Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140707_OR007_01 C20140707_OR007_01 TB449442.[MT7]-NIGMC[CAM]PTC[CAM]K[MT7].3y3_1.heavy 456.894 / 552.293 6406.0 23.87420082092285 50 20 10 10 10 5.332325336787229 14.998022645037526 0.0 3 0.9926656894377894 14.401805014773444 6406.0 28.629062191942865 0.0 - - - - - - - 254.91666666666666 12 12 TRAFD1 TRAF-type zinc finger domain containing 1 3 1 C20140707_OR007_01 C20140707_OR007_01 TB449442.[MT7]-NIGMC[CAM]PTC[CAM]K[MT7].3b4_1.heavy 456.894 / 560.298 6502.0 23.87420082092285 50 20 10 10 10 5.332325336787229 14.998022645037526 0.0 3 0.9926656894377894 14.401805014773444 6502.0 4.899607843137255 1.0 - - - - - - - 203.125 13 8 TRAFD1 TRAF-type zinc finger domain containing 1 5 1 C20140707_OR007_01 C20140707_OR007_01 TB449442.[MT7]-NIGMC[CAM]PTC[CAM]K[MT7].3b5_1.heavy 456.894 / 720.329 2390.0 23.87420082092285 50 20 10 10 10 5.332325336787229 14.998022645037526 0.0 3 0.9926656894377894 14.401805014773444 2390.0 22.419284467713787 0.0 - - - - - - - 207.0 4 6 TRAFD1 TRAF-type zinc finger domain containing 1 7 1 C20140707_OR007_01 C20140707_OR007_01 TB449442.[MT7]-NIGMC[CAM]PTC[CAM]K[MT7].3y4_1.heavy 456.894 / 649.346 8223.0 23.87420082092285 50 20 10 10 10 5.332325336787229 14.998022645037526 0.0 3 0.9926656894377894 14.401805014773444 8223.0 70.51480889140231 0.0 - - - - - - - 223.0 16 3 TRAFD1 TRAF-type zinc finger domain containing 1 9 2 C20140707_OR007_01 C20140707_OR007_01 TB449440.[MT7]-AFESDVFHNR.3b4_1.heavy 455.894 / 579.289 2664.0 29.153449535369873 44 18 10 6 10 5.580601312540368 17.91921594099303 0.03619956970214844 3 0.9830966297756965 9.478989886139408 2664.0 26.390558731329527 1.0 - - - - - - - 246.58333333333334 5 12 TRAFD1 TRAF-type zinc finger domain containing 1 11 2 C20140707_OR007_01 C20140707_OR007_01 TB449440.[MT7]-AFESDVFHNR.3b5_1.heavy 455.894 / 694.316 20519.0 29.153449535369873 44 18 10 6 10 5.580601312540368 17.91921594099303 0.03619956970214844 3 0.9830966297756965 9.478989886139408 20519.0 208.85910865410867 0.0 - - - - - - - 225.57142857142858 41 7 TRAFD1 TRAF-type zinc finger domain containing 1 13 2 C20140707_OR007_01 C20140707_OR007_01 TB449440.[MT7]-AFESDVFHNR.3b3_1.heavy 455.894 / 492.258 9766.0 29.153449535369873 44 18 10 6 10 5.580601312540368 17.91921594099303 0.03619956970214844 3 0.9830966297756965 9.478989886139408 9766.0 28.748526420776784 0.0 - - - - - - - 239.64285714285714 19 14 TRAFD1 TRAF-type zinc finger domain containing 1 15 2 C20140707_OR007_01 C20140707_OR007_01 TB449440.[MT7]-AFESDVFHNR.3y4_1.heavy 455.894 / 573.289 17658.0 29.153449535369873 44 18 10 6 10 5.580601312540368 17.91921594099303 0.03619956970214844 3 0.9830966297756965 9.478989886139408 17658.0 98.09765070133423 0.0 - - - - - - - 197.5 35 10 TRAFD1 TRAF-type zinc finger domain containing 1 17 3 C20140707_OR007_01 C20140707_OR007_01 TB419679.[MT7]-VLFYPTLLYTLFRGK[MT7].4y8_2.heavy 530.569 / 571.346 1123.0 53.59966786702474 35 9 10 6 10 0.6877256974601201 87.9388468453257 0.03079986572265625 3 0.80667120671901 2.7602930620901924 1123.0 11.91060606060606 0.0 - - - - - - - 113.66666666666667 2 9 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 19 3 C20140707_OR007_01 C20140707_OR007_01 TB419679.[MT7]-VLFYPTLLYTLFRGK[MT7].4y7_1.heavy 530.569 / 1028.6 N/A 53.59966786702474 35 9 10 6 10 0.6877256974601201 87.9388468453257 0.03079986572265625 3 0.80667120671901 2.7602930620901924 66.0 0.0 7.0 - - - - - - - 0.0 0 0 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 21 3 C20140707_OR007_01 C20140707_OR007_01 TB419679.[MT7]-VLFYPTLLYTLFRGK[MT7].4y7_2.heavy 530.569 / 514.804 231.0 53.59966786702474 35 9 10 6 10 0.6877256974601201 87.9388468453257 0.03079986572265625 3 0.80667120671901 2.7602930620901924 231.0 8.75 0.0 - - - - - - - 0.0 0 0 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 23 3 C20140707_OR007_01 C20140707_OR007_01 TB419679.[MT7]-VLFYPTLLYTLFRGK[MT7].4b4_1.heavy 530.569 / 667.394 528.0 53.59966786702474 35 9 10 6 10 0.6877256974601201 87.9388468453257 0.03079986572265625 3 0.80667120671901 2.7602930620901924 528.0 14.399999999999999 0.0 - - - - - - - 0.0 1 0 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 25 4 C20140707_OR007_01 C20140707_OR007_01 TB418699.[MT7]-HGC[CAM]AFLVDEVQTGGGC[CAM]TGK[MT7].4b4_1.heavy 571.029 / 570.258 N/A 30.90959930419922 42 20 2 10 10 18.592289759182 5.37857366119275 0.0 3 0.9991454193363819 42.21384446267651 9617.0 5.258490144325524 2.0 - - - - - - - 748.0 57 2 ABAT 4-aminobutyrate aminotransferase 27 4 C20140707_OR007_01 C20140707_OR007_01 TB418699.[MT7]-HGC[CAM]AFLVDEVQTGGGC[CAM]TGK[MT7].4b5_1.heavy 571.029 / 717.326 10899.0 30.90959930419922 42 20 2 10 10 18.592289759182 5.37857366119275 0.0 3 0.9991454193363819 42.21384446267651 10899.0 30.62154420603054 0.0 - - - - - - - 625.7142857142857 21 7 ABAT 4-aminobutyrate aminotransferase 29 4 C20140707_OR007_01 C20140707_OR007_01 TB418699.[MT7]-HGC[CAM]AFLVDEVQTGGGC[CAM]TGK[MT7].4y7_1.heavy 571.029 / 780.379 3206.0 30.90959930419922 42 20 2 10 10 18.592289759182 5.37857366119275 0.0 3 0.9991454193363819 42.21384446267651 3206.0 13.217466306828594 0.0 - - - - - - - 214.0 6 12 ABAT 4-aminobutyrate aminotransferase 31 4 C20140707_OR007_01 C20140707_OR007_01 TB418699.[MT7]-HGC[CAM]AFLVDEVQTGGGC[CAM]TGK[MT7].4b6_1.heavy 571.029 / 830.41 4808.0 30.90959930419922 42 20 2 10 10 18.592289759182 5.37857366119275 0.0 3 0.9991454193363819 42.21384446267651 4808.0 34.74940809968847 0.0 - - - - - - - 222.91666666666666 9 12 ABAT 4-aminobutyrate aminotransferase 33 5 C20140707_OR007_01 C20140707_OR007_01 TB419270.[MT7]-SIFETYMSK[MT7].2y4_1.heavy 697.367 / 672.351 5827.0 38.47829818725586 45 15 10 10 10 2.6126497072980444 30.53362678425951 0.0 3 0.9567655771672027 5.913849645170777 5827.0 4.097480478898945 0.0 - - - - - - - 249.6 11 10 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 35 5 C20140707_OR007_01 C20140707_OR007_01 TB419270.[MT7]-SIFETYMSK[MT7].2y5_1.heavy 697.367 / 773.398 3607.0 38.47829818725586 45 15 10 10 10 2.6126497072980444 30.53362678425951 0.0 3 0.9567655771672027 5.913849645170777 3607.0 4.917681163756715 1.0 - - - - - - - 200.33333333333334 11 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 37 5 C20140707_OR007_01 C20140707_OR007_01 TB419270.[MT7]-SIFETYMSK[MT7].2b6_1.heavy 697.367 / 885.447 2914.0 38.47829818725586 45 15 10 10 10 2.6126497072980444 30.53362678425951 0.0 3 0.9567655771672027 5.913849645170777 2914.0 5.323653846153846 0.0 - - - - - - - 246.55555555555554 5 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 39 5 C20140707_OR007_01 C20140707_OR007_01 TB419270.[MT7]-SIFETYMSK[MT7].2y3_1.heavy 697.367 / 509.287 4301.0 38.47829818725586 45 15 10 10 10 2.6126497072980444 30.53362678425951 0.0 3 0.9567655771672027 5.913849645170777 4301.0 14.072158948903082 0.0 - - - - - - - 219.66666666666666 8 12 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 41 6 C20140707_OR007_01 C20140707_OR007_01 TB418292.[MT7]-EEFRPNAPYR.3y6_1.heavy 474.913 / 717.368 3333.0 24.170400619506836 29 13 0 10 6 2.108074730694022 47.43664849446676 0.0 6 0.920426214783806 4.345647852874743 3333.0 22.0 1.0 - - - - - - - 168.33333333333334 24 9 ABAT 4-aminobutyrate aminotransferase 43 6 C20140707_OR007_01 C20140707_OR007_01 TB418292.[MT7]-EEFRPNAPYR.3y4_1.heavy 474.913 / 506.272 2222.0 24.170400619506836 29 13 0 10 6 2.108074730694022 47.43664849446676 0.0 6 0.920426214783806 4.345647852874743 2222.0 20.114285714285714 2.0 - - - - - - - 179.55555555555554 98 9 ABAT 4-aminobutyrate aminotransferase 45 6 C20140707_OR007_01 C20140707_OR007_01 TB418292.[MT7]-EEFRPNAPYR.3y8_2.heavy 474.913 / 510.772 3131.0 24.170400619506836 29 13 0 10 6 2.108074730694022 47.43664849446676 0.0 6 0.920426214783806 4.345647852874743 3131.0 17.42458333333333 0.0 - - - - - - - 242.4 6 5 ABAT 4-aminobutyrate aminotransferase 47 6 C20140707_OR007_01 C20140707_OR007_01 TB418292.[MT7]-EEFRPNAPYR.3y5_1.heavy 474.913 / 620.315 2020.0 24.170400619506836 29 13 0 10 6 2.108074730694022 47.43664849446676 0.0 6 0.920426214783806 4.345647852874743 2020.0 6.885714285714286 0.0 - - - - - - - 265.125 4 8 ABAT 4-aminobutyrate aminotransferase 49 7 C20140707_OR007_01 C20140707_OR007_01 TB439443.[MT7]-FGPLVVDWPHK[MT7].3y3_1.heavy 528.304 / 525.326 3920.0 39.50080108642578 44 17 9 10 8 5.904903766715886 16.935077005601517 0.0 4 0.9749875982425077 7.787091234162816 3920.0 10.527999999999999 1.0 - - - - - - - 256.6666666666667 9 6 CPEB2;CPEB3 cytoplasmic polyadenylation element binding protein 2;cytoplasmic polyadenylation element binding protein 3 51 7 C20140707_OR007_01 C20140707_OR007_01 TB439443.[MT7]-FGPLVVDWPHK[MT7].3b4_1.heavy 528.304 / 559.336 4200.0 39.50080108642578 44 17 9 10 8 5.904903766715886 16.935077005601517 0.0 4 0.9749875982425077 7.787091234162816 4200.0 8.76 0.0 - - - - - - - 280.0 8 6 CPEB2;CPEB3 cytoplasmic polyadenylation element binding protein 2;cytoplasmic polyadenylation element binding protein 3 53 7 C20140707_OR007_01 C20140707_OR007_01 TB439443.[MT7]-FGPLVVDWPHK[MT7].3b5_1.heavy 528.304 / 658.404 2100.0 39.50080108642578 44 17 9 10 8 5.904903766715886 16.935077005601517 0.0 4 0.9749875982425077 7.787091234162816 2100.0 7.425 0.0 - - - - - - - 280.0 4 8 CPEB2;CPEB3 cytoplasmic polyadenylation element binding protein 2;cytoplasmic polyadenylation element binding protein 3 55 7 C20140707_OR007_01 C20140707_OR007_01 TB439443.[MT7]-FGPLVVDWPHK[MT7].3b7_1.heavy 528.304 / 872.5 980.0 39.50080108642578 44 17 9 10 8 5.904903766715886 16.935077005601517 0.0 4 0.9749875982425077 7.787091234162816 980.0 5.6466666666666665 1.0 - - - - - - - 0.0 1 0 CPEB2;CPEB3 cytoplasmic polyadenylation element binding protein 2;cytoplasmic polyadenylation element binding protein 3 57 8 C20140707_OR007_01 C20140707_OR007_01 TB439228.[MT7]-SDGVYTGLSTR.2b4_1.heavy 650.337 / 503.258 21501.0 26.28580093383789 50 20 10 10 10 7.22263773233429 13.845357292713187 0.0 3 0.9937976344160363 15.66242348674442 21501.0 63.89084706170739 0.0 - - - - - - - 224.25 43 12 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 59 8 C20140707_OR007_01 C20140707_OR007_01 TB439228.[MT7]-SDGVYTGLSTR.2y9_1.heavy 650.337 / 953.505 27374.0 26.28580093383789 50 20 10 10 10 7.22263773233429 13.845357292713187 0.0 3 0.9937976344160363 15.66242348674442 27374.0 32.8123252512014 0.0 - - - - - - - 286.25 54 8 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 61 8 C20140707_OR007_01 C20140707_OR007_01 TB439228.[MT7]-SDGVYTGLSTR.2y10_1.heavy 650.337 / 1068.53 15628.0 26.28580093383789 50 20 10 10 10 7.22263773233429 13.845357292713187 0.0 3 0.9937976344160363 15.66242348674442 15628.0 84.81212034721497 0.0 - - - - - - - 236.625 31 8 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 63 8 C20140707_OR007_01 C20140707_OR007_01 TB439228.[MT7]-SDGVYTGLSTR.2y7_1.heavy 650.337 / 797.415 19013.0 26.28580093383789 50 20 10 10 10 7.22263773233429 13.845357292713187 0.0 3 0.9937976344160363 15.66242348674442 19013.0 115.06499035355348 0.0 - - - - - - - 262.6363636363636 38 11 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 65 9 C20140707_OR007_01 C20140707_OR007_01 TB439543.[MT7]-VDVEFDYDGPLMK[MT7].2y5_1.heavy 908.457 / 689.414 19017.0 40.02690124511719 46 16 10 10 10 2.2017441274568905 45.41853830921957 0.0 3 0.9683552779468112 6.919261807429619 19017.0 40.081004751148846 0.0 - - - - - - - 277.6666666666667 38 6 ABAT 4-aminobutyrate aminotransferase 67 9 C20140707_OR007_01 C20140707_OR007_01 TB439543.[MT7]-VDVEFDYDGPLMK[MT7].2b4_1.heavy 908.457 / 587.316 8190.0 40.02690124511719 46 16 10 10 10 2.2017441274568905 45.41853830921957 0.0 3 0.9683552779468112 6.919261807429619 8190.0 32.65439004395697 0.0 - - - - - - - 254.66666666666666 16 6 ABAT 4-aminobutyrate aminotransferase 69 9 C20140707_OR007_01 C20140707_OR007_01 TB439543.[MT7]-VDVEFDYDGPLMK[MT7].2b6_1.heavy 908.457 / 849.411 6246.0 40.02690124511719 46 16 10 10 10 2.2017441274568905 45.41853830921957 0.0 3 0.9683552779468112 6.919261807429619 6246.0 2.870056496230603 1.0 - - - - - - - 194.6 19 5 ABAT 4-aminobutyrate aminotransferase 71 9 C20140707_OR007_01 C20140707_OR007_01 TB439543.[MT7]-VDVEFDYDGPLMK[MT7].2y7_1.heavy 908.457 / 967.504 6941.0 40.02690124511719 46 16 10 10 10 2.2017441274568905 45.41853830921957 0.0 3 0.9683552779468112 6.919261807429619 6941.0 28.473890336379547 0.0 - - - - - - - 277.6666666666667 13 6 ABAT 4-aminobutyrate aminotransferase 73 10 C20140707_OR007_01 C20140707_OR007_01 TB439544.[MT7]-SATMVAAYLIQVHK[MT7].3b6_1.heavy 607.35 / 705.372 17539.0 39.00119972229004 41 16 10 5 10 2.9224000228774747 27.276940869907406 0.049198150634765625 3 0.9608841105340143 6.219562702991747 17539.0 131.20166935417183 0.0 - - - - - - - 222.6 35 5 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 75 10 C20140707_OR007_01 C20140707_OR007_01 TB439544.[MT7]-SATMVAAYLIQVHK[MT7].3b4_1.heavy 607.35 / 535.267 15034.0 39.00119972229004 41 16 10 5 10 2.9224000228774747 27.276940869907406 0.049198150634765625 3 0.9608841105340143 6.219562702991747 15034.0 22.683880526257937 0.0 - - - - - - - 243.625 30 8 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 77 10 C20140707_OR007_01 C20140707_OR007_01 TB439544.[MT7]-SATMVAAYLIQVHK[MT7].3b5_1.heavy 607.35 / 634.335 12110.0 39.00119972229004 41 16 10 5 10 2.9224000228774747 27.276940869907406 0.049198150634765625 3 0.9608841105340143 6.219562702991747 12110.0 28.27172513142476 0.0 - - - - - - - 255.16666666666666 24 6 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 79 10 C20140707_OR007_01 C20140707_OR007_01 TB439544.[MT7]-SATMVAAYLIQVHK[MT7].3b7_1.heavy 607.35 / 776.409 24778.0 39.00119972229004 41 16 10 5 10 2.9224000228774747 27.276940869907406 0.049198150634765625 3 0.9608841105340143 6.219562702991747 24778.0 111.25996602307475 0.0 - - - - - - - 208.66666666666666 49 6 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 81 11 C20140707_OR007_01 C20140707_OR007_01 TB439360.[MT7]-LSNSDSQDIQGR.2b8_1.heavy 732.364 / 991.445 3237.0 21.12332534790039 37 11 10 6 10 2.5477196200226286 39.25078694456645 0.03929901123046875 3 0.8615944480338346 3.2782673542155996 3237.0 38.516202531645575 0.0 - - - - - - - 158.0 6 9 TRAFD1 TRAF-type zinc finger domain containing 1 83 11 C20140707_OR007_01 C20140707_OR007_01 TB439360.[MT7]-LSNSDSQDIQGR.2b5_1.heavy 732.364 / 661.327 3316.0 21.12332534790039 37 11 10 6 10 2.5477196200226286 39.25078694456645 0.03929901123046875 3 0.8615944480338346 3.2782673542155996 3316.0 13.956582278481012 0.0 - - - - - - - 237.0 6 11 TRAFD1 TRAF-type zinc finger domain containing 1 85 11 C20140707_OR007_01 C20140707_OR007_01 TB439360.[MT7]-LSNSDSQDIQGR.2y11_1.heavy 732.364 / 1206.53 1500.0 21.12332534790039 37 11 10 6 10 2.5477196200226286 39.25078694456645 0.03929901123046875 3 0.8615944480338346 3.2782673542155996 1500.0 8.044303797468356 1.0 - - - - - - - 124.14285714285714 3 7 TRAFD1 TRAF-type zinc finger domain containing 1 87 11 C20140707_OR007_01 C20140707_OR007_01 TB439360.[MT7]-LSNSDSQDIQGR.2y7_1.heavy 732.364 / 803.401 4026.0 21.12332534790039 37 11 10 6 10 2.5477196200226286 39.25078694456645 0.03929901123046875 3 0.8615944480338346 3.2782673542155996 4026.0 35.67341772151899 0.0 - - - - - - - 181.7 8 10 TRAFD1 TRAF-type zinc finger domain containing 1 89 12 C20140707_OR007_01 C20140707_OR007_01 TB439226.[MT7]-ATSVYLVQK[MT7].3b6_1.heavy 432.93 / 779.442 2207.0 28.823299407958984 46 16 10 10 10 1.8859057864958504 42.08577335310113 0.0 3 0.965090227610373 6.585932413460889 2207.0 13.254183897786813 0.0 - - - - - - - 150.3 4 10 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 91 12 C20140707_OR007_01 C20140707_OR007_01 TB439226.[MT7]-ATSVYLVQK[MT7].3y3_1.heavy 432.93 / 518.342 15349.0 28.823299407958984 46 16 10 10 10 1.8859057864958504 42.08577335310113 0.0 3 0.965090227610373 6.585932413460889 15349.0 34.327905597641184 0.0 - - - - - - - 713.5555555555555 30 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 93 12 C20140707_OR007_01 C20140707_OR007_01 TB439226.[MT7]-ATSVYLVQK[MT7].3b4_1.heavy 432.93 / 503.295 21469.0 28.823299407958984 46 16 10 10 10 1.8859057864958504 42.08577335310113 0.0 3 0.965090227610373 6.585932413460889 21469.0 171.69083475783475 0.0 - - - - - - - 223.76923076923077 42 13 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 95 12 C20140707_OR007_01 C20140707_OR007_01 TB439226.[MT7]-ATSVYLVQK[MT7].3b5_1.heavy 432.93 / 666.358 10835.0 28.823299407958984 46 16 10 10 10 1.8859057864958504 42.08577335310113 0.0 3 0.965090227610373 6.585932413460889 10835.0 68.37189748468812 0.0 - - - - - - - 222.88888888888889 21 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 97 13 C20140707_OR007_01 C20140707_OR007_01 TB439365.[MT7]-DETTC[CAM]ISQDTR.2y8_1.heavy 735.337 / 980.447 2622.0 20.877300262451172 44 14 10 10 10 2.745587438762179 25.999029268169345 0.0 3 0.9430088064055555 5.144865406166825 2622.0 38.962481402093054 0.0 - - - - - - - 169.6 5 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 99 13 C20140707_OR007_01 C20140707_OR007_01 TB439365.[MT7]-DETTC[CAM]ISQDTR.2y5_1.heavy 735.337 / 606.284 2854.0 20.877300262451172 44 14 10 10 10 2.745587438762179 25.999029268169345 0.0 3 0.9430088064055555 5.144865406166825 2854.0 37.15384285082826 0.0 - - - - - - - 231.375 5 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 101 13 C20140707_OR007_01 C20140707_OR007_01 TB439365.[MT7]-DETTC[CAM]ISQDTR.2y9_1.heavy 735.337 / 1081.49 1697.0 20.877300262451172 44 14 10 10 10 2.745587438762179 25.999029268169345 0.0 3 0.9430088064055555 5.144865406166825 1697.0 15.206883116883116 0.0 - - - - - - - 154.16666666666666 3 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 103 13 C20140707_OR007_01 C20140707_OR007_01 TB439365.[MT7]-DETTC[CAM]ISQDTR.2y7_1.heavy 735.337 / 879.399 2005.0 20.877300262451172 44 14 10 10 10 2.745587438762179 25.999029268169345 0.0 3 0.9430088064055555 5.144865406166825 2005.0 32.3069350229059 0.0 - - - - - - - 180.0 4 3 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 105 14 C20140707_OR007_01 C20140707_OR007_01 TB439858.[MT7]-SLEDVVMLNVDTNTLESPFSDLNNLPSDVVSALK[MT7].4y9_1.heavy 991.764 / 1059.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 107 14 C20140707_OR007_01 C20140707_OR007_01 TB439858.[MT7]-SLEDVVMLNVDTNTLESPFSDLNNLPSDVVSALK[MT7].4b4_1.heavy 991.764 / 589.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 109 14 C20140707_OR007_01 C20140707_OR007_01 TB439858.[MT7]-SLEDVVMLNVDTNTLESPFSDLNNLPSDVVSALK[MT7].4b5_1.heavy 991.764 / 688.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 111 14 C20140707_OR007_01 C20140707_OR007_01 TB439858.[MT7]-SLEDVVMLNVDTNTLESPFSDLNNLPSDVVSALK[MT7].4b6_1.heavy 991.764 / 787.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 113 15 C20140707_OR007_01 C20140707_OR007_01 TB418993.[MT7]-TSVSLAVSR.2y8_1.heavy 532.315 / 818.473 8358.0 25.63705062866211 40 15 10 5 10 2.510031402473326 39.840139012389386 0.040500640869140625 3 0.9513253457786988 5.571003143896639 8358.0 35.936819277108434 0.0 - - - - - - - 159.5 16 10 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 115 15 C20140707_OR007_01 C20140707_OR007_01 TB418993.[MT7]-TSVSLAVSR.2b4_1.heavy 532.315 / 519.289 2289.0 25.63705062866211 40 15 10 5 10 2.510031402473326 39.840139012389386 0.040500640869140625 3 0.9513253457786988 5.571003143896639 2289.0 10.561397898583827 2.0 - - - - - - - 199.33333333333334 4 12 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 117 15 C20140707_OR007_01 C20140707_OR007_01 TB418993.[MT7]-TSVSLAVSR.2b6_1.heavy 532.315 / 703.411 5572.0 25.63705062866211 40 15 10 5 10 2.510031402473326 39.840139012389386 0.040500640869140625 3 0.9513253457786988 5.571003143896639 5572.0 16.706666666666667 0.0 - - - - - - - 199.30769230769232 11 13 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 119 15 C20140707_OR007_01 C20140707_OR007_01 TB418993.[MT7]-TSVSLAVSR.2y7_1.heavy 532.315 / 731.441 3184.0 25.63705062866211 40 15 10 5 10 2.510031402473326 39.840139012389386 0.040500640869140625 3 0.9513253457786988 5.571003143896639 3184.0 10.16358106169297 0.0 - - - - - - - 129.7 6 10 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 121 16 C20140707_OR007_01 C20140707_OR007_01 TB418798.[MT7]-ALLGLVQDVIGDLHQC[CAM]QRTWDK[MT7].4b8_1.heavy 714.138 / 954.574 584.0 52.65694999694824 38 14 10 6 8 2.1100510419683434 38.00973811714823 0.036098480224609375 4 0.938057609336989 4.932881889326459 584.0 8.26285460599334 2.0 - - - - - - - 0.0 1 0 UNC13D unc-13 homolog D (C. elegans) 123 16 C20140707_OR007_01 C20140707_OR007_01 TB418798.[MT7]-ALLGLVQDVIGDLHQC[CAM]QRTWDK[MT7].4y12_2.heavy 714.138 / 844.408 425.0 52.65694999694824 38 14 10 6 8 2.1100510419683434 38.00973811714823 0.036098480224609375 4 0.938057609336989 4.932881889326459 425.0 3.0976996639958645 6.0 - - - - - - - 0.0 1 0 UNC13D unc-13 homolog D (C. elegans) 125 16 C20140707_OR007_01 C20140707_OR007_01 TB418798.[MT7]-ALLGLVQDVIGDLHQC[CAM]QRTWDK[MT7].4y13_2.heavy 714.138 / 900.95 531.0 52.65694999694824 38 14 10 6 8 2.1100510419683434 38.00973811714823 0.036098480224609375 4 0.938057609336989 4.932881889326459 531.0 18.935660377358488 1.0 - - - - - - - 0.0 1 0 UNC13D unc-13 homolog D (C. elegans) 127 16 C20140707_OR007_01 C20140707_OR007_01 TB418798.[MT7]-ALLGLVQDVIGDLHQC[CAM]QRTWDK[MT7].4b6_1.heavy 714.138 / 711.489 1062.0 52.65694999694824 38 14 10 6 8 2.1100510419683434 38.00973811714823 0.036098480224609375 4 0.938057609336989 4.932881889326459 1062.0 23.510943396226413 0.0 - - - - - - - 176.91666666666666 2 12 UNC13D unc-13 homolog D (C. elegans) 129 17 C20140707_OR007_01 C20140707_OR007_01 TB449248.[MT7]-THPEVC[CAM]GR.2y6_1.heavy 550.275 / 717.335 4965.0 15.68904995918274 40 20 6 6 8 4.664038009783518 21.440648594680198 0.03979969024658203 4 0.9966881358552522 21.4390817285687 4965.0 166.39596527068437 0.0 - - - - - - - 127.5 9 8 TRAFD1 TRAF-type zinc finger domain containing 1 131 17 C20140707_OR007_01 C20140707_OR007_01 TB449248.[MT7]-THPEVC[CAM]GR.2y5_1.heavy 550.275 / 620.282 399.0 15.68904995918274 40 20 6 6 8 4.664038009783518 21.440648594680198 0.03979969024658203 4 0.9966881358552522 21.4390817285687 399.0 10.261363636363637 4.0 - - - - - - - 144.8 14 15 TRAFD1 TRAF-type zinc finger domain containing 1 133 17 C20140707_OR007_01 C20140707_OR007_01 TB449248.[MT7]-THPEVC[CAM]GR.2b4_1.heavy 550.275 / 609.311 89.0 15.68904995918274 40 20 6 6 8 4.664038009783518 21.440648594680198 0.03979969024658203 4 0.9966881358552522 21.4390817285687 89.0 0.5482998035629614 19.0 - - - - - - - 0.0 0 0 TRAFD1 TRAF-type zinc finger domain containing 1 135 17 C20140707_OR007_01 C20140707_OR007_01 TB449248.[MT7]-THPEVC[CAM]GR.2y7_1.heavy 550.275 / 854.394 1153.0 15.68904995918274 40 20 6 6 8 4.664038009783518 21.440648594680198 0.03979969024658203 4 0.9966881358552522 21.4390817285687 1153.0 34.5007469241285 0.0 - - - - - - - 83.66666666666667 2 9 TRAFD1 TRAF-type zinc finger domain containing 1 137 18 C20140707_OR007_01 C20140707_OR007_01 TB439745.[MT7]-TTQIGC[CAM]LLRLEPNLQAQMYR.4y4_1.heavy 638.092 / 597.281 920.0 42.17755126953125 28 11 10 5 2 1.480167448204058 53.474787970437774 0.04669952392578125 11 0.8640264305112316 3.308160611759209 920.0 1.176677237324414 21.0 - - - - - - - 277.22222222222223 3 9 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 139 18 C20140707_OR007_01 C20140707_OR007_01 TB439745.[MT7]-TTQIGC[CAM]LLRLEPNLQAQMYR.4y5_1.heavy 638.092 / 668.318 2629.0 42.17755126953125 28 11 10 5 2 1.480167448204058 53.474787970437774 0.04669952392578125 11 0.8640264305112316 3.308160611759209 2629.0 19.396349827566166 0.0 - - - - - - - 248.0 5 9 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 141 18 C20140707_OR007_01 C20140707_OR007_01 TB439745.[MT7]-TTQIGC[CAM]LLRLEPNLQAQMYR.4b11_2.heavy 638.092 / 715.401 4075.0 42.17755126953125 28 11 10 5 2 1.480167448204058 53.474787970437774 0.04669952392578125 11 0.8640264305112316 3.308160611759209 4075.0 11.858694618945279 0.0 - - - - - - - 322.3636363636364 8 11 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 143 18 C20140707_OR007_01 C20140707_OR007_01 TB439745.[MT7]-TTQIGC[CAM]LLRLEPNLQAQMYR.4y6_1.heavy 638.092 / 796.377 657.0 42.17755126953125 28 11 10 5 2 1.480167448204058 53.474787970437774 0.04669952392578125 11 0.8640264305112316 3.308160611759209 657.0 1.411577946768061 18.0 - - - - - - - 250.8181818181818 2 11 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 145 19 C20140707_OR007_01 C20140707_OR007_01 TB439645.[MT7]-DLTYQVVLGEYNLAVK[MT7].3b4_1.heavy 705.064 / 637.331 6033.0 43.86242485046387 42 16 10 6 10 2.6309581185012796 31.50506127422648 0.03949737548828125 3 0.9681053517002651 6.891953610527036 6033.0 27.751988149072197 0.0 - - - - - - - 279.7857142857143 12 14 CELA3A chymotrypsin-like elastase family, member 3A 147 19 C20140707_OR007_01 C20140707_OR007_01 TB439645.