAK[MT7].3y4_1.heavy 419.943 / 532.357 4744.0 38.70009994506836 40 10 10 10 10 0.8198187332733825 78.70736631611351 0.0 3 0.8240130425112525 2.8975895796318425 4744.0 34.267720599598206 0.0 - - - - - - - 239.66666666666666 9 3 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1759 223 C20140707_OR006_05 C20140707_OR006_05 TB437045.[MT7]-LQILNLGAK[MT7].3b3_1.heavy 419.943 / 499.336 4456.0 38.70009994506836 40 10 10 10 10 0.8198187332733825 78.70736631611351 0.0 3 0.8240130425112525 2.8975895796318425 4456.0 4.508837944664031 1.0 - - - - - - - 239.66666666666666 12 3 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1761 224 C20140707_OR006_05 C20140707_OR006_05 TB437245.[MT7]-DNPGVVTC[CAM]LDEAR.2y8_1.heavy 795.389 / 963.456 5084.0 29.93150043487549 34 9 10 5 10 1.6907645673067788 40.728304398389845 0.04139900207519531 3 0.8068907466980717 2.7619160834835217 5084.0 63.02479338842976 0.0 - - - - - - - 121.0 10 3 UBA1 ubiquitin-like modifier activating enzyme 1 1763 224 C20140707_OR006_05 C20140707_OR006_05 TB437245.[MT7]-DNPGVVTC[CAM]LDEAR.2b4_1.heavy 795.389 / 528.253 2905.0 29.93150043487549 34 9 10 5 10 1.6907645673067788 40.728304398389845 0.04139900207519531 3 0.8068907466980717 2.7619160834835217 2905.0 7.202479338842975 0.0 - - - - - - - 332.75 5 8 UBA1 ubiquitin-like modifier activating enzyme 1 1765 224 C20140707_OR006_05 C20140707_OR006_05 TB437245.[MT7]-DNPGVVTC[CAM]LDEAR.2b5_1.heavy 795.389 / 627.322 4478.0 29.93150043487549 34 9 10 5 10 1.6907645673067788 40.728304398389845 0.04139900207519531 3 0.8068907466980717 2.7619160834835217 4478.0 35.712975206611574 0.0 - - - - - - - 282.3333333333333 8 3 UBA1 ubiquitin-like modifier activating enzyme 1 1767 224 C20140707_OR006_05 C20140707_OR006_05 TB437245.[MT7]-DNPGVVTC[CAM]LDEAR.2y11_1.heavy 795.389 / 1216.6 2542.0 29.93150043487549 34 9 10 5 10 1.6907645673067788 40.728304398389845 0.04139900207519531 3 0.8068907466980717 2.7619160834835217 2542.0 22.12870523415978 0.0 - - - - - - - 262.1666666666667 5 6 UBA1 ubiquitin-like modifier activating enzyme 1 1769 225 C20140707_OR006_05 C20140707_OR006_05 TB412026.[MT7]-NVIEAC[CAM]VQTGTR.3y6_1.heavy 497.928 / 661.363 2023.0 27.562599182128906 50 20 10 10 10 6.394702502578813 15.637944057549616 0.0 3 0.9932833722574053 15.050237298203713 2023.0 11.03809729861875 2.0 - - - - - - - 256.53846153846155 7 13 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 1771 225 C20140707_OR006_05 C20140707_OR006_05 TB412026.[MT7]-NVIEAC[CAM]VQTGTR.3b4_1.heavy 497.928 / 600.347 6171.0 27.562599182128906 50 20 10 10 10 6.394702502578813 15.637944057549616 0.0 3 0.9932833722574053 15.050237298203713 6171.0 19.396214235799143 0.0 - - - - - - - 266.45454545454544 12 11 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 1773 225 C20140707_OR006_05 C20140707_OR006_05 TB412026.[MT7]-NVIEAC[CAM]VQTGTR.3b5_1.heavy 497.928 / 671.385 3035.0 27.562599182128906 50 20 10 10 10 6.394702502578813 15.637944057549616 0.0 3 0.9932833722574053 15.050237298203713 3035.0 16.01156337856008 0.0 - - - - - - - 236.0 6 6 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 1775 225 C20140707_OR006_05 C20140707_OR006_05 TB412026.[MT7]-NVIEAC[CAM]VQTGTR.3y5_1.heavy 497.928 / 562.294 6171.0 27.562599182128906 50 20 10 10 10 6.394702502578813 15.637944057549616 0.0 3 0.9932833722574053 15.050237298203713 6171.0 47.148069306930694 0.0 - - - - - - - 231.0 12 7 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 1777 226 C20140707_OR006_05 C20140707_OR006_05 TB412327.[MT7]-VSDYISPLLNFAAEHVPR.3y7_1.heavy 724.724 / 779.416 7497.0 50.51620101928711 47 17 10 10 10 3.732886345749155 26.788921691622235 0.0 3 0.9751685303036257 7.815528607117029 7497.0 8.93435907295676 1.0 - - - - - - - 104.0 14 1 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1779 226 C20140707_OR006_05 C20140707_OR006_05 TB412327.[MT7]-VSDYISPLLNFAAEHVPR.3b6_1.heavy 724.724 / 809.416 6977.0 50.51620101928711 47 17 10 10 10 3.732886345749155 26.788921691622235 0.0 3 0.9751685303036257 7.815528607117029 6977.0 1.6529043121540266 1.0 - - - - - - - 286.5 13 4 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1781 226 C20140707_OR006_05 C20140707_OR006_05 TB412327.[MT7]-VSDYISPLLNFAAEHVPR.3b4_1.heavy 724.724 / 609.3 10100.0 50.51620101928711 47 17 10 10 10 3.732886345749155 26.788921691622235 0.0 3 0.9751685303036257 7.815528607117029 10100.0 1.3303362896255913 2.0 - - - - - - - 104.0 20 2 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1783 226 C20140707_OR006_05 C20140707_OR006_05 TB412327.[MT7]-VSDYISPLLNFAAEHVPR.3b5_1.heavy 724.724 / 722.384 3853.0 50.51620101928711 47 17 10 10 10 3.732886345749155 26.788921691622235 0.0 3 0.9751685303036257 7.815528607117029 3853.0 1.6795151425919463 4.0 - - - - - - - 242.66666666666666 15 3 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1785 227 C20140707_OR006_05 C20140707_OR006_05 TB450124.[MT7]-GMFEPYLK[MT7].2y4_1.heavy 636.849 / 664.415 30038.0 36.960999488830566 43 18 10 5 10 7.589864681914375 13.175465464922784 0.044399261474609375 3 0.9851751993330998 10.123482741994222 30038.0 152.89125899280575 0.0 - - - - - - - 278.0 60 8 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 1787 227 C20140707_OR006_05 C20140707_OR006_05 TB450124.[MT7]-GMFEPYLK[MT7].2b4_1.heavy 636.849 / 609.282 25727.0 36.960999488830566 43 18 10 5 10 7.589864681914375 13.175465464922784 0.044399261474609375 3 0.9851751993330998 10.123482741994222 25727.0 46.175131635931145 0.0 - - - - - - - 712.375 51 8 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 1789 227 C20140707_OR006_05 C20140707_OR006_05 TB450124.[MT7]-GMFEPYLK[MT7].2y6_1.heavy 636.849 / 940.526 4728.0 36.960999488830566 43 18 10 5 10 7.589864681914375 13.175465464922784 0.044399261474609375 3 0.9851751993330998 10.123482741994222 4728.0 41.83769784172662 0.0 - - - - - - - 254.83333333333334 9 12 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 1791 227 C20140707_OR006_05 C20140707_OR006_05 TB450124.[MT7]-GMFEPYLK[MT7].2b5_1.heavy 636.849 / 706.335 3616.0 36.960999488830566 43 18 10 5 10 7.589864681914375 13.175465464922784 0.044399261474609375 3 0.9851751993330998 10.123482741994222 3616.0 11.879904076738608 0.0 - - - - - - - 297.85714285714283 7 7 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 1793 228 C20140707_OR006_05 C20140707_OR006_05 TB450265.[MT7]-DIVMPTYDLTDSVLETMGR.3y6_1.heavy 767.381 / 706.355 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1795 228 C20140707_OR006_05 C20140707_OR006_05 TB450265.[MT7]-DIVMPTYDLTDSVLETMGR.3b4_1.heavy 767.381 / 603.329 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1797 228 C20140707_OR006_05 C20140707_OR006_05 TB450265.[MT7]-DIVMPTYDLTDSVLETMGR.3y8_1.heavy 767.381 / 892.456 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1799 228 C20140707_OR006_05 C20140707_OR006_05 TB450265.[MT7]-DIVMPTYDLTDSVLETMGR.3y10_1.heavy 767.381 / 1108.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1801 229 C20140707_OR006_05 C20140707_OR006_05 TB411822.[MT7]-C[CAM]FTC[CAM]STC[CAM]R.2y4_1.heavy 618.258 / 523.229 977.0 20.615166346232098 42 20 10 6 6 4.6581923050673035 21.467555105274933 0.03260040283203125 5 0.9916665212659775 13.509744746125484 977.0 2.156669911313 5.0 - - - - - - - 696.1111111111111 5 9 LMO4 LIM domain only 4 1803 229 C20140707_OR006_05 C20140707_OR006_05 TB411822.[MT7]-C[CAM]FTC[CAM]STC[CAM]R.2y5_1.heavy 618.258 / 683.26 N/A 20.615166346232098 42 20 10 6 6 4.6581923050673035 21.467555105274933 0.03260040283203125 5 0.9916665212659775 13.509744746125484 0.0 0.0 41.0 - - - - - - - 145.69230769230768 2 13 LMO4 LIM domain only 4 1805 229 C20140707_OR006_05 C20140707_OR006_05 TB411822.[MT7]-C[CAM]FTC[CAM]STC[CAM]R.2y6_1.heavy 618.258 / 784.308 2127.0 20.615166346232098 42 20 10 6 6 4.6581923050673035 21.467555105274933 0.03260040283203125 5 0.9916665212659775 13.509744746125484 2127.0 22.2162891809909 0.0 - - - - - - - 148.25 4 12 LMO4 LIM domain only 4 1807 229 C20140707_OR006_05 C20140707_OR006_05 TB411822.[MT7]-C[CAM]FTC[CAM]STC[CAM]R.2y7_1.heavy 618.258 / 931.376 4542.0 20.615166346232098 42 20 10 6 6 4.6581923050673035 21.467555105274933 0.03260040283203125 5 0.9916665212659775 13.509744746125484 4542.0 43.49114256825075 0.0 - - - - - - - 109.45454545454545 9 11 LMO4 LIM domain only 4 1809 230 C20140707_OR006_05 C20140707_OR006_05 TB437387.[MT7]-IK[MT7]PGISEFATSPEK[MT7].4b8_2.heavy 484.783 / 580.849 7510.0 30.265900293986004 43 20 10 3 10 12.815814883409201 7.802859272683134 0.07649993896484375 3 0.9968990479038878 22.156571060976436 7510.0 29.261285103125793 0.0 - - - - - - - 257.125 15 8 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1811 230 C20140707_OR006_05 C20140707_OR006_05 TB437387.[MT7]-IK[MT7]PGISEFATSPEK[MT7].4b7_1.heavy 484.783 / 1013.62 N/A 30.265900293986004 43 20 10 3 10 12.815814883409201 7.802859272683134 0.07649993896484375 3 0.9968990479038878 22.156571060976436 485.0 3.9882231404958675 2.0 - - - - - - - 0.0 0 0 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1813 230 C20140707_OR006_05 C20140707_OR006_05 TB437387.[MT7]-IK[MT7]PGISEFATSPEK[MT7].4b7_2.heavy 484.783 / 507.315 17442.0 30.265900293986004 43 20 10 3 10 12.815814883409201 7.802859272683134 0.07649993896484375 3 0.9968990479038878 22.156571060976436 17442.0 9.503346175013759 1.0 - - - - - - - 254.2 34 10 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1815 230 C20140707_OR006_05 C20140707_OR006_05 TB437387.[MT7]-IK[MT7]PGISEFATSPEK[MT7].4y3_1.heavy 484.783 / 517.31 20592.0 30.265900293986004 43 20 10 3 10 12.815814883409201 7.802859272683134 0.07649993896484375 3 0.9968990479038878 22.156571060976436 20592.0 80.23280730273852 0.0 - - - - - - - 309.3333333333333 41 9 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1817 231 C20140707_OR006_05 C20140707_OR006_05 TB411997.[MT7]-NASELFPAVVK[MT7].3y5_1.heavy 488.288 / 657.442 9482.0 36.80649948120117 40 18 10 2 10 3.262258699237808 30.653608195868685 0.08750152587890625 3 0.9837721597445915 9.674821198670564 9482.0 35.26544425087108 0.0 - - - - - - - 215.5 18 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1819 231 C20140707_OR006_05 C20140707_OR006_05 TB411997.[MT7]-NASELFPAVVK[MT7].3b4_1.heavy 488.288 / 546.264 19251.0 36.80649948120117 40 18 10 2 10 3.262258699237808 30.653608195868685 0.08750152587890625 3 0.9837721597445915 9.674821198670564 19251.0 71.44989327146172 0.0 - - - - - - - 144.0 38 1 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1821 231 C20140707_OR006_05 C20140707_OR006_05 TB411997.[MT7]-NASELFPAVVK[MT7].3b5_1.heavy 488.288 / 659.348 11062.0 36.80649948120117 40 18 10 2 10 3.262258699237808 30.653608195868685 0.08750152587890625 3 0.9837721597445915 9.674821198670564 11062.0 45.569953330118906 0.0 - - - - - - - 303.22222222222223 22 9 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1823 231 C20140707_OR006_05 C20140707_OR006_05 TB411997.[MT7]-NASELFPAVVK[MT7].3y4_1.heavy 488.288 / 560.389 6896.0 36.80649948120117 40 18 10 2 10 3.262258699237808 30.653608195868685 0.08750152587890625 3 0.9837721597445915 9.674821198670564 6896.0 32.95988555123116 0.0 - - - - - - - 316.0 13 5 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1825 232 C20140707_OR006_05 C20140707_OR006_05 TB437241.[MT7]-RFLMSYLNEVR.3b5_1.heavy 524.621 / 779.435 5602.0 38.5932502746582 45 20 10 5 10 11.262296348111805 8.879183863490294 0.04470062255859375 3 0.9924128532947065 14.159507836339987 5602.0 47.924501086956525 0.0 - - - - - - - 191.66666666666666 11 3 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1827 232 C20140707_OR006_05 C20140707_OR006_05 TB437241.[MT7]-RFLMSYLNEVR.3b3_1.heavy 524.621 / 561.363 2442.0 38.5932502746582 45 20 10 5 10 11.262296348111805 8.879183863490294 0.04470062255859375 3 0.9924128532947065 14.159507836339987 2442.0 13.613937282229966 0.0 - - - - - - - 239.33333333333334 4 6 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1829 232 C20140707_OR006_05 C20140707_OR006_05 TB437241.[MT7]-RFLMSYLNEVR.3y4_1.heavy 524.621 / 517.273 11060.0 38.5932502746582 45 20 10 5 10 11.262296348111805 8.879183863490294 0.04470062255859375 3 0.9924128532947065 14.159507836339987 11060.0 42.37013785790032 0.0 - - - - - - - 328.2857142857143 22 7 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1831 232 C20140707_OR006_05 C20140707_OR006_05 TB437241.[MT7]-RFLMSYLNEVR.3y5_1.heavy 524.621 / 630.357 9911.0 38.5932502746582 45 20 10 5 10 11.262296348111805 8.879183863490294 0.04470062255859375 3 0.9924128532947065 14.159507836339987 9911.0 98.19391356949282 0.0 - - - - - - - 239.5 19 6 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1833 233 C20140707_OR006_05 C20140707_OR006_05 TB412379.[MT7]-GTGDFDLC[CAM]RETIQPFMNK[MT7].4y5_1.heavy 605.051 / 780.419 13373.0 37.53990173339844 43 13 10 10 10 3.3105299514418656 30.206644092268697 0.0 3 0.9183256240543387 4.2886270340531265 13373.0 41.69408666019994 0.0 - - - - - - - 383.3333333333333 26 9 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1835 233 C20140707_OR006_05 C20140707_OR006_05 TB412379.[MT7]-GTGDFDLC[CAM]RETIQPFMNK[MT7].4b11_2.heavy 605.051 / 698.818 15387.0 37.53990173339844 43 13 10 10 10 3.3105299514418656 30.206644092268697 0.0 3 0.9183256240543387 4.2886270340531265 15387.0 18.07437403400309 0.0 - - - - - - - 311.6666666666667 30 6 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1837 233 C20140707_OR006_05 C20140707_OR006_05 TB412379.[MT7]-GTGDFDLC[CAM]RETIQPFMNK[MT7].4y3_1.heavy 605.051 / 536.298 31348.0 37.53990173339844 43 13 10 10 10 3.3105299514418656 30.206644092268697 0.0 3 0.9183256240543387 4.2886270340531265 31348.0 30.382118649406053 0.0 - - - - - - - 395.25 62 4 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1839 233 C20140707_OR006_05 C20140707_OR006_05 TB412379.[MT7]-GTGDFDLC[CAM]RETIQPFMNK[MT7].4b6_1.heavy 605.051 / 737.322 9778.0 37.53990173339844 43 13 10 10 10 3.3105299514418656 30.206644092268697 0.0 3 0.9183256240543387 4.2886270340531265 9778.0 18.191847703387985 0.0 - - - - - - - 311.6666666666667 19 6 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1841 234 C20140707_OR006_05 C20140707_OR006_05 TB436835.[MT7]-AASALNR.2y5_1.heavy 423.749 / 560.315 4726.0 17.995399475097656 48 18 10 10 10 5.626629989629385 17.77262769798495 0.0 3 0.9871132765836613 10.859844935661949 4726.0 171.7719230769231 0.0 - - - - - - - 80.88888888888889 9 9 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1843 234 C20140707_OR006_05 C20140707_OR006_05 TB436835.[MT7]-AASALNR.2b4_1.heavy 423.749 / 445.253 6337.0 17.995399475097656 48 18 10 10 10 5.626629989629385 17.77262769798495 0.0 3 0.9871132765836613 10.859844935661949 6337.0 82.25913461538461 0.0 - - - - - - - 116.0 12 13 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1845 234 C20140707_OR006_05 C20140707_OR006_05 TB436835.[MT7]-AASALNR.2y6_1.heavy 423.749 / 631.352 14803.0 17.995399475097656 48 18 10 10 10 5.626629989629385 17.77262769798495 0.0 3 0.9871132765836613 10.859844935661949 14803.0 296.7716826923077 0.0 - - - - - - - 156.0 29 16 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1847 234 C20140707_OR006_05 C20140707_OR006_05 TB436835.[MT7]-AASALNR.2b5_1.heavy 423.749 / 558.337 3168.0 17.995399475097656 48 18 10 10 10 5.626629989629385 17.77262769798495 0.0 3 0.9871132765836613 10.859844935661949 3168.0 25.20678970766536 0.0 - - - - - - - 108.0 6 13 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1849 235 C20140707_OR006_05 C20140707_OR006_05 TB436834.[MT7]-RFLVTVIK[MT7].3y3_1.heavy 421.951 / 503.367 6294.0 33.28432559967041 39 13 10 6 10 1.172344482969022 61.05593412280925 0.038501739501953125 3 0.9010680956412614 3.8908720500106697 6294.0 13.799082201954784 0.0 - - - - - - - 273.8 12 5 XPO1 exportin 1 (CRM1 homolog, yeast) 1851 235 C20140707_OR006_05 C20140707_OR006_05 TB436834.[MT7]-RFLVTVIK[MT7].3b4_1.heavy 421.951 / 660.431 2873.0 33.28432559967041 39 13 10 6 10 1.172344482969022 61.05593412280925 0.038501739501953125 3 0.9010680956412614 3.8908720500106697 2873.0 30.61737226277372 0.0 - - - - - - - 246.4 5 5 XPO1 exportin 1 (CRM1 homolog, yeast) 1853 235 C20140707_OR006_05 C20140707_OR006_05 TB436834.[MT7]-RFLVTVIK[MT7].3y4_1.heavy 421.951 / 604.415 3831.0 33.28432559967041 39 13 10 6 10 1.172344482969022 61.05593412280925 0.038501739501953125 3 0.9010680956412614 3.8908720500106697 3831.0 25.167153284671535 0.0 - - - - - - - 182.66666666666666 7 3 XPO1 exportin 1 (CRM1 homolog, yeast) 1855 235 C20140707_OR006_05 C20140707_OR006_05 TB436834.[MT7]-RFLVTVIK[MT7].3b3_1.heavy 421.951 / 561.363 3557.0 33.28432559967041 39 13 10 6 10 1.172344482969022 61.05593412280925 0.038501739501953125 3 0.9010680956412614 3.8908720500106697 3557.0 3.4725007651141055 2.0 - - - - - - - 301.0 8 5 XPO1 exportin 1 (CRM1 homolog, yeast) 1857 236 C20140707_OR006_05 C20140707_OR006_05 TB436837.[MT7]-IYIDSLMK[MT7].3b4_1.heavy 424.249 / 649.368 1435.0 39.08530044555664 39 14 10 5 10 2.7011630663005164 28.898279215620704 0.0447998046875 3 0.939936088430158 5.010227394303157 1435.0 10.631171049239494 1.0 - - - - - - - 258.6 2 5 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 1859 236 C20140707_OR006_05 C20140707_OR006_05 TB436837.[MT7]-IYIDSLMK[MT7].3b5_1.heavy 424.249 / 736.4 861.0 39.08530044555664 39 14 10 5 10 2.7011630663005164 28.898279215620704 0.0447998046875 3 0.939936088430158 5.010227394303157 861.0 11.958333333333334 0.0 - - - - - - - 0.0 1 0 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 1861 236 C20140707_OR006_05 C20140707_OR006_05 TB436837.[MT7]-IYIDSLMK[MT7].3y4_1.heavy 424.249 / 622.371 718.0 39.08530044555664 39 14 10 5 10 2.7011630663005164 28.898279215620704 0.0447998046875 3 0.939936088430158 5.010227394303157 718.0 5.985647073988141 0.0 - - - - - - - 0.0 1 0 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 1863 236 C20140707_OR006_05 C20140707_OR006_05 TB436837.[MT7]-IYIDSLMK[MT7].3b3_1.heavy 424.249 / 534.341 1722.0 39.08530044555664 39 14 10 5 10 2.7011630663005164 28.898279215620704 0.0447998046875 3 0.939936088430158 5.010227394303157 1722.0 11.817696062909015 1.0 - - - - - - - 239.66666666666666 3 3 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 1865 237 C20140707_OR006_05 C20140707_OR006_05 TB411617.[MT7]-EDIDTALLK[MT7].3y3_1.heavy 435.922 / 517.383 3553.0 33.43090057373047 33 11 2 10 10 1.3258836084617924 50.64518188407578 0.0 3 0.8602644903599194 3.2622481665109286 3553.0 7.145651305974069 0.0 - - - - - - - 703.0 7 7 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1867 237 C20140707_OR006_05 C20140707_OR006_05 TB411617.[MT7]-EDIDTALLK[MT7].3b4_1.heavy 435.922 / 617.29 3690.0 33.43090057373047 33 11 2 10 10 1.3258836084617924 50.64518188407578 0.0 3 0.8602644903599194 3.2622481665109286 3690.0 37.21374027432421 0.0 - - - - - - - 239.25 7 4 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1869 237 C20140707_OR006_05 C20140707_OR006_05 TB411617.[MT7]-EDIDTALLK[MT7].3y7_2.heavy 435.922 / 459.293 137.0 33.43090057373047 33 11 2 10 10 1.3258836084617924 50.64518188407578 0.0 3 0.8602644903599194 3.2622481665109286 137.0 0.10018281535648994 31.0 - - - - - - - 239.25 16 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1871 237 C20140707_OR006_05 C20140707_OR006_05 TB411617.[MT7]-EDIDTALLK[MT7].3b3_1.heavy 435.922 / 502.263 3963.0 33.43090057373047 33 11 2 10 10 1.3258836084617924 50.64518188407578 0.0 3 0.8602644903599194 3.2622481665109286 3963.0 33.31374027432422 0.0 - - - - - - - 164.2 7 5 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1873 238 C20140707_OR006_05 C20140707_OR006_05 TB437332.[MT7]-NHAGSPGC[CAM]EESDAGK[MT7].3y6_1.heavy 601.944 / 750.375 1732.0 15.538599967956543 50 20 10 10 10 8.295514232995844 12.054707784388427 0.0 3 0.9956317200944927 18.6658993746462 1732.0 50.19940566037735 0.0 - - - - - - - 112.35714285714286 3 14 CASP2 caspase 2, apoptosis-related cysteine peptidase 1875 238 C20140707_OR006_05 C20140707_OR006_05 TB437332.[MT7]-NHAGSPGC[CAM]EESDAGK[MT7].3b5_1.heavy 601.944 / 611.302 1546.0 15.538599967956543 50 20 10 10 10 8.295514232995844 12.054707784388427 0.0 3 0.9956317200944927 18.6658993746462 1546.0 20.22803738317757 0.0 - - - - - - - 93.38888888888889 3 18 CASP2 caspase 2, apoptosis-related cysteine peptidase 1877 238 C20140707_OR006_05 C20140707_OR006_05 TB437332.[MT7]-NHAGSPGC[CAM]EESDAGK[MT7].3y4_1.heavy 601.944 / 534.3 2905.0 15.538599967956543 50 20 10 10 10 8.295514232995844 12.054707784388427 0.0 3 0.9956317200944927 18.6658993746462 2905.0 35.275 0.0 - - - - - - - 118.3125 5 16 CASP2 caspase 2, apoptosis-related cysteine peptidase 1879 238 C20140707_OR006_05 C20140707_OR006_05 TB437332.[MT7]-NHAGSPGC[CAM]EESDAGK[MT7].3y5_1.heavy 601.944 / 621.332 5730.0 15.538599967956543 50 20 10 10 10 8.295514232995844 12.054707784388427 0.0 3 0.9956317200944927 18.6658993746462 5730.0 95.26125 0.0 - - - - - - - 112.0 11 15 CASP2 caspase 2, apoptosis-related cysteine peptidase 1881 239 C20140707_OR006_05 C20140707_OR006_05 TB411811.[MT7]-TALQVYDK[MT7].2y4_1.heavy 613.355 / 668.374 3027.0 27.02829933166504 50 20 10 10 10 27.451357752306553 3.64280706631342 0.0 3 0.9968468796861835 21.972421283028474 3027.0 15.184950495049506 0.0 - - - - - - - 245.28571428571428 6 7 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1883 239 C20140707_OR006_05 C20140707_OR006_05 TB411811.[MT7]-TALQVYDK[MT7].2y5_1.heavy 613.355 / 796.432 2220.0 27.02829933166504 50 20 10 10 10 27.451357752306553 3.64280706631342 0.0 3 0.9968468796861835 21.972421283028474 2220.0 24.617821782178222 0.0 - - - - - - - 277.75 4 8 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1885 239 C20140707_OR006_05 C20140707_OR006_05 TB411811.[MT7]-TALQVYDK[MT7].2b4_1.heavy 613.355 / 558.337 5045.0 27.02829933166504 50 20 10 10 10 27.451357752306553 3.64280706631342 0.0 3 0.9968468796861835 21.972421283028474 5045.0 8.216300999104059 0.0 - - - - - - - 269.3333333333333 10 12 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1887 239 C20140707_OR006_05 C20140707_OR006_05 TB411811.[MT7]-TALQVYDK[MT7].2y3_1.heavy 613.355 / 569.305 6458.0 27.02829933166504 50 20 10 10 10 27.451357752306553 3.64280706631342 0.0 3 0.9968468796861835 21.972421283028474 6458.0 11.41595835448635 0.0 - - - - - - - 731.5 12 8 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1889 240 C20140707_OR006_05 C20140707_OR006_05 TB411810.[MT7]-SSLGSHQLPR.3y3_1.heavy 409.23 / 385.256 2166.0 21.275750160217285 35 15 10 6 4 1.7290152363705464 45.95442648282807 0.03289985656738281 7 0.9526472035651229 5.648858865989703 2166.0 2.6579572446555817 0.0 - - - - - - - 281.9375 4 16 BAG3 BCL2-associated athanogene 3 1891 240 C20140707_OR006_05 C20140707_OR006_05 TB411810.[MT7]-SSLGSHQLPR.3b4_1.heavy 409.23 / 489.279 1143.0 21.275750160217285 35 15 10 6 4 1.7290152363705464 45.95442648282807 0.03289985656738281 7 0.9526472035651229 5.648858865989703 1143.0 3.5902665836938303 5.0 - - - - - - - 756.2857142857143 4 7 BAG3 BCL2-associated athanogene 3 1893 240 C20140707_OR006_05 C20140707_OR006_05 TB411810.[MT7]-SSLGSHQLPR.3b5_1.heavy 409.23 / 576.311 662.0 21.275750160217285 35 15 10 6 4 1.7290152363705464 45.95442648282807 0.03289985656738281 7 0.9526472035651229 5.648858865989703 662.0 3.31 0.0 - - - - - - - 0.0 1 0 BAG3 BCL2-associated athanogene 3 1895 240 C20140707_OR006_05 C20140707_OR006_05 TB411810.[MT7]-SSLGSHQLPR.3y4_1.heavy 409.23 / 513.314 2467.0 21.275750160217285 35 15 10 6 4 1.7290152363705464 45.95442648282807 0.03289985656738281 7 0.9526472035651229 5.648858865989703 2467.0 40.643971496437054 0.0 - - - - - - - 196.33333333333334 4 15 BAG3 BCL2-associated athanogene 3 1897 241 C20140707_OR006_05 C20140707_OR006_05 TB437334.[MT7]-GVINMGSYNYLGFAR.2y8_1.heavy 903.46 / 1003.5 2102.0 41.99250030517578 48 18 10 10 10 7.130622608586353 14.024020830885764 0.0 3 0.9872090708760025 10.900522482117147 2102.0 19.01809523809524 0.0 - - - - - - - 221.66666666666666 4 12 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1899 241 C20140707_OR006_05 C20140707_OR006_05 TB437334.[MT7]-GVINMGSYNYLGFAR.2b4_1.heavy 903.46 / 528.326 5887.0 41.99250030517578 48 18 10 10 10 7.130622608586353 14.024020830885764 0.0 3 0.9872090708760025 10.900522482117147 5887.0 31.187083333333334 0.0 - - - - - - - 340.0 11 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1901 241 C20140707_OR006_05 C20140707_OR006_05 TB437334.