[MT7]-DLTYQVVLGEYNLAVK[MT7].3b5_1.heavy 705.064 / 765.39 25190.0 43.86242485046387 42 16 10 6 10 2.6309581185012796 31.50506127422648 0.03949737548828125 3 0.9681053517002651 6.891953610527036 25190.0 64.74899478474282 0.0 - - - - - - - 688.0 50 8 CELA3A chymotrypsin-like elastase family, member 3A 149 19 C20140707_OR007_01 C20140707_OR007_01 TB439645.[MT7]-DLTYQVVLGEYNLAVK[MT7].3y8_1.heavy 705.064 / 1037.57 9949.0 43.86242485046387 42 16 10 6 10 2.6309581185012796 31.50506127422648 0.03949737548828125 3 0.9681053517002651 6.891953610527036 9949.0 38.807509230259974 0.0 - - - - - - - 247.22222222222223 19 9 CELA3A chymotrypsin-like elastase family, member 3A 151 19 C20140707_OR007_01 C20140707_OR007_01 TB439645.[MT7]-DLTYQVVLGEYNLAVK[MT7].3b7_1.heavy 705.064 / 963.527 8890.0 43.86242485046387 42 16 10 6 10 2.6309581185012796 31.50506127422648 0.03949737548828125 3 0.9681053517002651 6.891953610527036 8890.0 33.066604293362445 0.0 - - - - - - - 211.88888888888889 17 9 CELA3A chymotrypsin-like elastase family, member 3A 153 20 C20140707_OR007_01 C20140707_OR007_01 TB418147.[MT7]-DK[MT7]GQDDFLGNVVLR.3y7_1.heavy 622.01 / 770.488 5673.0 36.34015083312988 42 17 10 5 10 5.014683242764062 19.941439002013738 0.043498992919921875 3 0.9778169015337894 8.270754845281644 5673.0 29.869204545454544 0.0 - - - - - - - 220.0 11 9 UNC13D unc-13 homolog D (C. elegans) 155 20 C20140707_OR007_01 C20140707_OR007_01 TB418147.[MT7]-DK[MT7]GQDDFLGNVVLR.3b6_1.heavy 622.01 / 947.467 3167.0 36.34015083312988 42 17 10 5 10 5.014683242764062 19.941439002013738 0.043498992919921875 3 0.9778169015337894 8.270754845281644 3167.0 8.797707162580837 1.0 - - - - - - - 293.3333333333333 6 9 UNC13D unc-13 homolog D (C. elegans) 157 20 C20140707_OR007_01 C20140707_OR007_01 TB418147.[MT7]-DK[MT7]GQDDFLGNVVLR.3y6_1.heavy 622.01 / 657.404 24013.0 36.34015083312988 42 17 10 5 10 5.014683242764062 19.941439002013738 0.043498992919921875 3 0.9778169015337894 8.270754845281644 24013.0 92.53494444444443 0.0 - - - - - - - 250.8 48 10 UNC13D unc-13 homolog D (C. elegans) 159 20 C20140707_OR007_01 C20140707_OR007_01 TB418147.[MT7]-DK[MT7]GQDDFLGNVVLR.3y8_1.heavy 622.01 / 917.557 7521.0 36.34015083312988 42 17 10 5 10 5.014683242764062 19.941439002013738 0.043498992919921875 3 0.9778169015337894 8.270754845281644 7521.0 20.484132432193654 0.0 - - - - - - - 280.5 15 8 UNC13D unc-13 homolog D (C. elegans) 161 21 C20140707_OR007_01 C20140707_OR007_01 TB419848.[MT7]-DVSGFSDPYC[CAM]LLGIEQGVGVPGGSPGSR.4y8_1.heavy 738.614 / 714.353 8374.0 44.707401275634766 44 16 10 10 8 4.691540840834547 21.314958857357336 0.0 4 0.9653117631929896 6.607052944125965 8374.0 65.98301858965564 0.0 - - - - - - - 226.8 16 10 UNC13D unc-13 homolog D (C. elegans) 163 21 C20140707_OR007_01 C20140707_OR007_01 TB419848.[MT7]-DVSGFSDPYC[CAM]LLGIEQGVGVPGGSPGSR.4b7_1.heavy 738.614 / 852.386 3547.0 44.707401275634766 44 16 10 10 8 4.691540840834547 21.314958857357336 0.0 4 0.9653117631929896 6.607052944125965 3547.0 27.889619632322677 0.0 - - - - - - - 177.6 7 10 UNC13D unc-13 homolog D (C. elegans) 165 21 C20140707_OR007_01 C20140707_OR007_01 TB419848.[MT7]-DVSGFSDPYC[CAM]LLGIEQGVGVPGGSPGSR.4b5_1.heavy 738.614 / 650.327 591.0 44.707401275634766 44 16 10 10 8 4.691540840834547 21.314958857357336 0.0 4 0.9653117631929896 6.607052944125965 591.0 0.0 13.0 - - - - - - - 252.0 2 9 UNC13D unc-13 homolog D (C. elegans) 167 21 C20140707_OR007_01 C20140707_OR007_01 TB419848.[MT7]-DVSGFSDPYC[CAM]LLGIEQGVGVPGGSPGSR.4y7_1.heavy 738.614 / 617.3 1478.0 44.707401275634766 44 16 10 10 8 4.691540840834547 21.314958857357336 0.0 4 0.9653117631929896 6.607052944125965 1478.0 8.23251474825079 2.0 - - - - - - - 268.90909090909093 3 11 UNC13D unc-13 homolog D (C. elegans) 169 22 C20140707_OR007_01 C20140707_OR007_01 TB418401.[MT7]-DC[CAM]IFTIDPSTAR.3b4_1.heavy 513.925 / 680.319 1864.0 36.35102558135986 41 20 6 5 10 32.853306236115515 3.0438336793655907 0.043498992919921875 3 0.9988449687407996 36.309786055339856 1864.0 1.679629566988766 2.0 - - - - - - - 310.3333333333333 3 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 171 22 C20140707_OR007_01 C20140707_OR007_01 TB418401.[MT7]-DC[CAM]IFTIDPSTAR.3b3_1.heavy 513.925 / 533.251 5460.0 36.35102558135986 41 20 6 5 10 32.853306236115515 3.0438336793655907 0.043498992919921875 3 0.9988449687407996 36.309786055339856 5460.0 32.22631578947368 0.0 - - - - - - - 266.0 10 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 173 22 C20140707_OR007_01 C20140707_OR007_01 TB418401.[MT7]-DC[CAM]IFTIDPSTAR.3y5_1.heavy 513.925 / 531.289 12517.0 36.35102558135986 41 20 6 5 10 32.853306236115515 3.0438336793655907 0.043498992919921875 3 0.9988449687407996 36.309786055339856 12517.0 42.10508658971372 0.0 - - - - - - - 228.0 25 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 175 22 C20140707_OR007_01 C20140707_OR007_01 TB418401.[MT7]-DC[CAM]IFTIDPSTAR.3b7_2.heavy 513.925 / 505.243 1864.0 36.35102558135986 41 20 6 5 10 32.853306236115515 3.0438336793655907 0.043498992919921875 3 0.9988449687407996 36.309786055339856 1864.0 0.06779096973104709 8.0 - - - - - - - 682.625 38 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 177 23 C20140707_OR007_01 C20140707_OR007_01 TB419844.[MT7]-VVHGEDAVPYSWPWQVSLQYEK[MT7].4b8_1.heavy 727.125 / 951.502 4254.0 43.54359817504883 40 12 10 10 8 1.0964281586056892 55.37391316870222 0.0 4 0.8852155032200792 3.6072502244214344 4254.0 0.6007541908218343 1.0 - - - - - - - 218.0 8 8 CELA3A chymotrypsin-like elastase family, member 3A 179 23 C20140707_OR007_01 C20140707_OR007_01 TB419844.[MT7]-VVHGEDAVPYSWPWQVSLQYEK[MT7].4b7_1.heavy 727.125 / 852.433 1854.0 43.54359817504883 40 12 10 10 8 1.0964281586056892 55.37391316870222 0.0 4 0.8852155032200792 3.6072502244214344 1854.0 0.3561196357408984 2.0 - - - - - - - 174.4 6 5 CELA3A chymotrypsin-like elastase family, member 3A 181 23 C20140707_OR007_01 C20140707_OR007_01 TB419844.[MT7]-VVHGEDAVPYSWPWQVSLQYEK[MT7].4y3_1.heavy 727.125 / 583.321 4036.0 43.54359817504883 40 12 10 10 8 1.0964281586056892 55.37391316870222 0.0 4 0.8852155032200792 3.6072502244214344 4036.0 7.87865873338352 0.0 - - - - - - - 748.2857142857143 8 7 CELA3A chymotrypsin-like elastase family, member 3A 183 23 C20140707_OR007_01 C20140707_OR007_01 TB419844.[MT7]-VVHGEDAVPYSWPWQVSLQYEK[MT7].4b6_1.heavy 727.125 / 781.396 1418.0 43.54359817504883 40 12 10 10 8 1.0964281586056892 55.37391316870222 0.0 4 0.8852155032200792 3.6072502244214344 1418.0 1.8617221541970739 2.0 - - - - - - - 199.83333333333334 4 12 CELA3A chymotrypsin-like elastase family, member 3A 185 24 C20140707_OR007_01 C20140707_OR007_01 TB418406.[MT7]-GTFDWNLQFK[MT7].3y3_1.heavy 515.276 / 566.342 2539.0 41.0713996887207 48 18 10 10 10 1.5128657006670612 38.73473923415661 0.0 3 0.9888292682803849 11.665851561934634 2539.0 9.17281578763372 0.0 - - - - - - - 312.0 5 3 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 187 24 C20140707_OR007_01 C20140707_OR007_01 TB418406.[MT7]-GTFDWNLQFK[MT7].3b6_1.heavy 515.276 / 865.396 2004.0 41.0713996887207 48 18 10 10 10 1.5128657006670612 38.73473923415661 0.0 3 0.9888292682803849 11.665851561934634 2004.0 15.383886982201291 0.0 - - - - - - - 200.5 4 2 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 189 24 C20140707_OR007_01 C20140707_OR007_01 TB418406.[MT7]-GTFDWNLQFK[MT7].3b4_1.heavy 515.276 / 565.274 9488.0 41.0713996887207 48 18 10 10 10 1.5128657006670612 38.73473923415661 0.0 3 0.9888292682803849 11.665851561934634 9488.0 56.830343616613895 0.0 - - - - - - - 334.0 18 4 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 191 24 C20140707_OR007_01 C20140707_OR007_01 TB418406.[MT7]-GTFDWNLQFK[MT7].3b5_1.heavy 515.276 / 751.353 1336.0 41.0713996887207 48 18 10 10 10 1.5128657006670612 38.73473923415661 0.0 3 0.9888292682803849 11.665851561934634 1336.0 14.82378221253284 0.0 - - - - - - - 200.5 2 2 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 193 25 C20140707_OR007_01 C20140707_OR007_01 TB439553.[MT7]-ESVLPEDAILPLMK[MT7].3y3_1.heavy 615.021 / 535.339 3596.0 44.95839977264404 37 14 10 3 10 2.4213686413598103 31.798933373617718 0.06940078735351562 3 0.9397844360806812 5.003849643290413 3596.0 1.4543983822042468 1.0 - - - - - - - 227.58823529411765 7 17 UNC13D unc-13 homolog D (C. elegans) 195 25 C20140707_OR007_01 C20140707_OR007_01 TB439553.[MT7]-ESVLPEDAILPLMK[MT7].3b4_1.heavy 615.021 / 573.336 10158.0 44.95839977264404 37 14 10 3 10 2.4213686413598103 31.798933373617718 0.06940078735351562 3 0.9397844360806812 5.003849643290413 10158.0 30.365731509860133 0.0 - - - - - - - 297.38461538461536 20 13 UNC13D unc-13 homolog D (C. elegans) 197 25 C20140707_OR007_01 C20140707_OR007_01 TB439553.[MT7]-ESVLPEDAILPLMK[MT7].3y4_1.heavy 615.021 / 632.392 13214.0 44.95839977264404 37 14 10 3 10 2.4213686413598103 31.798933373617718 0.06940078735351562 3 0.9397844360806812 5.003849643290413 13214.0 47.1351478153378 0.0 - - - - - - - 197.93333333333334 26 15 UNC13D unc-13 homolog D (C. elegans) 199 25 C20140707_OR007_01 C20140707_OR007_01 TB439553.[MT7]-ESVLPEDAILPLMK[MT7].3b7_1.heavy 615.021 / 914.459 1708.0 44.95839977264404 37 14 10 3 10 2.4213686413598103 31.798933373617718 0.06940078735351562 3 0.9397844360806812 5.003849643290413 1708.0 0.31673620769587396 3.0 - - - - - - - 216.0 4 10 UNC13D unc-13 homolog D (C. elegans) 201 26 C20140707_OR007_01 C20140707_OR007_01 TB449458.[MT7]-SIFETYMSK[MT7].3y3_1.heavy 465.247 / 509.287 8345.0 38.47829818725586 48 18 10 10 10 6.678861910747174 14.972610803509316 0.0 3 0.9874526271512833 11.006033117470635 8345.0 -1.1155174334410158 1.0 - - - - - - - 210.33333333333334 17 3 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 203 26 C20140707_OR007_01 C20140707_OR007_01 TB449458.[MT7]-SIFETYMSK[MT7].3b4_1.heavy 465.247 / 621.336 7207.0 38.47829818725586 48 18 10 10 10 6.678861910747174 14.972610803509316 0.0 3 0.9874526271512833 11.006033117470635 7207.0 0.0 0.0 - - - - - - - 379.0 14 1 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 205 26 C20140707_OR007_01 C20140707_OR007_01 TB449458.[MT7]-SIFETYMSK[MT7].3b5_1.heavy 465.247 / 722.384 4678.0 38.47829818725586 48 18 10 10 10 6.678861910747174 14.972610803509316 0.0 3 0.9874526271512833 11.006033117470635 4678.0 0.0 0.0 - - - - - - - 759.0 9 2 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 207 26 C20140707_OR007_01 C20140707_OR007_01 TB449458.[MT7]-SIFETYMSK[MT7].3b3_1.heavy 465.247 / 492.294 5690.0 38.47829818725586 48 18 10 10 10 6.678861910747174 14.972610803509316 0.0 3 0.9874526271512833 11.006033117470635 5690.0 0.0 0.0 - - - - - - - 379.0 11 1 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 209 27 C20140707_OR007_01 C20140707_OR007_01 TB439371.[MT7]-K[MT7]QSTATGDGVAR.2b8_1.heavy 739.912 / 1077.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 211 27 C20140707_OR007_01 C20140707_OR007_01 TB439371.[MT7]-K[MT7]QSTATGDGVAR.2y9_1.heavy 739.912 / 847.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 213 27 C20140707_OR007_01 C20140707_OR007_01 TB439371.[MT7]-K[MT7]QSTATGDGVAR.2y10_1.heavy 739.912 / 934.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 215 27 C20140707_OR007_01 C20140707_OR007_01 TB439371.[MT7]-K[MT7]QSTATGDGVAR.2y11_1.heavy 739.912 / 1062.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 217 28 C20140707_OR007_01 C20140707_OR007_01 TB439180.[MT7]-QLVQDENVR.2y4_1.heavy 622.839 / 517.273 9065.0 22.92620086669922 48 20 10 10 8 6.791698338708613 14.723857717599127 0.0 4 0.9933660241889499 15.143806221306155 9065.0 19.713190612815417 0.0 - - - - - - - 217.1 18 10 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 219 28 C20140707_OR007_01 C20140707_OR007_01 TB439180.[MT7]-QLVQDENVR.2y8_1.heavy 622.839 / 972.511 12218.0 22.92620086669922 48 20 10 10 8 6.791698338708613 14.723857717599127 0.0 4 0.9933660241889499 15.143806221306155 12218.0 53.68467499304991 0.0 - - - - - - - 246.58333333333334 24 12 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 221 28 C20140707_OR007_01 C20140707_OR007_01 TB439180.[MT7]-QLVQDENVR.2y6_1.heavy 622.839 / 760.358 6208.0 22.92620086669922 48 20 10 10 8 6.791698338708613 14.723857717599127 0.0 4 0.9933660241889499 15.143806221306155 6208.0 36.795061006373494 0.0 - - - - - - - 253.57142857142858 12 7 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 223 28 C20140707_OR007_01 C20140707_OR007_01 TB439180.[MT7]-QLVQDENVR.2y7_1.heavy 622.839 / 859.427 7686.0 22.92620086669922 48 20 10 10 8 6.791698338708613 14.723857717599127 0.0 4 0.9933660241889499 15.143806221306155 7686.0 61.08123988201399 1.0 - - - - - - - 180.83333333333334 17 6 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 225 29 C20140707_OR007_01 C20140707_OR007_01 TB439559.[MT7]-QFLETAINLQLFK[MT7].3y3_1.heavy 618.364 / 551.367 33753.0 47.29819869995117 41 11 10 10 10 0.9860147706757384 67.61223933894873 0.0 3 0.8785916824805767 3.505443946427276 33753.0 78.48186996343543 0.0 - - - - - - - 284.0 67 10 DENND1B DENN/MADD domain containing 1B 227 29 C20140707_OR007_01 C20140707_OR007_01 TB439559.[MT7]-QFLETAINLQLFK[MT7].3b6_1.heavy 618.364 / 834.448 21664.0 47.29819869995117 41 11 10 10 10 0.9860147706757384 67.61223933894873 0.0 3 0.8785916824805767 3.505443946427276 21664.0 177.20000486529221 0.0 - - - - - - - 230.84615384615384 43 13 DENND1B DENN/MADD domain containing 1B 229 29 C20140707_OR007_01 C20140707_OR007_01 TB439559.[MT7]-QFLETAINLQLFK[MT7].3b4_1.heavy 618.364 / 662.363 18499.0 47.29819869995117 41 11 10 10 10 0.9860147706757384 67.61223933894873 0.0 3 0.8785916824805767 3.505443946427276 18499.0 103.80691387005157 0.0 - - - - - - - 237.07692307692307 36 13 DENND1B DENN/MADD domain containing 1B 231 29 C20140707_OR007_01 C20140707_OR007_01 TB439559.[MT7]-QFLETAINLQLFK[MT7].3b5_1.heavy 618.364 / 763.411 11927.0 47.29819869995117 41 11 10 10 10 0.9860147706757384 67.61223933894873 0.0 3 0.8785916824805767 3.505443946427276 11927.0 155.54353639060002 0.0 - - - - - - - 260.85714285714283 23 14 DENND1B DENN/MADD domain containing 1B 233 30 C20140707_OR007_01 C20140707_OR007_01 TB439376.[MT7]-ELENDLNETLR.2b3_1.heavy 745.384 / 516.279 4065.0 33.95050048828125 40 10 10 10 10 1.9514921032875008 40.98123366211924 0.0 3 0.8418959845968738 3.061931465233123 4065.0 5.8877480097710135 1.0 - - - - - - - 283.4 8 10 DENND1B DENN/MADD domain containing 1B 235 30 C20140707_OR007_01 C20140707_OR007_01 TB439376.[MT7]-ELENDLNETLR.2y8_1.heavy 745.384 / 974.49 4065.0 33.95050048828125 40 10 10 10 10 1.9514921032875008 40.98123366211924 0.0 3 0.8418959845968738 3.061931465233123 4065.0 41.641463414634146 0.0 - - - - - - - 273.6666666666667 8 9 DENND1B DENN/MADD domain containing 1B 237 30 C20140707_OR007_01 C20140707_OR007_01 TB439376.[MT7]-ELENDLNETLR.2y9_1.heavy 745.384 / 1103.53 7637.0 33.95050048828125 40 10 10 10 10 1.9514921032875008 40.98123366211924 0.0 3 0.8418959845968738 3.061931465233123 7637.0 54.01780487804878 0.0 - - - - - - - 295.6 15 10 DENND1B DENN/MADD domain containing 1B 239 30 C20140707_OR007_01 C20140707_OR007_01 TB439376.[MT7]-ELENDLNETLR.2y10_1.heavy 745.384 / 1216.62 2587.0 33.95050048828125 40 10 10 10 10 1.9514921032875008 40.98123366211924 0.0 3 0.8418959845968738 3.061931465233123 2587.0 19.626557532151775 0.0 - - - - - - - 232.66666666666666 5 9 DENND1B DENN/MADD domain containing 1B 241 31 C20140707_OR007_01 C20140707_OR007_01 TB439173.[MT7]-GVQGPPGPAGPR.3y7_1.heavy 411.899 / 651.357 1602.0 20.934099197387695 37 17 8 6 6 7.420717181883348 13.475786443409557 0.037799835205078125 5 0.9727120709883914 7.453916445206171 1602.0 13.01625 1.0 - - - - - - - 209.30769230769232 3 13 COL1A1 collagen, type I, alpha 1 243 31 C20140707_OR007_01 C20140707_OR007_01 TB439173.[MT7]-GVQGPPGPAGPR.3y6_1.heavy 411.899 / 554.305 881.0 20.934099197387695 37 17 8 6 6 7.420717181883348 13.475786443409557 0.037799835205078125 5 0.9727120709883914 7.453916445206171 881.0 3.30375 3.0 - - - - - - - 184.6153846153846 2 13 COL1A1 collagen, type I, alpha 1 245 31 C20140707_OR007_01 C20140707_OR007_01 TB439173.[MT7]-GVQGPPGPAGPR.3b4_1.heavy 411.899 / 486.279 1682.0 20.934099197387695 37 17 8 6 6 7.420717181883348 13.475786443409557 0.037799835205078125 5 0.9727120709883914 7.453916445206171 1682.0 11.093094608659449 2.0 - - - - - - - 296.2 4 10 COL1A1 collagen, type I, alpha 1 247 31 C20140707_OR007_01 C20140707_OR007_01 TB439173.[MT7]-GVQGPPGPAGPR.3b3_1.heavy 411.899 / 429.258 240.0 20.934099197387695 37 17 8 6 6 7.420717181883348 13.475786443409557 0.037799835205078125 5 0.9727120709883914 7.453916445206171 240.0 0.0 31.0 - - - - - - - 0.0 1 0 COL1A1 collagen, type I, alpha 1 249 32 C20140707_OR007_01 C20140707_OR007_01 TB419529.[MT7]-GYTPLMETHLSSK[MT7].3b6_1.heavy 584.646 / 807.419 3443.0 30.663799285888672 43 13 10 10 10 2.1704915302572725 35.7046234590288 0.0 3 0.9297377552573008 4.628338124732723 3443.0 12.293239387913893 0.0 - - - - - - - 244.63636363636363 6 11 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 251 32 C20140707_OR007_01 C20140707_OR007_01 TB419529.[MT7]-GYTPLMETHLSSK[MT7].3b5_1.heavy 584.646 / 676.379 11943.0 30.663799285888672 43 13 10 10 10 2.1704915302572725 35.7046234590288 0.0 3 0.9297377552573008 4.628338124732723 11943.0 31.54668025417135 0.0 - - - - - - - 726.25 23 8 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 253 32 C20140707_OR007_01 C20140707_OR007_01 TB419529.[MT7]-GYTPLMETHLSSK[MT7].3y4_1.heavy 584.646 / 578.363 25822.0 30.663799285888672 43 13 10 10 10 2.1704915302572725 35.7046234590288 0.0 3 0.9297377552573008 4.628338124732723 25822.0 26.983310155908647 0.0 - - - - - - - 108.0 51 1 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 255 32 C20140707_OR007_01 C20140707_OR007_01 TB419529.[MT7]-GYTPLMETHLSSK[MT7].3b7_1.heavy 584.646 / 936.462 5702.0 30.663799285888672 43 13 10 10 10 2.1704915302572725 35.7046234590288 0.0 3 0.9297377552573008 4.628338124732723 5702.0 15.534860681114552 0.0 - - - - - - - 255.5 11 8 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 257 33 C20140707_OR007_01 C20140707_OR007_01 TB439652.[MT7]-LSTVDMTGIPTLDNLQK[MT7].2b8_1.heavy 1067.59 / 949.478 4122.0 41.30289936065674 28 7 10 1 10 0.8445727567701115 75.77494292111716 0.09199905395507812 3 0.7477825630578602 2.403768726152068 4122.0 8.36796992481203 0.0 - - - - - - - 282.625 8 8 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 259 33 C20140707_OR007_01 C20140707_OR007_01 TB439652.[MT7]-LSTVDMTGIPTLDNLQK[MT7].2y4_1.heavy 1067.59 / 646.4 2926.0 41.30289936065674 28 7 10 1 10 0.8445727567701115 75.77494292111716 0.09199905395507812 3 0.7477825630578602 2.403768726152068 2926.0 10.175 0.0 - - - - - - - 243.83333333333334 5 6 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 261 33 C20140707_OR007_01 C20140707_OR007_01 TB439652.[MT7]-LSTVDMTGIPTLDNLQK[MT7].2y8_1.heavy 1067.59 / 1072.61 20612.0 41.30289936065674 28 7 10 1 10 0.8445727567701115 75.77494292111716 0.09199905395507812 3 0.7477825630578602 2.403768726152068 20612.0 93.09716433941998 0.0 - - - - - - - 177.33333333333334 41 6 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 263 33 C20140707_OR007_01 C20140707_OR007_01 TB439652.[MT7]-LSTVDMTGIPTLDNLQK[MT7].2b5_1.heavy 1067.59 / 660.369 6250.0 41.30289936065674 28 7 10 1 10 0.8445727567701115 75.77494292111716 0.09199905395507812 3 0.7477825630578602 2.403768726152068 6250.0 53.1015037593985 0.0 - - - - - - - 243.83333333333334 12 6 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 265 34 C20140707_OR007_01 C20140707_OR007_01 TB439175.[MT7]-GLAVFISDIR.2y8_1.heavy 617.867 / 920.52 12525.0 44.78070068359375 50 20 10 10 10 8.356272690265648 11.967058006195938 0.0 3 0.9941753584385815 16.16280528972213 12525.0 71.50547915345592 0.0 - - - - - - - 237.5 25 8 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 267 34 C20140707_OR007_01 C20140707_OR007_01 TB439175.[MT7]-GLAVFISDIR.2y6_1.heavy 617.867 / 750.414 14043.0 44.78070068359375 50 20 10 10 10 8.356272690265648 11.967058006195938 0.0 3 0.9941753584385815 16.16280528972213 14043.0 79.70018421052632 0.0 - - - - - - - 233.76923076923077 28 13 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 269 34 C20140707_OR007_01 C20140707_OR007_01 TB439175.[MT7]-GLAVFISDIR.2b5_1.heavy 617.867 / 632.389 11860.0 44.78070068359375 50 20 10 10 10 8.356272690265648 11.967058006195938 0.0 3 0.9941753584385815 16.16280528972213 11860.0 98.20912280701754 0.0 - - - - - - - 209.0 23 15 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 271 34 C20140707_OR007_01 C20140707_OR007_01 TB439175.[MT7]-GLAVFISDIR.2y7_1.heavy 617.867 / 849.483 10152.0 44.78070068359375 50 20 10 10 10 8.356272690265648 11.967058006195938 0.0 3 0.9941753584385815 16.16280528972213 10152.0 67.51535436129868 0.0 - - - - - - - 171.0 20 10 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 273 35 C20140707_OR007_01 C20140707_OR007_01 TB449157.[MT7]-SLSDIK[MT7].2y4_1.heavy 475.792 / 606.358 5785.0 25.285400390625 48 18 10 10 10 3.919940785847421 25.51058943569776 0.0 3 0.9837776157717577 9.676452440024626 5785.0 29.637438423645317 0.0 - - - - - - - 258.1818181818182 11 11 TRAFD1 TRAF-type zinc finger domain containing 1 275 35 C20140707_OR007_01 C20140707_OR007_01 TB449157.[MT7]-SLSDIK[MT7].2y5_1.heavy 475.792 / 719.442 2943.0 25.285400390625 48 18 10 10 10 3.919940785847421 25.51058943569776 0.0 3 0.9837776157717577 9.676452440024626 2943.0 41.16008632882993 2.0 - - - - - - - 202.66666666666666 5 9 TRAFD1 TRAF-type zinc finger domain containing 1 277 35 C20140707_OR007_01 C20140707_OR007_01 TB449157.[MT7]-SLSDIK[MT7].2b4_1.heavy 475.792 / 547.284 16441.0 25.285400390625 48 18 10 10 10 3.919940785847421 25.51058943569776 0.0 3 0.9837776157717577 9.676452440024626 16441.0 114.54777612133783 0.0 - - - - - - - 172.2 32 10 TRAFD1 TRAF-type zinc finger domain containing 1 279 35 C20140707_OR007_01 C20140707_OR007_01 TB449157.[MT7]-SLSDIK[MT7].2y3_1.heavy 475.792 / 519.326 4263.0 25.285400390625 48 18 10 10 10 3.919940785847421 25.51058943569776 0.0 3 0.9837776157717577 9.676452440024626 4263.0 29.981644736842107 0.0 - - - - - - - 239.8181818181818 8 11 TRAFD1 TRAF-type zinc finger domain containing 1 281 36 C20140707_OR007_01 C20140707_OR007_01 TB418008.[MT7]-NPEEFK[MT7].2y4_1.heavy 526.287 / 696.369 1394.0 22.969600677490234 45 15 10 10 10 3.264586487219684 30.631750879164464 0.0 3 0.9562833195274043 5.880899884127267 1394.0 3.0991607142857136 0.0 - - - - - - - 174.5 2 8 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 283 36 C20140707_OR007_01 C20140707_OR007_01 TB418008.[MT7]-NPEEFK[MT7].2y5_1.heavy 526.287 / 793.421 8463.0 22.969600677490234 45 15 10 10 10 3.264586487219684 30.631750879164464 0.0 3 0.9562833195274043 5.880899884127267 8463.0 42.57652657601977 1.0 - - - - - - - 159.6 16 5 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 285 36 C20140707_OR007_01 C20140707_OR007_01 TB418008.[MT7]-NPEEFK[MT7].2y3_1.heavy 526.287 / 567.326 1095.0 22.969600677490234 45 15 10 10 10 3.264586487219684 30.631750879164464 0.0 3 0.9562833195274043 5.880899884127267 1095.0 -0.3525062567498528 4.0 - - - - - - - 253.54545454545453 2 11 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 287 37 C20140707_OR007_01 C20140707_OR007_01 TB418007.[MT7]-RTDEDK[MT7].2b3_1.heavy 526.285 / 517.285 N/A 12.54723326365153 46 20 10 6 10 8.100338717504997 12.34516277497112 0.034999847412109375 3 0.998562499504222 32.54665269510021 2006.0 6.248241338831177 0.0 - - - - - - - 223.46153846153845 4 26 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 289 37 C20140707_OR007_01 C20140707_OR007_01 TB418007.[MT7]-RTDEDK[MT7].2y5_1.heavy 526.285 / 751.359 268.0 12.54723326365153 46 20 10 6 10 8.100338717504997 12.34516277497112 0.034999847412109375 3 0.998562499504222 32.54665269510021 268.0 12.521680672268907 0.0 - - - - - - - 0.0 0 0 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 291 37 C20140707_OR007_01 C20140707_OR007_01 TB418007.[MT7]-RTDEDK[MT7].2y3_1.heavy 526.285 / 535.284 562.0 12.54723326365153 46 20 10 6 10 8.100338717504997 12.34516277497112 0.034999847412109375 3 0.998562499504222 32.54665269510021 562.0 -0.5 1.0 - - - - - - - 0.0 1 0 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 293 37 C20140707_OR007_01 C20140707_OR007_01 TB418007.[MT7]-RTDEDK[MT7].2b5_1.heavy 526.285 / 761.355 1625.0 12.54723326365153 46 20 10 6 10 8.100338717504997 12.34516277497112 0.034999847412109375 3 0.998562499504222 32.54665269510021 1625.0 43.75 0.0 - - - - - - - 43.76190476190476 3 21 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 295 38 C20140707_OR007_01 C20140707_OR007_01 TB449660.[MT7]-VLFYPTLLYTLFR.3y6_1.heavy 597.351 / 812.466 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPMT1 protein tyrosine phosphatase, mitochondrial 1 297 38 C20140707_OR007_01 C20140707_OR007_01 TB449660.[MT7]-VLFYPTLLYTLFR.3b4_1.heavy 597.351 / 667.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPMT1 protein tyrosine phosphatase, mitochondrial 1 299 38 C20140707_OR007_01 C20140707_OR007_01 TB449660.[MT7]-VLFYPTLLYTLFR.3b3_1.heavy 597.351 / 504.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPMT1 protein tyrosine phosphatase, mitochondrial 1 301 38 C20140707_OR007_01 C20140707_OR007_01 TB449660.[MT7]-VLFYPTLLYTLFR.3y5_1.heavy 597.351 / 699.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTPMT1 protein tyrosine phosphatase, mitochondrial 1 303 39 C20140707_OR007_01 C20140707_OR007_01 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 148630.0 29.96540069580078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 148630.0 683.7784690004422 0.0 - - - - - - - 243.0 297 11 305 39 C20140707_OR007_01 C20140707_OR007_01 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 63256.0 29.96540069580078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 63256.0 162.82224677037073 0.0 - - - - - - - 240.5 126 4 307 39 C20140707_OR007_01 C20140707_OR007_01 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 70628.0 29.96540069580078 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 70628.0 256.58861423220975 0.0 - - - - - - - 310.90909090909093 141 11 309 40 C20140707_OR007_01 C20140707_OR007_01 TB439653.[MT7]-FPEDFGDQEILQSVPK[MT7].3b9_1.heavy 713.04 / 1209.52 6321.0 40.7214241027832 43 20 10 5 8 3.906836080397755 20.256284568153532 0.0457000732421875 4 0.9902429471179822 12.48387143583487 6321.0 14.789102401877328 2.0 - - - - - - - 206.0 12 2 DENND1B DENN/MADD domain containing 1B 311 40 C20140707_OR007_01 C20140707_OR007_01 TB439653.[MT7]-FPEDFGDQEILQSVPK[MT7].3b6_1.heavy 713.04 / 837.39 2198.0 40.7214241027832 43 20 10 5 8 3.906836080397755 20.256284568153532 0.0457000732421875 4 0.9902429471179822 12.48387143583487 2198.0 2.620895750861504 3.0 - - - - - - - 289.8888888888889 5 9 DENND1B DENN/MADD domain containing 1B 313 40 C20140707_OR007_01 C20140707_OR007_01 TB439653.[MT7]-FPEDFGDQEILQSVPK[MT7].3b4_1.heavy 713.04 / 633.3 8931.0 40.7214241027832 43 20 10 5 8 3.906836080397755 20.256284568153532 0.0457000732421875 4 0.9902429471179822 12.48387143583487 8931.0 16.289844155844154 1.0 - - - - - - - 275.0 19 1 DENND1B DENN/MADD domain containing 1B 315 40 C20140707_OR007_01 C20140707_OR007_01 TB439653.[MT7]-FPEDFGDQEILQSVPK[MT7].3b7_1.heavy 713.04 / 952.417 4672.0 40.7214241027832 43 20 10 5 8 3.906836080397755 20.256284568153532 0.0457000732421875 4 0.9902429471179822 12.48387143583487 4672.0 3.20809170776799 1.0 - - - - - - - 274.5 9 2 DENND1B DENN/MADD domain containing 1B 317 41 C20140707_OR007_01 C20140707_OR007_01 TB419835.[MT7]-QHLQIQSSQPSLNEAIQNLAAIK[MT7].4y4_1.heavy 705.646 / 546.373 35970.0 41.83970069885254 36 11 10 5 10 1.257888051725186 62.84375781881019 0.048198699951171875 3 0.8512393139753849 3.1592303525123793 35970.0 42.31507577322044 0.0 - - - - - - - 710.625 71 8 GLYAT glycine-N-acyltransferase 319 41 C20140707_OR007_01 C20140707_OR007_01 TB419835.[MT7]-QHLQIQSSQPSLNEAIQNLAAIK[MT7].4b4_1.heavy 705.646 / 651.37 16134.0 41.83970069885254 36 11 10 5 10 1.257888051725186 62.84375781881019 0.048198699951171875 3 0.8512393139753849 3.1592303525123793 16134.0 47.590063623816135 0.0 - - - - - - - 214.625 32 8 GLYAT glycine-N-acyltransferase 321 41 C20140707_OR007_01 C20140707_OR007_01 TB419835.[MT7]-QHLQIQSSQPSLNEAIQNLAAIK[MT7].4b5_1.heavy 705.646 / 764.453 11373.0 41.83970069885254 36 11 10 5 10 1.257888051725186 62.84375781881019 0.048198699951171875 3 0.8512393139753849 3.1592303525123793 11373.0 52.86120821876611 0.0 - - - - - - - 231.25 22 8 GLYAT glycine-N-acyltransferase 323 41 C20140707_OR007_01 C20140707_OR007_01 TB419835.[MT7]-QHLQIQSSQPSLNEAIQNLAAIK[MT7].4b3_1.heavy 705.646 / 523.311 11505.0 41.83970069885254 36 11 10 5 10 1.257888051725186 62.84375781881019 0.048198699951171875 3 0.8512393139753849 3.1592303525123793 11505.0 23.952047350936567 0.0 - - - - - - - 198.0 23 4 GLYAT glycine-N-acyltransferase 325 42 C20140707_OR007_01 C20140707_OR007_01 TB439050.[MT7]-GEAGPQGPR.2y8_1.heavy 506.768 / 811.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL1A1 collagen, type I, alpha 1 327 42 C20140707_OR007_01 C20140707_OR007_01 TB439050.[MT7]-GEAGPQGPR.2y5_1.heavy 506.768 / 554.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL1A1 collagen, type I, alpha 1 329 42 C20140707_OR007_01 C20140707_OR007_01 TB439050.[MT7]-GEAGPQGPR.2y6_1.heavy 506.768 / 611.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL1A1 collagen, type I, alpha 1 331 42 C20140707_OR007_01 C20140707_OR007_01 TB439050.[MT7]-GEAGPQGPR.2y7_1.heavy 506.768 / 682.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL1A1 collagen, type I, alpha 1 333 43 C20140707_OR007_01 C20140707_OR007_01 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 38003.0 16.153833389282227 23 -3 10 6 10 null 0.0 0.03440093994140625 3 0.0 0.0 38003.0 37.75016803236751 0.0 - - - - - - - 170.9 76 10 335 43 C20140707_OR007_01 C20140707_OR007_01 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 47049.0 16.153833389282227 23 -3 10 6 10 null 0.0 0.03440093994140625 3 0.0 0.0 47049.0 802.2309730171709 0.0 - - - - - - - 213.375 94 8 337 43 C20140707_OR007_01 C20140707_OR007_01 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 32712.0 16.153833389282227 23 -3 10 6 10 null 0.0 0.03440093994140625 3 0.0 0.0 32712.0 151.41553992968358 0.0 - - - - - - - 195.625 65 16 339 44 C20140707_OR007_01 C20140707_OR007_01 TB419100.[MT7]-NADVELQQR.2y8_1.heavy 608.824 / 958.495 4550.0 21.665199279785156 48 18 10 10 10 7.44111429927211 13.438847459953948 0.0 3 0.9880732363333833 11.289337899515782 4550.0 69.94302325581396 1.0 - - - - - - - 162.33333333333334 9 9 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 341 44 C20140707_OR007_01 C20140707_OR007_01 TB419100.[MT7]-NADVELQQR.2b6_1.heavy 608.824 / 786.411 1116.0 21.665199279785156 48 18 10 10 10 7.44111429927211 13.438847459953948 0.0 3 0.9880732363333833 11.289337899515782 1116.0 12.979164091722232 0.0 - - - - - - - 229.0 2 6 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 343 44 C20140707_OR007_01 C20140707_OR007_01 TB419100.[MT7]-NADVELQQR.2y6_1.heavy 608.824 / 772.431 5752.0 21.665199279785156 48 18 10 10 10 7.44111429927211 13.438847459953948 0.0 3 0.9880732363333833 11.289337899515782 5752.0 81.3751937984496 0.0 - - - - - - - 171.8 11 10 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 345 44 C20140707_OR007_01 C20140707_OR007_01 TB419100.[MT7]-NADVELQQR.2y7_1.heavy 608.824 / 887.458 2146.0 21.665199279785156 48 18 10 10 10 7.44111429927211 13.438847459953948 0.0 3 0.9880732363333833 11.289337899515782 2146.0 13.63736027301286 0.0 - - - - - - - 189.0 4 10 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 347 45 C20140707_OR007_01 C20140707_OR007_01 TB419391.[MT7]-YGGTFQNVSVQLPITLNK[MT7].3y6_1.heavy 756.426 / 829.526 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A2 adaptor-related protein complex 2, alpha 2 subunit 349 45 C20140707_OR007_01 C20140707_OR007_01 TB419391.[MT7]-YGGTFQNVSVQLPITLNK[MT7].3b4_1.heavy 756.426 / 523.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A2 adaptor-related protein complex 2, alpha 2 subunit 351 45 C20140707_OR007_01 C20140707_OR007_01 TB419391.[MT7]-YGGTFQNVSVQLPITLNK[MT7].3y4_1.heavy 756.426 / 619.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A2 adaptor-related protein complex 2, alpha 2 subunit 353 45 C20140707_OR007_01 C20140707_OR007_01 TB419391.[MT7]-YGGTFQNVSVQLPITLNK[MT7].3b7_1.heavy 756.426 / 912.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A2 adaptor-related protein complex 2, alpha 2 subunit 355 46 C20140707_OR007_01 C20140707_OR007_01 TB418579.[MT7]-LTFSVIWTLTPEGK[MT7].3b6_1.heavy 627.364 / 805.494 9535.0 48.850900650024414 43 17 10 6 10 4.890153294668174 20.449256694883548 0.03800201416015625 3 0.9791875438230258 8.539738714402752 9535.0 139.50090655509064 0.0 - - - - - - - 209.69230769230768 19 13 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 357 46 C20140707_OR007_01 C20140707_OR007_01 TB418579.[MT7]-LTFSVIWTLTPEGK[MT7].3b4_1.heavy 627.364 / 593.341 6882.0 48.850900650024414 43 17 10 6 10 4.890153294668174 20.449256694883548 0.03800201416015625 3 0.9791875438230258 8.539738714402752 6882.0 41.610751851370665 0.0 - - - - - - - 201.8181818181818 13 11 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 359 46 C20140707_OR007_01 C20140707_OR007_01 TB418579.[MT7]-LTFSVIWTLTPEGK[MT7].3b5_1.heavy 627.364 / 692.41 8030.0 48.850900650024414 43 17 10 6 10 4.890153294668174 20.449256694883548 0.03800201416015625 3 0.9791875438230258 8.539738714402752 8030.0 31.450453771979575 0.0 - - - - - - - 286.7692307692308 16 13 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 361 46 C20140707_OR007_01 C20140707_OR007_01 TB418579.[MT7]-LTFSVIWTLTPEGK[MT7].3y4_1.heavy 627.364 / 574.332 22368.0 48.850900650024414 43 17 10 6 10 4.890153294668174 20.449256694883548 0.03800201416015625 3 0.9791875438230258 8.539738714402752 22368.0 145.98036979523764 0.0 - - - - - - - 183.11111111111111 44 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 363 47 C20140707_OR007_01 C20140707_OR007_01 TB417900.[MT7]-LILIAR.2y4_1.heavy 421.801 / 472.324 12755.0 35.89690017700195 39 9 10 10 10 0.9308192995098452 71.92198039355586 0.0 3 0.8179129971140416 2.8470901205779335 12755.0 134.06715328467152 0.0 - - - - - - - 137.0 25 2 ABAT 4-aminobutyrate aminotransferase 365 47 C20140707_OR007_01 C20140707_OR007_01 TB417900.[MT7]-LILIAR.2b3_1.heavy 421.801 / 484.362 13578.0 35.89690017700195 39 9 10 10 10 0.9308192995098452 71.92198039355586 0.0 3 0.8179129971140416 2.8470901205779335 13578.0 146.58293430656937 0.0 - - - - - - - 205.5 27 6 ABAT 4-aminobutyrate aminotransferase 367 47 C20140707_OR007_01 C20140707_OR007_01 TB417900.[MT7]-LILIAR.2y5_1.heavy 421.801 / 585.408 6858.0 35.89690017700195 39 9 10 10 10 0.9308192995098452 71.92198039355586 0.0 3 0.8179129971140416 2.8470901205779335 6858.0 26.021608393096553 0.0 - - - - - - - 205.5 13 4 ABAT 4-aminobutyrate aminotransferase 369 47 C20140707_OR007_01 C20140707_OR007_01 TB417900.[MT7]-LILIAR.2b4_1.heavy 421.801 / 597.446 5486.0 35.89690017700195 39 9 10 10 10 0.9308192995098452 71.92198039355586 0.0 3 0.8179129971140416 2.8470901205779335 5486.0 45.27618491484185 0.0 - - - - - - - 274.0 10 4 ABAT 4-aminobutyrate aminotransferase 371 48 C20140707_OR007_01 C20140707_OR007_01 TB449365.[MT7]-VWIYPEGTR.2y8_1.heavy 632.844 / 1021.51 24624.0 34.92509841918945 50 20 10 10 10 8.73279174843055 11.451091802111495 0.0 3 0.9934358385630553 15.224214410481734 24624.0 20.214376474231166 1.0 - - - - - - - 268.22222222222223 55 9 AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) 373 48 C20140707_OR007_01 C20140707_OR007_01 TB449365.[MT7]-VWIYPEGTR.2y5_1.heavy 632.844 / 559.284 10863.0 34.92509841918945 50 20 10 10 10 8.73279174843055 11.451091802111495 0.0 3 0.9934358385630553 15.224214410481734 10863.0 50.669707576953435 0.0 - - - - - - - 271.5833333333333 21 12 AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) 375 48 C20140707_OR007_01 C20140707_OR007_01 TB449365.[MT7]-VWIYPEGTR.2y6_1.heavy 632.844 / 722.347 11346.0 34.92509841918945 50 20 10 10 10 8.73279174843055 11.451091802111495 0.0 3 0.9934358385630553 15.224214410481734 11346.0 34.272647266737586 0.0 - - - - - - - 321.8888888888889 22 9 AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) 377 48 C20140707_OR007_01 C20140707_OR007_01 TB449365.[MT7]-VWIYPEGTR.2y7_1.heavy 632.844 / 835.431 6880.0 34.92509841918945 50 20 10 10 10 8.73279174843055 11.451091802111495 0.0 3 0.9934358385630553 15.224214410481734 6880.0 30.788950276243092 0.0 - - - - - - - 275.92857142857144 13 14 AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) 379 49 C20140707_OR007_01 C20140707_OR007_01 TB418262.[MT7]-GLPGTAGLPGMK[MT7].2y4_1.heavy 693.904 / 576.33 4144.0 33.615450859069824 29 12 6 5 6 2.2078595357130375 45.29273641844456 0.041400909423828125 5 0.8846769851446943 3.598649418899476 4144.0 16.315481592863538 0.0 - - - - - - - 237.33333333333334 8 9 COL1A1 collagen, type I, alpha 1 381 49 C20140707_OR007_01 C20140707_OR007_01 TB418262.[MT7]-GLPGTAGLPGMK[MT7].2y6_1.heavy 693.904 / 746.435 1381.0 33.615450859069824 29 12 6 5 6 2.2078595357130375 45.29273641844456 0.041400909423828125 5 0.8846769851446943 3.598649418899476 1381.0 3.16640539341509 3.0 - - - - - - - 301.4 13 5 COL1A1 collagen, type I, alpha 1 383 49 C20140707_OR007_01 C20140707_OR007_01 TB418262.[MT7]-GLPGTAGLPGMK[MT7].2b7_1.heavy 693.904 / 698.395 502.0 33.615450859069824 29 12 6 5 6 2.2078595357130375 45.29273641844456 0.041400909423828125 5 0.8846769851446943 3.598649418899476 502.0 2.2573196918024503 24.0 - - - - - - - 240.91666666666666 2 12 COL1A1 collagen, type I, alpha 1 385 49 C20140707_OR007_01 C20140707_OR007_01 TB418262.[MT7]-GLPGTAGLPGMK[MT7].2y10_1.heavy 693.904 / 1072.59 3516.0 33.615450859069824 29 12 6 5 6 2.2078595357130375 45.29273641844456 0.041400909423828125 5 0.8846769851446943 3.598649418899476 3516.0 16.386116905512278 0.0 - - - - - - - 237.44444444444446 7 9 COL1A1 collagen, type I, alpha 1 387 50 C20140707_OR007_01 C20140707_OR007_01 TB417901.[MT7]-VLAQLR.2b3_1.heavy 422.28 / 428.299 1150.0 29.072400093078613 27 20 0 3 4 30.744124867752813 3.2526539763338307 0.07139968872070312 9 0.9969538952738223 22.355256163432262 1150.0 4.456937799043062 7.0 - - - - - - - 209.16666666666666 2 6 MYO3B;CABIN1;SEZ6L2;CP110 myosin IIIB;calcineurin binding protein 1;seizure related 6 homolog (mouse)-like 2;CP110 protein 389 50 C20140707_OR007_01 C20140707_OR007_01 TB417901.[MT7]-VLAQLR.2y4_1.heavy 422.28 / 487.299 2299.0 29.072400093078613 27 20 0 3 4 30.744124867752813 3.2526539763338307 0.07139968872070312 9 0.9969538952738223 22.355256163432262 2299.0 4.4 6.0 - - - - - - - 220.88888888888889 66 9 MYO3B;CABIN1;SEZ6L2;CP110 myosin IIIB;calcineurin binding protein 1;seizure related 6 homolog (mouse)-like 2;CP110 protein 391 50 C20140707_OR007_01 C20140707_OR007_01 TB417901.[MT7]-VLAQLR.2y5_1.heavy 422.28 / 600.383 7734.0 29.072400093078613 27 20 0 3 4 30.744124867752813 3.2526539763338307 0.07139968872070312 9 0.9969538952738223 22.355256163432262 7734.0 84.8643062200957 2.0 - - - - - - - 331.0 153 6 MYO3B;CABIN1;SEZ6L2;CP110 myosin IIIB;calcineurin binding protein 1;seizure related 6 homolog (mouse)-like 2;CP110 protein 393 50 C20140707_OR007_01 C20140707_OR007_01 TB417901.[MT7]-VLAQLR.2b4_1.heavy 422.28 / 556.357 1568.0 29.072400093078613 27 20 0 3 4 30.744124867752813 3.2526539763338307 0.07139968872070312 9 0.9969538952738223 22.355256163432262 1568.0 8.495208931419457 2.0 - - - - - - - 267.22222222222223 158 9 MYO3B;CABIN1;SEZ6L2;CP110 myosin IIIB;calcineurin binding protein 1;seizure related 6 homolog (mouse)-like 2;CP110 protein 395 51 C20140707_OR007_01 C20140707_OR007_01 TB418971.[MT7]-ALDGYSK[MT7].2y4_1.heavy 521.295 / 598.332 13450.0 23.229799270629883 50 20 10 10 10 5.694752022628448 17.56002712719427 0.0 3 0.9936035471693543 15.422720981032166 13450.0 33.86870131267936 0.0 - - - - - - - 265.8888888888889 26 9 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 397 51 C20140707_OR007_01 C20140707_OR007_01 TB418971.[MT7]-ALDGYSK[MT7].2y5_1.heavy 521.295 / 713.359 5380.0 23.229799270629883 50 20 10 10 10 5.694752022628448 17.56002712719427 0.0 3 0.9936035471693543 15.422720981032166 5380.0 25.61904761904762 0.0 - - - - - - - 260.7692307692308 10 13 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 399 51 C20140707_OR007_01 C20140707_OR007_01 TB418971.[MT7]-ALDGYSK[MT7].2y3_1.heavy 521.295 / 541.31 1395.0 23.229799270629883 50 20 10 10 10 5.694752022628448 17.56002712719427 0.0 3 0.9936035471693543 15.422720981032166 1395.0 8.665500579822186 2.0 - - - - - - - 211.75 5 8 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 401 51 C20140707_OR007_01 C20140707_OR007_01 TB418971.[MT7]-ALDGYSK[MT7].2y6_1.heavy 521.295 / 826.443 3487.0 23.229799270629883 50 20 10 10 10 5.694752022628448 17.56002712719427 0.0 3 0.9936035471693543 15.422720981032166 3487.0 52.217386934673364 0.0 - - - - - - - 219.2 6 5 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 403 52 C20140707_OR007_01 C20140707_OR007_01 TB449790.[MT7]-YK[MT7]PGEPITFC[CAM]EESFVK[MT7].4y5_1.heavy 591.563 / 753.426 10673.0 35.55720138549805 38 8 10 10 10 0.5550785434527833 98.18450689915768 0.0 3 0.7907637107499911 2.6494936259043373 10673.0 38.15369093427736 0.0 - - - - - - - 246.46153846153845 21 13 DENND1B DENN/MADD domain containing 1B 405 52 C20140707_OR007_01 C20140707_OR007_01 TB449790.[MT7]-YK[MT7]PGEPITFC[CAM]EESFVK[MT7].4y4_1.heavy 591.563 / 624.384 37355.0 35.55720138549805 38 8 10 10 10 0.5550785434527833 98.18450689915768 0.0 3 0.7907637107499911 2.6494936259043373 37355.0 58.05895732640631 1.0 - - - - - - - 414.8333333333333 74 6 DENND1B DENN/MADD domain containing 1B 407 52 C20140707_OR007_01 C20140707_OR007_01 TB449790.[MT7]-YK[MT7]PGEPITFC[CAM]EESFVK[MT7].4b8_2.heavy 591.563 / 587.839 26801.0 35.55720138549805 38 8 10 10 10 0.5550785434527833 98.18450689915768 0.0 3 0.7907637107499911 2.6494936259043373 26801.0 -6.952269779507134 0.0 - - - - - - - 698.4444444444445 53 9 DENND1B DENN/MADD domain containing 1B 409 52 C20140707_OR007_01 C20140707_OR007_01 TB449790.[MT7]-YK[MT7]PGEPITFC[CAM]EESFVK[MT7].4b5_1.heavy 591.563 / 863.487 14705.0 35.55720138549805 38 8 10 10 10 0.5550785434527833 98.18450689915768 0.0 3 0.7907637107499911 2.6494936259043373 14705.0 -12.40928270042194 0.0 - - - - - - - 220.35714285714286 29 14 DENND1B DENN/MADD domain containing 1B 411 53 C20140707_OR007_01 C20140707_OR007_01 TB439835.[MT7]-RNEVAIPPNAYDESWGQDGIWIASQLLR.3b6_1.heavy 1114.9 / 827.486 4438.0 51.152400970458984 44 14 10 10 10 2.526831211156739 39.57525914610726 0.0 3 0.9434110774145605 5.1632963291989356 4438.0 28.150210554076242 1.0 - - - - - - - 805.1428571428571 10 7 TRAFD1 TRAF-type zinc finger domain containing 1 413 53 C20140707_OR007_01 C20140707_OR007_01 TB439835.[MT7]-RNEVAIPPNAYDESWGQDGIWIASQLLR.3b5_1.heavy 1114.9 / 714.401 2536.0 51.152400970458984 44 14 10 10 10 2.526831211156739 39.57525914610726 0.0 3 0.9434110774145605 5.1632963291989356 2536.0 21.35642311510077 0.0 - - - - - - - 211.27272727272728 5 11 TRAFD1 TRAF-type zinc finger domain containing 1 415 53 C20140707_OR007_01 C20140707_OR007_01 TB439835.[MT7]-RNEVAIPPNAYDESWGQDGIWIASQLLR.3y8_1.heavy 1114.9 / 986.578 3734.0 51.152400970458984 44 14 10 10 10 2.526831211156739 39.57525914610726 0.0 3 0.9434110774145605 5.1632963291989356 3734.0 15.438948254283371 0.0 - - - - - - - 220.0 7 8 TRAFD1 TRAF-type zinc finger domain containing 1 417 53 C20140707_OR007_01 C20140707_OR007_01 TB439835.[MT7]-RNEVAIPPNAYDESWGQDGIWIASQLLR.3y10_1.heavy 1114.9 / 1156.68 3522.0 51.152400970458984 44 14 10 10 10 2.526831211156739 39.57525914610726 0.0 3 0.9434110774145605 5.1632963291989356 3522.0 21.295071324951643 0.0 - - - - - - - 175.91666666666666 7 12 TRAFD1 TRAF-type zinc finger domain containing 1 419 54 C20140707_OR007_01 C20140707_OR007_01 TB418976.[MT7]-GVQFALK[MT7].2y4_1.heavy 525.831 / 622.404 13245.0 31.8528995513916 50 20 10 10 10 13.105680445206023 7.630279131106038 0.0 3 0.9968539971089052 21.99727517718379 13245.0 33.0207756232687 0.0 - - - - - - - 254.0 26 9 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 421 54 C20140707_OR007_01 C20140707_OR007_01 TB418976.[MT7]-GVQFALK[MT7].2y5_1.heavy 525.831 / 750.463 4214.0 31.8528995513916 50 20 10 10 10 13.105680445206023 7.630279131106038 0.0 3 0.9968539971089052 21.99727517718379 4214.0 13.36375489077821 0.0 - - - - - - - 220.58333333333334 8 12 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 423 54 C20140707_OR007_01 C20140707_OR007_01 TB418976.[MT7]-GVQFALK[MT7].2b4_1.heavy 525.831 / 576.326 6261.0 31.8528995513916 50 20 10 10 10 13.105680445206023 7.630279131106038 0.0 3 0.9968539971089052 21.99727517718379 6261.0 35.07199170124481 0.0 - - - - - - - 213.88888888888889 12 9 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 425 54 C20140707_OR007_01 C20140707_OR007_01 TB418976.[MT7]-GVQFALK[MT7].2b5_1.heavy 525.831 / 647.363 7104.0 31.8528995513916 50 20 10 10 10 13.105680445206023 7.630279131106038 0.0 3 0.9968539971089052 21.99727517718379 7104.0 34.73170739778441 0.0 - - - - - - - 287.15384615384613 14 13 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 427 55 C20140707_OR007_01 C20140707_OR007_01 TB439045.[MT7]-SLPASLK[MT7].2y4_1.heavy 502.323 / 562.368 6562.0 27.44902515411377 42 20 10 6 6 13.58474994065767 7.361195490298348 0.036899566650390625 5 0.9958119726791084 19.063644488496124 6562.0 10.936666666666666 1.0 - - - - - - - 783.375 13 8 GLYAT glycine-N-acyltransferase 429 55 C20140707_OR007_01 C20140707_OR007_01 TB439045.[MT7]-SLPASLK[MT7].2y5_1.heavy 502.323 / 659.421 36922.0 27.44902515411377 42 20 10 6 6 13.58474994065767 7.361195490298348 0.036899566650390625 5 0.9958119726791084 19.063644488496124 36922.0 94.09458673469388 1.0 - - - - - - - 228.66666666666666 78 6 GLYAT glycine-N-acyltransferase 431 55 C20140707_OR007_01 C20140707_OR007_01 TB439045.[MT7]-SLPASLK[MT7].2b4_1.heavy 502.323 / 513.315 2644.0 27.44902515411377 42 20 10 6 6 13.58474994065767 7.361195490298348 0.036899566650390625 5 0.9958119726791084 19.063644488496124 2644.0 3.1127050603296285 2.0 - - - - - - - 310.3333333333333 5 6 GLYAT glycine-N-acyltransferase 433 55 C20140707_OR007_01 C20140707_OR007_01 TB439045.[MT7]-SLPASLK[MT7].2y6_1.heavy 502.323 / 772.505 4309.0 27.44902515411377 42 20 10 6 6 13.58474994065767 7.361195490298348 0.036899566650390625 5 0.9958119726791084 19.063644488496124 4309.0 0.35915815794957284 1.0 - - - - - - - 283.1111111111111 9 9 GLYAT glycine-N-acyltransferase 435 56 C20140707_OR007_01 C20140707_OR007_01 TB419286.[MT7]-NQETYETLK[MT7].2y4_1.heavy 707.377 / 634.389 3055.0 24.707000732421875 41 16 10 5 10 2.4572814641567193 32.74536711116521 0.04380035400390625 3 0.9661943437760085 6.693242542253027 3055.0 26.506617647058825 0.0 - - - - - - - 203.9090909090909 6 11 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 437 56 C20140707_OR007_01 C20140707_OR007_01 TB419286.[MT7]-NQETYETLK[MT7].2y5_1.heavy 707.377 / 797.453 4379.0 24.707000732421875 41 16 10 5 10 2.4572814641567193 32.74536711116521 0.04380035400390625 3 0.9661943437760085 6.693242542253027 4379.0 84.36014705882351 0.0 - - - - - - - 142.8 8 5 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 439 56 C20140707_OR007_01 C20140707_OR007_01 TB419286.[MT7]-NQETYETLK[MT7].2y3_1.heavy 707.377 / 505.347 4379.0 24.707000732421875 41 16 10 5 10 2.4572814641567193 32.74536711116521 0.04380035400390625 3 0.9661943437760085 6.693242542253027 4379.0 45.9523910006263 0.0 - - - - - - - 220.66666666666666 8 6 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 441 56 C20140707_OR007_01 C20140707_OR007_01 TB419286.[MT7]-NQETYETLK[MT7].2y6_1.heavy 707.377 / 898.5 6009.0 24.707000732421875 41 16 10 5 10 2.4572814641567193 32.74536711116521 0.04380035400390625 3 0.9661943437760085 6.693242542253027 6009.0 67.77024136435901 0.0 - - - - - - - 224.2 12 5 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 443 57 C20140707_OR007_01 C20140707_OR007_01 TB449220.[MT7]-GDAGPAGPK[MT7].2y4_1.heavy 529.298 / 516.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL1A1 collagen, type I, alpha 1 445 57 C20140707_OR007_01 C20140707_OR007_01 TB449220.[MT7]-GDAGPAGPK[MT7].2b5_1.heavy 529.298 / 542.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL1A1 collagen, type I, alpha 1 447 57 C20140707_OR007_01 C20140707_OR007_01 TB449220.[MT7]-GDAGPAGPK[MT7].2y7_1.heavy 529.298 / 741.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL1A1 collagen, type I, alpha 1 449 58 C20140707_OR007_01 C20140707_OR007_01 TB439572.[MT7]-LTFSVIWTLTPEGK[MT7].2y4_1.heavy 940.542 / 574.332 5359.0 48.86962604522705 35 11 10 6 8 1.4883942288379293 61.239420225428695 0.036899566650390625 4 0.8609412143006886 3.270370759294856 5359.0 67.97657718120806 0.0 - - - - - - - 186.0 10 10 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 451 58 C20140707_OR007_01 C20140707_OR007_01 TB439572.[MT7]-LTFSVIWTLTPEGK[MT7].2y8_1.heavy 940.542 / 1075.59 3721.0 48.86962604522705 35 11 10 6 8 1.4883942288379293 61.239420225428695 0.036899566650390625 4 0.8609412143006886 3.270370759294856 3721.0 22.475838926174497 1.0 - - - - - - - 163.6 8 10 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 453 58 C20140707_OR007_01 C20140707_OR007_01 TB439572.[MT7]-LTFSVIWTLTPEGK[MT7].2b4_1.heavy 940.542 / 593.341 1935.0 48.86962604522705 35 11 10 6 8 1.4883942288379293 61.239420225428695 0.036899566650390625 4 0.8609412143006886 3.270370759294856 1935.0 25.102702702702704 0.0 - - - - - - - 239.77777777777777 3 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 455 58 C20140707_OR007_01 C20140707_OR007_01 TB439572.