[MT7]-GVINMGSYNYLGFAR.2y6_1.heavy 903.46 / 726.393 561.0 41.99250030517578 48 18 10 10 10 7.130622608586353 14.024020830885764 0.0 3 0.9872090708760025 10.900522482117147 561.0 1.135515967385765 23.0 - - - - - - - 0.0 1 0 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1903 241 C20140707_OR006_05 C20140707_OR006_05 TB437334.[MT7]-GVINMGSYNYLGFAR.2y10_1.heavy 903.46 / 1147.55 3925.0 41.99250030517578 48 18 10 10 10 7.130622608586353 14.024020830885764 0.0 3 0.9872090708760025 10.900522482117147 3925.0 26.907886692480133 0.0 - - - - - - - 245.0 7 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 1905 242 C20140707_OR006_05 C20140707_OR006_05 TB411815.[MT7]-ILPESQQK[MT7].3y3_1.heavy 410.915 / 547.332 1781.0 24.821999549865723 38 16 10 6 6 2.681800913702265 37.28837569152311 0.03560066223144531 6 0.9648786538241128 6.565948082997862 1781.0 2.1014749262536876 3.0 - - - - - - - 203.66666666666666 4 15 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1907 242 C20140707_OR006_05 C20140707_OR006_05 TB411815.[MT7]-ILPESQQK[MT7].3b4_1.heavy 410.915 / 597.373 5002.0 24.821999549865723 38 16 10 6 6 2.681800913702265 37.28837569152311 0.03560066223144531 6 0.9648786538241128 6.565948082997862 5002.0 7.8771653543307085 1.0 - - - - - - - 169.83333333333334 10 12 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1909 242 C20140707_OR006_05 C20140707_OR006_05 TB411815.[MT7]-ILPESQQK[MT7].3b5_1.heavy 410.915 / 684.405 424.0 24.821999549865723 38 16 10 6 6 2.681800913702265 37.28837569152311 0.03560066223144531 6 0.9648786538241128 6.565948082997862 424.0 1.9952941176470589 4.0 - - - - - - - 0.0 1 0 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1911 242 C20140707_OR006_05 C20140707_OR006_05 TB411815.[MT7]-ILPESQQK[MT7].3y4_1.heavy 410.915 / 634.364 2035.0 24.821999549865723 38 16 10 6 6 2.681800913702265 37.28837569152311 0.03560066223144531 6 0.9648786538241128 6.565948082997862 2035.0 19.472909729929707 1.0 - - - - - - - 160.11111111111111 5 9 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 1913 243 C20140707_OR006_05 C20140707_OR006_05 TB436975.[MT7]-QMLESNK[MT7].2y4_1.heavy 569.312 / 621.332 3939.0 20.76759910583496 47 17 10 10 10 4.653293490190647 21.490155351431095 0.0 3 0.9769114190872419 8.106335722964596 3939.0 51.90914464109666 0.0 - - - - - - - 179.0 7 18 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1915 243 C20140707_OR006_05 C20140707_OR006_05 TB436975.[MT7]-QMLESNK[MT7].2y5_1.heavy 569.312 / 734.417 3223.0 20.76759910583496 47 17 10 10 10 4.653293490190647 21.490155351431095 0.0 3 0.9769114190872419 8.106335722964596 3223.0 60.74478451882845 0.0 - - - - - - - 157.78571428571428 6 14 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1917 243 C20140707_OR006_05 C20140707_OR006_05 TB436975.[MT7]-QMLESNK[MT7].2b4_1.heavy 569.312 / 646.335 3163.0 20.76759910583496 47 17 10 10 10 4.653293490190647 21.490155351431095 0.0 3 0.9769114190872419 8.106335722964596 3163.0 31.862434513554376 0.0 - - - - - - - 165.66666666666666 6 18 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1919 243 C20140707_OR006_05 C20140707_OR006_05 TB436975.[MT7]-QMLESNK[MT7].2y6_1.heavy 569.312 / 865.457 9787.0 20.76759910583496 47 17 10 10 10 4.653293490190647 21.490155351431095 0.0 3 0.9769114190872419 8.106335722964596 9787.0 159.91990787269683 0.0 - - - - - - - 224.7058823529412 19 17 AP3B1 adaptor-related protein complex 3, beta 1 subunit 1921 244 C20140707_OR006_05 C20140707_OR006_05 TB437233.[MT7]-ELLALDSVDPEGR.2b3_1.heavy 779.416 / 500.32 4891.0 38.5260009765625 45 15 10 10 10 5.2036334802363955 19.217341186654274 0.0 3 0.9584611072691112 6.034203990475391 4891.0 22.768550120772947 0.0 - - - - - - - 336.0 9 3 BAG3 BCL2-associated athanogene 3 1923 244 C20140707_OR006_05 C20140707_OR006_05 TB437233.[MT7]-ELLALDSVDPEGR.2b4_1.heavy 779.416 / 571.357 4747.0 38.5260009765625 45 15 10 10 10 5.2036334802363955 19.217341186654274 0.0 3 0.9584611072691112 6.034203990475391 4747.0 26.26233796296296 0.0 - - - - - - - 270.0 9 8 BAG3 BCL2-associated athanogene 3 1925 244 C20140707_OR006_05 C20140707_OR006_05 TB437233.[MT7]-ELLALDSVDPEGR.2y10_1.heavy 779.416 / 1058.51 3453.0 38.5260009765625 45 15 10 10 10 5.2036334802363955 19.217341186654274 0.0 3 0.9584611072691112 6.034203990475391 3453.0 15.592713768115942 0.0 - - - - - - - 240.0 6 6 BAG3 BCL2-associated athanogene 3 1927 244 C20140707_OR006_05 C20140707_OR006_05 TB437233.[MT7]-ELLALDSVDPEGR.2y7_1.heavy 779.416 / 759.363 1726.0 38.5260009765625 45 15 10 10 10 5.2036334802363955 19.217341186654274 0.0 3 0.9584611072691112 6.034203990475391 1726.0 5.792418478260869 1.0 - - - - - - - 288.0 3 9 BAG3 BCL2-associated athanogene 3 1929 245 C20140707_OR006_05 C20140707_OR006_05 TB449977.[MT7]-SDTAAAAVR.2y8_1.heavy 503.276 / 774.41 1852.0 17.537399291992188 48 18 10 10 10 4.7044755212670735 21.256354624004217 0.0 3 0.9878402347996944 11.180435341019487 1852.0 53.817917133258675 0.0 - - - - - - - 108.28571428571429 3 7 UBA1 ubiquitin-like modifier activating enzyme 1 1931 245 C20140707_OR006_05 C20140707_OR006_05 TB449977.[MT7]-SDTAAAAVR.2b6_1.heavy 503.276 / 661.327 1614.0 17.537399291992188 48 18 10 10 10 4.7044755212670735 21.256354624004217 0.0 3 0.9878402347996944 11.180435341019487 1614.0 40.98844171411448 0.0 - - - - - - - 104.1 3 10 UBA1 ubiquitin-like modifier activating enzyme 1 1933 245 C20140707_OR006_05 C20140707_OR006_05 TB449977.[MT7]-SDTAAAAVR.2b5_1.heavy 503.276 / 590.29 1899.0 17.537399291992188 48 18 10 10 10 4.7044755212670735 21.256354624004217 0.0 3 0.9878402347996944 11.180435341019487 1899.0 30.56137138621201 0.0 - - - - - - - 138.85714285714286 3 14 UBA1 ubiquitin-like modifier activating enzyme 1 1935 245 C20140707_OR006_05 C20140707_OR006_05 TB449977.[MT7]-SDTAAAAVR.2y7_1.heavy 503.276 / 659.383 2991.0 17.537399291992188 48 18 10 10 10 4.7044755212670735 21.256354624004217 0.0 3 0.9878402347996944 11.180435341019487 2991.0 88.60125755879059 0.0 - - - - - - - 169.42857142857142 5 7 UBA1 ubiquitin-like modifier activating enzyme 1 1937 246 C20140707_OR006_05 C20140707_OR006_05 TB437236.[MT7]-RLQTSSVLVSGLR.2b8_1.heavy 780.471 / 1029.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1939 246 C20140707_OR006_05 C20140707_OR006_05 TB437236.[MT7]-RLQTSSVLVSGLR.2y9_1.heavy 780.471 / 917.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1941 246 C20140707_OR006_05 C20140707_OR006_05 TB437236.[MT7]-RLQTSSVLVSGLR.2b6_1.heavy 780.471 / 817.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1943 246 C20140707_OR006_05 C20140707_OR006_05 TB437236.[MT7]-RLQTSSVLVSGLR.2y10_1.heavy 780.471 / 1018.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - UBA1 ubiquitin-like modifier activating enzyme 1 1945 247 C20140707_OR006_05 C20140707_OR006_05 TB437330.[MT7]-YFYIQAVDTSGNK[MT7].2b3_1.heavy 897.469 / 618.304 9270.0 36.75199890136719 50 20 10 10 10 8.086726300911495 12.365943433590488 0.0 3 0.996267734009931 20.194862862714203 9270.0 89.24265734265734 0.0 - - - - - - - 214.0 18 8 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1947 247 C20140707_OR006_05 C20140707_OR006_05 TB437330.[MT7]-YFYIQAVDTSGNK[MT7].2y8_1.heavy 897.469 / 935.491 4279.0 36.75199890136719 50 20 10 10 10 8.086726300911495 12.365943433590488 0.0 3 0.996267734009931 20.194862862714203 4279.0 35.7817004048583 0.0 - - - - - - - 199.8 8 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1949 247 C20140707_OR006_05 C20140707_OR006_05 TB437330.[MT7]-YFYIQAVDTSGNK[MT7].2y5_1.heavy 897.469 / 650.359 4421.0 36.75199890136719 50 20 10 10 10 8.086726300911495 12.365943433590488 0.0 3 0.996267734009931 20.194862862714203 4421.0 41.13197157048559 0.0 - - - - - - - 314.0 8 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1951 247 C20140707_OR006_05 C20140707_OR006_05 TB437330.[MT7]-YFYIQAVDTSGNK[MT7].2y6_1.heavy 897.469 / 765.386 4136.0 36.75199890136719 50 20 10 10 10 8.086726300911495 12.365943433590488 0.0 3 0.996267734009931 20.194862862714203 4136.0 35.439902834008095 0.0 - - - - - - - 285.4 8 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1953 248 C20140707_OR006_05 C20140707_OR006_05 TB437235.[MT7]-TIQMFLVYEDR.3y6_1.heavy 520.273 / 794.404 1352.0 43.265899658203125 40 10 10 10 10 1.0327104524894106 57.796598966568254 0.0 3 0.8396595296842642 3.039900294283878 1352.0 9.609214814814814 0.0 - - - - - - - 270.25 2 4 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1955 248 C20140707_OR006_05 C20140707_OR006_05 TB437235.[MT7]-TIQMFLVYEDR.3b4_1.heavy 520.273 / 618.34 3652.0 43.265899658203125 40 10 10 10 10 1.0327104524894106 57.796598966568254 0.0 3 0.8396595296842642 3.039900294283878 3652.0 39.90148148148148 0.0 - - - - - - - 180.0 7 3 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1957 248 C20140707_OR006_05 C20140707_OR006_05 TB437235.[MT7]-TIQMFLVYEDR.3y4_1.heavy 520.273 / 582.252 1217.0 43.265899658203125 40 10 10 10 10 1.0327104524894106 57.796598966568254 0.0 3 0.8396595296842642 3.039900294283878 1217.0 7.482407316183178 0.0 - - - - - - - 270.25 2 4 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1959 248 C20140707_OR006_05 C20140707_OR006_05 TB437235.[MT7]-TIQMFLVYEDR.3y5_1.heavy 520.273 / 681.32 811.0 43.265899658203125 40 10 10 10 10 1.0327104524894106 57.796598966568254 0.0 3 0.8396595296842642 3.039900294283878 811.0 4.841067779602262 0.0 - - - - - - - 0.0 1 0 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 1961 249 C20140707_OR006_05 C20140707_OR006_05 TB412384.[MT7]-YMLLPNQVWDSIIQQATK[MT7].4y4_1.heavy 609.835 / 591.358 1172.0 53.34809875488281 35 16 10 3 6 2.417365786761533 34.34708520760345 0.06620025634765625 6 0.9661622510207207 6.6900496345144465 1172.0 14.643170163170163 0.0 - - - - - - - 162.46153846153845 2 13 XPO1 exportin 1 (CRM1 homolog, yeast) 1963 249 C20140707_OR006_05 C20140707_OR006_05 TB412384.[MT7]-YMLLPNQVWDSIIQQATK[MT7].4b7_1.heavy 609.835 / 1004.54 234.0 53.34809875488281 35 16 10 3 6 2.417365786761533 34.34708520760345 0.06620025634765625 6 0.9661622510207207 6.6900496345144465 234.0 0.7999999999999998 9.0 - - - - - - - 0.0 0 0 XPO1 exportin 1 (CRM1 homolog, yeast) 1965 249 C20140707_OR006_05 C20140707_OR006_05 TB412384.[MT7]-YMLLPNQVWDSIIQQATK[MT7].4y9_2.heavy 609.835 / 574.326 879.0 53.34809875488281 35 16 10 3 6 2.417365786761533 34.34708520760345 0.06620025634765625 6 0.9661622510207207 6.6900496345144465 879.0 13.855423728813559 5.0 - - - - - - - 163.0 5 9 XPO1 exportin 1 (CRM1 homolog, yeast) 1967 249 C20140707_OR006_05 C20140707_OR006_05 TB412384.[MT7]-YMLLPNQVWDSIIQQATK[MT7].4b4_1.heavy 609.835 / 665.381 2461.0 53.34809875488281 35 16 10 3 6 2.417365786761533 34.34708520760345 0.06620025634765625 6 0.9661622510207207 6.6900496345144465 2461.0 40.92887719095275 0.0 - - - - - - - 195.5 4 6 XPO1 exportin 1 (CRM1 homolog, yeast) 1969 250 C20140707_OR006_05 C20140707_OR006_05 TB449969.[MT7]-ELIQAK[MT7].2b3_1.heavy 495.315 / 500.32 7225.0 24.201099395751953 47 17 10 10 10 2.1795059470728844 32.470642678846474 0.0 3 0.9742122386362246 7.6686305300174915 7225.0 59.95571095571096 0.0 - - - - - - - 196.83333333333334 14 12 CASP2 caspase 2, apoptosis-related cysteine peptidase 1971 250 C20140707_OR006_05 C20140707_OR006_05 TB449969.[MT7]-ELIQAK[MT7].2y4_1.heavy 495.315 / 603.395 7511.0 24.201099395751953 47 17 10 10 10 2.1795059470728844 32.470642678846474 0.0 3 0.9742122386362246 7.6686305300174915 7511.0 56.594511627906975 0.0 - - - - - - - 200.46666666666667 15 15 CASP2 caspase 2, apoptosis-related cysteine peptidase 1973 250 C20140707_OR006_05 C20140707_OR006_05 TB449969.[MT7]-ELIQAK[MT7].2y5_1.heavy 495.315 / 716.479 5294.0 24.201099395751953 47 17 10 10 10 2.1795059470728844 32.470642678846474 0.0 3 0.9742122386362246 7.6686305300174915 5294.0 16.684121212121212 0.0 - - - - - - - 572.2857142857143 10 7 CASP2 caspase 2, apoptosis-related cysteine peptidase 1975 250 C20140707_OR006_05 C20140707_OR006_05 TB449969.[MT7]-ELIQAK[MT7].2b4_1.heavy 495.315 / 628.379 2361.0 24.201099395751953 47 17 10 10 10 2.1795059470728844 32.470642678846474 0.0 3 0.9742122386362246 7.6686305300174915 2361.0 46.01381701631701 0.0 - - - - - - - 167.16666666666666 4 12 CASP2 caspase 2, apoptosis-related cysteine peptidase 1977 251 C20140707_OR006_05 C20140707_OR006_05 TB412248.