[MT7]-LTFSVIWTLTPEGK[MT7].2b6_1.heavy 940.542 / 805.494 3275.0 48.86962604522705 35 11 10 6 8 1.4883942288379293 61.239420225428695 0.036899566650390625 4 0.8609412143006886 3.270370759294856 3275.0 24.73381365969206 0.0 - - - - - - - 595.4285714285714 6 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 457 59 C20140707_OR007_01 C20140707_OR007_01 TB419823.[MT7]-ILPGAQGQFPRVC[CAM]MTVDSLVNK[MT7].4b4_1.heavy 680.372 / 525.352 3274.0 40.892601013183594 46 16 10 10 10 2.116693465047478 38.04753580843746 0.0 3 0.96192326848389 6.304414715080278 3274.0 2.3828061348228244 2.0 - - - - - - - 272.7142857142857 8 7 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 459 59 C20140707_OR007_01 C20140707_OR007_01 TB419823.[MT7]-ILPGAQGQFPRVC[CAM]MTVDSLVNK[MT7].4b5_1.heavy 680.372 / 596.389 4365.0 40.892601013183594 46 16 10 10 10 2.116693465047478 38.04753580843746 0.0 3 0.96192326848389 6.304414715080278 4365.0 7.809085210641048 0.0 - - - - - - - 272.6666666666667 8 6 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 461 59 C20140707_OR007_01 C20140707_OR007_01 TB419823.[MT7]-ILPGAQGQFPRVC[CAM]MTVDSLVNK[MT7].4y6_1.heavy 680.372 / 819.469 1637.0 40.892601013183594 46 16 10 10 10 2.116693465047478 38.04753580843746 0.0 3 0.96192326848389 6.304414715080278 1637.0 6.51057054192751 0.0 - - - - - - - 255.625 3 8 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 463 59 C20140707_OR007_01 C20140707_OR007_01 TB419823.[MT7]-ILPGAQGQFPRVC[CAM]MTVDSLVNK[MT7].4y3_1.heavy 680.372 / 504.326 14869.0 40.892601013183594 46 16 10 10 10 2.116693465047478 38.04753580843746 0.0 3 0.96192326848389 6.304414715080278 14869.0 57.04996811664294 0.0 - - - - - - - 318.1666666666667 29 6 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 465 60 C20140707_OR007_01 C20140707_OR007_01 TB419781.[MT7]-YLQEAFHVEPEEHQQTLQR.4b4_1.heavy 632.318 / 678.358 24504.0 32.97930145263672 48 18 10 10 10 4.044932575354742 19.718695992012215 0.0 3 0.9881338809813309 11.318207018675166 24504.0 90.25983193277311 0.0 - - - - - - - 277.6666666666667 49 12 UNC13D unc-13 homolog D (C. elegans) 467 60 C20140707_OR007_01 C20140707_OR007_01 TB419781.[MT7]-YLQEAFHVEPEEHQQTLQR.4b5_1.heavy 632.318 / 749.395 37826.0 32.97930145263672 48 18 10 10 10 4.044932575354742 19.718695992012215 0.0 3 0.9881338809813309 11.318207018675166 37826.0 87.41302521008403 0.0 - - - - - - - 297.5 75 6 UNC13D unc-13 homolog D (C. elegans) 469 60 C20140707_OR007_01 C20140707_OR007_01 TB419781.[MT7]-YLQEAFHVEPEEHQQTLQR.4y6_1.heavy 632.318 / 773.426 25336.0 32.97930145263672 48 18 10 10 10 4.044932575354742 19.718695992012215 0.0 3 0.9881338809813309 11.318207018675166 25336.0 227.8110924369748 0.0 - - - - - - - 297.5 50 10 UNC13D unc-13 homolog D (C. elegans) 471 60 C20140707_OR007_01 C20140707_OR007_01 TB419781.[MT7]-YLQEAFHVEPEEHQQTLQR.4b6_1.heavy 632.318 / 896.463 17010.0 32.97930145263672 48 18 10 10 10 4.044932575354742 19.718695992012215 0.0 3 0.9881338809813309 11.318207018675166 17010.0 42.38235294117647 1.0 - - - - - - - 223.125 34 8 UNC13D unc-13 homolog D (C. elegans) 473 61 C20140707_OR007_01 C20140707_OR007_01 TB439252.[MT7]-ILPGAQGQFPR.3y6_1.heavy 443.258 / 732.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 475 61 C20140707_OR007_01 C20140707_OR007_01 TB439252.[MT7]-ILPGAQGQFPR.3b4_1.heavy 443.258 / 525.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 477 61 C20140707_OR007_01 C20140707_OR007_01 TB439252.[MT7]-ILPGAQGQFPR.3b5_1.heavy 443.258 / 596.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 479 61 C20140707_OR007_01 C20140707_OR007_01 TB439252.[MT7]-ILPGAQGQFPR.3y5_1.heavy 443.258 / 604.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 481 62 C20140707_OR007_01 C20140707_OR007_01 TB419826.[MT7]-QLNIIQNAEAVHFFC[CAM]NYEESR.3b4_1.heavy 909.442 / 613.379 5577.0 42.80107402801514 38 13 10 5 10 1.0903018136459734 61.14514883152681 0.042499542236328125 3 0.9175096185872486 4.267063277160041 5577.0 20.336173649671885 0.0 - - - - - - - 257.5 11 8 ABAT 4-aminobutyrate aminotransferase 483 62 C20140707_OR007_01 C20140707_OR007_01 TB419826.[MT7]-QLNIIQNAEAVHFFC[CAM]NYEESR.3b5_1.heavy 909.442 / 726.463 2546.0 42.80107402801514 38 13 10 5 10 1.0903018136459734 61.14514883152681 0.042499542236328125 3 0.9175096185872486 4.267063277160041 2546.0 21.041322314049587 0.0 - - - - - - - 242.2 5 5 ABAT 4-aminobutyrate aminotransferase 485 62 C20140707_OR007_01 C20140707_OR007_01 TB419826.[MT7]-QLNIIQNAEAVHFFC[CAM]NYEESR.3b3_1.heavy 909.442 / 500.295 4001.0 42.80107402801514 38 13 10 5 10 1.0903018136459734 61.14514883152681 0.042499542236328125 3 0.9175096185872486 4.267063277160041 4001.0 17.261593123371473 0.0 - - - - - - - 214.23076923076923 8 13 ABAT 4-aminobutyrate aminotransferase 487 62 C20140707_OR007_01 C20140707_OR007_01 TB419826.[MT7]-QLNIIQNAEAVHFFC[CAM]NYEESR.3y8_1.heavy 909.442 / 1104.44 5941.0 42.80107402801514 38 13 10 5 10 1.0903018136459734 61.14514883152681 0.042499542236328125 3 0.9175096185872486 4.267063277160041 5941.0 13.7210397740805 0.0 - - - - - - - 313.0833333333333 11 12 ABAT 4-aminobutyrate aminotransferase 489 63 C20140707_OR007_01 C20140707_OR007_01 TB419688.[MT7]-SM[OXI]LGTDFNHTNPELHK[MT7].4y5_1.heavy 537.021 / 767.453 295.0 26.00557565689087 27 16 4 6 1 18.104557775887997 5.523471008675061 0.03669929504394531 17 0.9637898969262954 6.465888546520161 295.0 -0.5 18.0 - - - - - - - 0.0 1 0 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 491 63 C20140707_OR007_01 C20140707_OR007_01 TB419688.[MT7]-SM[OXI]LGTDFNHTNPELHK[MT7].4y3_1.heavy 537.021 / 541.358 1376.0 26.00557565689087 27 16 4 6 1 18.104557775887997 5.523471008675061 0.03669929504394531 17 0.9637898969262954 6.465888546520161 1376.0 3.6979661016949157 4.0 - - - - - - - 285.42857142857144 4 21 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 493 63 C20140707_OR007_01 C20140707_OR007_01 TB419688.[MT7]-SM[OXI]LGTDFNHTNPELHK[MT7].4b3_1.heavy 537.021 / 492.261 786.0 26.00557565689087 27 16 4 6 1 18.104557775887997 5.523471008675061 0.03669929504394531 17 0.9637898969262954 6.465888546520161 786.0 1.1989830508474577 32.0 - - - - - - - 371.1666666666667 5 18 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 495 63 C20140707_OR007_01 C20140707_OR007_01 TB419688.[MT7]-SM[OXI]LGTDFNHTNPELHK[MT7].4b6_1.heavy 537.021 / 765.357 1081.0 26.00557565689087 27 16 4 6 1 18.104557775887997 5.523471008675061 0.03669929504394531 17 0.9637898969262954 6.465888546520161 1081.0 0.0 0.0 - - - - - - - 276.4375 2 16 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 497 64 C20140707_OR007_01 C20140707_OR007_01 TB439352.[MT7]-QNIHSLSPQER.2b3_1.heavy 726.887 / 500.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 499 64 C20140707_OR007_01 C20140707_OR007_01 TB439352.[MT7]-QNIHSLSPQER.2y8_1.heavy 726.887 / 953.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 501 64 C20140707_OR007_01 C20140707_OR007_01 TB439352.[MT7]-QNIHSLSPQER.2y10_1.heavy 726.887 / 1180.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 503 64 C20140707_OR007_01 C20140707_OR007_01 TB439352.[MT7]-QNIHSLSPQER.2y7_1.heavy 726.887 / 816.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 505 65 C20140707_OR007_01 C20140707_OR007_01 TB419686.[MT7]-LSYEHAQSMIESPTEK[MT7].3b4_1.heavy 713.361 / 637.331 3911.0 30.502099990844727 40 10 10 10 10 0.6215378224735932 87.93049375386138 0.0 3 0.8238755039346356 2.896422460783609 3911.0 16.270519417475725 0.0 - - - - - - - 235.42857142857142 7 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 507 65 C20140707_OR007_01 C20140707_OR007_01 TB419686.[MT7]-LSYEHAQSMIESPTEK[MT7].3b5_1.heavy 713.361 / 774.39 1647.0 30.502099990844727 40 10 10 10 10 0.6215378224735932 87.93049375386138 0.0 3 0.8238755039346356 2.896422460783609 1647.0 14.670970873786407 2.0 - - - - - - - 226.6 3 10 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 509 65 C20140707_OR007_01 C20140707_OR007_01 TB419686.[MT7]-LSYEHAQSMIESPTEK[MT7].3y4_1.heavy 713.361 / 618.358 8336.0 30.502099990844727 40 10 10 10 10 0.6215378224735932 87.93049375386138 0.0 3 0.8238755039346356 2.896422460783609 8336.0 43.52456413599094 0.0 - - - - - - - 188.83333333333334 16 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 511 65 C20140707_OR007_01 C20140707_OR007_01 TB419686.[MT7]-LSYEHAQSMIESPTEK[MT7].3b8_2.heavy 713.361 / 530.763 7615.0 30.502099990844727 40 10 10 10 10 0.6215378224735932 87.93049375386138 0.0 3 0.8238755039346356 2.896422460783609 7615.0 44.35922330097087 0.0 - - - - - - - 171.66666666666666 15 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 513 66 C20140707_OR007_01 C20140707_OR007_01 TB439354.[MT7]-ALLGLVQDVIGDLHQC[CAM]QR.3b6_1.heavy 727.064 / 711.489 1182.0 52.99704933166504 43 17 10 6 10 4.244282594989623 18.705985904877593 0.032299041748046875 3 0.979474507801083 8.599435156264931 1182.0 12.482803738317756 0.0 - - - - - - - 171.8 2 10 UNC13D unc-13 homolog D (C. elegans) 515 66 C20140707_OR007_01 C20140707_OR007_01 TB439354.[MT7]-ALLGLVQDVIGDLHQC[CAM]QR.3y6_1.heavy 727.064 / 841.41 860.0 52.99704933166504 43 17 10 6 10 4.244282594989623 18.705985904877593 0.032299041748046875 3 0.979474507801083 8.599435156264931 860.0 22.296296296296298 0.0 - - - - - - - 0.0 1 0 UNC13D unc-13 homolog D (C. elegans) 517 66 C20140707_OR007_01 C20140707_OR007_01 TB439354.[MT7]-ALLGLVQDVIGDLHQC[CAM]QR.3y8_1.heavy 727.064 / 1013.46 2096.0 52.99704933166504 43 17 10 6 10 4.244282594989623 18.705985904877593 0.032299041748046875 3 0.979474507801083 8.599435156264931 2096.0 19.57661809949498 0.0 - - - - - - - 207.07142857142858 4 14 UNC13D unc-13 homolog D (C. elegans) 519 66 C20140707_OR007_01 C20140707_OR007_01 TB439354.[MT7]-ALLGLVQDVIGDLHQC[CAM]QR.3y9_1.heavy 727.064 / 1126.54 1612.0 52.99704933166504 43 17 10 6 10 4.244282594989623 18.705985904877593 0.032299041748046875 3 0.979474507801083 8.599435156264931 1612.0 8.610310327677343 0.0 - - - - - - - 119.92307692307692 3 13 UNC13D unc-13 homolog D (C. elegans) 521 67 C20140707_OR007_01 C20140707_OR007_01 TB419684.[MT7]-FPEDFGDQEILQSVPK[MT7].2b3_1.heavy 1069.06 / 518.273 N/A 40.80160140991211 43 13 10 10 10 1.2635167021578104 62.948680889190406 0.0 3 0.9145242672460405 4.190808655900754 270.0 0.7330049261083743 14.0 - - - - - - - 0.0 1 0 DENND1B DENN/MADD domain containing 1B 523 67 C20140707_OR007_01 C20140707_OR007_01 TB419684.[MT7]-FPEDFGDQEILQSVPK[MT7].2b4_1.heavy 1069.06 / 633.3 1217.0 40.80160140991211 43 13 10 10 10 1.2635167021578104 62.948680889190406 0.0 3 0.9145242672460405 4.190808655900754 1217.0 4.656174055829228 0.0 - - - - - - - 221.0909090909091 2 11 DENND1B DENN/MADD domain containing 1B 525 67 C20140707_OR007_01 C20140707_OR007_01 TB419684.[MT7]-FPEDFGDQEILQSVPK[MT7].2b7_1.heavy 1069.06 / 952.417 1217.0 40.80160140991211 43 13 10 10 10 1.2635167021578104 62.948680889190406 0.0 3 0.9145242672460405 4.190808655900754 1217.0 3.2983994703370527 0.0 - - - - - - - 307.3636363636364 2 11 DENND1B DENN/MADD domain containing 1B 527 67 C20140707_OR007_01 C20140707_OR007_01 TB419684.[MT7]-FPEDFGDQEILQSVPK[MT7].2b9_1.heavy 1069.06 / 1209.52 541.0 40.80160140991211 43 13 10 10 10 1.2635167021578104 62.948680889190406 0.0 3 0.9145242672460405 4.190808655900754 541.0 4.802907389162562 13.0 - - - - - - - 0.0 1 0 DENND1B DENN/MADD domain containing 1B 529 68 C20140707_OR007_01 C20140707_OR007_01 TB419682.[MT7]-LSTVDMTGIPTLDNLQK[MT7].4b8_1.heavy 534.297 / 949.478 654.0 41.25652503967285 41 20 10 1 10 3.046653779087168 24.840694849756648 0.09349822998046875 3 0.9908152248410518 12.86752841109754 654.0 5.890992366412213 1.0 - - - - - - - 0.0 1 0 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 531 68 C20140707_OR007_01 C20140707_OR007_01 TB419682.[MT7]-LSTVDMTGIPTLDNLQK[MT7].4y5_1.heavy 534.297 / 761.427 654.0 41.25652503967285 41 20 10 1 10 3.046653779087168 24.840694849756648 0.09349822998046875 3 0.9908152248410518 12.86752841109754 654.0 5.491603053435114 2.0 - - - - - - - 0.0 1 0 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 533 68 C20140707_OR007_01 C20140707_OR007_01 TB419682.[MT7]-LSTVDMTGIPTLDNLQK[MT7].4b5_1.heavy 534.297 / 660.369 3008.0 41.25652503967285 41 20 10 1 10 3.046653779087168 24.840694849756648 0.09349822998046875 3 0.9908152248410518 12.86752841109754 3008.0 29.027973204548992 1.0 - - - - - - - 261.8 6 5 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 535 68 C20140707_OR007_01 C20140707_OR007_01 TB419682.[MT7]-LSTVDMTGIPTLDNLQK[MT7].4y6_1.heavy 534.297 / 874.511 785.0 41.25652503967285 41 20 10 1 10 3.046653779087168 24.840694849756648 0.09349822998046875 3 0.9908152248410518 12.86752841109754 785.0 7.57545178376694 1.0 - - - - - - - 0.0 1 0 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 537 69 C20140707_OR007_01 C20140707_OR007_01 TB419018.[MT7]-LC[CAM]DNC[CAM]K[MT7].2y4_1.heavy 549.27 / 680.315 2843.0 18.547675609588623 42 16 10 6 10 2.0056691381957448 40.02881902449814 0.03149986267089844 3 0.9623209443298512 6.337809708910557 2843.0 20.22824555377452 0.0 - - - - - - - 204.1818181818182 5 11 TRAFD1 TRAF-type zinc finger domain containing 1 539 69 C20140707_OR007_01 C20140707_OR007_01 TB419018.[MT7]-LC[CAM]DNC[CAM]K[MT7].2b3_1.heavy 549.27 / 533.251 8596.0 18.547675609588623 42 16 10 6 10 2.0056691381957448 40.02881902449814 0.03149986267089844 3 0.9623209443298512 6.337809708910557 8596.0 12.949941844364442 0.0 - - - - - - - 670.7142857142857 17 7 TRAFD1 TRAF-type zinc finger domain containing 1 541 69 C20140707_OR007_01 C20140707_OR007_01 TB419018.[MT7]-LC[CAM]DNC[CAM]K[MT7].2y5_1.heavy 549.27 / 840.346 7869.0 18.547675609588623 42 16 10 6 10 2.0056691381957448 40.02881902449814 0.03149986267089844 3 0.9623209443298512 6.337809708910557 7869.0 110.28522727272727 0.0 - - - - - - - 198.21428571428572 15 14 TRAFD1 TRAF-type zinc finger domain containing 1 543 69 C20140707_OR007_01 C20140707_OR007_01 TB419018.[MT7]-LC[CAM]DNC[CAM]K[MT7].2y3_1.heavy 549.27 / 565.288 8728.0 18.547675609588623 42 16 10 6 10 2.0056691381957448 40.02881902449814 0.03149986267089844 3 0.9623209443298512 6.337809708910557 8728.0 63.69676767676768 0.0 - - - - - - - 176.06666666666666 17 15 TRAFD1 TRAF-type zinc finger domain containing 1 545 70 C20140707_OR007_01 C20140707_OR007_01 TB439431.[MT7]-TLAEQLEVGIAK[MT7].3b4_1.heavy 520.646 / 559.321 4243.0 38.07487392425537 38 13 10 5 10 1.1113217001159243 55.33927950167828 0.041500091552734375 3 0.9056120485616032 3.9849912902214917 4243.0 33.56280823179302 0.0 - - - - - - - 293.57142857142856 8 7 UNC13D unc-13 homolog D (C. elegans) 547 70 C20140707_OR007_01 C20140707_OR007_01 TB439431.[MT7]-TLAEQLEVGIAK[MT7].3b5_1.heavy 520.646 / 687.379 3696.0 38.07487392425537 38 13 10 5 10 1.1113217001159243 55.33927950167828 0.041500091552734375 3 0.9056120485616032 3.9849912902214917 3696.0 29.855766423357665 0.0 - - - - - - - 301.4 7 5 UNC13D unc-13 homolog D (C. elegans) 549 70 C20140707_OR007_01 C20140707_OR007_01 TB439431.[MT7]-TLAEQLEVGIAK[MT7].3y4_1.heavy 520.646 / 532.357 8076.0 38.07487392425537 38 13 10 5 10 1.1113217001159243 55.33927950167828 0.041500091552734375 3 0.9056120485616032 3.9849912902214917 8076.0 29.17970802919708 0.0 - - - - - - - 296.8333333333333 16 6 UNC13D unc-13 homolog D (C. elegans) 551 70 C20140707_OR007_01 C20140707_OR007_01 TB439431.[MT7]-TLAEQLEVGIAK[MT7].3b7_1.heavy 520.646 / 929.506 1506.0 38.07487392425537 38 13 10 5 10 1.1113217001159243 55.33927950167828 0.041500091552734375 3 0.9056120485616032 3.9849912902214917 1506.0 6.705547445255474 2.0 - - - - - - - 191.8 16 5 UNC13D unc-13 homolog D (C. elegans) 553 71 C20140707_OR007_01 C20140707_OR007_01 TB439432.[MT7]-QQGAGDAEEEEEE.2b8_1.heavy 782.822 / 901.413 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRAFD1 TRAF-type zinc finger domain containing 1 555 71 C20140707_OR007_01 C20140707_OR007_01 TB439432.[MT7]-QQGAGDAEEEEEE.2b4_1.heavy 782.822 / 529.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRAFD1 TRAF-type zinc finger domain containing 1 557 71 C20140707_OR007_01 C20140707_OR007_01 TB439432.[MT7]-QQGAGDAEEEEEE.2b6_1.heavy 782.822 / 701.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRAFD1 TRAF-type zinc finger domain containing 1 559 71 C20140707_OR007_01 C20140707_OR007_01 TB439432.[MT7]-QQGAGDAEEEEEE.2b7_1.heavy 782.822 / 772.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRAFD1 TRAF-type zinc finger domain containing 1 561 72 C20140707_OR007_01 C20140707_OR007_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 280083.0 18.91990089416504 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 280083.0 1087.084737410072 0.0 - - - - - - - 266.6666666666667 560 12 563 72 C20140707_OR007_01 C20140707_OR007_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 140980.0 18.91990089416504 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 140980.0 722.2412511370214 0.0 - - - - - - - 200.0625 281 16 565 72 C20140707_OR007_01 C20140707_OR007_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 174713.0 18.91990089416504 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 174713.0 674.4650522403468 0.0 - - - - - - - 179.83333333333334 349 12 567 73 C20140707_OR007_01 C20140707_OR007_01 TB418251.[MT7]-FGWTGPNC[CAM]ER.2y5_1.heavy 684.318 / 675.288 1556.0 31.29794979095459 34 13 10 5 6 1.762405589964747 44.65555712952634 0.04129981994628906 6 0.9246355990486926 4.466971967707861 1556.0 3.04 17.0 - - - - - - - 667.0 4 9 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 569 73 C20140707_OR007_01 C20140707_OR007_01 TB418251.[MT7]-FGWTGPNC[CAM]ER.2y9_1.heavy 684.318 / 1076.46 3002.0 31.29794979095459 34 13 10 5 6 1.762405589964747 44.65555712952634 0.04129981994628906 6 0.9246355990486926 4.466971967707861 3002.0 7.587808561097935 0.0 - - - - - - - 198.42857142857142 6 14 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 571 73 C20140707_OR007_01 C20140707_OR007_01 TB418251.[MT7]-FGWTGPNC[CAM]ER.2y6_1.heavy 684.318 / 732.309 1112.0 31.29794979095459 34 13 10 5 6 1.762405589964747 44.65555712952634 0.04129981994628906 6 0.9246355990486926 4.466971967707861 1112.0 3.665274855694017 1.0 - - - - - - - 212.1818181818182 2 11 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 573 73 C20140707_OR007_01 C20140707_OR007_01 TB418251.[MT7]-FGWTGPNC[CAM]ER.2y7_1.heavy 684.318 / 833.357 1001.0 31.29794979095459 34 13 10 5 6 1.762405589964747 44.65555712952634 0.04129981994628906 6 0.9246355990486926 4.466971967707861 1001.0 8.243720327010816 2.0 - - - - - - - 177.8 2 5 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 575 74 C20140707_OR007_01 C20140707_OR007_01 TB449780.[MT7]-GFSDVFEEEITSGGFC[CAM]GGK[MT7].3b6_1.heavy 771.031 / 797.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 577 74 C20140707_OR007_01 C20140707_OR007_01 TB449780.[MT7]-GFSDVFEEEITSGGFC[CAM]GGK[MT7].3b4_1.heavy 771.031 / 551.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 579 74 C20140707_OR007_01 C20140707_OR007_01 TB449780.[MT7]-GFSDVFEEEITSGGFC[CAM]GGK[MT7].3b5_1.heavy 771.031 / 650.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 581 74 C20140707_OR007_01 C20140707_OR007_01 TB449780.[MT7]-GFSDVFEEEITSGGFC[CAM]GGK[MT7].3b7_1.heavy 771.031 / 926.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 583 75 C20140707_OR007_01 C20140707_OR007_01 TB439778.[MT7]-MLDLYSQISSVPIGYSHPALLK[MT7].4y5_1.heavy 680.879 / 685.473 12831.0 44.57174873352051 42 17 10 5 10 2.407471066720813 29.583203324507494 0.040500640869140625 3 0.9752872162815207 7.834351810376795 12831.0 52.51722460078686 0.0 - - - - - - - 242.3125 25 16 ABAT 4-aminobutyrate aminotransferase 585 75 C20140707_OR007_01 C20140707_OR007_01 TB439778.[MT7]-MLDLYSQISSVPIGYSHPALLK[MT7].4b4_1.heavy 680.879 / 617.345 16809.0 44.57174873352051 42 17 10 5 10 2.407471066720813 29.583203324507494 0.040500640869140625 3 0.9752872162815207 7.834351810376795 16809.0 92.9140703517588 0.0 - - - - - - - 767.4285714285714 33 7 ABAT 4-aminobutyrate aminotransferase 587 75 C20140707_OR007_01 C20140707_OR007_01 TB439778.[MT7]-MLDLYSQISSVPIGYSHPALLK[MT7].4b5_1.heavy 680.879 / 780.408 5669.0 44.57174873352051 42 17 10 5 10 2.407471066720813 29.583203324507494 0.040500640869140625 3 0.9752872162815207 7.834351810376795 5669.0 62.93124194969833 0.0 - - - - - - - 198.66666666666666 11 9 ABAT 4-aminobutyrate aminotransferase 589 75 C20140707_OR007_01 C20140707_OR007_01 TB439778.[MT7]-MLDLYSQISSVPIGYSHPALLK[MT7].4b3_1.heavy 680.879 / 504.261 14422.0 44.57174873352051 42 17 10 5 10 2.407471066720813 29.583203324507494 0.040500640869140625 3 0.9752872162815207 7.834351810376795 14422.0 39.49743718592964 0.0 - - - - - - - 758.5 28 8 ABAT 4-aminobutyrate aminotransferase 591 76 C20140707_OR007_01 C20140707_OR007_01 TB439820.[MT7]-AEADTFMFGGHDTTASGLSWVLYNLAR.4y5_1.heavy 769.375 / 636.346 2415.0 51.62655067443848 39 14 10 5 10 3.967289263236399 25.2061277524349 0.042301177978515625 3 0.9301288364039468 4.64142812452873 2415.0 28.02137404580153 0.0 - - - - - - - 181.55555555555554 4 9 CYP4F8;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 12 593 76 C20140707_OR007_01 C20140707_OR007_01 TB439820.[MT7]-AEADTFMFGGHDTTASGLSWVLYNLAR.4b5_1.heavy 769.375 / 632.301 326.0 51.62655067443848 39 14 10 5 10 3.967289263236399 25.2061277524349 0.042301177978515625 3 0.9301288364039468 4.64142812452873 326.0 4.582986029288 15.0 - - - - - - - 165.26666666666668 3 15 CYP4F8;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 12 595 76 C20140707_OR007_01 C20140707_OR007_01 TB439820.[MT7]-AEADTFMFGGHDTTASGLSWVLYNLAR.4y7_1.heavy 769.375 / 848.499 1566.0 51.62655067443848 39 14 10 5 10 3.967289263236399 25.2061277524349 0.042301177978515625 3 0.9301288364039468 4.64142812452873 1566.0 11.036946564885495 1.0 - - - - - - - 146.875 3 8 CYP4F8;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 12 597 76 C20140707_OR007_01 C20140707_OR007_01 TB439820.[MT7]-AEADTFMFGGHDTTASGLSWVLYNLAR.4y6_1.heavy 769.375 / 749.43 4307.0 51.62655067443848 39 14 10 5 10 3.967289263236399 25.2061277524349 0.042301177978515625 3 0.9301288364039468 4.64142812452873 4307.0 52.76561458171055 0.0 - - - - - - - 252.875 8 8 CYP4F8;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 12 599 77 C20140707_OR007_01 C20140707_OR007_01 TB439151.[MT7]-QSTATGDGVAR.2b8_1.heavy 603.813 / 862.402 1648.0 15.830599784851074 50 20 10 10 10 11.888635950692017 8.41139390715208 0.0 3 0.9934477068572966 15.23801123541075 1648.0 41.94909090909091 0.0 - - - - - - - 172.71428571428572 3 7 DENND1B DENN/MADD domain containing 1B 601 77 C20140707_OR007_01 C20140707_OR007_01 TB439151.[MT7]-QSTATGDGVAR.2y8_1.heavy 603.813 / 746.379 1153.0 15.830599784851074 50 20 10 10 10 11.888635950692017 8.41139390715208 0.0 3 0.9934477068572966 15.23801123541075 1153.0 18.996181818181817 1.0 - - - - - - - 110.0 2 9 DENND1B DENN/MADD domain containing 1B 603 77 C20140707_OR007_01 C20140707_OR007_01 TB439151.[MT7]-QSTATGDGVAR.2y9_1.heavy 603.813 / 847.427 2032.0 15.830599784851074 50 20 10 10 10 11.888635950692017 8.41139390715208 0.0 3 0.9934477068572966 15.23801123541075 2032.0 16.616218181818184 0.0 - - - - - - - 110.0 4 5 DENND1B DENN/MADD domain containing 1B 605 77 C20140707_OR007_01 C20140707_OR007_01 TB439151.[MT7]-QSTATGDGVAR.2y10_1.heavy 603.813 / 934.459 8897.0 15.830599784851074 50 20 10 10 10 11.888635950692017 8.41139390715208 0.0 3 0.9934477068572966 15.23801123541075 8897.0 36.41524228618761 0.0 - - - - - - - 176.64285714285714 17 14 DENND1B DENN/MADD domain containing 1B 607 78 C20140707_OR007_01 C20140707_OR007_01 TB419508.[MT7]-SC[CAM]VAC[CAM]GNDIALIK[MT7].2b8_1.heavy 854.952 / 1008.4 2428.0 32.40079879760742 44 14 10 10 10 2.542223317654498 39.335647386108405 0.0 3 0.939702237935114 5.000402818190441 2428.0 4.479529050899446 1.0 - - - - - - - 242.8 5 5 CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 609 78 C20140707_OR007_01 C20140707_OR007_01 TB419508.[MT7]-SC[CAM]VAC[CAM]GNDIALIK[MT7].2y4_1.heavy 854.952 / 588.42 1457.0 32.40079879760742 44 14 10 10 10 2.542223317654498 39.335647386108405 0.0 3 0.939702237935114 5.000402818190441 1457.0 7.616354126412702 0.0 - - - - - - - 225.28571428571428 2 7 CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 611 78 C20140707_OR007_01 C20140707_OR007_01 TB419508.[MT7]-SC[CAM]VAC[CAM]GNDIALIK[MT7].2b4_1.heavy 854.952 / 562.278 2671.0 32.40079879760742 44 14 10 10 10 2.542223317654498 39.335647386108405 0.0 3 0.939702237935114 5.000402818190441 2671.0 23.541962582871673 0.0 - - - - - - - 169.6 5 5 CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 613 78 C20140707_OR007_01 C20140707_OR007_01 TB419508.[MT7]-SC[CAM]VAC[CAM]GNDIALIK[MT7].2y3_1.heavy 854.952 / 517.383 2428.0 32.40079879760742 44 14 10 10 10 2.542223317654498 39.335647386108405 0.0 3 0.939702237935114 5.000402818190441 2428.0 12.62751051417718 0.0 - - - - - - - 222.33333333333334 4 6 CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 615 79 C20140707_OR007_01 C20140707_OR007_01 TB418159.[MT7]-RGTLIQGVLR.2y8_1.heavy 628.9 / 899.567 N/A N/A - - - - - - - - - 0.0 - - - - - - - DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 617 79 C20140707_OR007_01 C20140707_OR007_01 TB418159.[MT7]-RGTLIQGVLR.2y9_1.heavy 628.9 / 956.589 N/A N/A - - - - - - - - - 0.0 - - - - - - - DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 619 79 C20140707_OR007_01 C20140707_OR007_01 TB418159.[MT7]-RGTLIQGVLR.2b7_1.heavy 628.9 / 870.528 N/A N/A - - - - - - - - - 0.0 - - - - - - - DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 621 79 C20140707_OR007_01 C20140707_OR007_01 TB418159.[MT7]-RGTLIQGVLR.2y7_1.heavy 628.9 / 798.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 623 80 C20140707_OR007_01 C20140707_OR007_01 TB439822.[MT7]-TVAGIIVEPIQSEGGDNHASDDFFRK[MT7].4y5_1.heavy 773.399 / 856.48 2145.0 37.6980504989624 41 18 10 3 10 19.863088334371017 5.034463841504463 0.07940292358398438 3 0.9836133923628285 9.627710025403438 2145.0 2.5611940298507463 1.0 - - - - - - - 172.28571428571428 4 7 ABAT 4-aminobutyrate aminotransferase 625 80 C20140707_OR007_01 C20140707_OR007_01 TB439822.[MT7]-TVAGIIVEPIQSEGGDNHASDDFFRK[MT7].4y8_1.heavy 773.399 / 1129.58 5363.0 37.6980504989624 41 18 10 3 10 19.863088334371017 5.034463841504463 0.07940292358398438 3 0.9836133923628285 9.627710025403438 5363.0 31.08405472636816 0.0 - - - - - - - 241.2 10 5 ABAT 4-aminobutyrate aminotransferase 627 80 C20140707_OR007_01 C20140707_OR007_01 TB439822.[MT7]-TVAGIIVEPIQSEGGDNHASDDFFRK[MT7].4b5_1.heavy 773.399 / 586.368 19709.0 37.6980504989624 41 18 10 3 10 19.863088334371017 5.034463841504463 0.07940292358398438 3 0.9836133923628285 9.627710025403438 19709.0 60.4149405211232 0.0 - - - - - - - 686.875 39 8 ABAT 4-aminobutyrate aminotransferase 629 80 C20140707_OR007_01 C20140707_OR007_01 TB439822.[MT7]-TVAGIIVEPIQSEGGDNHASDDFFRK[MT7].4b6_1.heavy 773.399 / 699.452 10860.0 37.6980504989624 41 18 10 3 10 19.863088334371017 5.034463841504463 0.07940292358398438 3 0.9836133923628285 9.627710025403438 10860.0 63.755223880597015 0.0 - - - - - - - 248.85714285714286 21 7 ABAT 4-aminobutyrate aminotransferase 631 81 C20140707_OR007_01 C20140707_OR007_01 TB439777.[MT7]-FHEAFIPSPDGDRDIFIDGVVAR.4y5_1.heavy 680.101 / 501.314 11623.0 39.862600326538086 43 18 10 5 10 4.134221407677746 19.528422324683742 0.047199249267578125 3 0.9838075744304434 9.685424144937265 11623.0 13.600781263203906 0.0 - - - - - - - 294.0 23 10 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 633 81 C20140707_OR007_01 C20140707_OR007_01 TB439777.[MT7]-FHEAFIPSPDGDRDIFIDGVVAR.4b4_1.heavy 680.101 / 629.316 15264.0 39.862600326538086 43 18 10 5 10 4.134221407677746 19.528422324683742 0.047199249267578125 3 0.9838075744304434 9.685424144937265 15264.0 27.079971428571426 0.0 - - - - - - - 326.6666666666667 30 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 635 81 C20140707_OR007_01 C20140707_OR007_01 TB439777.[MT7]-FHEAFIPSPDGDRDIFIDGVVAR.4b5_1.heavy 680.101 / 776.385 6582.0 39.862600326538086 43 18 10 5 10 4.134221407677746 19.528422324683742 0.047199249267578125 3 0.9838075744304434 9.685424144937265 6582.0 35.73085714285714 0.0 - - - - - - - 280.0 13 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 637 81 C20140707_OR007_01 C20140707_OR007_01 TB439777.[MT7]-FHEAFIPSPDGDRDIFIDGVVAR.4b3_1.heavy 680.101 / 558.279 7282.0 39.862600326538086 43 18 10 5 10 4.134221407677746 19.528422324683742 0.047199249267578125 3 0.9838075744304434 9.685424144937265 7282.0 13.653749999999999 0.0 - - - - - - - 308.0 14 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 639 82 C20140707_OR007_01 C20140707_OR007_01 TB418983.[MT7]-YPQFISR.2b3_1.heavy 527.794 / 533.284 17300.0 34.88410186767578 28 2 10 10 6 0.36230786349708477 112.45714160377196 0.0 5 0.45783811716811224 1.593566908114282 17300.0 91.29836334669046 0.0 - - - - - - - 230.8 34 5 ABAT 4-aminobutyrate aminotransferase 641 82 C20140707_OR007_01 C20140707_OR007_01 TB418983.[MT7]-YPQFISR.2y4_1.heavy 527.794 / 522.304 32986.0 34.88410186767578 28 2 10 10 6 0.36230786349708477 112.45714160377196 0.0 5 0.45783811716811224 1.593566908114282 32986.0 124.22408850305492 0.0 - - - - - - - 296.42857142857144 65 7 ABAT 4-aminobutyrate aminotransferase 643 82 C20140707_OR007_01 C20140707_OR007_01 TB418983.[MT7]-YPQFISR.2y5_1.heavy 527.794 / 650.362 2883.0 34.88410186767578 28 2 10 10 6 0.36230786349708477 112.45714160377196 0.0 5 0.45783811716811224 1.593566908114282 2883.0 15.914826589595377 3.0 - - - - - - - 255.5 6 14 ABAT 4-aminobutyrate aminotransferase 645 82 C20140707_OR007_01 C20140707_OR007_01 TB418983.[MT7]-YPQFISR.2y6_1.heavy 527.794 / 747.415 14071.0 34.88410186767578 28 2 10 10 6 0.36230786349708477 112.45714160377196 0.0 5 0.45783811716811224 1.593566908114282 14071.0 59.35440606936417 2.0 - - - - - - - 230.5 34 6 ABAT 4-aminobutyrate aminotransferase 647 83 C20140707_OR007_01 C20140707_OR007_01 TB418785.[MT7]-EGPEQVIPINSEELFVHPLWNR.4y8_1.heavy 687.612 / 1068.57 5622.0 45.15112590789795 44 18 10 6 10 4.6829552659251386 21.354036996175438 0.033100128173828125 3 0.9862783289881178 10.523519511733081 5622.0 20.6154535085318 0.0 - - - - - - - 265.25 11 12 CELA3A chymotrypsin-like elastase family, member 3A 649 83 C20140707_OR007_01 C20140707_OR007_01 TB418785.[MT7]-EGPEQVIPINSEELFVHPLWNR.4b4_1.heavy 687.612 / 557.269 7870.0 45.15112590789795 44 18 10 6 10 4.6829552659251386 21.354036996175438 0.033100128173828125 3 0.9862783289881178 10.523519511733081 7870.0 30.554795121951223 0.0 - - - - - - - 249.73333333333332 15 15 CELA3A chymotrypsin-like elastase family, member 3A 651 83 C20140707_OR007_01 C20140707_OR007_01 TB418785.[MT7]-EGPEQVIPINSEELFVHPLWNR.4y6_1.heavy 687.612 / 822.437 8620.0 45.15112590789795 44 18 10 6 10 4.6829552659251386 21.354036996175438 0.033100128173828125 3 0.9862783289881178 10.523519511733081 8620.0 25.412946144721232 0.0 - - - - - - - 304.3333333333333 17 12 CELA3A chymotrypsin-like elastase family, member 3A 653 83 C20140707_OR007_01 C20140707_OR007_01 TB418785.[MT7]-EGPEQVIPINSEELFVHPLWNR.4b6_1.heavy 687.612 / 784.396 10119.0 45.15112590789795 44 18 10 6 10 4.6829552659251386 21.354036996175438 0.033100128173828125 3 0.9862783289881178 10.523519511733081 10119.0 30.613483959691763 0.0 - - - - - - - 263.90909090909093 20 11 CELA3A chymotrypsin-like elastase family, member 3A 655 84 C20140707_OR007_01 C20140707_OR007_01 TB439772.[MT7]-LSTVASTDILATVLEEMPPFPER.3b9_1.heavy 887.471 / 1032.57 1236.0 54.71415138244629 44 16 10 8 10 2.1599266159219046 39.88521335807664 0.01979827880859375 3 0.9616986907042845 6.285785422418565 1236.0 2.0016194331983805 0.0 - - - - - - - 118.05714285714286 2 35 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 657 84 C20140707_OR007_01 C20140707_OR007_01 TB439772.[MT7]-LSTVASTDILATVLEEMPPFPER.3y6_1.heavy 887.471 / 742.388 899.0 54.71415138244629 44 16 10 8 10 2.1599266159219046 39.88521335807664 0.01979827880859375 3 0.9616986907042845 6.285785422418565 899.0 -1.3318518518518514 0.0 - - - - - - - 0.0 1 0 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 659 84 C20140707_OR007_01 C20140707_OR007_01 TB439772.[MT7]-LSTVASTDILATVLEEMPPFPER.3b5_1.heavy 887.471 / 616.379 1213.0 54.71415138244629 44 16 10 8 10 2.1599266159219046 39.88521335807664 0.01979827880859375 3 0.9616986907042845 6.285785422418565 1213.0 6.738888888888888 0.0 - - - - - - - 97.19444444444444 2 36 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 661 84 C20140707_OR007_01 C20140707_OR007_01 TB439772.[MT7]-LSTVASTDILATVLEEMPPFPER.3b8_1.heavy 887.471 / 919.485 1618.0 54.71415138244629 44 16 10 8 10 2.1599266159219046 39.88521335807664 0.01979827880859375 3 0.9616986907042845 6.285785422418565 1618.0 -1.9104925150037928 0.0 - - - - - - - 96.2258064516129 3 31 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 663 85 C20140707_OR007_01 C20140707_OR007_01 TB418783.[MT7]-NAVLFEAISLIIHHDSEPNLLVR.4y8_1.heavy 686.886 / 927.526 1720.0 52.738274574279785 46 20 10 6 10 11.53962648269515 8.66579175244192 0.036098480224609375 3 0.9949075692923439 17.286828843948218 1720.0 22.817887029288702 0.0 - - - - - - - 159.41666666666666 3 12 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 665 85 C20140707_OR007_01 C20140707_OR007_01 TB418783.[MT7]-NAVLFEAISLIIHHDSEPNLLVR.4y9_1.heavy 686.886 / 1042.55 1194.0 52.738274574279785 46 20 10 6 10 11.53962648269515 8.66579175244192 0.036098480224609375 3 0.9949075692923439 17.286828843948218 1194.0 9.014827515580654 0.0 - - - - - - - 165.94117647058823 2 17 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 667 85 C20140707_OR007_01 C20140707_OR007_01 TB418783.[MT7]-NAVLFEAISLIIHHDSEPNLLVR.4b4_1.heavy 686.886 / 542.342 3440.0 52.738274574279785 46 20 10 6 10 11.53962648269515 8.66579175244192 0.036098480224609375 3 0.9949075692923439 17.286828843948218 3440.0 42.80044910179641 0.0 - - - - - - - 188.61111111111111 6 18 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 669 85 C20140707_OR007_01 C20140707_OR007_01 TB418783.[MT7]-NAVLFEAISLIIHHDSEPNLLVR.4b6_1.heavy 686.886 / 818.453 1051.0 52.738274574279785 46 20 10 6 10 11.53962648269515 8.66579175244192 0.036098480224609375 3 0.9949075692923439 17.286828843948218 1051.0 23.217212543554005 0.0 - - - - - - - 191.3 2 10 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 671 86 C20140707_OR007_01 C20140707_OR007_01 TB449680.[MT7]-VSAFIDWIEETIASH.3b6_1.heavy 621.32 / 777.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 673 86 C20140707_OR007_01 C20140707_OR007_01 TB449680.[MT7]-VSAFIDWIEETIASH.3b4_1.heavy 621.32 / 549.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 675 86 C20140707_OR007_01 C20140707_OR007_01 TB449680.[MT7]-VSAFIDWIEETIASH.3b5_1.heavy 621.32 / 662.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 677 86 C20140707_OR007_01 C20140707_OR007_01 TB449680.[MT7]-VSAFIDWIEETIASH.3y5_1.heavy 621.32 / 528.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 679 87 C20140707_OR007_01 C20140707_OR007_01 TB449681.[MT7]-VSAFIDWIEETIASH.2b4_1.heavy 931.476 / 549.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 681 87 C20140707_OR007_01 C20140707_OR007_01 TB449681.[MT7]-VSAFIDWIEETIASH.2b6_1.heavy 931.476 / 777.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 683 87 C20140707_OR007_01 C20140707_OR007_01 TB449681.[MT7]-VSAFIDWIEETIASH.2b7_1.heavy 931.476 / 963.506 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 685 87 C20140707_OR007_01 C20140707_OR007_01 TB449681.[MT7]-VSAFIDWIEETIASH.2b5_1.heavy 931.476 / 662.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 687 88 C20140707_OR007_01 C20140707_OR007_01 TB418780.[MT7]-MLDLYSQISSVPIGYSHPALLK[MT7].3b4_1.heavy 907.503 / 617.345 6465.0 44.60192394256592 39 13 10 6 10 2.988142123193456 33.46561036164138 0.039699554443359375 3 0.9018049185058857 3.9056915104283108 6465.0 34.220100502512565 0.0 - - - - - - - 223.5 12 8 ABAT 4-aminobutyrate aminotransferase 689 88 C20140707_OR007_01 C20140707_OR007_01 TB418780.[MT7]-MLDLYSQISSVPIGYSHPALLK[MT7].3b3_1.heavy 907.503 / 504.261 4177.0 44.60192394256592 39 13 10 6 10 2.988142123193456 33.46561036164138 0.039699554443359375 3 0.9018049185058857 3.9056915104283108 4177.0 7.440856564794147 1.0 - - - - - - - 287.1111111111111 17 9 ABAT 4-aminobutyrate aminotransferase 691 88 C20140707_OR007_01 C20140707_OR007_01 TB418780.[MT7]-MLDLYSQISSVPIGYSHPALLK[MT7].3b7_1.heavy 907.503 / 995.499 5968.0 44.60192394256592 39 13 10 6 10 2.988142123193456 33.46561036164138 0.039699554443359375 3 0.9018049185058857 3.9056915104283108 5968.0 36.764834517414656 0.0 - - - - - - - 190.33333333333334 11 12 ABAT 4-aminobutyrate aminotransferase 693 88 C20140707_OR007_01 C20140707_OR007_01 TB418780.[MT7]-MLDLYSQISSVPIGYSHPALLK[MT7].3y5_1.heavy 907.503 / 685.473 7161.0 44.60192394256592 39 13 10 6 10 2.988142123193456 33.46561036164138 0.039699554443359375 3 0.9018049185058857 3.9056915104283108 7161.0 9.60883859793494 1.0 - - - - - - - 198.66666666666666 17 15 ABAT 4-aminobutyrate aminotransferase 695 89 C20140707_OR007_01 C20140707_OR007_01 TB439056.[MT7]-SQELMK[MT7].2y4_1.heavy 512.291 / 664.382 5169.0 21.575525760650635 46 20 10 6 10 8.994637465068974 11.117735471646736 0.03989982604980469 3 0.9968057149882668 21.830308100092463 5169.0 39.783876404494386 0.0 - - - - - - - 213.7 10 10 ABAT 4-aminobutyrate aminotransferase 697 89 C20140707_OR007_01 C20140707_OR007_01 TB439056.[MT7]-SQELMK[MT7].2y5_1.heavy 512.291 / 792.441 3654.0 21.575525760650635 46 20 10 6 10 8.994637465068974 11.117735471646736 0.03989982604980469 3 0.9968057149882668 21.830308100092463 3654.0 7.9470403587443945 1.0 - - - - - - - 401.0 7 2 ABAT 4-aminobutyrate aminotransferase 699 89 C20140707_OR007_01 C20140707_OR007_01 TB439056.[MT7]-SQELMK[MT7].2b4_1.heavy 512.291 / 602.327 4189.0 21.575525760650635 46 20 10 6 10 8.994637465068974 11.117735471646736 0.03989982604980469 3 0.9968057149882668 21.830308100092463 4189.0 24.312299695474117 0.0 - - - - - - - 275.27272727272725 8 11 ABAT 4-aminobutyrate aminotransferase 701 89 C20140707_OR007_01 C20140707_OR007_01 TB439056.[MT7]-SQELMK[MT7].2y3_1.heavy 512.291 / 535.339 7753.0 21.575525760650635 46 20 10 6 10 8.994637465068974 11.117735471646736 0.03989982604980469 3 0.9968057149882668 21.830308100092463 7753.0 97.00722980803143 0.0 - - - - - - - 230.08333333333334 15 12 ABAT 4-aminobutyrate aminotransferase 703 90 C20140707_OR007_01 C20140707_OR007_01 TB439635.[MT7]-VRHQGDLSSGYLDDTK[MT7].4y4_1.heavy 520.523 / 622.316 6597.0 24.46969985961914 38 8 10 10 10 0.4498360862840217 105.67040299722618 0.0 3 0.762166853646273 2.478658570013239 6597.0 12.874314134539182 1.0 - - - - - - - 223.1 18 10 TRAFD1 TRAF-type zinc finger domain containing 1 705 90 C20140707_OR007_01 C20140707_OR007_01 TB439635.[MT7]-VRHQGDLSSGYLDDTK[MT7].4y3_1.heavy 520.523 / 507.289 5988.0 24.46969985961914 38 8 10 10 10 0.4498360862840217 105.67040299722618 0.0 3 0.762166853646273 2.478658570013239 5988.0 15.625108443766045 0.0 - - - - - - - 212.8 11 10 TRAFD1 TRAF-type zinc finger domain containing 1 707 90 C20140707_OR007_01 C20140707_OR007_01 TB439635.[MT7]-VRHQGDLSSGYLDDTK[MT7].4b3_1.heavy 520.523 / 537.338 812.0 24.46969985961914 38 8 10 10 10 0.4498360862840217 105.67040299722618 0.0 3 0.762166853646273 2.478658570013239 812.0 7.712945495733006 7.0 - - - - - - - 223.0 2 5 TRAFD1 TRAF-type zinc finger domain containing 1 709 90 C20140707_OR007_01 C20140707_OR007_01 TB439635.[MT7]-VRHQGDLSSGYLDDTK[MT7].4b6_1.heavy 520.523 / 837.445 1522.0 24.46969985961914 38 8 10 10 10 0.4498360862840217 105.67040299722618 0.0 3 0.762166853646273 2.478658570013239 1522.0 7.947389162561576 0.0 - - - - - - - 202.75 3 8 TRAFD1 TRAF-type zinc finger domain containing 1 711 91 C20140707_OR007_01 C20140707_OR007_01 TB419298.[MT7]-EEFRPNAPYR.2y4_1.heavy 711.866 / 506.272 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 713 91 C20140707_OR007_01 C20140707_OR007_01 TB419298.[MT7]-EEFRPNAPYR.2y8_2.heavy 711.866 / 510.772 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 715 91 C20140707_OR007_01 C20140707_OR007_01 TB419298.[MT7]-EEFRPNAPYR.2b4_1.heavy 711.866 / 706.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 717 91 C20140707_OR007_01 C20140707_OR007_01 TB419298.[MT7]-EEFRPNAPYR.2y6_1.heavy 711.866 / 717.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 719 92 C20140707_OR007_01 C20140707_OR007_01 TB419402.[MT7]-VLVAGDTMDSVK[MT7].2y8_1.heavy 761.923 / 996.479 3497.0 31.483200073242188 45 15 10 10 10 2.0134548052711123 42.71414315527589 0.0 3 0.9503309306350228 5.514487774195183 3497.0 37.388438095238094 0.0 - - - - - - - 186.8 6 5 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 721 92 C20140707_OR007_01 C20140707_OR007_01 TB419402.[MT7]-VLVAGDTMDSVK[MT7].2y9_1.heavy 761.923 / 1067.52 4314.0 31.483200073242188 45 15 10 10 10 2.0134548052711123 42.71414315527589 0.0 3 0.9503309306350228 5.514487774195183 4314.0 18.354141354808302 1.0 - - - - - - - 204.125 10 8 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 723 92 C20140707_OR007_01 C20140707_OR007_01 TB419402.[MT7]-VLVAGDTMDSVK[MT7].2y3_1.heavy 761.923 / 477.315 3614.0 31.483200073242188 45 15 10 10 10 2.0134548052711123 42.71414315527589 0.0 3 0.9503309306350228 5.514487774195183 3614.0 36.67834920634921 0.0 - - - - - - - 262.375 7 8 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 725 92 C20140707_OR007_01 C20140707_OR007_01 TB419402.[MT7]-VLVAGDTMDSVK[MT7].2y10_1.heavy 761.923 / 1166.58 1166.0 31.483200073242188 45 15 10 10 10 2.0134548052711123 42.71414315527589 0.0 3 0.9503309306350228 5.514487774195183 1166.0 5.504721030042918 0.0 - - - - - - - 247.875 2 8 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 727 93 C20140707_OR007_01 C20140707_OR007_01 TB418154.[MT7]-ELTPFLLK[MT7].3y3_1.heavy 416.932 / 517.383 9136.0 41.233150482177734 41 16 10 5 10 2.304411063577012 38.22331416999029 0.04669952392578125 3 0.964420429019092 6.523277682406936 9136.0 60.709479224376736 0.0 - - - - - - - 240.25 18 4 GLYAT glycine-N-acyltransferase 729 93 C20140707_OR007_01 C20140707_OR007_01 TB418154.[MT7]-ELTPFLLK[MT7].3b4_1.heavy 416.932 / 585.336 2524.0 41.233150482177734 41 16 10 5 10 2.304411063577012 38.22331416999029 0.04669952392578125 3 0.964420429019092 6.523277682406936 2524.0 26.27548717948718 0.0 - - - - - - - 441.0 5 3 GLYAT glycine-N-acyltransferase 731 93 C20140707_OR007_01 C20140707_OR007_01 TB418154.[MT7]-ELTPFLLK[MT7].3b5_1.heavy 416.932 / 732.405 9496.0 41.233150482177734 41 16 10 5 10 2.304411063577012 38.22331416999029 0.04669952392578125 3 0.964420429019092 6.523277682406936 9496.0 118.70000000000002 0.0 - - - - - - - 962.0 18 1 GLYAT glycine-N-acyltransferase 733 93 C20140707_OR007_01 C20140707_OR007_01 TB418154.[MT7]-ELTPFLLK[MT7].3y4_1.heavy 416.932 / 664.451 4928.0 41.233150482177734 41 16 10 5 10 2.304411063577012 38.22331416999029 0.04669952392578125 3 0.964420429019092 6.523277682406936 4928.0 41.8798003327787 0.0 - - - - - - - 240.25 9 4 GLYAT glycine-N-acyltransferase 735 94 C20140707_OR007_01 C20140707_OR007_01 TB418555.[MT7]-GRLTEC[CAM]LETILNK[MT7].3y3_1.heavy 612.348 / 518.342 14025.0 39.59640121459961 43 13 10 10 10 1.1466411231882523 57.97849700395346 0.0 3 0.9130854907745098 4.15546213880006 14025.0 37.813480741797434 0.0 - - - - - - - 233.66666666666666 28 6 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 737 94 C20140707_OR007_01 C20140707_OR007_01 TB418555.[MT7]-GRLTEC[CAM]LETILNK[MT7].3b5_1.heavy 612.348 / 701.406 1963.0 39.59640121459961 43 13 10 10 10 1.1466411231882523 57.97849700395346 0.0 3 0.9130854907745098 4.15546213880006 1963.0 2.3807419670557266 3.0 - - - - - - - 718.625 6 8 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 739 94 C20140707_OR007_01 C20140707_OR007_01 TB418555.[MT7]-GRLTEC[CAM]LETILNK[MT7].3y4_1.heavy 612.348 / 631.426 4348.0 39.59640121459961 43 13 10 10 10 1.1466411231882523 57.97849700395346 0.0 3 0.9130854907745098 4.15546213880006 4348.0 29.3354367201426 0.0 - - - - - - - 227.75 8 8 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 741 94 C20140707_OR007_01 C20140707_OR007_01 TB418555.[MT7]-GRLTEC[CAM]LETILNK[MT7].3b8_2.heavy 612.348 / 552.285 13885.0 39.59640121459961 43 13 10 10 10 1.1466411231882523 57.97849700395346 0.0 3 0.9130854907745098 4.15546213880006 13885.0 125.88375636240244 0.0 - - - - - - - 210.25 27 8 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 743 95 C20140707_OR007_01 C20140707_OR007_01 TB439501.[MT7]-MVVC[CAM]PLIDVIDDR.3y7_1.heavy 563.633 / 845.436 4113.0 45.90640068054199 46 20 10 6 10 9.417626525364009 10.61838667425122 0.034801483154296875 3 0.9945975570562928 16.783075969415158 4113.0 11.87134110787172 1.0 - - - - - - - 152.33333333333334 8 9 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 745 95 C20140707_OR007_01 C20140707_OR007_01 TB439501.[MT7]-MVVC[CAM]PLIDVIDDR.3y6_1.heavy 563.633 / 732.352 8055.0 45.90640068054199 46 20 10 6 10 9.417626525364009 10.61838667425122 0.034801483154296875 3 0.9945975570562928 16.783075969415158 8055.0 46.63421052631579 0.0 - - - - - - - 232.57142857142858 16 7 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 747 95 C20140707_OR007_01 C20140707_OR007_01 TB439501.[MT7]-MVVC[CAM]PLIDVIDDR.3b4_1.heavy 563.633 / 634.317 9341.0 45.90640068054199 46 20 10 6 10 9.417626525364009 10.61838667425122 0.034801483154296875 3 0.9945975570562928 16.783075969415158 9341.0 51.61175097276265 0.0 - - - - - - - 180.88888888888889 18 9 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 749 95 C20140707_OR007_01 C20140707_OR007_01 TB439501.[MT7]-MVVC[CAM]PLIDVIDDR.3y5_1.heavy 563.633 / 617.325 5485.0 45.90640068054199 46 20 10 6 10 9.417626525364009 10.61838667425122 0.034801483154296875 3 0.9945975570562928 16.783075969415158 5485.0 15.050891477820496 0.0 - - - - - - - 190.33333333333334 10 9 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 751 96 C20140707_OR007_01 C20140707_OR007_01 TB418653.[MT7]-DLTYQVVLGEYNLAVK[MT7].2y8_1.heavy 1057.09 / 1037.57 13884.0 43.8525505065918 35 9 10 6 10 9.980220915866342 10.01981828288211 0.03949737548828125 3 0.8065469168299458 2.7593754180029237 13884.0 21.90534759358289 0.0 - - - - - - - 244.28571428571428 27 7 CELA3A chymotrypsin-like elastase family, member 3A 753 96 C20140707_OR007_01 C20140707_OR007_01 TB418653.[MT7]-DLTYQVVLGEYNLAVK[MT7].2y9_1.heavy 1057.09 / 1150.66 7796.0 43.8525505065918 35 9 10 6 10 9.980220915866342 10.01981828288211 0.03949737548828125 3 0.8065469168299458 2.7593754180029237 7796.0 38.0487970413314 0.0 - - - - - - - 223.45454545454547 15 11 CELA3A chymotrypsin-like elastase family, member 3A 755 96 C20140707_OR007_01 C20140707_OR007_01 TB418653.[MT7]-DLTYQVVLGEYNLAVK[MT7].2y10_1.heavy 1057.09 / 1249.73 6835.0 43.8525505065918 35 9 10 6 10 9.980220915866342 10.01981828288211 0.03949737548828125 3 0.8065469168299458 2.7593754180029237 6835.0 53.127752336448594 0.0 - - - - - - - 267.0 13 6 CELA3A chymotrypsin-like elastase family, member 3A 757 96 C20140707_OR007_01 C20140707_OR007_01 TB418653.[MT7]-DLTYQVVLGEYNLAVK[MT7].2b5_1.heavy 1057.09 / 765.39 5874.0 43.8525505065918 35 9 10 6 10 9.980220915866342 10.01981828288211 0.03949737548828125 3 0.8065469168299458 2.7593754180029237 5874.0 27.25150819672131 0.0 - - - - - - - 256.4 11 5 CELA3A chymotrypsin-like elastase family, member 3A 759 97 C20140707_OR007_01 C20140707_OR007_01 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 193113.0 38.06449890136719 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 193113.0 68.2273271889401 0.0 - - - - - - - 274.0 386 3 761 97 C20140707_OR007_01 C20140707_OR007_01 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 137331.0 38.06449890136719 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 137331.0 61.45161478599222 0.0 - - - - - - - 205.5 274 6 763 97 C20140707_OR007_01 C20140707_OR007_01 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 195169.0 38.06449890136719 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 195169.0 45.38323912326436 1.0 - - - - - - - 246.6 410 5 765 98 C20140707_OR007_01 C20140707_OR007_01 TB439503.[MT7]-REDLLNNAAHAGK[MT7].4b7_2.heavy 424.989 / 500.271 20497.0 22.840299606323242 27 9 0 10 8 1.984552370971584 50.38919680967788 0.0 4 0.8133142067896257 2.8106478278652367 20497.0 102.54188653110695 1.0 - - - - - - - 189.0 2209 1 ABAT 4-aminobutyrate aminotransferase 767 98 C20140707_OR007_01 C20140707_OR007_01 TB439503.[MT7]-REDLLNNAAHAGK[MT7].4b4_1.heavy 424.989 / 658.364 4912.0 22.840299606323242 27 9 0 10 8 1.984552370971584 50.38919680967788 0.0 4 0.8133142067896257 2.8106478278652367 4912.0 21.682337764316564 0.0 - - - - - - - 178.11111111111111 9 9 ABAT 4-aminobutyrate aminotransferase 769 98 C20140707_OR007_01 C20140707_OR007_01 TB439503.[MT7]-REDLLNNAAHAGK[MT7].4b3_1.heavy 424.989 / 545.28 4817.0 22.840299606323242 27 9 0 10 8 1.984552370971584 50.38919680967788 0.0 4 0.8133142067896257 2.8106478278652367 4817.0 77.89191489361701 0.0 - - - - - - - 220.22222222222223 9 9 ABAT 4-aminobutyrate aminotransferase 771 98 C20140707_OR007_01 C20140707_OR007_01 TB439503.[MT7]-REDLLNNAAHAGK[MT7].4b6_2.heavy 424.989 / 443.249 9729.0 22.840299606323242 27 9 0 10 8 1.984552370971584 50.38919680967788 0.0 4 0.8133142067896257 2.8106478278652367 9729.0 26.08126984126984 0.0 - - - - - - - 264.3 19 10 ABAT 4-aminobutyrate aminotransferase 773 99 C20140707_OR007_01 C20140707_OR007_01 TB419813.