[MT7]-ALASPEQLAQLPSSGVPR.2y8_1.heavy 983.048 / 812.463 862.0 36.99429893493652 36 16 10 2 8 3.7551240567423405 26.630278650967494 0.08879852294921875 4 0.9605395967229892 6.192172481886007 862.0 1.2916347826086956 4.0 - - - - - - - 0.0 1 0 TSC22D4 TSC22 domain family, member 4 1979 251 C20140707_OR006_05 C20140707_OR006_05 TB412248.[MT7]-ALASPEQLAQLPSSGVPR.2y10_1.heavy 983.048 / 1011.56 2874.0 36.99429893493652 36 16 10 2 8 3.7551240567423405 26.630278650967494 0.08879852294921875 4 0.9605395967229892 6.192172481886007 2874.0 4.91500482811653 1.0 - - - - - - - 251.25 6 4 TSC22D4 TSC22 domain family, member 4 1981 251 C20140707_OR006_05 C20140707_OR006_05 TB412248.[MT7]-ALASPEQLAQLPSSGVPR.2y11_1.heavy 983.048 / 1124.64 1150.0 36.99429893493652 36 16 10 2 8 3.7551240567423405 26.630278650967494 0.08879852294921875 4 0.9605395967229892 6.192172481886007 1150.0 5.006620209059234 0.0 - - - - - - - 305.125 2 8 TSC22D4 TSC22 domain family, member 4 1983 251 C20140707_OR006_05 C20140707_OR006_05 TB412248.[MT7]-ALASPEQLAQLPSSGVPR.2y7_1.heavy 983.048 / 699.378 4024.0 36.99429893493652 36 16 10 2 8 3.7551240567423405 26.630278650967494 0.08879852294921875 4 0.9605395967229892 6.192172481886007 4024.0 7.3217692551826055 2.0 - - - - - - - 359.0 10 2 TSC22D4 TSC22 domain family, member 4 1985 252 C20140707_OR006_05 C20140707_OR006_05 TB449968.[MT7]-QLSPEK[MT7].2y4_1.heavy 495.297 / 604.342 3064.0 19.474199295043945 50 20 10 10 10 7.066789050081163 14.150698328663353 0.0 3 0.9948840783074154 17.247061037318723 3064.0 23.931887611308035 0.0 - - - - - - - 199.8095238095238 6 21 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1987 252 C20140707_OR006_05 C20140707_OR006_05 TB449968.[MT7]-QLSPEK[MT7].2y5_1.heavy 495.297 / 717.426 2473.0 19.474199295043945 50 20 10 10 10 7.066789050081163 14.150698328663353 0.0 3 0.9948840783074154 17.247061037318723 2473.0 8.152704263228664 0.0 - - - - - - - 198.21052631578948 4 19 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1989 252 C20140707_OR006_05 C20140707_OR006_05 TB449968.[MT7]-QLSPEK[MT7].2y3_1.heavy 495.297 / 517.31 5430.0 19.474199295043945 50 20 10 10 10 7.066789050081163 14.150698328663353 0.0 3 0.9948840783074154 17.247061037318723 5430.0 43.801561857007 0.0 - - - - - - - 188.3 10 10 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1991 252 C20140707_OR006_05 C20140707_OR006_05 TB449968.[MT7]-QLSPEK[MT7].2b5_1.heavy 495.297 / 699.379 430.0 19.474199295043945 50 20 10 10 10 7.066789050081163 14.150698328663353 0.0 3 0.9948840783074154 17.247061037318723 430.0 0.0 8.0 - - - - - - - 0.0 1 0 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 1993 253 C20140707_OR006_05 C20140707_OR006_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 171931.0 44.009700775146484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 171931.0 224.82529053648517 0.0 - - - - - - - 264.75 343 4 1995 253 C20140707_OR006_05 C20140707_OR006_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 262533.0 44.009700775146484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 262533.0 50.399654313963694 1.0 - - - - - - - 265.0 530 4 1997 253 C20140707_OR006_05 C20140707_OR006_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 247433.0 44.009700775146484 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 247433.0 418.45412774668495 0.0 - - - - - - - 231.5 494 4 1999 254 C20140707_OR006_05 C20140707_OR006_05 TB412140.[MT7]-QFLFRPWDVTK[MT7].3y10_2.heavy 575.662 / 726.91 13573.0 40.10860061645508 40 12 10 10 8 1.4915849107829033 61.182055348632495 0.0 4 0.8819053129053563 3.5553104758827345 13573.0 69.56509500569483 0.0 - - - - - - - 286.0 27 1 UBA1 ubiquitin-like modifier activating enzyme 1 2001 254 C20140707_OR006_05 C20140707_OR006_05 TB412140.[MT7]-QFLFRPWDVTK[MT7].3y6_1.heavy 575.662 / 889.49 3715.0 40.10860061645508 40 12 10 10 8 1.4915849107829033 61.182055348632495 0.0 4 0.8819053129053563 3.5553104758827345 3715.0 -0.35910510965935594 2.0 - - - - - - - 321.75 8 4 UBA1 ubiquitin-like modifier activating enzyme 1 2003 254 C20140707_OR006_05 C20140707_OR006_05 TB412140.[MT7]-QFLFRPWDVTK[MT7].3y4_1.heavy 575.662 / 606.358 3715.0 40.10860061645508 40 12 10 10 8 1.4915849107829033 61.182055348632495 0.0 4 0.8819053129053563 3.5553104758827345 3715.0 24.771314799552844 0.0 - - - - - - - 257.4 7 5 UBA1 ubiquitin-like modifier activating enzyme 1 2005 254 C20140707_OR006_05 C20140707_OR006_05 TB412140.[MT7]-QFLFRPWDVTK[MT7].3b3_1.heavy 575.662 / 533.32 5143.0 40.10860061645508 40 12 10 10 8 1.4915849107829033 61.182055348632495 0.0 4 0.8819053129053563 3.5553104758827345 5143.0 6.910748714143413 0.0 - - - - - - - 286.0 10 10 UBA1 ubiquitin-like modifier activating enzyme 1 2007 255 C20140707_OR006_05 C20140707_OR006_05 TB436846.[MT7]-RPLDEQQK[MT7].3b4_2.heavy 434.585 / 313.691 6413.0 16.975499629974365 33 13 10 2 8 3.5954908475880125 27.81261425462498 0.08839988708496094 4 0.9109791673431229 4.10526184248812 6413.0 33.83778400700788 1.0 - - - - - - - 174.2 13 10 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 2009 255 C20140707_OR006_05 C20140707_OR006_05 TB436846.[MT7]-RPLDEQQK[MT7].3b4_1.heavy 434.585 / 626.374 1466.0 16.975499629974365 33 13 10 2 8 3.5954908475880125 27.81261425462498 0.08839988708496094 4 0.9109791673431229 4.10526184248812 1466.0 14.619347826086956 1.0 - - - - - - - 112.63636363636364 2 11 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 2011 255 C20140707_OR006_05 C20140707_OR006_05 TB436846.[MT7]-RPLDEQQK[MT7].3b5_1.heavy 434.585 / 755.417 275.0 16.975499629974365 33 13 10 2 8 3.5954908475880125 27.81261425462498 0.08839988708496094 4 0.9109791673431229 4.10526184248812 275.0 1.0043795620437956 2.0 - - - - - - - 0.0 0 0 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 2013 255 C20140707_OR006_05 C20140707_OR006_05 TB436846.[MT7]-RPLDEQQK[MT7].3y4_1.heavy 434.585 / 676.375 412.0 16.975499629974365 33 13 10 2 8 3.5954908475880125 27.81261425462498 0.08839988708496094 4 0.9109791673431229 4.10526184248812 412.0 13.972173913043479 1.0 - - - - - - - 0.0 0 0 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 2015 256 C20140707_OR006_05 C20140707_OR006_05 TB412380.[MT7]-EVQYIVLQNIATMSIQRK[MT7].4y8_1.heavy 606.349 / 1078.62 3186.0 44.58250045776367 47 17 10 10 10 2.62220911018308 31.773147656275345 0.0 3 0.9715502640030217 7.299417531891619 3186.0 7.420185225082538 1.0 - - - - - - - 199.375 6 8 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2017 256 C20140707_OR006_05 C20140707_OR006_05 TB412380.[MT7]-EVQYIVLQNIATMSIQRK[MT7].4b4_1.heavy 606.349 / 664.342 8098.0 44.58250045776367 47 17 10 10 10 2.62220911018308 31.773147656275345 0.0 3 0.9715502640030217 7.299417531891619 8098.0 24.99184684500715 0.0 - - - - - - - 243.5 16 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2019 256 C20140707_OR006_05 C20140707_OR006_05 TB412380.[MT7]-EVQYIVLQNIATMSIQRK[MT7].4b5_1.heavy 606.349 / 777.426 6903.0 44.58250045776367 47 17 10 10 10 2.62220911018308 31.773147656275345 0.0 3 0.9715502640030217 7.299417531891619 6903.0 46.45251879699248 0.0 - - - - - - - 216.125 13 8 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2021 256 C20140707_OR006_05 C20140707_OR006_05 TB412380.[MT7]-EVQYIVLQNIATMSIQRK[MT7].4b3_1.heavy 606.349 / 501.279 10753.0 44.58250045776367 47 17 10 10 10 2.62220911018308 31.773147656275345 0.0 3 0.9715502640030217 7.299417531891619 10753.0 53.1781096566718 0.0 - - - - - - - 625.8571428571429 21 7 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2023 257 C20140707_OR006_05 C20140707_OR006_05 TB437322.[MT7]-LAGTQPLEVLEAVQR.2y6_1.heavy 884.508 / 715.41 1364.0 42.78160095214844 47 17 10 10 10 3.319704912434787 30.123159328235747 0.0 3 0.9702237656331743 7.134177546203331 1364.0 2.901515892420538 1.0 - - - - - - - 245.4 2 5 UBA1 ubiquitin-like modifier activating enzyme 1 2025 257 C20140707_OR006_05 C20140707_OR006_05 TB437322.[MT7]-LAGTQPLEVLEAVQR.2y10_1.heavy 884.508 / 1153.66 12955.0 42.78160095214844 47 17 10 10 10 3.319704912434787 30.123159328235747 0.0 3 0.9702237656331743 7.134177546203331 12955.0 58.70051273095282 0.0 - - - - - - - 289.875 25 8 UBA1 ubiquitin-like modifier activating enzyme 1 2027 257 C20140707_OR006_05 C20140707_OR006_05 TB437322.[MT7]-LAGTQPLEVLEAVQR.2b5_1.heavy 884.508 / 615.358 7227.0 42.78160095214844 47 17 10 10 10 3.319704912434787 30.123159328235747 0.0 3 0.9702237656331743 7.134177546203331 7227.0 38.67124936188506 0.0 - - - - - - - 253.28571428571428 14 7 UBA1 ubiquitin-like modifier activating enzyme 1 2029 257 C20140707_OR006_05 C20140707_OR006_05 TB437322.[MT7]-LAGTQPLEVLEAVQR.2y7_1.heavy 884.508 / 814.478 1227.0 42.78160095214844 47 17 10 10 10 3.319704912434787 30.123159328235747 0.0 3 0.9702237656331743 7.134177546203331 1227.0 3.7508256880733946 0.0 - - - - - - - 253.14285714285714 2 7 UBA1 ubiquitin-like modifier activating enzyme 1 2031 258 C20140707_OR006_05 C20140707_OR006_05 TB437328.[MT7]-LSLIFSHMLAEIK[MT7].3b6_1.heavy 597.354 / 805.494 2405.0 50.155099868774414 42 17 10 5 10 2.3176159318882417 29.032628247759867 0.046001434326171875 3 0.9743804879039495 7.693879060198663 2405.0 11.729026396753913 0.0 - - - - - - - 710.5 4 2 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 2033 258 C20140707_OR006_05 C20140707_OR006_05 TB437328.[MT7]-LSLIFSHMLAEIK[MT7].3b4_1.heavy 597.354 / 571.394 3389.0 50.155099868774414 42 17 10 5 10 2.3176159318882417 29.032628247759867 0.046001434326171875 3 0.9743804879039495 7.693879060198663 3389.0 43.775470654769386 0.0 - - - - - - - 145.66666666666666 6 3 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 2035 258 C20140707_OR006_05 C20140707_OR006_05 TB437328.[MT7]-LSLIFSHMLAEIK[MT7].3y4_1.heavy 597.354 / 604.379 4919.0 50.155099868774414 42 17 10 5 10 2.3176159318882417 29.032628247759867 0.046001434326171875 3 0.9743804879039495 7.693879060198663 4919.0 50.96543699579021 0.0 - - - - - - - 249.85714285714286 9 7 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 2037 258 C20140707_OR006_05 C20140707_OR006_05 TB437328.[MT7]-LSLIFSHMLAEIK[MT7].3y5_1.heavy 597.354 / 717.463 3826.0 50.155099868774414 42 17 10 5 10 2.3176159318882417 29.032628247759867 0.046001434326171875 3 0.9743804879039495 7.693879060198663 3826.0 70.20183486238533 0.0 - - - - - - - 219.0 7 1 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 2039 259 C20140707_OR006_05 C20140707_OR006_05 TB437327.[MT7]-DLEPHSFGGLLEGIR.3b3_1.heavy 595.32 / 502.263 14983.0 40.451698303222656 50 20 10 10 10 7.319147821812111 13.662792777867615 0.0 3 0.9925744876485131 14.31297960692026 14983.0 27.03493626377948 0.0 - - - - - - - 739.3636363636364 29 11 TSC22D4 TSC22 domain family, member 4 2041 259 C20140707_OR006_05 C20140707_OR006_05 TB437327.[MT7]-DLEPHSFGGLLEGIR.3y8_1.heavy 595.32 / 814.478 7420.0 40.451698303222656 50 20 10 10 10 7.319147821812111 13.662792777867615 0.0 3 0.9925744876485131 14.31297960692026 7420.0 25.80905263157895 1.0 - - - - - - - 178.5 14 4 TSC22D4 TSC22 domain family, member 4 2043 259 C20140707_OR006_05 C20140707_OR006_05 TB437327.[MT7]-DLEPHSFGGLLEGIR.3y10_1.heavy 595.32 / 1048.58 9703.0 40.451698303222656 50 20 10 10 10 7.319147821812111 13.662792777867615 0.0 3 0.9925744876485131 14.31297960692026 9703.0 85.77240196719168 0.0 - - - - - - - 237.91666666666666 19 12 TSC22D4 TSC22 domain family, member 4 2045 259 C20140707_OR006_05 C20140707_OR006_05 TB437327.[MT7]-DLEPHSFGGLLEGIR.3y9_1.heavy 595.32 / 961.547 4852.0 40.451698303222656 50 20 10 10 10 7.319147821812111 13.662792777867615 0.0 3 0.9925744876485131 14.31297960692026 4852.0 16.66541175988443 1.0 - - - - - - - 249.625 10 8 TSC22D4 TSC22 domain family, member 4 2047 260 C20140707_OR006_05 C20140707_OR006_05 TB436841.[MT7]-LSGATIR.2y5_1.heavy 431.267 / 517.309 2021.0 23.719575881958008 42 20 8 6 8 3.1853657701606872 23.390899131927505 0.0345001220703125 4 0.9950359390827245 17.5091071106211 2021.0 15.959828326180258 2.0 - - - - - - - 233.15384615384616 4 13 SPTLC3;SPTLC2 serine palmitoyltransferase, long chain base subunit 3;serine palmitoyltransferase, long chain base subunit 2 2049 260 C20140707_OR006_05 C20140707_OR006_05 TB436841.