[MT7]-LAFTLDHETGLPQGC[CAM]HIYEYR.4y5_1.heavy 666.83 / 743.372 4067.0 36.60605049133301 40 15 10 5 10 2.294126851748062 34.337794337798464 0.044902801513671875 3 0.9500464727420277 5.498631592671854 4067.0 7.1505432348479365 0.0 - - - - - - - 203.2 8 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 775 99 C20140707_OR007_01 C20140707_OR007_01 TB419813.[MT7]-LAFTLDHETGLPQGC[CAM]HIYEYR.4y4_1.heavy 666.83 / 630.288 10422.0 36.60605049133301 40 15 10 5 10 2.294126851748062 34.337794337798464 0.044902801513671875 3 0.9500464727420277 5.498631592671854 10422.0 35.74350437936831 0.0 - - - - - - - 241.3 20 10 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 777 99 C20140707_OR007_01 C20140707_OR007_01 TB419813.[MT7]-LAFTLDHETGLPQGC[CAM]HIYEYR.4y6_1.heavy 666.83 / 880.431 2923.0 36.60605049133301 40 15 10 5 10 2.294126851748062 34.337794337798464 0.044902801513671875 3 0.9500464727420277 5.498631592671854 2923.0 13.797940944881889 0.0 - - - - - - - 235.85714285714286 5 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 779 99 C20140707_OR007_01 C20140707_OR007_01 TB419813.[MT7]-LAFTLDHETGLPQGC[CAM]HIYEYR.4b6_1.heavy 666.83 / 805.458 6482.0 36.60605049133301 40 15 10 5 10 2.294126851748062 34.337794337798464 0.044902801513671875 3 0.9500464727420277 5.498631592671854 6482.0 28.58204724409449 0.0 - - - - - - - 243.41666666666666 12 12 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 781 100 C20140707_OR007_01 C20140707_OR007_01 TB439406.[MT7]-LLNTLADYLAK[MT7].3b4_1.heavy 508.308 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 783 100 C20140707_OR007_01 C20140707_OR007_01 TB439406.[MT7]-LLNTLADYLAK[MT7].3y4_1.heavy 508.308 / 638.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 785 100 C20140707_OR007_01 C20140707_OR007_01 TB439406.[MT7]-LLNTLADYLAK[MT7].3y5_1.heavy 508.308 / 753.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 787 100 C20140707_OR007_01 C20140707_OR007_01 TB439406.[MT7]-LLNTLADYLAK[MT7].3b7_1.heavy 508.308 / 885.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 789 101 C20140707_OR007_01 C20140707_OR007_01 TB419816.[MT7]-FWAHEHWGLDDPADVMTFSK[MT7].4y4_1.heavy 670.074 / 626.363 12004.0 41.209800720214844 44 14 10 10 10 9.785610115707797 10.219086885495331 0.0 3 0.9481074212100458 5.39403252591867 12004.0 11.674914406787043 0.0 - - - - - - - 306.75 24 4 ABAT 4-aminobutyrate aminotransferase 791 101 C20140707_OR007_01 C20140707_OR007_01 TB419816.[MT7]-FWAHEHWGLDDPADVMTFSK[MT7].4b11_2.heavy 670.074 / 769.85 11049.0 41.209800720214844 44 14 10 10 10 9.785610115707797 10.219086885495331 0.0 3 0.9481074212100458 5.39403252591867 11049.0 19.117368079985187 0.0 - - - - - - - 136.0 22 1 ABAT 4-aminobutyrate aminotransferase 793 101 C20140707_OR007_01 C20140707_OR007_01 TB419816.[MT7]-FWAHEHWGLDDPADVMTFSK[MT7].4y3_1.heavy 670.074 / 525.315 9276.0 41.209800720214844 44 14 10 10 10 9.785610115707797 10.219086885495331 0.0 3 0.9481074212100458 5.39403252591867 9276.0 15.357718229414564 0.0 - - - - - - - 181.66666666666666 18 6 ABAT 4-aminobutyrate aminotransferase 795 101 C20140707_OR007_01 C20140707_OR007_01 TB419816.[MT7]-FWAHEHWGLDDPADVMTFSK[MT7].4b3_1.heavy 670.074 / 549.294 3001.0 41.209800720214844 44 14 10 10 10 9.785610115707797 10.219086885495331 0.0 3 0.9481074212100458 5.39403252591867 3001.0 0.23690178129052522 1.0 - - - - - - - 238.5 7 12 ABAT 4-aminobutyrate aminotransferase 797 102 C20140707_OR007_01 C20140707_OR007_01 TB439405.[MT7]-IDPTVLLGALPLR.2y8_1.heavy 761.478 / 852.567 2121.0 49.676700592041016 48 18 10 10 10 3.2157864583989295 24.62838450554671 0.0 3 0.9870085330493262 10.815882798635306 2121.0 33.8690530846485 0.0 - - - - - - - 220.11111111111111 4 9 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 799 102 C20140707_OR007_01 C20140707_OR007_01 TB439405.[MT7]-IDPTVLLGALPLR.2y6_1.heavy 761.478 / 626.398 2600.0 49.676700592041016 48 18 10 10 10 3.2157864583989295 24.62838450554671 0.0 3 0.9870085330493262 10.815882798635306 2600.0 14.690902617055368 0.0 - - - - - - - 180.71428571428572 5 14 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 801 102 C20140707_OR007_01 C20140707_OR007_01 TB439405.[MT7]-IDPTVLLGALPLR.2y11_1.heavy 761.478 / 1149.74 9099.0 49.676700592041016 48 18 10 10 10 3.2157864583989295 24.62838450554671 0.0 3 0.9870085330493262 10.815882798635306 9099.0 106.80998112871639 0.0 - - - - - - - 152.3846153846154 18 13 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 803 102 C20140707_OR007_01 C20140707_OR007_01 TB439405.[MT7]-IDPTVLLGALPLR.2y7_1.heavy 761.478 / 739.482 1847.0 49.676700592041016 48 18 10 10 10 3.2157864583989295 24.62838450554671 0.0 3 0.9870085330493262 10.815882798635306 1847.0 12.403211678832118 0.0 - - - - - - - 177.8 3 10 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 805 103 C20140707_OR007_01 C20140707_OR007_01 TB449484.[MT7]-ALLTGLLDLQAR.2y8_1.heavy 714.439 / 885.515 13850.0 46.43629837036133 46 16 10 10 10 16.884959131424434 5.922430680562973 0.0 3 0.9663831993262575 6.712124125574984 13850.0 125.78743961352656 0.0 - - - - - - - 206.625 27 8 ABAT 4-aminobutyrate aminotransferase 807 103 C20140707_OR007_01 C20140707_OR007_01 TB449484.[MT7]-ALLTGLLDLQAR.2y9_1.heavy 714.439 / 986.563 27182.0 46.43629837036133 46 16 10 10 10 16.884959131424434 5.922430680562973 0.0 3 0.9663831993262575 6.712124125574984 27182.0 91.8611509328009 0.0 - - - - - - - 247.9 54 10 ABAT 4-aminobutyrate aminotransferase 809 103 C20140707_OR007_01 C20140707_OR007_01 TB449484.[MT7]-ALLTGLLDLQAR.2y10_1.heavy 714.439 / 1099.65 13023.0 46.43629837036133 46 16 10 10 10 16.884959131424434 5.922430680562973 0.0 3 0.9663831993262575 6.712124125574984 13023.0 134.69301839962418 0.0 - - - - - - - 229.66666666666666 26 9 ABAT 4-aminobutyrate aminotransferase 811 103 C20140707_OR007_01 C20140707_OR007_01 TB449484.[MT7]-ALLTGLLDLQAR.2y11_1.heavy 714.439 / 1212.73 2377.0 46.43629837036133 46 16 10 10 10 16.884959131424434 5.922430680562973 0.0 3 0.9663831993262575 6.712124125574984 2377.0 29.516339805825243 0.0 - - - - - - - 183.66666666666666 4 9 ABAT 4-aminobutyrate aminotransferase 813 104 C20140707_OR007_01 C20140707_OR007_01 TB419775.[MT7]-IYVPLK[MT7]DC[CAM]PQDFVARPK[MT7].4y5_1.heavy 620.353 / 714.474 1008.0 36.16940116882324 25 8 10 5 2 1.1591885598733158 76.08519583132818 0.042400360107421875 13 0.7629277614115706 2.482805772992574 1008.0 3.136 7.0 - - - - - - - 236.25 2 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 815 104 C20140707_OR007_01 C20140707_OR007_01 TB419775.[MT7]-IYVPLK[MT7]DC[CAM]PQDFVARPK[MT7].4y7_1.heavy 620.353 / 976.57 126.0 36.16940116882324 25 8 10 5 2 1.1591885598733158 76.08519583132818 0.042400360107421875 13 0.7629277614115706 2.482805772992574 126.0 0.4066666666666666 38.0 - - - - - - - 201.6 2 10 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 817 104 C20140707_OR007_01 C20140707_OR007_01 TB419775.[MT7]-IYVPLK[MT7]DC[CAM]PQDFVARPK[MT7].4y6_1.heavy 620.353 / 861.543 504.0 36.16940116882324 25 8 10 5 2 1.1591885598733158 76.08519583132818 0.042400360107421875 13 0.7629277614115706 2.482805772992574 504.0 1.0133333333333332 20.0 - - - - - - - 315.0 2 4 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 819 104 C20140707_OR007_01 C20140707_OR007_01 TB419775.[MT7]-IYVPLK[MT7]DC[CAM]PQDFVARPK[MT7].4b3_1.heavy 620.353 / 520.325 4664.0 36.16940116882324 25 8 10 5 2 1.1591885598733158 76.08519583132818 0.042400360107421875 13 0.7629277614115706 2.482805772992574 4664.0 3.4526078104780873 0.0 - - - - - - - 644.0 9 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 821 105 C20140707_OR007_01 C20140707_OR007_01 TB449803.[MT7]-DPQNC[CAM]QEFLGSPELINWK[MT7].4y4_1.heavy 616.561 / 704.421 5893.0 41.8882999420166 35 20 2 5 8 8.767262381787786 11.406069037893719 0.048999786376953125 4 0.9960872921732314 19.72340773873776 5893.0 13.683176638176636 0.0 - - - - - - - 681.7142857142857 11 7 GLYAT glycine-N-acyltransferase 823 105 C20140707_OR007_01 C20140707_OR007_01 TB449803.[MT7]-DPQNC[CAM]QEFLGSPELINWK[MT7].4b7_1.heavy 616.561 / 1016.42 7577.0 41.8882999420166 35 20 2 5 8 8.767262381787786 11.406069037893719 0.048999786376953125 4 0.9960872921732314 19.72340773873776 7577.0 9.590891661938443 2.0 - - - - - - - 351.0 92 4 GLYAT glycine-N-acyltransferase 825 105 C20140707_OR007_01 C20140707_OR007_01 TB449803.[MT7]-DPQNC[CAM]QEFLGSPELINWK[MT7].4b4_1.heavy 616.561 / 599.291 9681.0 41.8882999420166 35 20 2 5 8 8.767262381787786 11.406069037893719 0.048999786376953125 4 0.9960872921732314 19.72340773873776 9681.0 12.878978840023027 0.0 - - - - - - - 701.5714285714286 19 7 GLYAT glycine-N-acyltransferase 827 105 C20140707_OR007_01 C20140707_OR007_01 TB449803.[MT7]-DPQNC[CAM]QEFLGSPELINWK[MT7].4y3_1.heavy 616.561 / 591.337 15153.0 41.8882999420166 35 20 2 5 8 8.767262381787786 11.406069037893719 0.048999786376953125 4 0.9960872921732314 19.72340773873776 15153.0 -1.5109829059829067 0.0 - - - - - - - 300.57142857142856 30 7 GLYAT glycine-N-acyltransferase 829 106 C20140707_OR007_01 C20140707_OR007_01 TB418389.[MT7]-AVC[CAM]EADQSHGGPR.2y9_1.heavy 764.358 / 924.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRAFD1 TRAF-type zinc finger domain containing 1 831 106 C20140707_OR007_01 C20140707_OR007_01 TB418389.[MT7]-AVC[CAM]EADQSHGGPR.2y10_1.heavy 764.358 / 1053.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRAFD1 TRAF-type zinc finger domain containing 1 833 106 C20140707_OR007_01 C20140707_OR007_01 TB418389.[MT7]-AVC[CAM]EADQSHGGPR.2y11_1.heavy 764.358 / 1213.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRAFD1 TRAF-type zinc finger domain containing 1 835 106 C20140707_OR007_01 C20140707_OR007_01 TB418389.[MT7]-AVC[CAM]EADQSHGGPR.2y7_1.heavy 764.358 / 738.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRAFD1 TRAF-type zinc finger domain containing 1 837 107 C20140707_OR007_01 C20140707_OR007_01 TB418553.[MT7]-EGPEQVIPINSEELFVHPLWNR.3y6_1.heavy 916.481 / 822.437 9500.0 45.14285087585449 40 14 10 6 10 1.8947373267627943 41.56375533140801 0.033100128173828125 3 0.9341295617022383 4.781936881137471 9500.0 23.826983962459714 0.0 - - - - - - - 245.84615384615384 19 13 CELA3A chymotrypsin-like elastase family, member 3A 839 107 C20140707_OR007_01 C20140707_OR007_01 TB418553.[MT7]-EGPEQVIPINSEELFVHPLWNR.3b6_1.heavy 916.481 / 784.396 13826.0 45.14285087585449 40 14 10 6 10 1.8947373267627943 41.56375533140801 0.033100128173828125 3 0.9341295617022383 4.781936881137471 13826.0 21.819597181037473 0.0 - - - - - - - 282.0 27 8 CELA3A chymotrypsin-like elastase family, member 3A 841 107 C20140707_OR007_01 C20140707_OR007_01 TB418553.[MT7]-EGPEQVIPINSEELFVHPLWNR.3y8_1.heavy 916.481 / 1068.57 7901.0 45.14285087585449 40 14 10 6 10 1.8947373267627943 41.56375533140801 0.033100128173828125 3 0.9341295617022383 4.781936881137471 7901.0 85.89414396183328 0.0 - - - - - - - 671.5714285714286 15 7 CELA3A chymotrypsin-like elastase family, member 3A 843 107 C20140707_OR007_01 C20140707_OR007_01 TB418553.[MT7]-EGPEQVIPINSEELFVHPLWNR.3b7_1.heavy 916.481 / 897.48 21069.0 45.14285087585449 40 14 10 6 10 1.8947373267627943 41.56375533140801 0.033100128173828125 3 0.9341295617022383 4.781936881137471 21069.0 264.707329787234 0.0 - - - - - - - 266.3333333333333 42 12 CELA3A chymotrypsin-like elastase family, member 3A 845 108 C20140707_OR007_01 C20140707_OR007_01 TB439260.[MT7]-SLYNHPVPK[MT7].3b4_1.heavy 448.262 / 622.332 20014.0 22.92620086669922 50 20 10 10 10 5.946961922870735 16.81530860579778 0.0 3 0.9914001919405171 13.298610349041427 20014.0 145.84712532796226 0.0 - - - - - - - 248.11111111111111 40 9 DENND1B DENN/MADD domain containing 1B 847 108 C20140707_OR007_01 C20140707_OR007_01 TB439260.[MT7]-SLYNHPVPK[MT7].3b5_1.heavy 448.262 / 759.391 2332.0 22.92620086669922 50 20 10 10 10 5.946961922870735 16.81530860579778 0.0 3 0.9914001919405171 13.298610349041427 2332.0 25.483711340206185 0.0 - - - - - - - 121.25 4 4 DENND1B DENN/MADD domain containing 1B 849 108 C20140707_OR007_01 C20140707_OR007_01 TB439260.[MT7]-SLYNHPVPK[MT7].3y4_1.heavy 448.262 / 584.389 4080.0 22.92620086669922 50 20 10 10 10 5.946961922870735 16.81530860579778 0.0 3 0.9914001919405171 13.298610349041427 4080.0 36.17319587628866 0.0 - - - - - - - 172.44444444444446 8 9 DENND1B DENN/MADD domain containing 1B 851 108 C20140707_OR007_01 C20140707_OR007_01 TB439260.[MT7]-SLYNHPVPK[MT7].3b3_1.heavy 448.262 / 508.289 7967.0 22.92620086669922 50 20 10 10 10 5.946961922870735 16.81530860579778 0.0 3 0.9914001919405171 13.298610349041427 7967.0 45.19201026510835 0.0 - - - - - - - 202.25 15 12 DENND1B DENN/MADD domain containing 1B 853 109 C20140707_OR007_01 C20140707_OR007_01 TB449200.[MT7]-IYVPLK[MT7].2b3_1.heavy 510.838 / 520.325 17341.0 34.07099914550781 50 20 10 10 10 3.4090343590898895 22.877568470116135 0.0 3 0.9905421957373113 12.68014805673283 17341.0 51.507169022088476 0.0 - - - - - - - 324.42857142857144 34 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 855 109 C20140707_OR007_01 C20140707_OR007_01 TB449200.[MT7]-IYVPLK[MT7].2y4_1.heavy 510.838 / 600.42 11242.0 34.07099914550781 50 20 10 10 10 3.4090343590898895 22.877568470116135 0.0 3 0.9905421957373113 12.68014805673283 11242.0 63.945008566333726 0.0 - - - - - - - 311.0 22 10 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 857 109 C20140707_OR007_01 C20140707_OR007_01 TB449200.[MT7]-IYVPLK[MT7].2y5_1.heavy 510.838 / 763.483 5980.0 34.07099914550781 50 20 10 10 10 3.4090343590898895 22.877568470116135 0.0 3 0.9905421957373113 12.68014805673283 5980.0 -0.35536972756915947 4.0 - - - - - - - 239.33333333333334 23 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 859 109 C20140707_OR007_01 C20140707_OR007_01 TB449200.[MT7]-IYVPLK[MT7].2y3_1.heavy 510.838 / 501.352 63982.0 34.07099914550781 50 20 10 10 10 3.4090343590898895 22.877568470116135 0.0 3 0.9905421957373113 12.68014805673283 63982.0 222.8053743676694 0.0 - - - - - - - 259.3333333333333 127 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 861 110 C20140707_OR007_01 C20140707_OR007_01 TB419222.[MT7]-SLYNHPVPK[MT7].2b3_1.heavy 671.89 / 508.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 863 110 C20140707_OR007_01 C20140707_OR007_01 TB419222.[MT7]-SLYNHPVPK[MT7].2y4_1.heavy 671.89 / 584.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 865 110 C20140707_OR007_01 C20140707_OR007_01 TB419222.[MT7]-SLYNHPVPK[MT7].2b4_1.heavy 671.89 / 622.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 867 110 C20140707_OR007_01 C20140707_OR007_01 TB419222.[MT7]-SLYNHPVPK[MT7].2b5_1.heavy 671.89 / 759.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND1B DENN/MADD domain containing 1B 869 111 C20140707_OR007_01 C20140707_OR007_01 TB439408.[MT7]-AVC[CAM]EADQSHGGPR.3b6_1.heavy 509.908 / 790.352 3350.0 16.412099838256836 44 14 10 10 10 3.676683693316357 27.198423454752053 0.0 3 0.9395215095871954 4.992848952565455 3350.0 33.33782426013884 0.0 - - - - - - - 209.5 6 4 TRAFD1 TRAF-type zinc finger domain containing 1 871 111 C20140707_OR007_01 C20140707_OR007_01 TB439408.[MT7]-AVC[CAM]EADQSHGGPR.3y6_1.heavy 509.908 / 610.306 6254.0 16.412099838256836 44 14 10 10 10 3.676683693316357 27.198423454752053 0.0 3 0.9395215095871954 4.992848952565455 6254.0 180.9192857142857 0.0 - - - - - - - 119.85714285714286 12 7 TRAFD1 TRAF-type zinc finger domain containing 1 873 111 C20140707_OR007_01 C20140707_OR007_01 TB439408.[MT7]-AVC[CAM]EADQSHGGPR.3b4_1.heavy 509.908 / 604.288 13234.0 16.412099838256836 44 14 10 10 10 3.676683693316357 27.198423454752053 0.0 3 0.9395215095871954 4.992848952565455 13234.0 229.74084489574454 0.0 - - - - - - - 153.75 26 12 TRAFD1 TRAF-type zinc finger domain containing 1 875 111 C20140707_OR007_01 C20140707_OR007_01 TB439408.[MT7]-AVC[CAM]EADQSHGGPR.3y5_1.heavy 509.908 / 523.274 6589.0 16.412099838256836 44 14 10 10 10 3.676683693316357 27.198423454752053 0.0 3 0.9395215095871954 4.992848952565455 6589.0 148.2525 0.0 - - - - - - - 151.85714285714286 13 7 TRAFD1 TRAF-type zinc finger domain containing 1 877 112 C20140707_OR007_01 C20140707_OR007_01 TB419171.[MT7]-EHEDYC[CAM]GAR.3y3_1.heavy 427.52 / 303.177 3222.0 15.839599847793579 44 18 10 6 10 6.445392722824461 15.514958405230985 0.03600025177001953 3 0.9860255133655729 10.427672529966818 3222.0 65.1943143812709 0.0 - - - - - - - 120.3076923076923 6 13 TRAFD1 TRAF-type zinc finger domain containing 1 879 112 C20140707_OR007_01 C20140707_OR007_01 TB419171.[MT7]-EHEDYC[CAM]GAR.3b4_1.heavy 427.52 / 655.28 1519.0 15.839599847793579 44 18 10 6 10 6.445392722824461 15.514958405230985 0.03600025177001953 3 0.9860255133655729 10.427672529966818 1519.0 23.885724637681157 0.0 - - - - - - - 92.0 3 8 TRAFD1 TRAF-type zinc finger domain containing 1 881 112 C20140707_OR007_01 C20140707_OR007_01 TB419171.[MT7]-EHEDYC[CAM]GAR.3y4_1.heavy 427.52 / 463.208 4879.0 15.839599847793579 44 18 10 6 10 6.445392722824461 15.514958405230985 0.03600025177001953 3 0.9860255133655729 10.427672529966818 4879.0 15.500658243784002 0.0 - - - - - - - 140.7058823529412 9 17 TRAFD1 TRAF-type zinc finger domain containing 1 883 112 C20140707_OR007_01 C20140707_OR007_01 TB419171.[MT7]-EHEDYC[CAM]GAR.3y5_1.heavy 427.52 / 626.271 1197.0 15.839599847793579 44 18 10 6 10 6.445392722824461 15.514958405230985 0.03600025177001953 3 0.9860255133655729 10.427672529966818 1197.0 28.62391304347826 0.0 - - - - - - - 110.4 2 10 TRAFD1 TRAF-type zinc finger domain containing 1 885 113 C20140707_OR007_01 C20140707_OR007_01 TB419170.[MT7]-EHEDYC[CAM]GAR.2y8_1.heavy 640.776 / 1007.4 843.0 15.848599910736084 40 14 10 6 10 1.7742238380823334 41.357070777402924 0.03600025177001953 3 0.948406912641236 5.409803345972014 843.0 19.729787234042554 0.0 - - - - - - - 0.0 1 0 TRAFD1 TRAF-type zinc finger domain containing 1 887 113 C20140707_OR007_01 C20140707_OR007_01 TB419170.[MT7]-EHEDYC[CAM]GAR.2y5_1.heavy 640.776 / 626.271 1124.0 15.848599910736084 40 14 10 6 10 1.7742238380823334 41.357070777402924 0.03600025177001953 3 0.948406912641236 5.409803345972014 1124.0 5.484146341463415 0.0 - - - - - - - 218.77777777777777 2 9 TRAFD1 TRAF-type zinc finger domain containing 1 889 113 C20140707_OR007_01 C20140707_OR007_01 TB419170.[MT7]-EHEDYC[CAM]GAR.2b4_1.heavy 640.776 / 655.28 1078.0 15.848599910736084 40 14 10 6 10 1.7742238380823334 41.357070777402924 0.03600025177001953 3 0.948406912641236 5.409803345972014 1078.0 25.917872340425532 0.0 - - - - - - - 114.77777777777777 2 9 TRAFD1 TRAF-type zinc finger domain containing 1 891 113 C20140707_OR007_01 C20140707_OR007_01 TB419170.[MT7]-EHEDYC[CAM]GAR.2y6_1.heavy 640.776 / 741.299 328.0 15.848599910736084 40 14 10 6 10 1.7742238380823334 41.357070777402924 0.03600025177001953 3 0.948406912641236 5.409803345972014 328.0 7.327659574468085 2.0 - - - - - - - 0.0 0 0 TRAFD1 TRAF-type zinc finger domain containing 1 893 114 C20140707_OR007_01 C20140707_OR007_01 TB439811.[MT7]-TQAAEALEAVEGAAFFVSLDAEPAGLTR.3y6_1.heavy 993.512 / 614.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT1C carnitine palmitoyltransferase 1C 895 114 C20140707_OR007_01 C20140707_OR007_01 TB439811.[MT7]-TQAAEALEAVEGAAFFVSLDAEPAGLTR.3b6_1.heavy 993.512 / 716.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT1C carnitine palmitoyltransferase 1C 897 114 C20140707_OR007_01 C20140707_OR007_01 TB439811.[MT7]-TQAAEALEAVEGAAFFVSLDAEPAGLTR.3y11_1.heavy 993.512 / 1129.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT1C carnitine palmitoyltransferase 1C 899 114 C20140707_OR007_01 C20140707_OR007_01 TB439811.[MT7]-TQAAEALEAVEGAAFFVSLDAEPAGLTR.3y8_1.heavy 993.512 / 814.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT1C carnitine palmitoyltransferase 1C 901 115 C20140707_OR007_01 C20140707_OR007_01 TB419579.[MT7]-QFLETAINLQLFK[MT7].2y9_1.heavy 927.042 / 1191.72 1822.0 47.29819869995117 47 17 10 10 10 2.599192701823071 30.383478887534682 0.0 3 0.9758716716347549 7.929058653743431 1822.0 6.073333333333334 0.0 - - - - - - - 251.95454545454547 3 22 DENND1B DENN/MADD domain containing 1B 903 115 C20140707_OR007_01 C20140707_OR007_01 TB419579.[MT7]-QFLETAINLQLFK[MT7].2b4_1.heavy 927.042 / 662.363 7923.0 47.29819869995117 47 17 10 10 10 2.599192701823071 30.383478887534682 0.0 3 0.9758716716347549 7.929058653743431 7923.0 42.30272268907562 0.0 - - - - - - - 225.53846153846155 15 13 DENND1B DENN/MADD domain containing 1B 905 115 C20140707_OR007_01 C20140707_OR007_01 TB419579.[MT7]-QFLETAINLQLFK[MT7].2y3_1.heavy 927.042 / 551.367 5546.0 47.29819869995117 47 17 10 10 10 2.599192701823071 30.383478887534682 0.0 3 0.9758716716347549 7.929058653743431 5546.0 60.11701425716189 0.0 - - - - - - - 253.4 11 15 DENND1B DENN/MADD domain containing 1B 907 115 C20140707_OR007_01 C20140707_OR007_01 TB419579.[MT7]-QFLETAINLQLFK[MT7].2b6_1.heavy 927.042 / 834.448 3486.0 47.29819869995117 47 17 10 10 10 2.599192701823071 30.383478887534682 0.0 3 0.9758716716347549 7.929058653743431 3486.0 31.297161282593937 0.0 - - - - - - - 215.0 6 14 DENND1B DENN/MADD domain containing 1B 909 116 C20140707_OR007_01 C20140707_OR007_01 TB439275.[MT7]-FC[CAM]FPFDVER.2b3_1.heavy 680.827 / 599.277 10627.0 43.28609848022461 43 13 10 10 10 1.8271693943139942 43.39109033906723 0.0 3 0.9270319092255471 4.5406603788882975 10627.0 27.28095595107145 0.0 - - - - - - - 277.0833333333333 21 12 DENND1B;DENND1C DENN/MADD domain containing 1B;DENN/MADD domain containing 1C 911 116 C20140707_OR007_01 C20140707_OR007_01 TB439275.[MT7]-FC[CAM]FPFDVER.2y8_1.heavy 680.827 / 1069.48 20395.0 43.28609848022461 43 13 10 10 10 1.8271693943139942 43.39109033906723 0.0 3 0.9270319092255471 4.5406603788882975 20395.0 200.34343243276876 0.0 - - - - - - - 154.88888888888889 40 9 DENND1B;DENND1C DENN/MADD domain containing 1B;DENN/MADD domain containing 1C 913 116 C20140707_OR007_01 C20140707_OR007_01 TB439275.[MT7]-FC[CAM]FPFDVER.2y6_1.heavy 680.827 / 762.378 11486.0 43.28609848022461 43 13 10 10 10 1.8271693943139942 43.39109033906723 0.0 3 0.9270319092255471 4.5406603788882975 11486.0 116.36084000149333 0.0 - - - - - - - 268.3333333333333 22 6 DENND1B;DENND1C DENN/MADD domain containing 1B;DENN/MADD domain containing 1C 915 116 C20140707_OR007_01 C20140707_OR007_01 TB439275.[MT7]-FC[CAM]FPFDVER.2y7_1.heavy 680.827 / 909.446 5582.0 43.28609848022461 43 13 10 10 10 1.8271693943139942 43.39109033906723 0.0 3 0.9270319092255471 4.5406603788882975 5582.0 34.638555539506 0.0 - - - - - - - 214.7 11 10 DENND1B;DENND1C DENN/MADD domain containing 1B;DENN/MADD domain containing 1C 917 117 C20140707_OR007_01 C20140707_OR007_01 TB449599.[MT7]-NLLLAEVINIIK[MT7].3b6_1.heavy 547.69 / 798.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 919 117 C20140707_OR007_01 C20140707_OR007_01 TB449599.[MT7]-NLLLAEVINIIK[MT7].3b4_1.heavy 547.69 / 598.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 921 117 C20140707_OR007_01 C20140707_OR007_01 TB449599.[MT7]-NLLLAEVINIIK[MT7].3b5_1.heavy 547.69 / 669.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 923 117 C20140707_OR007_01 C20140707_OR007_01 TB449599.[MT7]-NLLLAEVINIIK[MT7].3y4_1.heavy 547.69 / 631.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 925 118 C20140707_OR007_01 C20140707_OR007_01 TB439418.[MT7]-DC[CAM]IFTIDPSTAR.2b3_1.heavy 770.383 / 533.251 4344.0 36.361900329589844 50 20 10 10 10 3.3824660598386425 21.384563848510194 0.0 3 0.9973877667329555 24.14136412685317 4344.0 5.709967426710097 0.0 - - - - - - - 329.0 8 4 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 927 118 C20140707_OR007_01 C20140707_OR007_01 TB439418.[MT7]-DC[CAM]IFTIDPSTAR.2y5_1.heavy 770.383 / 531.289 29748.0 36.361900329589844 50 20 10 10 10 3.3824660598386425 21.384563848510194 0.0 3 0.9973877667329555 24.14136412685317 29748.0 51.739365761413026 0.0 - - - - - - - 184.4 59 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 929 118 C20140707_OR007_01 C20140707_OR007_01 TB439418.[MT7]-DC[CAM]IFTIDPSTAR.2y9_1.heavy 770.383 / 1007.52 5265.0 36.361900329589844 50 20 10 10 10 3.3824660598386425 21.384563848510194 0.0 3 0.9973877667329555 24.14136412685317 5265.0 54.70498185274801 0.0 - - - - - - - 214.125 10 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 931 118 C20140707_OR007_01 C20140707_OR007_01 TB439418.[MT7]-DC[CAM]IFTIDPSTAR.2b7_2.heavy 770.383 / 505.243 2764.0 36.361900329589844 50 20 10 10 10 3.3824660598386425 21.384563848510194 0.0 3 0.9973877667329555 24.14136412685317 2764.0 1.9166777586408708 1.0 - - - - - - - 282.14285714285717 6 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 933 119 C20140707_OR007_01 C20140707_OR007_01 TB419628.[MT7]-ALLYEDALY[MT7]TVLHR.4y5_1.heavy 492.032 / 625.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 935 119 C20140707_OR007_01 C20140707_OR007_01 TB419628.[MT7]-ALLYEDALY[MT7]TVLHR.4y8_2.heavy 492.032 / 558.836 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 937 119 C20140707_OR007_01 C20140707_OR007_01 TB419628.