[MT7]-LSGATIR.2b4_1.heavy 431.267 / 473.284 2954.0 23.719575881958008 42 20 8 6 8 3.1853657701606872 23.390899131927505 0.0345001220703125 4 0.9950359390827245 17.5091071106211 2954.0 10.44823151125402 1.0 - - - - - - - 277.64285714285717 5 14 SPTLC3;SPTLC2 serine palmitoyltransferase, long chain base subunit 3;serine palmitoyltransferase, long chain base subunit 2 2051 260 C20140707_OR006_05 C20140707_OR006_05 TB436841.[MT7]-LSGATIR.2y6_1.heavy 431.267 / 604.341 14538.0 23.719575881958008 42 20 8 6 8 3.1853657701606872 23.390899131927505 0.0345001220703125 4 0.9950359390827245 17.5091071106211 14538.0 66.84675241157555 1.0 - - - - - - - 203.30769230769232 29 13 SPTLC3;SPTLC2 serine palmitoyltransferase, long chain base subunit 3;serine palmitoyltransferase, long chain base subunit 2 2053 260 C20140707_OR006_05 C20140707_OR006_05 TB436841.[MT7]-LSGATIR.2b5_1.heavy 431.267 / 574.332 3576.0 23.719575881958008 42 20 8 6 8 3.1853657701606872 23.390899131927505 0.0345001220703125 4 0.9950359390827245 17.5091071106211 3576.0 9.35959261968177 4.0 - - - - - - - 244.14285714285714 38 14 SPTLC3;SPTLC2 serine palmitoyltransferase, long chain base subunit 3;serine palmitoyltransferase, long chain base subunit 2 2055 261 C20140707_OR006_05 C20140707_OR006_05 TB436980.[MT7]-DAIVYGQPR.2y8_1.heavy 581.82 / 903.505 7831.0 25.140774250030518 42 16 10 6 10 4.769813596439936 20.965179870894197 0.03750038146972656 3 0.9670803378598267 6.783221931316415 7831.0 42.71454545454545 1.0 - - - - - - - 220.0 15 10 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 2057 261 C20140707_OR006_05 C20140707_OR006_05 TB436980.[MT7]-DAIVYGQPR.2y5_1.heavy 581.82 / 620.315 8887.0 25.140774250030518 42 16 10 6 10 4.769813596439936 20.965179870894197 0.03750038146972656 3 0.9670803378598267 6.783221931316415 8887.0 29.825310606060604 0.0 - - - - - - - 234.66666666666666 17 9 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 2059 261 C20140707_OR006_05 C20140707_OR006_05 TB436980.[MT7]-DAIVYGQPR.2b4_1.heavy 581.82 / 543.326 8271.0 25.140774250030518 42 16 10 6 10 4.769813596439936 20.965179870894197 0.03750038146972656 3 0.9670803378598267 6.783221931316415 8271.0 24.214890495867767 1.0 - - - - - - - 276.57142857142856 16 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 2061 261 C20140707_OR006_05 C20140707_OR006_05 TB436980.[MT7]-DAIVYGQPR.2y6_1.heavy 581.82 / 719.383 13462.0 25.140774250030518 42 16 10 6 10 4.769813596439936 20.965179870894197 0.03750038146972656 3 0.9670803378598267 6.783221931316415 13462.0 73.68405303030303 0.0 - - - - - - - 220.0 26 8 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 2063 262 C20140707_OR006_05 C20140707_OR006_05 TB412356.[MT7]-IADRFLLYAMDSYWHSR.3y7_1.heavy 763.385 / 950.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO4 LIM domain only 4 2065 262 C20140707_OR006_05 C20140707_OR006_05 TB412356.[MT7]-IADRFLLYAMDSYWHSR.3b6_1.heavy 763.385 / 860.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO4 LIM domain only 4 2067 262 C20140707_OR006_05 C20140707_OR006_05 TB412356.[MT7]-IADRFLLYAMDSYWHSR.3y6_1.heavy 763.385 / 835.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO4 LIM domain only 4 2069 262 C20140707_OR006_05 C20140707_OR006_05 TB412356.[MT7]-IADRFLLYAMDSYWHSR.3y4_1.heavy 763.385 / 585.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMO4 LIM domain only 4 2071 263 C20140707_OR006_05 C20140707_OR006_05 TB412252.[MT7]-TTTWNDPRVPSEGPK[MT7].3y7_1.heavy 658.349 / 857.485 2570.0 26.44540023803711 47 17 10 10 10 2.19951613460816 45.46454487264528 0.0 3 0.9710705761090034 7.238355164159454 2570.0 16.4937051334146 1.0 - - - - - - - 183.69230769230768 33 13 BAG3 BCL2-associated athanogene 3 2073 263 C20140707_OR006_05 C20140707_OR006_05 TB412252.[MT7]-TTTWNDPRVPSEGPK[MT7].3y6_1.heavy 658.349 / 758.417 5598.0 26.44540023803711 47 17 10 10 10 2.19951613460816 45.46454487264528 0.0 3 0.9710705761090034 7.238355164159454 5598.0 17.591075400098994 0.0 - - - - - - - 183.75 11 8 BAG3 BCL2-associated athanogene 3 2075 263 C20140707_OR006_05 C20140707_OR006_05 TB412252.[MT7]-TTTWNDPRVPSEGPK[MT7].3b6_1.heavy 658.349 / 863.402 25331.0 26.44540023803711 47 17 10 10 10 2.19951613460816 45.46454487264528 0.0 3 0.9710705761090034 7.238355164159454 25331.0 251.93331521739128 0.0 - - - - - - - 192.9 50 10 BAG3 BCL2-associated athanogene 3 2077 263 C20140707_OR006_05 C20140707_OR006_05 TB412252.[MT7]-TTTWNDPRVPSEGPK[MT7].3y9_2.heavy 658.349 / 555.823 107014.0 26.44540023803711 47 17 10 10 10 2.19951613460816 45.46454487264528 0.0 3 0.9710705761090034 7.238355164159454 107014.0 1145.198508790399 0.0 - - - - - - - 275.3333333333333 214 6 BAG3 BCL2-associated athanogene 3 2079 264 C20140707_OR006_05 C20140707_OR006_05 TB412354.[MT7]-RGPQAFDAFC[CAM]EALRETK[MT7].4y8_2.heavy 571.799 / 575.804 37276.0 37.53990173339844 44 14 10 10 10 5.4490095782734045 18.3519589318994 0.0 3 0.932595539216844 4.726589473756695 37276.0 153.28625330737054 0.0 - - - - - - - 215.0 74 8 CASP2 caspase 2, apoptosis-related cysteine peptidase 2081 264 C20140707_OR006_05 C20140707_OR006_05 TB412354.[MT7]-RGPQAFDAFC[CAM]EALRETK[MT7].4b7_1.heavy 571.799 / 916.476 9749.0 37.53990173339844 44 14 10 10 10 5.4490095782734045 18.3519589318994 0.0 3 0.932595539216844 4.726589473756695 9749.0 54.51606438936282 0.0 - - - - - - - 286.6666666666667 19 6 CASP2 caspase 2, apoptosis-related cysteine peptidase 2083 264 C20140707_OR006_05 C20140707_OR006_05 TB412354.[MT7]-RGPQAFDAFC[CAM]EALRETK[MT7].4y10_2.heavy 571.799 / 684.857 37132.0 37.53990173339844 44 14 10 10 10 5.4490095782734045 18.3519589318994 0.0 3 0.932595539216844 4.726589473756695 37132.0 325.15832369490977 0.0 - - - - - - - 214.9 74 10 CASP2 caspase 2, apoptosis-related cysteine peptidase 2085 264 C20140707_OR006_05 C20140707_OR006_05 TB412354.[MT7]-RGPQAFDAFC[CAM]EALRETK[MT7].4y11_2.heavy 571.799 / 742.37 31684.0 37.53990173339844 44 14 10 10 10 5.4490095782734045 18.3519589318994 0.0 3 0.932595539216844 4.726589473756695 31684.0 110.92421932708308 0.0 - - - - - - - 286.7 63 10 CASP2 caspase 2, apoptosis-related cysteine peptidase 2087 265 C20140707_OR006_05 C20140707_OR006_05 TB412256.[MT7]-IHMVNNFRPPQPLK[MT7].4y10_2.heavy 495.537 / 677.889 5385.0 31.58715057373047 37 15 9 5 8 4.061847477648864 24.619338995437467 0.045299530029296875 4 0.959424486702343 6.105916123259357 5385.0 16.690350877192984 0.0 - - - - - - - 224.25 10 8 CA7 carbonic anhydrase VII 2089 265 C20140707_OR006_05 C20140707_OR006_05 TB412256.[MT7]-IHMVNNFRPPQPLK[MT7].4y6_1.heavy 495.537 / 823.516 2693.0 31.58715057373047 37 15 9 5 8 4.061847477648864 24.619338995437467 0.045299530029296875 4 0.959424486702343 6.105916123259357 2693.0 14.349624908625731 0.0 - - - - - - - 304.375 5 8 CA7 carbonic anhydrase VII 2091 265 C20140707_OR006_05 C20140707_OR006_05 TB412256.[MT7]-IHMVNNFRPPQPLK[MT7].4y3_1.heavy 495.537 / 501.352 15386.0 31.58715057373047 37 15 9 5 8 4.061847477648864 24.619338995437467 0.045299530029296875 4 0.959424486702343 6.105916123259357 15386.0 30.796003120124805 1.0 - - - - - - - 274.7142857142857 35 7 CA7 carbonic anhydrase VII 2093 265 C20140707_OR006_05 C20140707_OR006_05 TB412256.[MT7]-IHMVNNFRPPQPLK[MT7].4b3_1.heavy 495.537 / 526.293 8078.0 31.58715057373047 37 15 9 5 8 4.061847477648864 24.619338995437467 0.045299530029296875 4 0.959424486702343 6.105916123259357 8078.0 34.8583956201267 0.0 - - - - - - - 213.33333333333334 16 6 CA7 carbonic anhydrase VII 2095 266 C20140707_OR006_05 C20140707_OR006_05 TB450297.[MT7]-GVYILVPLPLEK[MT7].2y4_1.heavy 815.015 / 630.394 9498.0 46.669700622558594 37 12 10 5 10 1.8146903734448043 38.976632912006025 0.0431976318359375 3 0.890554555996481 3.695903301617451 9498.0 37.01784615384616 0.0 - - - - - - - 243.75 18 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 2097 266 C20140707_OR006_05 C20140707_OR006_05 TB450297.[MT7]-GVYILVPLPLEK[MT7].2b4_1.heavy 815.015 / 577.347 11710.0 46.669700622558594 37 12 10 5 10 1.8146903734448043 38.976632912006025 0.0431976318359375 3 0.890554555996481 3.695903301617451 11710.0 18.288122474939758 1.0 - - - - - - - 260.0 23 7 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 2099 266 C20140707_OR006_05 C20140707_OR006_05 TB450297.[MT7]-GVYILVPLPLEK[MT7].2y6_1.heavy 815.015 / 840.531 13792.0 46.669700622558594 37 12 10 5 10 1.8146903734448043 38.976632912006025 0.0431976318359375 3 0.890554555996481 3.695903301617451 13792.0 46.11756020323762 0.0 - - - - - - - 303.3333333333333 27 6 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 2101 266 C20140707_OR006_05 C20140707_OR006_05 TB450297.[MT7]-GVYILVPLPLEK[MT7].2b5_1.heavy 815.015 / 690.431 14963.0 46.669700622558594 37 12 10 5 10 1.8146903734448043 38.976632912006025 0.0431976318359375 3 0.890554555996481 3.695903301617451 14963.0 60.12427956989247 0.0 - - - - - - - 260.0 29 5 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 2103 267 C20140707_OR006_05 C20140707_OR006_05 TB450296.[MT7]-DLAHFPAVDPEK[MT7].2b4_1.heavy 813.94 / 581.316 3167.0 31.823500156402588 43 18 10 5 10 4.091549007312051 24.440621344456325 0.04440116882324219 3 0.981479311594646 9.054432459143275 3167.0 17.008660043506538 0.0 - - - - - - - 304.3333333333333 6 6 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2105 267 C20140707_OR006_05 C20140707_OR006_05 TB450296.[MT7]-DLAHFPAVDPEK[MT7].2y3_1.heavy 813.94 / 517.31 6821.0 31.823500156402588 43 18 10 5 10 4.091549007312051 24.440621344456325 0.04440116882324219 3 0.981479311594646 9.054432459143275 6821.0 14.933517417281607 0.0 - - - - - - - 812.0 13 3 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2107 267 C20140707_OR006_05 C20140707_OR006_05 TB450296.[MT7]-DLAHFPAVDPEK[MT7].2b5_1.heavy 813.94 / 728.385 2192.0 31.823500156402588 43 18 10 5 10 4.091549007312051 24.440621344456325 0.04440116882324219 3 0.981479311594646 9.054432459143275 2192.0 6.605410818261089 0.0 - - - - - - - 280.1 4 10 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2109 267 C20140707_OR006_05 C20140707_OR006_05 TB450296.[MT7]-DLAHFPAVDPEK[MT7].2y7_1.heavy 813.94 / 899.495 1583.0 31.823500156402588 43 18 10 5 10 4.091549007312051 24.440621344456325 0.04440116882324219 3 0.981479311594646 9.054432459143275 1583.0 -0.3999999999999999 2.0 - - - - - - - 274.25 3 4 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2111 268 C20140707_OR006_05 C20140707_OR006_05 TB437490.[MT7]-VSLDMMSVQANTGPPWESK[MT7].3y6_1.heavy 789.064 / 887.474 6127.0 40.56034851074219 38 13 10 5 10 2.0205104650818067 49.49244348306367 0.04290008544921875 3 0.9238785113898454 4.444414245554363 6127.0 46.25036178066841 0.0 - - - - - - - 227.6 12 10 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2113 268 C20140707_OR006_05 C20140707_OR006_05 TB437490.[MT7]-VSLDMMSVQANTGPPWESK[MT7].3b4_1.heavy 789.064 / 559.321 8834.0 40.56034851074219 38 13 10 5 10 2.0205104650818067 49.49244348306367 0.04290008544921875 3 0.9238785113898454 4.444414245554363 8834.0 14.039262829358037 0.0 - - - - - - - 651.1428571428571 17 7 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2115 268 C20140707_OR006_05 C20140707_OR006_05 TB437490.[MT7]-VSLDMMSVQANTGPPWESK[MT7].3b5_1.heavy 789.064 / 690.361 7266.0 40.56034851074219 38 13 10 5 10 2.0205104650818067 49.49244348306367 0.04290008544921875 3 0.9238785113898454 4.444414245554363 7266.0 11.48962807017544 0.0 - - - - - - - 793.8571428571429 14 7 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2117 268 C20140707_OR006_05 C20140707_OR006_05 TB437490.[MT7]-VSLDMMSVQANTGPPWESK[MT7].3b7_1.heavy 789.064 / 908.434 2422.0 40.56034851074219 38 13 10 5 10 2.0205104650818067 49.49244348306367 0.04290008544921875 3 0.9238785113898454 4.444414245554363 2422.0 3.965847953216375 0.0 - - - - - - - 244.0 4 7 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2119 269 C20140707_OR006_05 C20140707_OR006_05 TB436857.[MT7]-GFSFPVNYK[MT7].3y3_1.heavy 449.583 / 568.321 1722.0 36.8617000579834 37 14 10 5 8 2.974647825235306 33.617424944107334 0.044399261474609375 4 0.9486962168417395 5.425168271090507 1722.0 4.001791469170119 1.0 - - - - - - - 287.2 5 5 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 2121 269 C20140707_OR006_05 C20140707_OR006_05 TB436857.[MT7]-GFSFPVNYK[MT7].3b6_1.heavy 449.583 / 779.421 431.0 36.8617000579834 37 14 10 5 8 2.974647825235306 33.617424944107334 0.044399261474609375 4 0.9486962168417395 5.425168271090507 431.0 2.793055555555555 5.0 - - - - - - - 335.3333333333333 2 3 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 2123 269 C20140707_OR006_05 C20140707_OR006_05 TB436857.[MT7]-GFSFPVNYK[MT7].3b4_1.heavy 449.583 / 583.3 3875.0 36.8617000579834 37 14 10 5 8 2.974647825235306 33.617424944107334 0.044399261474609375 4 0.9486962168417395 5.425168271090507 3875.0 28.415863391376448 0.0 - - - - - - - 144.0 7 2 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 2125 269 C20140707_OR006_05 C20140707_OR006_05 TB436857.[MT7]-GFSFPVNYK[MT7].3y4_1.heavy 449.583 / 667.39 718.0 36.8617000579834 37 14 10 5 8 2.974647825235306 33.617424944107334 0.044399261474609375 4 0.9486962168417395 5.425168271090507 718.0 3.3248453209590094 0.0 - - - - - - - 0.0 1 0 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 2127 270 C20140707_OR006_05 C20140707_OR006_05 TB412250.[MT7]-QLLLSELLEHLLEK[MT7].3b6_1.heavy 656.066 / 828.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 2129 270 C20140707_OR006_05 C20140707_OR006_05 TB412250.[MT7]-QLLLSELLEHLLEK[MT7].3y3_1.heavy 656.066 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 2131 270 C20140707_OR006_05 C20140707_OR006_05 TB412250.[MT7]-QLLLSELLEHLLEK[MT7].3b4_1.heavy 656.066 / 612.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 2133 270 C20140707_OR006_05 C20140707_OR006_05 TB412250.[MT7]-QLLLSELLEHLLEK[MT7].3y4_1.heavy 656.066 / 646.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CASP2 caspase 2, apoptosis-related cysteine peptidase 2135 271 C20140707_OR006_05 C20140707_OR006_05 TB437495.[MT7]-VLSSIRVPIIVPIMMLAIK[MT7].3b9_1.heavy 794.505 / 1109.72 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 2137 271 C20140707_OR006_05 C20140707_OR006_05 TB437495.[MT7]-VLSSIRVPIIVPIMMLAIK[MT7].3y6_1.heavy 794.505 / 850.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 2139 271 C20140707_OR006_05 C20140707_OR006_05 TB437495.[MT7]-VLSSIRVPIIVPIMMLAIK[MT7].3b10_1.heavy 794.505 / 1222.8 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 2141 271 C20140707_OR006_05 C20140707_OR006_05 TB437495.[MT7]-VLSSIRVPIIVPIMMLAIK[MT7].3y8_1.heavy 794.505 / 1060.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 2143 272 C20140707_OR006_05 C20140707_OR006_05 TB436858.[MT7]-LLQLLR.2y4_1.heavy 450.312 / 529.346 24757.0 40.23680114746094 43 13 10 10 10 2.187762719578725 45.70879607056106 0.0 3 0.9258283275829969 4.50320486165009 24757.0 64.09065520264403 1.0 - - - - - - - 256.2 49 5 FAM179B;RIN1 family with sequence similarity 179, member B;Ras and Rab interactor 1 2145 272 C20140707_OR006_05 C20140707_OR006_05 TB436858.[MT7]-LLQLLR.2b3_1.heavy 450.312 / 499.336 25326.0 40.23680114746094 43 13 10 10 10 2.187762719578725 45.70879607056106 0.0 3 0.9258283275829969 4.50320486165009 25326.0 42.55038560417055 1.0 - - - - - - - 213.5 56 2 FAM179B;RIN1 family with sequence similarity 179, member B;Ras and Rab interactor 1 2147 272 C20140707_OR006_05 C20140707_OR006_05 TB436858.[MT7]-LLQLLR.2y5_1.heavy 450.312 / 642.43 38273.0 40.23680114746094 43 13 10 10 10 2.187762719578725 45.70879607056106 0.0 3 0.9258283275829969 4.50320486165009 38273.0 223.2520904309955 0.0 - - - - - - - 356.0 76 2 FAM179B;RIN1 family with sequence similarity 179, member B;Ras and Rab interactor 1 2149 272 C20140707_OR006_05 C20140707_OR006_05 TB436858.[MT7]-LLQLLR.2b4_1.heavy 450.312 / 612.42 22338.0 40.23680114746094 43 13 10 10 10 2.187762719578725 45.70879607056106 0.0 3 0.9258283275829969 4.50320486165009 22338.0 79.55773037760453 0.0 - - - - - - - 170.6 44 5 FAM179B;RIN1 family with sequence similarity 179, member B;Ras and Rab interactor 1 2151 273 C20140707_OR006_05 C20140707_OR006_05 TB437354.[MT7]-NSFNPDDIINC[CAM]LK[MT7].3y3_1.heavy 613.317 / 564.33 1964.0 42.01465034484863 38 13 10 5 10 1.2606960225559505 52.880841593761716 0.044300079345703125 3 0.9263188046630566 4.518358188117322 1964.0 7.691993834091385 0.0 - - - - - - - 327.44444444444446 3 9 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 2153 273 C20140707_OR006_05 C20140707_OR006_05 TB437354.[MT7]-NSFNPDDIINC[CAM]LK[MT7].3b4_1.heavy 613.317 / 607.296 6593.0 42.01465034484863 38 13 10 5 10 1.2606960225559505 52.880841593761716 0.044300079345703125 3 0.9263188046630566 4.518358188117322 6593.0 11.281453554260919 0.0 - - - - - - - 187.0 13 3 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 2155 273 C20140707_OR006_05 C20140707_OR006_05 TB437354.[MT7]-NSFNPDDIINC[CAM]LK[MT7].3y4_1.heavy 613.317 / 678.372 7435.0 42.01465034484863 38 13 10 5 10 1.2606960225559505 52.880841593761716 0.044300079345703125 3 0.9263188046630566 4.518358188117322 7435.0 25.435600873906033 0.0 - - - - - - - 298.375 14 8 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 2157 273 C20140707_OR006_05 C20140707_OR006_05 TB437354.[MT7]-NSFNPDDIINC[CAM]LK[MT7].3b7_1.heavy 613.317 / 934.402 6873.0 42.01465034484863 38 13 10 5 10 1.2606960225559505 52.880841593761716 0.044300079345703125 3 0.9263188046630566 4.518358188117322 6873.0 2.0184494646131017 0.0 - - - - - - - 224.4 13 5 TGFBRAP1 transforming growth factor, beta receptor associated protein 1 2159 274 C20140707_OR006_05 C20140707_OR006_05 TB437356.[MT7]-K[MT7]HDVGSEHTVDGK[MT7].3y4_1.heavy 614.334 / 562.332 4763.0 15.677249908447266 43 17 10 6 10 2.3186971705525776 30.29287765451899 0.0373992919921875 3 0.978919672307553 8.485116366373262 4763.0 99.84795349833922 0.0 - - - - - - - 103.1875 9 16 CA7 carbonic anhydrase VII 2161 274 C20140707_OR006_05 C20140707_OR006_05 TB437356.[MT7]-K[MT7]HDVGSEHTVDGK[MT7].3b3_1.heavy 614.334 / 669.392 3694.0 15.677249908447266 43 17 10 6 10 2.3186971705525776 30.29287765451899 0.0373992919921875 3 0.978919672307553 8.485116366373262 3694.0 94.66039558089807 0.0 - - - - - - - 88.44444444444444 7 9 CA7 carbonic anhydrase VII 2163 274 C20140707_OR006_05 C20140707_OR006_05 TB437356.[MT7]-K[MT7]HDVGSEHTVDGK[MT7].3b7_1.heavy 614.334 / 1041.56 3236.0 15.677249908447266 43 17 10 6 10 2.3186971705525776 30.29287765451899 0.0373992919921875 3 0.978919672307553 8.485116366373262 3236.0 67.37245901639344 0.0 - - - - - - - 88.8 6 10 CA7 carbonic anhydrase VII 2165 274 C20140707_OR006_05 C20140707_OR006_05 TB437356.[MT7]-K[MT7]HDVGSEHTVDGK[MT7].3y5_1.heavy 614.334 / 663.379 6228.0 15.677249908447266 43 17 10 6 10 2.3186971705525776 30.29287765451899 0.0373992919921875 3 0.978919672307553 8.485116366373262 6228.0 134.83790163934427 0.0 - - - - - - - 93.85714285714286 12 14 CA7 carbonic anhydrase VII 2167 275 C20140707_OR006_05 C20140707_OR006_05 TB437351.[MT7]-VQGLEQAVDNFEGK[MT7].3b6_1.heavy 607.991 / 799.443 12070.0 39.335333506266274 43 18 10 5 10 4.0542194359769885 24.66566045059224 0.0447998046875 3 0.9847089908907113 9.967571008178306 12070.0 20.39662027833002 0.0 - - - - - - - 266.85714285714283 24 7 BAG3 BCL2-associated athanogene 3 2169 275 C20140707_OR006_05 C20140707_OR006_05 TB437351.[MT7]-VQGLEQAVDNFEGK[MT7].3b4_1.heavy 607.991 / 542.342 N/A 39.335333506266274 43 18 10 5 10 4.0542194359769885 24.66566045059224 0.0447998046875 3 0.9847089908907113 9.967571008178306 16668.0 19.601968654036448 0.0 - - - - - - - 359.0 33 2 BAG3 BCL2-associated athanogene 3 2171 275 C20140707_OR006_05 C20140707_OR006_05 TB437351.[MT7]-VQGLEQAVDNFEGK[MT7].3b5_1.heavy 607.991 / 671.385 14082.0 39.335333506266274 43 18 10 5 10 4.0542194359769885 24.66566045059224 0.0447998046875 3 0.9847089908907113 9.967571008178306 14082.0 50.978297991973065 0.0 - - - - - - - 215.625 28 8 BAG3 BCL2-associated athanogene 3 2173 275 C20140707_OR006_05 C20140707_OR006_05 TB437351.[MT7]-VQGLEQAVDNFEGK[MT7].3b7_1.heavy 607.991 / 870.48 10777.0 39.335333506266274 43 18 10 5 10 4.0542194359769885 24.66566045059224 0.0447998046875 3 0.9847089908907113 9.967571008178306 10777.0 46.284721941518384 0.0 - - - - - - - 307.7142857142857 21 7 BAG3 BCL2-associated athanogene 3 2175 276 C20140707_OR006_05 C20140707_OR006_05 TB412359.[MT7]-NSPPYILDILPDTYQHLR.3y6_1.heavy 767.078 / 817.432 1811.0 45.375173568725586 41 16 10 5 10 3.1263246565468115 31.98644126437438 0.04290008544921875 3 0.9651921855140826 6.5956277747195005 1811.0 4.947577319587629 0.0 - - - - - - - 244.22222222222223 3 9 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 2177 276 C20140707_OR006_05 C20140707_OR006_05 TB412359.[MT7]-NSPPYILDILPDTYQHLR.3b5_1.heavy 767.078 / 703.353 2846.0 45.375173568725586 41 16 10 5 10 3.1263246565468115 31.98644126437438 0.04290008544921875 3 0.9651921855140826 6.5956277747195005 2846.0 11.208864673903314 0.0 - - - - - - - 194.0 5 6 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 2179 276 C20140707_OR006_05 C20140707_OR006_05 TB412359.[MT7]-NSPPYILDILPDTYQHLR.3b8_1.heavy 767.078 / 1044.55 2846.0 45.375173568725586 41 16 10 5 10 3.1263246565468115 31.98644126437438 0.04290008544921875 3 0.9651921855140826 6.5956277747195005 2846.0 7.816606586104093 0.0 - - - - - - - 258.6 5 10 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 2181 276 C20140707_OR006_05 C20140707_OR006_05 TB412359.[MT7]-NSPPYILDILPDTYQHLR.3y8_1.heavy 767.078 / 1029.51 5563.0 45.375173568725586 41 16 10 5 10 3.1263246565468115 31.98644126437438 0.04290008544921875 3 0.9651921855140826 6.5956277747195005 5563.0 -0.3377978565392175 2.0 - - - - - - - 172.33333333333334 13 6 CBLB Cas-Br-M (murine) ecotropic retroviral transforming sequence b 2183 277 C20140707_OR006_05 C20140707_OR006_05 TB437094.[MT7]-IEQAMDLVK[MT7].3b6_1.heavy 445.591 / 832.399 2939.0 35.4341983795166 36 13 10 5 8 0.9404799020782494 54.234508323076426 0.042400360107421875 4 0.9130593899731891 4.154828991869045 2939.0 33.56757857142857 0.0 - - - - - - - 140.0 5 3 TSC22D3;TSC22D4;TSC22D1;TSC22D2 TSC22 domain family, member 3;TSC22 domain family, member 4;TSC22 domain family, member 1;TSC22 domain family, member 2 2185 277 C20140707_OR006_05 C20140707_OR006_05 TB437094.[MT7]-IEQAMDLVK[MT7].3b4_1.heavy 445.591 / 586.332 9238.0 35.4341983795166 36 13 10 5 8 0.9404799020782494 54.234508323076426 0.042400360107421875 4 0.9130593899731891 4.154828991869045 9238.0 97.32892857142856 0.0 - - - - - - - 210.0 18 6 TSC22D3;TSC22D4;TSC22D1;TSC22D2 TSC22 domain family, member 3;TSC22 domain family, member 4;TSC22 domain family, member 1;TSC22 domain family, member 2 2187 277 C20140707_OR006_05 C20140707_OR006_05 TB437094.[MT7]-IEQAMDLVK[MT7].3y4_1.heavy 445.591 / 618.394 5179.0 35.4341983795166 36 13 10 5 8 0.9404799020782494 54.234508323076426 0.042400360107421875 4 0.9130593899731891 4.154828991869045 5179.0 22.072404761904764 1.0 - - - - - - - 227.5 15 8 TSC22D3;TSC22D4;TSC22D1;TSC22D2 TSC22 domain family, member 3;TSC22 domain family, member 4;TSC22 domain family, member 1;TSC22 domain family, member 2 2189 277 C20140707_OR006_05 C20140707_OR006_05 TB437094.[MT7]-IEQAMDLVK[MT7].3b3_1.heavy 445.591 / 515.295 4339.0 35.4341983795166 36 13 10 5 8 0.9404799020782494 54.234508323076426 0.042400360107421875 4 0.9130593899731891 4.154828991869045 4339.0 25.000904761904764 0.0 - - - - - - - 315.0 8 4 TSC22D3;TSC22D4;TSC22D1;TSC22D2 TSC22 domain family, member 3;TSC22 domain family, member 4;TSC22 domain family, member 1;TSC22 domain family, member 2 2191 278 C20140707_OR006_05 C20140707_OR006_05 TB436968.[MT7]-LYLTNSK[MT7].2b3_1.heavy 563.839 / 534.341 4220.0 28.420299530029297 48 18 10 10 10 6.330800060100156 15.795791851056808 0.0 3 0.981942941355864 9.170292419057729 4220.0 35.16666666666667 0.0 - - - - - - - 304.0 8 9 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 2193 278 C20140707_OR006_05 C20140707_OR006_05 TB436968.[MT7]-LYLTNSK[MT7].2y4_1.heavy 563.839 / 593.338 10492.0 28.420299530029297 48 18 10 10 10 6.330800060100156 15.795791851056808 0.0 3 0.981942941355864 9.170292419057729 10492.0 40.28835964912281 1.0 - - - - - - - 321.27272727272725 20 11 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 2195 278 C20140707_OR006_05 C20140707_OR006_05 TB436968.