[MT7]-ALLYEDALY[MT7]TVLHR.4b4_1.heavy 492.032 / 605.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 939 119 C20140707_OR007_01 C20140707_OR007_01 TB419628.[MT7]-ALLYEDALY[MT7]TVLHR.4b6_1.heavy 492.032 / 849.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 941 120 C20140707_OR007_01 C20140707_OR007_01 TB439272.[MT7]-TPC[CAM]YITGWGR.2y8_1.heavy 677.838 / 1012.47 5419.0 34.485599517822266 50 20 10 10 10 13.23403765554552 7.556272892883642 0.0 3 0.999672053687537 68.14737384049447 5419.0 82.14515873015873 0.0 - - - - - - - 252.0 10 6 CELA3A chymotrypsin-like elastase family, member 3A 943 120 C20140707_OR007_01 C20140707_OR007_01 TB439272.[MT7]-TPC[CAM]YITGWGR.2y5_1.heavy 677.838 / 576.289 3277.0 34.485599517822266 50 20 10 10 10 13.23403765554552 7.556272892883642 0.0 3 0.999672053687537 68.14737384049447 3277.0 2.1469494490656125 3.0 - - - - - - - 299.25 8 8 CELA3A chymotrypsin-like elastase family, member 3A 945 120 C20140707_OR007_01 C20140707_OR007_01 TB439272.[MT7]-TPC[CAM]YITGWGR.2y9_1.heavy 677.838 / 1109.52 28862.0 34.485599517822266 50 20 10 10 10 13.23403765554552 7.556272892883642 0.0 3 0.999672053687537 68.14737384049447 28862.0 114.35491179469675 1.0 - - - - - - - 252.0 65 6 CELA3A chymotrypsin-like elastase family, member 3A 947 120 C20140707_OR007_01 C20140707_OR007_01 TB439272.[MT7]-TPC[CAM]YITGWGR.2y7_1.heavy 677.838 / 852.436 4789.0 34.485599517822266 50 20 10 10 10 13.23403765554552 7.556272892883642 0.0 3 0.999672053687537 68.14737384049447 4789.0 18.953291005291007 0.0 - - - - - - - 224.0 9 9 CELA3A chymotrypsin-like elastase family, member 3A 949 121 C20140707_OR007_01 C20140707_OR007_01 TB418563.[MT7]-SQEPLSAWSPGK[MT7]K[MT7].4y5_1.heavy 462.515 / 804.518 1177.0 28.377500534057617 42 20 10 6 6 4.774789921880101 20.943329787507054 0.03459930419921875 5 0.9911148697373515 13.0830313312386 1177.0 20.897755102040815 0.0 - - - - - - - 220.5 2 8 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 951 121 C20140707_OR007_01 C20140707_OR007_01 TB418563.[MT7]-SQEPLSAWSPGK[MT7]K[MT7].4y4_1.heavy 462.515 / 717.486 1275.0 28.377500534057617 42 20 10 6 6 4.774789921880101 20.943329787507054 0.03459930419921875 5 0.9911148697373515 13.0830313312386 1275.0 2.4770519561536406 2.0 - - - - - - - 280.93333333333334 5 15 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 953 121 C20140707_OR007_01 C20140707_OR007_01 TB418563.[MT7]-SQEPLSAWSPGK[MT7]K[MT7].4b4_1.heavy 462.515 / 586.295 1177.0 28.377500534057617 42 20 10 6 6 4.774789921880101 20.943329787507054 0.03459930419921875 5 0.9911148697373515 13.0830313312386 1177.0 9.127755102040815 1.0 - - - - - - - 211.07692307692307 2 13 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 955 121 C20140707_OR007_01 C20140707_OR007_01 TB418563.[MT7]-SQEPLSAWSPGK[MT7]K[MT7].4b3_1.heavy 462.515 / 489.242 3825.0 28.377500534057617 42 20 10 6 6 4.774789921880101 20.943329787507054 0.03459930419921875 5 0.9911148697373515 13.0830313312386 3825.0 8.383917010913127 0.0 - - - - - - - 220.5 7 12 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 957 122 C20140707_OR007_01 C20140707_OR007_01 TB418176.[MT7]-TMVC[CAM]AGGYIR.2y8_1.heavy 636.321 / 895.445 3154.0 29.27994966506958 40 14 10 6 10 1.835791644748957 48.02364349146556 0.03619956970214844 3 0.938401212557179 4.946765705870975 3154.0 31.54485997149351 0.0 - - - - - - - 193.2 6 10 CELA3A chymotrypsin-like elastase family, member 3A 959 122 C20140707_OR007_01 C20140707_OR007_01 TB418176.[MT7]-TMVC[CAM]AGGYIR.2y9_1.heavy 636.321 / 1026.49 8546.0 29.27994966506958 40 14 10 6 10 1.835791644748957 48.02364349146556 0.03619956970214844 3 0.938401212557179 4.946765705870975 8546.0 93.87960302548538 0.0 - - - - - - - 175.72727272727272 17 11 CELA3A chymotrypsin-like elastase family, member 3A 961 122 C20140707_OR007_01 C20140707_OR007_01 TB418176.[MT7]-TMVC[CAM]AGGYIR.2b7_1.heavy 636.321 / 821.377 712.0 29.27994966506958 40 14 10 6 10 1.835791644748957 48.02364349146556 0.03619956970214844 3 0.938401212557179 4.946765705870975 712.0 1.119056974459725 7.0 - - - - - - - 0.0 1 0 CELA3A chymotrypsin-like elastase family, member 3A 963 122 C20140707_OR007_01 C20140707_OR007_01 TB418176.[MT7]-TMVC[CAM]AGGYIR.2y7_1.heavy 636.321 / 796.377 6613.0 29.27994966506958 40 14 10 6 10 1.835791644748957 48.02364349146556 0.03619956970214844 3 0.938401212557179 4.946765705870975 6613.0 29.704295081967214 0.0 - - - - - - - 231.27272727272728 13 11 CELA3A chymotrypsin-like elastase family, member 3A 965 123 C20140707_OR007_01 C20140707_OR007_01 TB439791.[MT7]-QNIHSLSPQEREQFLGALDLAK[MT7].4y4_1.heavy 696.383 / 590.363 44952.0 37.36130142211914 38 8 10 10 10 0.47744151779658695 94.49876768153759 0.0 3 0.7529815141194761 2.4300929169139853 44952.0 53.50397625147812 0.0 - - - - - - - 393.0 89 2 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 967 123 C20140707_OR007_01 C20140707_OR007_01 TB439791.[MT7]-QNIHSLSPQEREQFLGALDLAK[MT7].4b9_1.heavy 696.383 / 1149.61 4063.0 37.36130142211914 38 8 10 10 10 0.47744151779658695 94.49876768153759 0.0 3 0.7529815141194761 2.4300929169139853 4063.0 39.07923664122137 0.0 - - - - - - - 278.375 8 8 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 969 123 C20140707_OR007_01 C20140707_OR007_01 TB439791.[MT7]-QNIHSLSPQEREQFLGALDLAK[MT7].4b9_2.heavy 696.383 / 575.31 30012.0 37.36130142211914 38 8 10 10 10 0.47744151779658695 94.49876768153759 0.0 3 0.7529815141194761 2.4300929169139853 30012.0 17.39679423844381 1.0 - - - - - - - 327.5 60 4 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 971 123 C20140707_OR007_01 C20140707_OR007_01 TB439791.[MT7]-QNIHSLSPQEREQFLGALDLAK[MT7].4b3_1.heavy 696.383 / 500.295 9567.0 37.36130142211914 38 8 10 10 10 0.47744151779658695 94.49876768153759 0.0 3 0.7529815141194761 2.4300929169139853 9567.0 28.360190839694656 0.0 - - - - - - - 580.1428571428571 19 7 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 973 124 C20140707_OR007_01 C20140707_OR007_01 TB439697.[MT7]-ALLTGLLDLQARYPQFISR.3y7_1.heavy 773.782 / 910.478 400.0 47.91469955444336 38 12 10 6 10 1.7602185389550267 44.68627347096498 0.0337982177734375 3 0.8807403230157275 3.537543639164916 400.0 1.4 12.0 - - - - - - - 0.0 0 0 ABAT 4-aminobutyrate aminotransferase 975 124 C20140707_OR007_01 C20140707_OR007_01 TB439697.[MT7]-ALLTGLLDLQARYPQFISR.3y11_2.heavy 773.782 / 689.883 1119.0 47.91469955444336 38 12 10 6 10 1.7602185389550267 44.68627347096498 0.0337982177734375 3 0.8807403230157275 3.537543639164916 1119.0 2.9689 1.0 - - - - - - - 266.6666666666667 2 9 ABAT 4-aminobutyrate aminotransferase 977 124 C20140707_OR007_01 C20140707_OR007_01 TB439697.[MT7]-ALLTGLLDLQARYPQFISR.3b5_1.heavy 773.782 / 600.384 799.0 47.91469955444336 38 12 10 6 10 1.7602185389550267 44.68627347096498 0.0337982177734375 3 0.8807403230157275 3.537543639164916 799.0 3.329166666666667 4.0 - - - - - - - 0.0 1 0 ABAT 4-aminobutyrate aminotransferase 979 124 C20140707_OR007_01 C20140707_OR007_01 TB439697.[MT7]-ALLTGLLDLQARYPQFISR.3y16_2.heavy 773.782 / 939.515 2638.0 47.91469955444336 38 12 10 6 10 1.7602185389550267 44.68627347096498 0.0337982177734375 3 0.8807403230157275 3.537543639164916 2638.0 10.332166666666666 1.0 - - - - - - - 209.23076923076923 5 13 ABAT 4-aminobutyrate aminotransferase 981 125 C20140707_OR007_01 C20140707_OR007_01 TB419806.[MT7]-ILDDPSPAC[CAM]PHEEHLAALTAAPR.4y5_1.heavy 657.086 / 515.294 22917.0 31.80459976196289 48 18 10 10 10 2.3216664343434554 32.44771427416465 0.0 3 0.9895922755336826 12.08668177094852 22917.0 33.70678679408117 0.0 - - - - - - - 670.8571428571429 45 7 CPT1C carnitine palmitoyltransferase 1C 983 125 C20140707_OR007_01 C20140707_OR007_01 TB419806.[MT7]-ILDDPSPAC[CAM]PHEEHLAALTAAPR.4y8_1.heavy 657.086 / 770.452 16545.0 31.80459976196289 48 18 10 10 10 2.3216664343434554 32.44771427416465 0.0 3 0.9895922755336826 12.08668177094852 16545.0 26.78645534272874 0.0 - - - - - - - 304.8181818181818 33 11 CPT1C carnitine palmitoyltransferase 1C 985 125 C20140707_OR007_01 C20140707_OR007_01 TB419806.[MT7]-ILDDPSPAC[CAM]PHEEHLAALTAAPR.4b4_1.heavy 657.086 / 601.331 64615.0 31.80459976196289 48 18 10 10 10 2.3216664343434554 32.44771427416465 0.0 3 0.9895922755336826 12.08668177094852 64615.0 65.20542074935351 0.0 - - - - - - - 316.8333333333333 129 6 CPT1C carnitine palmitoyltransferase 1C 987 125 C20140707_OR007_01 C20140707_OR007_01 TB419806.[MT7]-ILDDPSPAC[CAM]PHEEHLAALTAAPR.4y7_1.heavy 657.086 / 699.415 14980.0 31.80459976196289 48 18 10 10 10 2.3216664343434554 32.44771427416465 0.0 3 0.9895922755336826 12.08668177094852 14980.0 59.761236728236206 0.0 - - - - - - - 245.9 29 10 CPT1C carnitine palmitoyltransferase 1C 989 126 C20140707_OR007_01 C20140707_OR007_01 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1108880.0 35.04949951171875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1108880.0 2082.8951511215787 0.0 - - - - - - - 176.4 2217 10 991 126 C20140707_OR007_01 C20140707_OR007_01 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 212393.0 35.04949951171875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 212393.0 238.3332609885494 0.0 - - - - - - - 229.0909090909091 424 11 993 126 C20140707_OR007_01 C20140707_OR007_01 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 339376.0 35.04949951171875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 339376.0 692.1818311900865 0.0 - - - - - - - 693.0 678 8 995 127 C20140707_OR007_01 C20140707_OR007_01 TB439131.[MT7]-QSAALC[CAM]LLR.2y8_1.heavy 588.338 / 903.508 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 997 127 C20140707_OR007_01 C20140707_OR007_01 TB439131.[MT7]-QSAALC[CAM]LLR.2b4_1.heavy 588.338 / 502.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 999 127 C20140707_OR007_01 C20140707_OR007_01 TB439131.[MT7]-QSAALC[CAM]LLR.2y6_1.heavy 588.338 / 745.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1001 127 C20140707_OR007_01 C20140707_OR007_01 TB439131.[MT7]-QSAALC[CAM]LLR.2y7_1.heavy 588.338 / 816.476 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1003 128 C20140707_OR007_01 C20140707_OR007_01 TB419567.[MT7]-GRLTEC[CAM]LETILNK[MT7].4b8_1.heavy 459.513 / 1103.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1005 128 C20140707_OR007_01 C20140707_OR007_01 TB419567.[MT7]-GRLTEC[CAM]LETILNK[MT7].4b8_2.heavy 459.513 / 552.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1007 128 C20140707_OR007_01 C20140707_OR007_01 TB419567.[MT7]-GRLTEC[CAM]LETILNK[MT7].4b5_1.heavy 459.513 / 701.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1009 128 C20140707_OR007_01 C20140707_OR007_01 TB419567.[MT7]-GRLTEC[CAM]LETILNK[MT7].4y3_1.heavy 459.513 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1011 129 C20140707_OR007_01 C20140707_OR007_01 TB439384.[MT7]-TMGC[CAM]LATTHSK[MT7].2y4_1.heavy 747.886 / 616.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 1013 129 C20140707_OR007_01 C20140707_OR007_01 TB439384.[MT7]-TMGC[CAM]LATTHSK[MT7].2y3_1.heavy 747.886 / 515.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 1015 129 C20140707_OR007_01 C20140707_OR007_01 TB439384.[MT7]-TMGC[CAM]LATTHSK[MT7].2y6_1.heavy 747.886 / 788.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 1017 129 C20140707_OR007_01 C20140707_OR007_01 TB439384.[MT7]-TMGC[CAM]LATTHSK[MT7].2y7_1.heavy 747.886 / 901.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 1019 130 C20140707_OR007_01 C20140707_OR007_01 TB419145.[MT7]-RGTLIQGVLR.3y3_1.heavy 419.602 / 387.271 2122.0 30.61287498474121 36 16 10 2 8 2.0815841641222437 48.04033472370679 0.081298828125 4 0.9656677934177631 6.641422232346446 2122.0 5.278501970505504 1.0 - - - - - - - 279.25 4 12 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1021 130 C20140707_OR007_01 C20140707_OR007_01 TB419145.[MT7]-RGTLIQGVLR.3b3_2.heavy 419.602 / 230.143 3016.0 30.61287498474121 36 16 10 2 8 2.0815841641222437 48.04033472370679 0.081298828125 4 0.9656677934177631 6.641422232346446 3016.0 4.228328116018658 2.0 - - - - - - - 307.0 6 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1023 130 C20140707_OR007_01 C20140707_OR007_01 TB419145.[MT7]-RGTLIQGVLR.3y4_1.heavy 419.602 / 444.293 18208.0 30.61287498474121 36 16 10 2 8 2.0815841641222437 48.04033472370679 0.081298828125 4 0.9656677934177631 6.641422232346446 18208.0 119.28677633651347 0.0 - - - - - - - 372.3333333333333 36 3 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1025 130 C20140707_OR007_01 C20140707_OR007_01 TB419145.[MT7]-RGTLIQGVLR.3b3_1.heavy 419.602 / 459.28 3463.0 30.61287498474121 36 16 10 2 8 2.0815841641222437 48.04033472370679 0.081298828125 4 0.9656677934177631 6.641422232346446 3463.0 14.028479701871499 1.0 - - - - - - - 269.6666666666667 6 12 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1027 131 C20140707_OR007_01 C20140707_OR007_01 TB439524.[MT7]-LDSQPQETSPELPR.2y10_1.heavy 870.948 / 1153.58 9412.0 28.230074882507324 31 10 10 3 8 1.1315897911962154 53.693166564431564 0.06949996948242188 4 0.8258793490246853 2.913561506579555 9412.0 23.289897959183673 0.0 - - - - - - - 206.88888888888889 18 9 TRAFD1 TRAF-type zinc finger domain containing 1 1029 131 C20140707_OR007_01 C20140707_OR007_01 TB439524.[MT7]-LDSQPQETSPELPR.2y5_1.heavy 870.948 / 611.351 1765.0 28.230074882507324 31 10 10 3 8 1.1315897911962154 53.693166564431564 0.06949996948242188 4 0.8258793490246853 2.913561506579555 1765.0 3.94492571190691 1.0 - - - - - - - 196.0 4 12 TRAFD1 TRAF-type zinc finger domain containing 1 1031 131 C20140707_OR007_01 C20140707_OR007_01 TB439524.[MT7]-LDSQPQETSPELPR.2b4_1.heavy 870.948 / 588.311 12746.0 28.230074882507324 31 10 10 3 8 1.1315897911962154 53.693166564431564 0.06949996948242188 4 0.8258793490246853 2.913561506579555 12746.0 64.96558163265306 0.0 - - - - - - - 196.0 25 9 TRAFD1 TRAF-type zinc finger domain containing 1 1033 131 C20140707_OR007_01 C20140707_OR007_01 TB439524.[MT7]-LDSQPQETSPELPR.2y7_1.heavy 870.948 / 799.431 1667.0 28.230074882507324 31 10 10 3 8 1.1315897911962154 53.693166564431564 0.06949996948242188 4 0.8258793490246853 2.913561506579555 1667.0 4.831752869662278 1.0 - - - - - - - 196.0 4 11 TRAFD1 TRAF-type zinc finger domain containing 1 1035 132 C20140707_OR007_01 C20140707_OR007_01 TB439383.[MT7]-EQFLGALDLAK[MT7].2y4_1.heavy 746.934 / 590.363 1895.0 40.80160140991211 48 18 10 10 10 3.597084004601598 27.80029598198825 0.0 3 0.982875055243605 9.41729234679914 1895.0 3.9431997693387952 1.0 - - - - - - - 315.8333333333333 4 6 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1037 132 C20140707_OR007_01 C20140707_OR007_01 TB439383.[MT7]-EQFLGALDLAK[MT7].2b3_1.heavy 746.934 / 549.279 4873.0 40.80160140991211 48 18 10 10 10 3.597084004601598 27.80029598198825 0.0 3 0.982875055243605 9.41729234679914 4873.0 43.889006568144495 0.0 - - - - - - - 293.1666666666667 9 6 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1039 132 C20140707_OR007_01 C20140707_OR007_01 TB439383.[MT7]-EQFLGALDLAK[MT7].2b4_1.heavy 746.934 / 662.363 3249.0 40.80160140991211 48 18 10 10 10 3.597084004601598 27.80029598198825 0.0 3 0.982875055243605 9.41729234679914 3249.0 5.34 0.0 - - - - - - - 285.6666666666667 6 9 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1041 132 C20140707_OR007_01 C20140707_OR007_01 TB439383.[MT7]-EQFLGALDLAK[MT7].2y7_1.heavy 746.934 / 831.506 4196.0 40.80160140991211 48 18 10 10 10 3.597084004601598 27.80029598198825 0.0 3 0.982875055243605 9.41729234679914 4196.0 37.81323628397344 0.0 - - - - - - - 202.75 8 4 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1043 133 C20140707_OR007_01 C20140707_OR007_01 TB419650.[MT7]-AEADTFMFGGHDTTASGLSWVLYNLAR.3b6_1.heavy 1025.5 / 779.369 1278.0 51.647701263427734 37 17 2 10 8 3.117154478907199 25.27996200266875 0.0 4 0.972352429616588 7.405053045421355 1278.0 9.653201970443352 0.0 - - - - - - - 217.5625 2 16 CYP4F8;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 12 1045 133 C20140707_OR007_01 C20140707_OR007_01 TB419650.[MT7]-AEADTFMFGGHDTTASGLSWVLYNLAR.3b5_1.heavy 1025.5 / 632.301 697.0 51.647701263427734 37 17 2 10 8 3.117154478907199 25.27996200266875 0.0 4 0.972352429616588 7.405053045421355 697.0 7.731091954022988 0.0 - - - - - - - 0.0 1 0 CYP4F8;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 12 1047 133 C20140707_OR007_01 C20140707_OR007_01 TB419650.[MT7]-AEADTFMFGGHDTTASGLSWVLYNLAR.3b12_2.heavy 1025.5 / 712.307 813.0 51.647701263427734 37 17 2 10 8 3.117154478907199 25.27996200266875 0.0 4 0.972352429616588 7.405053045421355 813.0 3.3040640394088667 2.0 - - - - - - - 214.15384615384616 7 13 CYP4F8;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 12 1049 133 C20140707_OR007_01 C20140707_OR007_01 TB419650.[MT7]-AEADTFMFGGHDTTASGLSWVLYNLAR.3y9_1.heavy 1025.5 / 1121.61 1742.0 51.647701263427734 37 17 2 10 8 3.117154478907199 25.27996200266875 0.0 4 0.972352429616588 7.405053045421355 1742.0 14.01609195402299 0.0 - - - - - - - 201.06666666666666 3 15 CYP4F8;CYP4F12 cytochrome P450, family 4, subfamily F, polypeptide 8;cytochrome P450, family 4, subfamily F, polypeptide 12 1051 134 C20140707_OR007_01 C20140707_OR007_01 TB418530.[MT7]-GLAVFISDIRNC[CAM]K[MT7].3y7_1.heavy 594.338 / 1036.53 3319.0 41.65330123901367 37 12 10 5 10 2.287255052941586 43.72052861852565 0.0467987060546875 3 0.8978070684675932 3.8272086856735474 3319.0 16.976088187335808 0.0 - - - - - - - 166.25 6 8 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1053 134 C20140707_OR007_01 C20140707_OR007_01 TB418530.[MT7]-GLAVFISDIRNC[CAM]K[MT7].3y3_1.heavy 594.338 / 565.288 2655.0 41.65330123901367 37 12 10 5 10 2.287255052941586 43.72052861852565 0.0467987060546875 3 0.8978070684675932 3.8272086856735474 2655.0 6.170423727532464 0.0 - - - - - - - 265.75 5 8 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1055 134 C20140707_OR007_01 C20140707_OR007_01 TB418530.[MT7]-GLAVFISDIRNC[CAM]K[MT7].3b5_1.heavy 594.338 / 632.389 6506.0 41.65330123901367 37 12 10 5 10 2.287255052941586 43.72052861852565 0.0467987060546875 3 0.8978070684675932 3.8272086856735474 6506.0 28.109894184614078 0.0 - - - - - - - 243.66666666666666 13 6 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1057 134 C20140707_OR007_01 C20140707_OR007_01 TB418530.[MT7]-GLAVFISDIRNC[CAM]K[MT7].3y5_1.heavy 594.338 / 834.474 2523.0 41.65330123901367 37 12 10 5 10 2.287255052941586 43.72052861852565 0.0467987060546875 3 0.8978070684675932 3.8272086856735474 2523.0 22.778208712736618 0.0 - - - - - - - 212.6 5 5 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1059 135 C20140707_OR007_01 C20140707_OR007_01 TB418531.[MT7]-GLAVFISDIRNC[CAM]K[MT7].4y8_2.heavy 446.005 / 575.312 1722.0 41.65330123901367 18 7 0 5 6 0.5688002040569087 91.09706051832589 0.0467987060546875 5 0.7462023225617184 2.3959254045650202 1722.0 18.893756432247 0.0 - - - - - - - 331.0 3 2 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1061 135 C20140707_OR007_01 C20140707_OR007_01 TB418531.[MT7]-GLAVFISDIRNC[CAM]K[MT7].4b4_1.heavy 446.005 / 485.32 1060.0 41.65330123901367 18 7 0 5 6 0.5688002040569087 91.09706051832589 0.0467987060546875 5 0.7462023225617184 2.3959254045650202 1060.0 9.990151515151517 1.0 - - - - - - - 198.33333333333334 2 6 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1063 135 C20140707_OR007_01 C20140707_OR007_01 TB418531.[MT7]-GLAVFISDIRNC[CAM]K[MT7].4y3_1.heavy 446.005 / 565.288 265.0 41.65330123901367 18 7 0 5 6 0.5688002040569087 91.09706051832589 0.0467987060546875 5 0.7462023225617184 2.3959254045650202 265.0 -0.04015151515151527 2.0 - - - - - - - 0.0 1 0 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1065 135 C20140707_OR007_01 C20140707_OR007_01 TB418531.[MT7]-GLAVFISDIRNC[CAM]K[MT7].4y7_2.heavy 446.005 / 518.77 3180.0 41.65330123901367 18 7 0 5 6 0.5688002040569087 91.09706051832589 0.0467987060546875 5 0.7462023225617184 2.3959254045650202 3180.0 36.09090909090909 1.0 - - - - - - - 397.0 46 2 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1067 136 C20140707_OR007_01 C20140707_OR007_01 TB419049.[MT7]-ALEQQFQR.2y5_1.heavy 582.318 / 706.363 9538.0 25.996400833129883 48 18 10 10 10 17.445598893074823 5.732104733859027 0.0 3 0.986331939979325 10.544185150884447 9538.0 171.684 0.0 - - - - - - - 150.41666666666666 19 12 CPT1C carnitine palmitoyltransferase 1C 1069 136 C20140707_OR007_01 C20140707_OR007_01 TB419049.[MT7]-ALEQQFQR.2b4_1.heavy 582.318 / 586.332 3113.0 25.996400833129883 48 18 10 10 10 17.445598893074823 5.732104733859027 0.0 3 0.986331939979325 10.544185150884447 3113.0 17.92415447655039 0.0 - - - - - - - 662.7 6 10 CPT1C carnitine palmitoyltransferase 1C 1071 136 C20140707_OR007_01 C20140707_OR007_01 TB419049.[MT7]-ALEQQFQR.2y6_1.heavy 582.318 / 835.406 8936.0 25.996400833129883 48 18 10 10 10 17.445598893074823 5.732104733859027 0.0 3 0.986331939979325 10.544185150884447 8936.0 84.35827173516623 1.0 - - - - - - - 225.75 17 8 CPT1C carnitine palmitoyltransferase 1C 1073 136 C20140707_OR007_01 C20140707_OR007_01 TB419049.[MT7]-ALEQQFQR.2y7_1.heavy 582.318 / 948.49 17872.0 25.996400833129883 48 18 10 10 10 17.445598893074823 5.732104733859027 0.0 3 0.986331939979325 10.544185150884447 17872.0 57.42742837883384 0.0 - - - - - - - 228.0909090909091 35 11 CPT1C carnitine palmitoyltransferase 1C 1075 137 C20140707_OR007_01 C20140707_OR007_01 TB449463.[MT7]-ILYMAAETAK[MT7].3b4_1.heavy 466.935 / 665.381 14165.0 35.5989990234375 40 10 10 10 10 1.4659492277285893 46.828603775488475 0.0 3 0.8263887900338376 2.917965507642801 14165.0 152.68070973412438 0.0 - - - - - - - 184.75 28 4 GLYAT glycine-N-acyltransferase 1077 137 C20140707_OR007_01 C20140707_OR007_01 TB449463.[MT7]-ILYMAAETAK[MT7].3b5_1.heavy 466.935 / 736.418 12810.0 35.5989990234375 40 10 10 10 10 1.4659492277285893 46.828603775488475 0.0 3 0.8263887900338376 2.917965507642801 12810.0 141.6390243902439 0.0 - - - - - - - 164.0 25 3 GLYAT glycine-N-acyltransferase 1079 137 C20140707_OR007_01 C20140707_OR007_01 TB449463.[MT7]-ILYMAAETAK[MT7].3y4_1.heavy 466.935 / 592.342 13426.0 35.5989990234375 40 10 10 10 10 1.4659492277285893 46.828603775488475 0.0 3 0.8263887900338376 2.917965507642801 13426.0 53.34996754563895 0.0 - - - - - - - 431.5 26 4 GLYAT glycine-N-acyltransferase 1081 137 C20140707_OR007_01 C20140707_OR007_01 TB449463.[MT7]-ILYMAAETAK[MT7].3b3_1.heavy 466.935 / 534.341 10716.0 35.5989990234375 40 10 10 10 10 1.4659492277285893 46.828603775488475 0.0 3 0.8263887900338376 2.917965507642801 10716.0 121.97073170731707 0.0 - - - - - - - 246.33333333333334 21 3 GLYAT glycine-N-acyltransferase 1083 138 C20140707_OR007_01 C20140707_OR007_01 TB418806.[MT7]-DVSGFSDPYC[CAM]LLGIEQGVGVPGGSPGSR.3y12_1.heavy 984.482 / 1026.53 7781.0 44.679348945617676 40 16 10 6 8 3.047794098637822 24.69307726502035 0.037403106689453125 4 0.9617557806957231 6.290505656350022 7781.0 39.79704499299602 0.0 - - - - - - - 278.0 15 14 UNC13D unc-13 homolog D (C. elegans) 1085 138 C20140707_OR007_01 C20140707_OR007_01 TB418806.[MT7]-DVSGFSDPYC[CAM]LLGIEQGVGVPGGSPGSR.3y8_1.heavy 984.482 / 714.353 37708.0 44.679348945617676 40 16 10 6 8 3.047794098637822 24.69307726502035 0.037403106689453125 4 0.9617557806957231 6.290505656350022 37708.0 49.532659519966906 0.0 - - - - - - - 270.85714285714283 75 7 UNC13D unc-13 homolog D (C. elegans) 1087 138 C20140707_OR007_01 C20140707_OR007_01 TB418806.[MT7]-DVSGFSDPYC[CAM]LLGIEQGVGVPGGSPGSR.3b7_1.heavy 984.482 / 852.386 23443.0 44.679348945617676 40 16 10 6 8 3.047794098637822 24.69307726502035 0.037403106689453125 4 0.9617557806957231 6.290505656350022 23443.0 145.40530534223706 0.0 - - - - - - - 259.5 46 10 UNC13D unc-13 homolog D (C. elegans) 1089 138 C20140707_OR007_01 C20140707_OR007_01 TB418806.[MT7]-DVSGFSDPYC[CAM]LLGIEQGVGVPGGSPGSR.3y10_1.heavy 984.482 / 870.443 7881.0 44.679348945617676 40 16 10 6 8 3.047794098637822 24.69307726502035 0.037403106689453125 4 0.9617557806957231 6.290505656350022 7881.0 37.8288 1.0 - - - - - - - 299.46153846153845 22 13 UNC13D unc-13 homolog D (C. elegans) 1091 139 C20140707_OR007_01 C20140707_OR007_01 TB439286.[MT7]-NIGMC[CAM]PTC[CAM]K[MT7].2y4_1.heavy 684.837 / 649.346 10950.0 23.87420082092285 43 13 10 10 10 1.4459757889890386 55.053857501556486 0.0 3 0.9179218382081467 4.277916594210947 10950.0 99.15437487028603 0.0 - - - - - - - 185.66666666666666 21 6 TRAFD1 TRAF-type zinc finger domain containing 1 1093 139 C20140707_OR007_01 C20140707_OR007_01 TB439286.[MT7]-NIGMC[CAM]PTC[CAM]K[MT7].2y5_1.heavy 684.837 / 809.377 4461.0 23.87420082092285 43 13 10 10 10 1.4459757889890386 55.053857501556486 0.0 3 0.9179218382081467 4.277916594210947 4461.0 10.364861128683067 1.0 - - - - - - - 236.66666666666666 9 6 TRAFD1 TRAF-type zinc finger domain containing 1 1095 139 C20140707_OR007_01 C20140707_OR007_01 TB439286.