[MT7]-LYLTNSK[MT7].2y5_1.heavy 563.839 / 706.422 4904.0 28.420299530029297 48 18 10 10 10 6.330800060100156 15.795791851056808 0.0 3 0.981942941355864 9.170292419057729 4904.0 47.6265664160401 0.0 - - - - - - - 684.0 9 7 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 2197 278 C20140707_OR006_05 C20140707_OR006_05 TB436968.[MT7]-LYLTNSK[MT7].2y6_1.heavy 563.839 / 869.485 7185.0 28.420299530029297 48 18 10 10 10 6.330800060100156 15.795791851056808 0.0 3 0.981942941355864 9.170292419057729 7185.0 29.32824561403509 0.0 - - - - - - - 182.4 14 10 AP3B2;AP3B1 adaptor-related protein complex 3, beta 2 subunit;adaptor-related protein complex 3, beta 1 subunit 2199 279 C20140707_OR006_05 C20140707_OR006_05 TB437091.[MT7]-LLDSITVPVAR.2y8_1.heavy 664.407 / 842.509 14247.0 39.722999572753906 50 20 10 10 10 6.020239238088921 16.610635565330828 0.0 3 0.9914246179429687 13.317563865860054 14247.0 38.819073033707866 0.0 - - - - - - - 732.4285714285714 28 7 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2201 279 C20140707_OR006_05 C20140707_OR006_05 TB437091.[MT7]-LLDSITVPVAR.2y9_1.heavy 664.407 / 957.536 12395.0 39.722999572753906 50 20 10 10 10 6.020239238088921 16.610635565330828 0.0 3 0.9914246179429687 13.317563865860054 12395.0 62.40991228070175 0.0 - - - - - - - 242.0 24 10 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2203 279 C20140707_OR006_05 C20140707_OR006_05 TB437091.[MT7]-LLDSITVPVAR.2y6_1.heavy 664.407 / 642.393 7408.0 39.722999572753906 50 20 10 10 10 6.020239238088921 16.610635565330828 0.0 3 0.9914246179429687 13.317563865860054 7408.0 3.29658786167327 1.0 - - - - - - - 302.5 17 8 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2205 279 C20140707_OR006_05 C20140707_OR006_05 TB437091.[MT7]-LLDSITVPVAR.2y10_1.heavy 664.407 / 1070.62 15814.0 39.722999572753906 50 20 10 10 10 6.020239238088921 16.610635565330828 0.0 3 0.9914246179429687 13.317563865860054 15814.0 60.917032487615295 0.0 - - - - - - - 266.875 31 8 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2207 280 C20140707_OR006_05 C20140707_OR006_05 TB437487.[MT7]-ATGYLELSNWPEVAPDPSVR.3b6_1.heavy 782.401 / 779.406 7551.0 42.736900329589844 48 18 10 10 10 2.632155378186958 30.410315534640198 0.0 3 0.9809150508291846 8.919155365329752 7551.0 28.414565096291582 0.0 - - - - - - - 178.3 15 10 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2209 280 C20140707_OR006_05 C20140707_OR006_05 TB437487.[MT7]-ATGYLELSNWPEVAPDPSVR.3b4_1.heavy 782.401 / 537.279 4805.0 42.736900329589844 48 18 10 10 10 2.632155378186958 30.410315534640198 0.0 3 0.9809150508291846 8.919155365329752 4805.0 13.79606347613206 0.0 - - - - - - - 315.9 9 10 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2211 280 C20140707_OR006_05 C20140707_OR006_05 TB437487.[MT7]-ATGYLELSNWPEVAPDPSVR.3b5_1.heavy 782.401 / 650.363 3570.0 42.736900329589844 48 18 10 10 10 2.632155378186958 30.410315534640198 0.0 3 0.9809150508291846 8.919155365329752 3570.0 29.961075525100547 1.0 - - - - - - - 205.8 9 10 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2213 280 C20140707_OR006_05 C20140707_OR006_05 TB437487.[MT7]-ATGYLELSNWPEVAPDPSVR.3y10_1.heavy 782.401 / 1066.55 7826.0 42.736900329589844 48 18 10 10 10 2.632155378186958 30.410315534640198 0.0 3 0.9809150508291846 8.919155365329752 7826.0 -0.36086281412674825 2.0 - - - - - - - 299.54545454545456 18 11 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2215 281 C20140707_OR006_05 C20140707_OR006_05 TB412362.[MT7]-GLSLIEATPENDNTLC[CAM]PGLR.2b3_1.heavy 1157.6 / 402.247 430.0 39.29800033569336 36 11 10 5 10 1.8432934713336848 43.33249142448692 0.0447998046875 3 0.8789958530100864 3.5114171985844664 430.0 5.983916083916084 3.0 - - - - - - - 0.0 0 0 CCNG2 cyclin G2 2217 281 C20140707_OR006_05 C20140707_OR006_05 TB412362.[MT7]-GLSLIEATPENDNTLC[CAM]PGLR.2y8_1.heavy 1157.6 / 930.483 1865.0 39.29800033569336 36 11 10 5 10 1.8432934713336848 43.33249142448692 0.0447998046875 3 0.8789958530100864 3.5114171985844664 1865.0 17.781142028703005 0.0 - - - - - - - 214.83333333333334 3 6 CCNG2 cyclin G2 2219 281 C20140707_OR006_05 C20140707_OR006_05 TB412362.[MT7]-GLSLIEATPENDNTLC[CAM]PGLR.2b5_1.heavy 1157.6 / 628.415 3300.0 39.29800033569336 36 11 10 5 10 1.8432934713336848 43.33249142448692 0.0447998046875 3 0.8789958530100864 3.5114171985844664 3300.0 45.43846153846154 0.0 - - - - - - - 258.0 6 5 CCNG2 cyclin G2 2221 281 C20140707_OR006_05 C20140707_OR006_05 TB412362.[MT7]-GLSLIEATPENDNTLC[CAM]PGLR.2b4_1.heavy 1157.6 / 515.331 3300.0 39.29800033569336 36 11 10 5 10 1.8432934713336848 43.33249142448692 0.0447998046875 3 0.8789958530100864 3.5114171985844664 3300.0 33.77030286786384 0.0 - - - - - - - 200.6 6 5 CCNG2 cyclin G2 2223 282 C20140707_OR006_05 C20140707_OR006_05 TB449947.[MT7]-SSLSEK[MT7].2y4_1.heavy 469.773 / 620.374 460.0 17.339924335479736 29 14 2 5 8 2.406781274399221 41.54926792213884 0.04409980773925781 4 0.9329365402786259 4.738729076604201 460.0 4.0 0.0 - - - - - - - 0.0 0 0 MALT1;USP10 mucosa associated lymphoid tissue lymphoma translocation gene 1;ubiquitin specific peptidase 10 2225 282 C20140707_OR006_05 C20140707_OR006_05 TB449947.[MT7]-SSLSEK[MT7].2y5_1.heavy 469.773 / 707.406 1012.0 17.339924335479736 29 14 2 5 8 2.406781274399221 41.54926792213884 0.04409980773925781 4 0.9329365402786259 4.738729076604201 1012.0 20.35 1.0 - - - - - - - 84.33333333333333 14 6 MALT1;USP10 mucosa associated lymphoid tissue lymphoma translocation gene 1;ubiquitin specific peptidase 10 2227 282 C20140707_OR006_05 C20140707_OR006_05 TB449947.[MT7]-SSLSEK[MT7].2b4_1.heavy 469.773 / 519.289 552.0 17.339924335479736 29 14 2 5 8 2.406781274399221 41.54926792213884 0.04409980773925781 4 0.9329365402786259 4.738729076604201 552.0 13.344 0.0 - - - - - - - 0.0 1 0 MALT1;USP10 mucosa associated lymphoid tissue lymphoma translocation gene 1;ubiquitin specific peptidase 10 2229 282 C20140707_OR006_05 C20140707_OR006_05 TB449947.[MT7]-SSLSEK[MT7].2y3_1.heavy 469.773 / 507.289 2576.0 17.339924335479736 29 14 2 5 8 2.406781274399221 41.54926792213884 0.04409980773925781 4 0.9329365402786259 4.738729076604201 2576.0 25.573333333333334 0.0 - - - - - - - 158.44444444444446 5 9 MALT1;USP10 mucosa associated lymphoid tissue lymphoma translocation gene 1;ubiquitin specific peptidase 10 2231 283 C20140707_OR006_05 C20140707_OR006_05 TB437480.[MT7]-GLSLIEATPENDNTLC[CAM]PGLR.3b6_1.heavy 772.066 / 757.458 13620.0 39.32040023803711 48 18 10 10 10 3.538683506158789 23.131951867065666 0.0 3 0.9840489214728179 9.758618917939666 13620.0 47.92068671618166 0.0 - - - - - - - 327.57142857142856 27 7 CCNG2 cyclin G2 2233 283 C20140707_OR006_05 C20140707_OR006_05 TB437480.[MT7]-GLSLIEATPENDNTLC[CAM]PGLR.3b4_1.heavy 772.066 / 515.331 30395.0 39.32040023803711 48 18 10 10 10 3.538683506158789 23.131951867065666 0.0 3 0.9840489214728179 9.758618917939666 30395.0 47.71308139534884 0.0 - - - - - - - 702.3 60 10 CCNG2 cyclin G2 2235 283 C20140707_OR006_05 C20140707_OR006_05 TB437480.[MT7]-GLSLIEATPENDNTLC[CAM]PGLR.3b5_1.heavy 772.066 / 628.415 17061.0 39.32040023803711 48 18 10 10 10 3.538683506158789 23.131951867065666 0.0 3 0.9840489214728179 9.758618917939666 17061.0 59.50460221854627 0.0 - - - - - - - 243.7 34 10 CCNG2 cyclin G2 2237 283 C20140707_OR006_05 C20140707_OR006_05 TB437480.[MT7]-GLSLIEATPENDNTLC[CAM]PGLR.3y8_1.heavy 772.066 / 930.483 6882.0 39.32040023803711 48 18 10 10 10 3.538683506158789 23.131951867065666 0.0 3 0.9840489214728179 9.758618917939666 6882.0 89.03286713286712 0.0 - - - - - - - 245.57142857142858 13 7 CCNG2 cyclin G2 2239 284 C20140707_OR006_05 C20140707_OR006_05 TB412124.[MT7]-DREGYAPGTEFHR.4y4_1.heavy 420.457 / 588.289 2619.0 21.86894989013672 29 9 6 6 8 0.9492021626866795 67.59450177482708 0.03179931640625 4 0.8192716507937379 2.8581186621166306 2619.0 12.95188524590164 1.0 - - - - - - - 182.92857142857142 11 14 CASP2 caspase 2, apoptosis-related cysteine peptidase 2241 284 C20140707_OR006_05 C20140707_OR006_05 TB412124.[MT7]-DREGYAPGTEFHR.4b5_1.heavy 420.457 / 765.365 609.0 21.86894989013672 29 9 6 6 8 0.9492021626866795 67.59450177482708 0.03179931640625 4 0.8192716507937379 2.8581186621166306 609.0 6.689016393442623 0.0 - - - - - - - 0.0 1 0 CASP2 caspase 2, apoptosis-related cysteine peptidase 2243 284 C20140707_OR006_05 C20140707_OR006_05 TB412124.[MT7]-DREGYAPGTEFHR.4y3_1.heavy 420.457 / 459.246 4020.0 21.86894989013672 29 9 6 6 8 0.9492021626866795 67.59450177482708 0.03179931640625 4 0.8192716507937379 2.8581186621166306 4020.0 18.45245901639344 0.0 - - - - - - - 188.4090909090909 8 22 CASP2 caspase 2, apoptosis-related cysteine peptidase 2245 284 C20140707_OR006_05 C20140707_OR006_05 TB412124.[MT7]-DREGYAPGTEFHR.4b6_1.heavy 420.457 / 836.402 426.0 21.86894989013672 29 9 6 6 8 0.9492021626866795 67.59450177482708 0.03179931640625 4 0.8192716507937379 2.8581186621166306 426.0 1.3967213114754098 2.0 - - - - - - - 0.0 1 0 CASP2 caspase 2, apoptosis-related cysteine peptidase 2247 285 C20140707_OR006_05 C20140707_OR006_05 TB437481.[MT7]-LLSEEVFDFSSGQITQVK[MT7].3b6_1.heavy 772.417 / 815.463 7489.0 45.29999923706055 47 17 10 10 10 3.7713907079314275 26.51541771837505 0.0 3 0.9723195411569857 7.40063210032536 7489.0 42.766640826873385 0.0 - - - - - - - 236.5 14 6 XPO1 exportin 1 (CRM1 homolog, yeast) 2249 285 C20140707_OR006_05 C20140707_OR006_05 TB437481.[MT7]-LLSEEVFDFSSGQITQVK[MT7].3b5_1.heavy 772.417 / 716.395 13171.0 45.29999923706055 47 17 10 10 10 3.7713907079314275 26.51541771837505 0.0 3 0.9723195411569857 7.40063210032536 13171.0 44.02979226425376 0.0 - - - - - - - 202.71428571428572 26 7 XPO1 exportin 1 (CRM1 homolog, yeast) 2251 285 C20140707_OR006_05 C20140707_OR006_05 TB437481.[MT7]-LLSEEVFDFSSGQITQVK[MT7].3y4_1.heavy 772.417 / 619.39 10976.0 45.29999923706055 47 17 10 10 10 3.7713907079314275 26.51541771837505 0.0 3 0.9723195411569857 7.40063210032536 10976.0 67.91506000409962 1.0 - - - - - - - 258.0 28 9 XPO1 exportin 1 (CRM1 homolog, yeast) 2253 285 C20140707_OR006_05 C20140707_OR006_05 TB437481.[MT7]-LLSEEVFDFSSGQITQVK[MT7].3b8_1.heavy 772.417 / 1077.56 9426.0 45.29999923706055 47 17 10 10 10 3.7713907079314275 26.51541771837505 0.0 3 0.9723195411569857 7.40063210032536 9426.0 37.97365685074519 0.0 - - - - - - - 313.2857142857143 18 7 XPO1 exportin 1 (CRM1 homolog, yeast) 2255 286 C20140707_OR006_05 C20140707_OR006_05 TB450091.[MT7]-SIPIC[CAM]TLK[MT7].3y3_1.heavy 407.249 / 505.347 4814.0 31.857200622558594 42 17 10 5 10 6.159303252512918 16.235602616124034 0.045200347900390625 3 0.9704849710135758 7.16583412175711 4814.0 19.489878542510123 0.0 - - - - - - - 246.6 9 5 UBA1 ubiquitin-like modifier activating enzyme 1 2257 286 C20140707_OR006_05 C20140707_OR006_05 TB450091.[MT7]-SIPIC[CAM]TLK[MT7].3b4_1.heavy 407.249 / 555.362 2592.0 31.857200622558594 42 17 10 5 10 6.159303252512918 16.235602616124034 0.045200347900390625 3 0.9704849710135758 7.16583412175711 2592.0 8.40365028996608 0.0 - - - - - - - 277.75 5 8 UBA1 ubiquitin-like modifier activating enzyme 1 2259 286 C20140707_OR006_05 C20140707_OR006_05 TB450091.[MT7]-SIPIC[CAM]TLK[MT7].3y4_1.heavy 407.249 / 665.377 1111.0 31.857200622558594 42 17 10 5 10 6.159303252512918 16.235602616124034 0.045200347900390625 3 0.9704849710135758 7.16583412175711 1111.0 10.318399954832882 1.0 - - - - - - - 123.0 2 2 UBA1 ubiquitin-like modifier activating enzyme 1 2261 286 C20140707_OR006_05 C20140707_OR006_05 TB450091.[MT7]-SIPIC[CAM]TLK[MT7].3b3_1.heavy 407.249 / 442.278 3209.0 31.857200622558594 42 17 10 5 10 6.159303252512918 16.235602616124034 0.045200347900390625 3 0.9704849710135758 7.16583412175711 3209.0 9.576938282586383 0.0 - - - - - - - 334.85714285714283 6 7 UBA1 ubiquitin-like modifier activating enzyme 1 2263 287 C20140707_OR006_05 C20140707_OR006_05 TB412127.[MT7]-VYVATFLGFGGNAAR.2y8_1.heavy 843.958 / 749.369 3137.0 44.75749969482422 39 9 10 10 10 2.0401818479585616 42.19927259745254 0.0 3 0.8115370569130755 2.796919507926771 3137.0 23.983264601795796 0.0 - - - - - - - 196.08333333333334 6 12 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 2265 287 C20140707_OR006_05 C20140707_OR006_05 TB412127.[MT7]-VYVATFLGFGGNAAR.2y12_1.heavy 843.958 / 1181.61 1961.0 44.75749969482422 39 9 10 10 10 2.0401818479585616 42.19927259745254 0.0 3 0.8115370569130755 2.796919507926771 1961.0 18.887909683834927 0.0 - - - - - - - 217.83333333333334 3 6 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 2267 287 C20140707_OR006_05 C20140707_OR006_05 TB412127.[MT7]-VYVATFLGFGGNAAR.2y9_1.heavy 843.958 / 862.453 2091.0 44.75749969482422 39 9 10 10 10 2.0401818479585616 42.19927259745254 0.0 3 0.8115370569130755 2.796919507926771 2091.0 10.665250630424584 0.0 - - - - - - - 131.0 4 1 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 2269 287 C20140707_OR006_05 C20140707_OR006_05 TB412127.[MT7]-VYVATFLGFGGNAAR.2y11_1.heavy 843.958 / 1110.57 4575.0 44.75749969482422 39 9 10 10 10 2.0401818479585616 42.19927259745254 0.0 3 0.8115370569130755 2.796919507926771 4575.0 10.499363464314982 0.0 - - - - - - - 653.5714285714286 9 7 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 2271 288 C20140707_OR006_05 C20140707_OR006_05 TB450090.[MT7]-SIPIC[CAM]TLK[MT7].2y4_1.heavy 610.37 / 665.377 4567.0 31.845900535583496 43 20 10 5 8 8.186825981732932 12.214746010618473 0.045200347900390625 4 0.9961533172818158 19.892065116315514 4567.0 8.452121527777779 0.0 - - - - - - - 287.8333333333333 9 12 UBA1 ubiquitin-like modifier activating enzyme 1 2273 288 C20140707_OR006_05 C20140707_OR006_05 TB450090.[MT7]-SIPIC[CAM]TLK[MT7].2y5_1.heavy 610.37 / 778.461 864.0 31.845900535583496 43 20 10 5 8 8.186825981732932 12.214746010618473 0.045200347900390625 4 0.9961533172818158 19.892065116315514 864.0 4.372469635627531 8.0 - - - - - - - 202.57142857142858 3 14 UBA1 ubiquitin-like modifier activating enzyme 1 2275 288 C20140707_OR006_05 C20140707_OR006_05 TB450090.[MT7]-SIPIC[CAM]TLK[MT7].2y3_1.heavy 610.37 / 505.347 2839.0 31.845900535583496 43 20 10 5 8 8.186825981732932 12.214746010618473 0.045200347900390625 4 0.9961533172818158 19.892065116315514 2839.0 3.1938495671429488 1.0 - - - - - - - 329.0 7 6 UBA1 ubiquitin-like modifier activating enzyme 1 2277 288 C20140707_OR006_05 C20140707_OR006_05 TB450090.[MT7]-SIPIC[CAM]TLK[MT7].2y6_1.heavy 610.37 / 875.514 12961.0 31.845900535583496 43 20 10 5 8 8.186825981732932 12.214746010618473 0.045200347900390625 4 0.9961533172818158 19.892065116315514 12961.0 27.116284049457573 0.0 - - - - - - - 185.0 25 6 UBA1 ubiquitin-like modifier activating enzyme 1 2279 289 C20140707_OR006_05 C20140707_OR006_05 TB436867.[MT7]-EMLIEVIEK[MT7].3y3_1.heavy 464.607 / 533.341 4972.0 40.69020080566406 34 9 10 5 10 1.47096402635304 45.80055027488883 0.04360198974609375 3 0.806627242959178 2.7599683736096043 4972.0 51.435690140845075 0.0 - - - - - - - 284.0 9 6 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2281 289 C20140707_OR006_05 C20140707_OR006_05 TB436867.[MT7]-EMLIEVIEK[MT7].3b4_1.heavy 464.607 / 631.36 2699.0 40.69020080566406 34 9 10 5 10 1.47096402635304 45.80055027488883 0.04360198974609375 3 0.806627242959178 2.7599683736096043 2699.0 5.502112676056338 1.0 - - - - - - - 248.5 5 4 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2283 289 C20140707_OR006_05 C20140707_OR006_05 TB436867.[MT7]-EMLIEVIEK[MT7].3b5_1.heavy 464.607 / 760.403 2841.0 40.69020080566406 34 9 10 5 10 1.47096402635304 45.80055027488883 0.04360198974609375 3 0.806627242959178 2.7599683736096043 2841.0 16.672535211267608 0.0 - - - - - - - 213.0 5 2 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2285 289 C20140707_OR006_05 C20140707_OR006_05 TB436867.[MT7]-EMLIEVIEK[MT7].3b3_1.heavy 464.607 / 518.276 1847.0 40.69020080566406 34 9 10 5 10 1.47096402635304 45.80055027488883 0.04360198974609375 3 0.806627242959178 2.7599683736096043 1847.0 20.8112676056338 0.0 - - - - - - - 142.0 3 1 AP3B1 adaptor-related protein complex 3, beta 1 subunit 2287 290 C20140707_OR006_05 C20140707_OR006_05 TB436865.[MT7]-AGQEFAR.2y4_1.heavy 461.747 / 522.267 1269.0 19.881199836730957 43 18 10 7 8 25.328618644908822 3.9481031872261414 0.028600692749023438 4 0.9893135606354223 11.927744885530595 1269.0 41.35189655172414 0.0 - - - - - - - 157.66666666666666 2 15 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2289 290 C20140707_OR006_05 C20140707_OR006_05 TB436865.[MT7]-AGQEFAR.2b4_1.heavy 461.747 / 530.269 2539.0 19.881199836730957 43 18 10 7 8 25.328618644908822 3.9481031872261414 0.028600692749023438 4 0.9893135606354223 11.927744885530595 2539.0 8.636513680154142 1.0 - - - - - - - 149.41176470588235 6 17 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2291 290 C20140707_OR006_05 C20140707_OR006_05 TB436865.[MT7]-AGQEFAR.2y6_1.heavy 461.747 / 707.347 3346.0 19.881199836730957 43 18 10 7 8 25.328618644908822 3.9481031872261414 0.028600692749023438 4 0.9893135606354223 11.927744885530595 3346.0 26.700037732819524 0.0 - - - - - - - 142.26666666666668 6 15 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2293 290 C20140707_OR006_05 C20140707_OR006_05 TB436865.[MT7]-AGQEFAR.2b5_1.heavy 461.747 / 677.338 1385.0 19.881199836730957 43 18 10 7 8 25.328618644908822 3.9481031872261414 0.028600692749023438 4 0.9893135606354223 11.927744885530595 1385.0 10.727745664739885 0.0 - - - - - - - 147.44444444444446 2 18 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2295 291 C20140707_OR006_05 C20140707_OR006_05 TB436863.[MT7]-DLLGLC[CAM]EQK[MT7].3y3_1.heavy 455.255 / 548.316 1105.0 33.57982635498047 31 5 10 6 10 0.6741123299255587 74.79920653015206 0.0399017333984375 3 0.6550470085984699 2.0376232665648106 1105.0 6.766123188405796 2.0 - - - - - - - 230.0 4 6 XPO1 exportin 1 (CRM1 homolog, yeast) 2297 291 C20140707_OR006_05 C20140707_OR006_05 TB436863.[MT7]-DLLGLC[CAM]EQK[MT7].3b4_1.heavy 455.255 / 543.326 3453.0 33.57982635498047 31 5 10 6 10 0.6741123299255587 74.79920653015206 0.0399017333984375 3 0.6550470085984699 2.0376232665648106 3453.0 28.26804725350783 0.0 - - - - - - - 248.4 6 5 XPO1 exportin 1 (CRM1 homolog, yeast) 2299 291 C20140707_OR006_05 C20140707_OR006_05 TB436863.[MT7]-DLLGLC[CAM]EQK[MT7].3y4_1.heavy 455.255 / 708.347 1243.0 33.57982635498047 31 5 10 6 10 0.6741123299255587 74.79920653015206 0.0399017333984375 3 0.6550470085984699 2.0376232665648106 1243.0 14.411594202898549 0.0 - - - - - - - 138.0 2 3 XPO1 exportin 1 (CRM1 homolog, yeast) 2301 291 C20140707_OR006_05 C20140707_OR006_05 TB436863.[MT7]-DLLGLC[CAM]EQK[MT7].3b3_1.heavy 455.255 / 486.304 10636.0 33.57982635498047 31 5 10 6 10 0.6741123299255587 74.79920653015206 0.0399017333984375 3 0.6550470085984699 2.0376232665648106 10636.0 96.08367149758453 1.0 - - - - - - - 295.7142857142857 21 7 XPO1 exportin 1 (CRM1 homolog, yeast) 2303 292 C20140707_OR006_05 C20140707_OR006_05 TB436860.[MT7]-VDIMER.2b3_1.heavy 453.745 / 472.289 5438.0 27.472400665283203 48 18 10 10 10 6.4795588055503845 15.433149540110676 0.0 3 0.9844458497164331 9.882678988882045 5438.0 27.65274061032864 0.0 - - - - - - - 189.66666666666666 10 9 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 2305 292 C20140707_OR006_05 C20140707_OR006_05 TB436860.[MT7]-VDIMER.2y4_1.heavy 453.745 / 548.286 8210.0 27.472400665283203 48 18 10 10 10 6.4795588055503845 15.433149540110676 0.0 3 0.9844458497164331 9.882678988882045 8210.0 36.675609375 0.0 - - - - - - - 289.7142857142857 16 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 2307 292 C20140707_OR006_05 C20140707_OR006_05 TB436860.[MT7]-VDIMER.2y5_1.heavy 453.745 / 663.313 7997.0 27.472400665283203 48 18 10 10 10 6.4795588055503845 15.433149540110676 0.0 3 0.9844458497164331 9.882678988882045 7997.0 59.408464642018785 0.0 - - - - - - - 243.85714285714286 15 7 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 2309 292 C20140707_OR006_05 C20140707_OR006_05 TB436860.[MT7]-VDIMER.2b4_1.heavy 453.745 / 603.329 2666.0 27.472400665283203 48 18 10 10 10 6.4795588055503845 15.433149540110676 0.0 3 0.9844458497164331 9.882678988882045 2666.0 20.714186355633807 0.0 - - - - - - - 230.83333333333334 5 6 SPTLC2 serine palmitoyltransferase, long chain base subunit 2 2311 293 C20140707_OR006_05 C20140707_OR006_05 TB437202.[MT7]-TILWVQAATGSAQ.2b4_1.heavy 745.41 / 658.404 9554.0 42.168399810791016 47 17 10 10 10 2.981258791150877 28.441637997789655 0.0 3 0.9784150725987194 8.384994444296735 9554.0 97.52913003663002 0.0 - - - - - - - 170.25 19 8 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 2313 293 C20140707_OR006_05 C20140707_OR006_05 TB437202.[MT7]-TILWVQAATGSAQ.2b6_1.heavy 745.41 / 885.531 3822.0 42.168399810791016 47 17 10 10 10 2.981258791150877 28.441637997789655 0.0 3 0.9784150725987194 8.384994444296735 3822.0 10.235506112469439 1.0 - - - - - - - 272.625 7 8 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 2315 293 C20140707_OR006_05 C20140707_OR006_05 TB437202.[MT7]-TILWVQAATGSAQ.2b7_1.heavy 745.41 / 956.569 4095.0 42.168399810791016 47 17 10 10 10 2.981258791150877 28.441637997789655 0.0 3 0.9784150725987194 8.384994444296735 4095.0 9.039800429216402 1.0 - - - - - - - 272.5 9 8 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 2317 293 C20140707_OR006_05 C20140707_OR006_05 TB437202.[MT7]-TILWVQAATGSAQ.2b5_1.heavy 745.41 / 757.473 9827.0 42.168399810791016 47 17 10 10 10 2.981258791150877 28.441637997789655 0.0 3 0.9784150725987194 8.384994444296735 9827.0 69.3331550802139 0.0 - - - - - - - 247.9090909090909 19 11 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 2319 294 C20140707_OR006_05 C20140707_OR006_05 TB437341.[MT7]-IFMDAILLSLTRK[MT7].3y7_1.heavy 603.702 / 974.648 13487.0 50.76789855957031 43 13 10 10 10 1.4088762538803166 51.412292256538606 0.0 3 0.9225218160310809 4.404817530012645 13487.0 50.93115042807887 0.0 - - - - - - - 276.6666666666667 26 6 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2321 294 C20140707_OR006_05 C20140707_OR006_05 TB437341.[MT7]-IFMDAILLSLTRK[MT7].3b4_1.heavy 603.702 / 651.329 7366.0 50.76789855957031 43 13 10 10 10 1.4088762538803166 51.412292256538606 0.0 3 0.9225218160310809 4.404817530012645 7366.0 34.84405350311357 0.0 - - - - - - - 311.0 14 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2323 294 C20140707_OR006_05 C20140707_OR006_05 TB437341.[MT7]-IFMDAILLSLTRK[MT7].3b5_1.heavy 603.702 / 722.366 7781.0 50.76789855957031 43 13 10 10 10 1.4088762538803166 51.412292256538606 0.0 3 0.9225218160310809 4.404817530012645 7781.0 72.17159420289855 0.0 - - - - - - - 186.4 15 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2325 294 C20140707_OR006_05 C20140707_OR006_05 TB437341.[MT7]-IFMDAILLSLTRK[MT7].3y5_1.heavy 603.702 / 748.48 4876.0 50.76789855957031 43 13 10 10 10 1.4088762538803166 51.412292256538606 0.0 3 0.9225218160310809 4.404817530012645 4876.0 12.66042882304168 0.0 - - - - - - - 227.8 9 5 KDELC1 KDEL (Lys-Asp-Glu-Leu) containing 1 2327 295 C20140707_OR006_05 C20140707_OR006_05 TB437204.[MT7]-NVIEAC[CAM]VQTGTR.2y8_1.heavy 746.389 / 892.43 5976.0 27.562599182128906 43 13 10 10 10 2.6128105075599404 30.38118706740157 0.0 3 0.9126734782160041 4.145500617402029 5976.0 65.44590291262135 0.0 - - - - - - - 180.25 11 4 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 2329 295 C20140707_OR006_05 C20140707_OR006_05 TB437204.[MT7]-NVIEAC[CAM]VQTGTR.2y9_1.heavy 746.389 / 1021.47 8759.0 27.562599182128906 43 13 10 10 10 2.6128105075599404 30.38118706740157 0.0 3 0.9126734782160041 4.145500617402029 8759.0 108.56624595469255 0.0 - - - - - - - 240.33333333333334 17 6 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 2331 295 C20140707_OR006_05 C20140707_OR006_05 TB437204.[MT7]-NVIEAC[CAM]VQTGTR.2y10_1.heavy 746.389 / 1134.56 4431.0 27.562599182128906 43 13 10 10 10 2.6128105075599404 30.38118706740157 0.0 3 0.9126734782160041 4.145500617402029 4431.0 40.86844660194174 0.0 - - - - - - - 191.28571428571428 8 7 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 2333 295 C20140707_OR006_05 C20140707_OR006_05 TB437204.[MT7]-NVIEAC[CAM]VQTGTR.2y11_1.heavy 746.389 / 1233.63 1030.0 27.562599182128906 43 13 10 10 10 2.6128105075599404 30.38118706740157 0.0 3 0.9126734782160041 4.145500617402029 1030.0 9.649999999999999 0.0 - - - - - - - 154.5 2 6 HSD3B7 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7