[MT7]-NIGMC[CAM]PTC[CAM]K[MT7].2y3_1.heavy 684.837 / 552.293 1115.0 23.87420082092285 43 13 10 10 10 1.4459757889890386 55.053857501556486 0.0 3 0.9179218382081467 4.277916594210947 1115.0 9.666995073891625 1.0 - - - - - - - 223.1 2 10 TRAFD1 TRAF-type zinc finger domain containing 1 1097 139 C20140707_OR007_01 C20140707_OR007_01 TB439286.[MT7]-NIGMC[CAM]PTC[CAM]K[MT7].2y7_1.heavy 684.837 / 997.439 10848.0 23.87420082092285 43 13 10 10 10 1.4459757889890386 55.053857501556486 0.0 3 0.9179218382081467 4.277916594210947 10848.0 86.98158154005704 0.0 - - - - - - - 202.66666666666666 21 3 TRAFD1 TRAF-type zinc finger domain containing 1 1099 140 C20140707_OR007_01 C20140707_OR007_01 TB439667.[MT7]-GVSAVAGPHDIGASPGDK[MT7]K[MT7].4y5_1.heavy 549.559 / 832.513 10934.0 23.056299209594727 43 13 10 10 10 1.2402697449414195 46.27984384343152 0.0 3 0.9282826287022293 4.5805732526731155 10934.0 162.88278350515463 0.0 - - - - - - - 207.57142857142858 21 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1101 140 C20140707_OR007_01 C20140707_OR007_01 TB439667.[MT7]-GVSAVAGPHDIGASPGDK[MT7]K[MT7].4b7_1.heavy 549.559 / 686.395 15578.0 23.056299209594727 43 13 10 10 10 1.2402697449414195 46.27984384343152 0.0 3 0.9282826287022293 4.5805732526731155 15578.0 84.3083081172592 0.0 - - - - - - - 258.0 31 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1103 140 C20140707_OR007_01 C20140707_OR007_01 TB439667.[MT7]-GVSAVAGPHDIGASPGDK[MT7]K[MT7].4b5_1.heavy 549.559 / 558.337 20513.0 23.056299209594727 43 13 10 10 10 1.2402697449414195 46.27984384343152 0.0 3 0.9282826287022293 4.5805732526731155 20513.0 117.0226165018266 0.0 - - - - - - - 281.6363636363636 41 11 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1105 140 C20140707_OR007_01 C20140707_OR007_01 TB439667.[MT7]-GVSAVAGPHDIGASPGDK[MT7]K[MT7].4b10_2.heavy 549.559 / 518.271 22932.0 23.056299209594727 43 13 10 10 10 1.2402697449414195 46.27984384343152 0.0 3 0.9282826287022293 4.5805732526731155 22932.0 98.105100903325 0.0 - - - - - - - 290.375 45 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1107 141 C20140707_OR007_01 C20140707_OR007_01 TB439664.[MT7]-EIPVFNFTIHEIHC[CAM]QR.3y7_1.heavy 728.71 / 979.453 5179.0 39.52425003051758 45 20 10 5 10 5.210714383225776 19.191226508579696 0.04689788818359375 3 0.9917400486909926 13.56982462165974 5179.0 12.40611028269649 0.0 - - - - - - - 240.0 10 7 TRAFD1 TRAF-type zinc finger domain containing 1 1109 141 C20140707_OR007_01 C20140707_OR007_01 TB439664.[MT7]-EIPVFNFTIHEIHC[CAM]QR.3y6_1.heavy 728.71 / 842.394 4339.0 39.52425003051758 45 20 10 5 10 5.210714383225776 19.191226508579696 0.04689788818359375 3 0.9917400486909926 13.56982462165974 4339.0 33.54976785714286 0.0 - - - - - - - 140.0 8 5 TRAFD1 TRAF-type zinc finger domain containing 1 1111 141 C20140707_OR007_01 C20140707_OR007_01 TB439664.[MT7]-EIPVFNFTIHEIHC[CAM]QR.3b4_1.heavy 728.71 / 583.357 5039.0 39.52425003051758 45 20 10 5 10 5.210714383225776 19.191226508579696 0.04689788818359375 3 0.9917400486909926 13.56982462165974 5039.0 15.692885714285712 0.0 - - - - - - - 350.0 10 2 TRAFD1 TRAF-type zinc finger domain containing 1 1113 141 C20140707_OR007_01 C20140707_OR007_01 TB439664.[MT7]-EIPVFNFTIHEIHC[CAM]QR.3y5_1.heavy 728.71 / 713.351 3219.0 39.52425003051758 45 20 10 5 10 5.210714383225776 19.191226508579696 0.04689788818359375 3 0.9917400486909926 13.56982462165974 3219.0 14.715428571428571 0.0 - - - - - - - 262.5 6 8 TRAFD1 TRAF-type zinc finger domain containing 1 1115 142 C20140707_OR007_01 C20140707_OR007_01 TB419052.[MT7]-EDVSEGLK[MT7].2y5_1.heavy 582.821 / 677.395 11407.0 22.88279914855957 46 18 10 10 8 3.9213497822804735 20.25516916263981 0.0 4 0.9844570980978394 9.886263704413269 11407.0 23.958331958259734 0.0 - - - - - - - 251.2 22 15 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1117 142 C20140707_OR007_01 C20140707_OR007_01 TB419052.[MT7]-EDVSEGLK[MT7].2b6_1.heavy 582.821 / 761.343 2381.0 22.88279914855957 46 18 10 10 8 3.9213497822804735 20.25516916263981 0.0 4 0.9844570980978394 9.886263704413269 2381.0 13.607097823876348 0.0 - - - - - - - 173.375 4 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1119 142 C20140707_OR007_01 C20140707_OR007_01 TB419052.[MT7]-EDVSEGLK[MT7].2y6_1.heavy 582.821 / 776.463 6249.0 22.88279914855957 46 18 10 10 8 3.9213497822804735 20.25516916263981 0.0 4 0.9844570980978394 9.886263704413269 6249.0 25.059815871419453 0.0 - - - - - - - 216.36363636363637 12 11 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1121 142 C20140707_OR007_01 C20140707_OR007_01 TB419052.[MT7]-EDVSEGLK[MT7].2y7_1.heavy 582.821 / 891.49 8927.0 22.88279914855957 46 18 10 10 8 3.9213497822804735 20.25516916263981 0.0 4 0.9844570980978394 9.886263704413269 8927.0 72.94818209341372 1.0 - - - - - - - 207.27272727272728 22 11 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1123 143 C20140707_OR007_01 C20140707_OR007_01 TB419243.[MT7]-AFESDVFHNR.2y5_1.heavy 683.337 / 672.358 1892.0 29.144424438476562 26 17 0 3 6 2.6402096964662793 30.104508305917484 0.07229995727539062 5 0.9717974093916146 7.3314835344723885 1892.0 11.298828720359328 1.0 - - - - - - - 205.11764705882354 3 17 TRAFD1 TRAF-type zinc finger domain containing 1 1125 143 C20140707_OR007_01 C20140707_OR007_01 TB419243.[MT7]-AFESDVFHNR.2y9_1.heavy 683.337 / 1150.53 2589.0 29.144424438476562 26 17 0 3 6 2.6402096964662793 30.104508305917484 0.07229995727539062 5 0.9717974093916146 7.3314835344723885 2589.0 25.43464824120603 1.0 - - - - - - - 222.30769230769232 20 13 TRAFD1 TRAF-type zinc finger domain containing 1 1127 143 C20140707_OR007_01 C20140707_OR007_01 TB419243.[MT7]-AFESDVFHNR.2b5_1.heavy 683.337 / 694.316 1394.0 29.144424438476562 26 17 0 3 6 2.6402096964662793 30.104508305917484 0.07229995727539062 5 0.9717974093916146 7.3314835344723885 1394.0 5.604020100502513 2.0 - - - - - - - 210.33333333333334 3 9 TRAFD1 TRAF-type zinc finger domain containing 1 1129 143 C20140707_OR007_01 C20140707_OR007_01 TB419243.[MT7]-AFESDVFHNR.2y7_1.heavy 683.337 / 874.417 1394.0 29.144424438476562 26 17 0 3 6 2.6402096964662793 30.104508305917484 0.07229995727539062 5 0.9717974093916146 7.3314835344723885 1394.0 1.8648829431438128 2.0 - - - - - - - 199.3 2 10 TRAFD1 TRAF-type zinc finger domain containing 1 1131 144 C20140707_OR007_01 C20140707_OR007_01 TB419555.[MT7]-THPEVC[CAM]GREGEEK[MT7].4y5_1.heavy 454.728 / 735.364 766.0 16.51889991760254 48 18 10 10 10 4.4615112713854845 22.413929701660454 0.0 3 0.986472147470859 10.598810603210005 766.0 11.644519803087938 0.0 - - - - - - - 0.0 1 0 TRAFD1 TRAF-type zinc finger domain containing 1 1133 144 C20140707_OR007_01 C20140707_OR007_01 TB419555.[MT7]-THPEVC[CAM]GREGEEK[MT7].4y8_2.heavy 454.728 / 554.762 7172.0 16.51889991760254 48 18 10 10 10 4.4615112713854845 22.413929701660454 0.0 3 0.986472147470859 10.598810603210005 7172.0 83.42245905073102 0.0 - - - - - - - 155.16666666666666 14 12 TRAFD1 TRAF-type zinc finger domain containing 1 1135 144 C20140707_OR007_01 C20140707_OR007_01 TB419555.[MT7]-THPEVC[CAM]GREGEEK[MT7].4y10_2.heavy 454.728 / 668.818 6734.0 16.51889991760254 48 18 10 10 10 4.4615112713854845 22.413929701660454 0.0 3 0.986472147470859 10.598810603210005 6734.0 133.78630391506306 0.0 - - - - - - - 180.0 13 7 TRAFD1 TRAF-type zinc finger domain containing 1 1137 144 C20140707_OR007_01 C20140707_OR007_01 TB419555.[MT7]-THPEVC[CAM]GREGEEK[MT7].4y11_2.heavy 454.728 / 717.344 1095.0 16.51889991760254 48 18 10 10 10 4.4615112713854845 22.413929701660454 0.0 3 0.986472147470859 10.598810603210005 1095.0 22.015454545454546 0.0 - - - - - - - 200.83333333333334 2 6 TRAFD1 TRAF-type zinc finger domain containing 1 1139 145 C20140707_OR007_01 C20140707_OR007_01 TB449323.[MT7]-LC[CAM]ELLSAQF.2b3_1.heavy 612.824 / 547.267 745.0 47.345075607299805 31 5 10 6 10 2.822846494326605 35.42523484751344 0.03749847412109375 3 0.6811164162118808 2.124538106408769 745.0 8.010752688172044 8.0 - - - - - - - 186.0 2 6 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1141 145 C20140707_OR007_01 C20140707_OR007_01 TB449323.[MT7]-LC[CAM]ELLSAQF.2b4_1.heavy 612.824 / 660.351 5492.0 47.345075607299805 31 5 10 6 10 2.822846494326605 35.42523484751344 0.03749847412109375 3 0.6811164162118808 2.124538106408769 5492.0 46.06193548387097 1.0 - - - - - - - 165.33333333333334 10 9 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1143 145 C20140707_OR007_01 C20140707_OR007_01 TB449323.[MT7]-LC[CAM]ELLSAQF.2b6_1.heavy 612.824 / 860.467 1768.0 47.345075607299805 31 5 10 6 10 2.822846494326605 35.42523484751344 0.03749847412109375 3 0.6811164162118808 2.124538106408769 1768.0 17.109677419354842 0.0 - - - - - - - 217.0 3 9 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1145 145 C20140707_OR007_01 C20140707_OR007_01 TB449323.[MT7]-LC[CAM]ELLSAQF.2b5_1.heavy 612.824 / 773.435 2513.0 47.345075607299805 31 5 10 6 10 2.822846494326605 35.42523484751344 0.03749847412109375 3 0.6811164162118808 2.124538106408769 2513.0 4.5800430107526875 1.0 - - - - - - - 361.6666666666667 5 9 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1147 146 C20140707_OR007_01 C20140707_OR007_01 TB419556.[MT7]-VDVEFDYDGPLMK[MT7].3y3_1.heavy 605.974 / 535.339 19485.0 40.02690124511719 48 18 10 10 10 4.048800064690148 19.532597778060694 0.0 3 0.9864641008001679 10.59565266296937 19485.0 66.94665461121156 0.0 - - - - - - - 691.0 38 7 ABAT 4-aminobutyrate aminotransferase 1149 146 C20140707_OR007_01 C20140707_OR007_01 TB419556.[MT7]-VDVEFDYDGPLMK[MT7].3b6_1.heavy 605.974 / 849.411 27638.0 40.02690124511719 48 18 10 10 10 4.048800064690148 19.532597778060694 0.0 3 0.9864641008001679 10.59565266296937 27638.0 128.92110551815264 0.0 - - - - - - - 276.22222222222223 55 9 ABAT 4-aminobutyrate aminotransferase 1151 146 C20140707_OR007_01 C20140707_OR007_01 TB419556.[MT7]-VDVEFDYDGPLMK[MT7].3b4_1.heavy 605.974 / 587.316 39246.0 40.02690124511719 48 18 10 10 10 4.048800064690148 19.532597778060694 0.0 3 0.9864641008001679 10.59565266296937 39246.0 48.69183655590974 0.0 - - - - - - - 304.0 78 5 ABAT 4-aminobutyrate aminotransferase 1153 146 C20140707_OR007_01 C20140707_OR007_01 TB419556.[MT7]-VDVEFDYDGPLMK[MT7].3y5_1.heavy 605.974 / 689.414 13543.0 40.02690124511719 48 18 10 10 10 4.048800064690148 19.532597778060694 0.0 3 0.9864641008001679 10.59565266296937 13543.0 25.368463547349254 0.0 - - - - - - - 241.625 27 8 ABAT 4-aminobutyrate aminotransferase 1155 147 C20140707_OR007_01 C20140707_OR007_01 TB419559.[MT7]-ALLYEDALYTVLHR.3y6_1.heavy 607.672 / 788.441 91767.0 46.6692008972168 46 16 10 10 10 1.7360865431448793 41.031746110688715 0.0 3 0.9605752993966403 6.194994339220146 91767.0 328.2920083601441 0.0 - - - - - - - 200.45454545454547 183 11 UNC13D unc-13 homolog D (C. elegans) 1157 147 C20140707_OR007_01 C20140707_OR007_01 TB419559.[MT7]-ALLYEDALYTVLHR.3b6_1.heavy 607.672 / 849.447 67935.0 46.6692008972168 46 16 10 10 10 1.7360865431448793 41.031746110688715 0.0 3 0.9605752993966403 6.194994339220146 67935.0 191.2762340384982 0.0 - - - - - - - 212.0 135 4 UNC13D unc-13 homolog D (C. elegans) 1159 147 C20140707_OR007_01 C20140707_OR007_01 TB419559.[MT7]-ALLYEDALYTVLHR.3b7_1.heavy 607.672 / 920.485 67087.0 46.6692008972168 46 16 10 10 10 1.7360865431448793 41.031746110688715 0.0 3 0.9605752993966403 6.194994339220146 67087.0 514.5765950537385 0.0 - - - - - - - 240.5 134 6 UNC13D unc-13 homolog D (C. elegans) 1161 147 C20140707_OR007_01 C20140707_OR007_01 TB419559.[MT7]-ALLYEDALYTVLHR.3y5_1.heavy 607.672 / 625.378 106949.0 46.6692008972168 46 16 10 10 10 1.7360865431448793 41.031746110688715 0.0 3 0.9605752993966403 6.194994339220146 106949.0 1295.2580332963375 0.0 - - - - - - - 233.0 213 8 UNC13D unc-13 homolog D (C. elegans) 1163 148 C20140707_OR007_01 C20140707_OR007_01 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 24451.0 22.631500244140625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 24451.0 192.62450136588984 0.0 - - - - - - - 226.0 48 11 1165 148 C20140707_OR007_01 C20140707_OR007_01 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 22960.0 22.631500244140625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 22960.0 454.56161616161614 0.0 - - - - - - - 165.66666666666666 45 3 1167 148 C20140707_OR007_01 C20140707_OR007_01 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 89356.0 22.631500244140625 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 89356.0 591.086917889245 0.0 - - - - - - - 265.0 178 9 1169 149 C20140707_OR007_01 C20140707_OR007_01 TB419343.[MT7]-LSNSDSQDIQGR.3b4_1.heavy 488.578 / 546.3 10886.0 23.347000122070312 30 5 10 5 10 0.38442515012815953 113.4601882157781 0.04409980773925781 3 0.679145962649166 2.117609559297442 10886.0 -0.8176509247957938 1.0 - - - - - - - 192.69230769230768 21 13 TRAFD1 TRAF-type zinc finger domain containing 1 1171 149 C20140707_OR007_01 C20140707_OR007_01 TB419343.[MT7]-LSNSDSQDIQGR.3b5_1.heavy 488.578 / 661.327 66018.0 23.347000122070312 30 5 10 5 10 0.38442515012815953 113.4601882157781 0.04409980773925781 3 0.679145962649166 2.117609559297442 66018.0 -0.280927659574445 0.0 - - - - - - - 226.11111111111111 132 9 TRAFD1 TRAF-type zinc finger domain containing 1 1173 149 C20140707_OR007_01 C20140707_OR007_01 TB419343.[MT7]-LSNSDSQDIQGR.3y4_1.heavy 488.578 / 473.283 3916.0 23.347000122070312 30 5 10 5 10 0.38442515012815953 113.4601882157781 0.04409980773925781 3 0.679145962649166 2.117609559297442 3916.0 -0.4652212652212653 3.0 - - - - - - - 239.875 7 16 TRAFD1 TRAF-type zinc finger domain containing 1 1175 149 C20140707_OR007_01 C20140707_OR007_01 TB419343.[MT7]-LSNSDSQDIQGR.3y5_1.heavy 488.578 / 588.31 N/A 23.347000122070312 30 5 10 5 10 0.38442515012815953 113.4601882157781 0.04409980773925781 3 0.679145962649166 2.117609559297442 0.0 0.0 54.0 - - - - - - - 201.35714285714286 10 14 TRAFD1 TRAF-type zinc finger domain containing 1 1177 150 C20140707_OR007_01 C20140707_OR007_01 TB419743.[MT7]-SDMETHMAAEHC[CAM]QVTC[CAM]K[MT7].4y4_1.heavy 581.51 / 651.362 13885.0 22.03580093383789 44 14 10 10 10 2.917221974009454 27.941757600151668 0.0 3 0.9491276298029523 5.448322852692262 13885.0 114.89461526615676 0.0 - - - - - - - 285.61538461538464 27 13 TRAFD1 TRAF-type zinc finger domain containing 1 1179 150 C20140707_OR007_01 C20140707_OR007_01 TB419743.[MT7]-SDMETHMAAEHC[CAM]QVTC[CAM]K[MT7].4b4_1.heavy 581.51 / 607.251 13078.0 22.03580093383789 44 14 10 10 10 2.917221974009454 27.941757600151668 0.0 3 0.9491276298029523 5.448322852692262 13078.0 46.331460361992185 0.0 - - - - - - - 251.22222222222223 26 9 TRAFD1 TRAF-type zinc finger domain containing 1 1181 150 C20140707_OR007_01 C20140707_OR007_01 TB419743.[MT7]-SDMETHMAAEHC[CAM]QVTC[CAM]K[MT7].4b5_1.heavy 581.51 / 708.299 8961.0 22.03580093383789 44 14 10 10 10 2.917221974009454 27.941757600151668 0.0 3 0.9491276298029523 5.448322852692262 8961.0 48.8277399380805 0.0 - - - - - - - 219.21428571428572 17 14 TRAFD1 TRAF-type zinc finger domain containing 1 1183 150 C20140707_OR007_01 C20140707_OR007_01 TB419743.[MT7]-SDMETHMAAEHC[CAM]QVTC[CAM]K[MT7].4y3_1.heavy 581.51 / 552.293 36085.0 22.03580093383789 44 14 10 10 10 2.917221974009454 27.941757600151668 0.0 3 0.9491276298029523 5.448322852692262 36085.0 88.77576283714055 0.0 - - - - - - - 278.8181818181818 72 11 TRAFD1 TRAF-type zinc finger domain containing 1 1185 151 C20140707_OR007_01 C20140707_OR007_01 TB418494.[MT7]-YALFSPSDHRVPR.4y8_2.heavy 422.98 / 482.26 12104.0 29.207674503326416 38 14 10 6 8 2.5956743263733126 29.216446037926175 0.03610038757324219 4 0.9487926801579452 5.430320268357273 12104.0 28.379772123148342 0.0 - - - - - - - 181.6 24 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1187 151 C20140707_OR007_01 C20140707_OR007_01 TB418494.[MT7]-YALFSPSDHRVPR.4y9_2.heavy 422.98 / 525.776 3833.0 29.207674503326416 38 14 10 6 8 2.5956743263733126 29.216446037926175 0.03610038757324219 4 0.9487926801579452 5.430320268357273 3833.0 16.893378360140847 1.0 - - - - - - - 202.0 12 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1189 151 C20140707_OR007_01 C20140707_OR007_01 TB418494.[MT7]-YALFSPSDHRVPR.4b4_1.heavy 422.98 / 639.362 1917.0 29.207674503326416 38 14 10 6 8 2.5956743263733126 29.216446037926175 0.03610038757324219 4 0.9487926801579452 5.430320268357273 1917.0 9.490099009900991 0.0 - - - - - - - 235.5 3 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1191 151 C20140707_OR007_01 C20140707_OR007_01 TB418494.[MT7]-YALFSPSDHRVPR.4b3_1.heavy 422.98 / 492.294 9684.0 29.207674503326416 38 14 10 6 8 2.5956743263733126 29.216446037926175 0.03610038757324219 4 0.9487926801579452 5.430320268357273 9684.0 34.75023456309087 0.0 - - - - - - - 227.0 19 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1193 152 C20140707_OR007_01 C20140707_OR007_01 TB418497.[MT7]-STGGISVPGPMGPSGPR.2y12_1.heavy 849.442 / 1138.57 2226.0 31.10444927215576 45 20 10 5 10 3.5895109822080227 20.77042585223188 0.040599822998046875 3 0.9917663646724477 13.591522855176216 2226.0 6.664670658682635 0.0 - - - - - - - 244.8 4 5 COL1A1 collagen, type I, alpha 1 1195 152 C20140707_OR007_01 C20140707_OR007_01 TB418497.[MT7]-STGGISVPGPMGPSGPR.2b6_1.heavy 849.442 / 647.348 1558.0 31.10444927215576 45 20 10 5 10 3.5895109822080227 20.77042585223188 0.040599822998046875 3 0.9917663646724477 13.591522855176216 1558.0 2.5988023952095807 2.0 - - - - - - - 254.42857142857142 3 7 COL1A1 collagen, type I, alpha 1 1197 152 C20140707_OR007_01 C20140707_OR007_01 TB418497.[MT7]-STGGISVPGPMGPSGPR.2y10_1.heavy 849.442 / 952.467 10575.0 31.10444927215576 45 20 10 5 10 3.5895109822080227 20.77042585223188 0.040599822998046875 3 0.9917663646724477 13.591522855176216 10575.0 49.25465496296455 0.0 - - - - - - - 222.66666666666666 21 3 COL1A1 collagen, type I, alpha 1 1199 152 C20140707_OR007_01 C20140707_OR007_01 TB418497.[MT7]-STGGISVPGPMGPSGPR.2b5_1.heavy 849.442 / 560.316 2449.0 31.10444927215576 45 20 10 5 10 3.5895109822080227 20.77042585223188 0.040599822998046875 3 0.9917663646724477 13.591522855176216 2449.0 20.42663677130045 0.0 - - - - - - - 195.0 4 4 COL1A1 collagen, type I, alpha 1 1201 153 C20140707_OR007_01 C20140707_OR007_01 TB419360.[MT7]-ELENDLNETLR.3b4_1.heavy 497.259 / 630.321 1236.0 33.97060012817383 34 17 4 5 8 4.308364146123051 23.210665720999135 0.04019927978515625 4 0.9716708863387078 7.315015398194387 1236.0 2.565013477088949 4.0 - - - - - - - 288.55555555555554 19 9 DENND1B DENN/MADD domain containing 1B 1203 153 C20140707_OR007_01 C20140707_OR007_01 TB419360.[MT7]-ELENDLNETLR.3b3_1.heavy 497.259 / 516.279 1731.0 33.97060012817383 34 17 4 5 8 4.308364146123051 23.210665720999135 0.04019927978515625 4 0.9716708863387078 7.315015398194387 1731.0 8.77731112978382 3.0 - - - - - - - 272.2 4 10 DENND1B DENN/MADD domain containing 1B 1205 153 C20140707_OR007_01 C20140707_OR007_01 TB419360.[MT7]-ELENDLNETLR.3y4_1.heavy 497.259 / 518.293 1978.0 33.97060012817383 34 17 4 5 8 4.308364146123051 23.210665720999135 0.04019927978515625 4 0.9716708863387078 7.315015398194387 1978.0 7.16744939271255 3.0 - - - - - - - 300.57142857142856 3 14 DENND1B DENN/MADD domain containing 1B 1207 153 C20140707_OR007_01 C20140707_OR007_01 TB419360.[MT7]-ELENDLNETLR.3y5_1.heavy 497.259 / 632.336 5069.0 33.97060012817383 34 17 4 5 8 4.308364146123051 23.210665720999135 0.04019927978515625 4 0.9716708863387078 7.315015398194387 5069.0 23.220599199542598 0.0 - - - - - - - 159.14285714285714 10 7 DENND1B DENN/MADD domain containing 1B 1209 154 C20140707_OR007_01 C20140707_OR007_01 TB418545.[MT7]-SATMVAAYLIQVHK[MT7].4y4_1.heavy 455.764 / 655.401 561.0 39.01349925994873 35 14 8 5 8 1.332347591355596 43.6387031539139 0.049198150634765625 4 0.9376258153001671 4.9155969354444355 561.0 0.9305815352501611 3.0 - - - - - - - 0.0 1 0 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 1211 154 C20140707_OR007_01 C20140707_OR007_01 TB418545.[MT7]-SATMVAAYLIQVHK[MT7].4b4_1.heavy 455.764 / 535.267 1543.0 39.01349925994873 35 14 8 5 8 1.332347591355596 43.6387031539139 0.049198150634765625 4 0.9376258153001671 4.9155969354444355 1543.0 20.940714285714286 0.0 - - - - - - - 210.5 3 2 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 1213 154 C20140707_OR007_01 C20140707_OR007_01 TB418545.[MT7]-SATMVAAYLIQVHK[MT7].4b5_1.heavy 455.764 / 634.335 842.0 39.01349925994873 35 14 8 5 8 1.332347591355596 43.6387031539139 0.049198150634765625 4 0.9376258153001671 4.9155969354444355 842.0 4.9964412811387895 1.0 - - - - - - - 280.6666666666667 4 3 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 1215 154 C20140707_OR007_01 C20140707_OR007_01 TB418545.[MT7]-SATMVAAYLIQVHK[MT7].4y3_1.heavy 455.764 / 527.342 1683.0 39.01349925994873 35 14 8 5 8 1.332347591355596 43.6387031539139 0.049198150634765625 4 0.9376258153001671 4.9155969354444355 1683.0 6.170071174377224 0.0 - - - - - - - 252.6 3 5 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 1217 155 C20140707_OR007_01 C20140707_OR007_01 TB418942.[MT7]-AATGFLK[MT7].2y4_1.heavy 498.31 / 608.389 8900.0 28.212775230407715 43 17 10 6 10 2.4737871164633676 28.45768069179539 0.034900665283203125 3 0.9785216139513436 8.405840400024625 8900.0 81.95049504950495 0.0 - - - - - - - 252.875 17 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1219 155 C20140707_OR007_01 C20140707_OR007_01 TB418942.[MT7]-AATGFLK[MT7].2y5_1.heavy 498.31 / 709.437 6473.0 28.212775230407715 43 17 10 6 10 2.4737871164633676 28.45768069179539 0.034900665283203125 3 0.9785216139513436 8.405840400024625 6473.0 15.663061728395062 0.0 - - - - - - - 316.0 12 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1221 155 C20140707_OR007_01 C20140707_OR007_01 TB418942.[MT7]-AATGFLK[MT7].2y3_1.heavy 498.31 / 551.367 3540.0 28.212775230407715 43 17 10 6 10 2.4737871164633676 28.45768069179539 0.034900665283203125 3 0.9785216139513436 8.405840400024625 3540.0 17.749369566281175 0.0 - - - - - - - 211.1818181818182 7 11 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1223 155 C20140707_OR007_01 C20140707_OR007_01 TB418942.[MT7]-AATGFLK[MT7].2y6_1.heavy 498.31 / 780.474 6068.0 28.212775230407715 43 17 10 6 10 2.4737871164633676 28.45768069179539 0.034900665283203125 3 0.9785216139513436 8.405840400024625 6068.0 29.4162524948147 0.0 - - - - - - - 202.11111111111111 12 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1225 156 C20140707_OR007_01 C20140707_OR007_01 TB449334.[MT7]-TTFLHISK[MT7].3y3_1.heavy 412.251 / 491.331 48666.0 29.857799530029297 48 18 10 10 10 4.80021140784478 20.832415804973564 0.0 3 0.9893966380994257 11.974463951120683 48666.0 278.42248979591835 0.0 - - - - - - - 300.53333333333336 97 15 AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) 1227 156 C20140707_OR007_01 C20140707_OR007_01 TB449334.[MT7]-TTFLHISK[MT7].3b4_1.heavy 412.251 / 607.357 31530.0 29.857799530029297 48 18 10 10 10 4.80021140784478 20.832415804973564 0.0 3 0.9893966380994257 11.974463951120683 31530.0 123.33163265306123 0.0 - - - - - - - 205.8 63 10 AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) 1229 156 C20140707_OR007_01 C20140707_OR007_01 TB449334.[MT7]-TTFLHISK[MT7].3y4_1.heavy 412.251 / 628.39 5092.0 29.857799530029297 48 18 10 10 10 4.80021140784478 20.832415804973564 0.0 3 0.9893966380994257 11.974463951120683 5092.0 17.685714285714287 2.0 - - - - - - - 220.5 10 8 AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) 1231 156 C20140707_OR007_01 C20140707_OR007_01 TB449334.[MT7]-TTFLHISK[MT7].3b3_1.heavy 412.251 / 494.273 45141.0 29.857799530029297 48 18 10 10 10 4.80021140784478 20.832415804973564 0.0 3 0.9893966380994257 11.974463951120683 45141.0 100.9832671644713 0.0 - - - - - - - 254.8 90 10 AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) 1233 157 C20140707_OR007_01 C20140707_OR007_01 TB439115.[MT7]-DGTFVISK[MT7].2y4_1.heavy 577.837 / 590.399 3317.0 29.41160011291504 25 15 0 6 4 1.6025820927245331 49.570802697714555 0.034198760986328125 7 0.9534853705360905 5.699931333030273 3317.0 8.126135142157734 3.0 - - - - - - - 665.1666666666666 13 12 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 1235 157 C20140707_OR007_01 C20140707_OR007_01 TB439115.[MT7]-DGTFVISK[MT7].2y5_1.heavy 577.837 / 737.468 1451.0 29.41160011291504 25 15 0 6 4 1.6025820927245331 49.570802697714555 0.034198760986328125 7 0.9534853705360905 5.699931333030273 1451.0 5.8398822560852475 7.0 - - - - - - - 273.3636363636364 3 11 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 1237 157 C20140707_OR007_01 C20140707_OR007_01 TB439115.[MT7]-DGTFVISK[MT7].2b4_1.heavy 577.837 / 565.274 4250.0 29.41160011291504 25 15 0 6 4 1.6025820927245331 49.570802697714555 0.034198760986328125 7 0.9534853705360905 5.699931333030273 4250.0 6.103130490770656 3.0 - - - - - - - 1303.0 10 7 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 1239 157 C20140707_OR007_01 C20140707_OR007_01 TB439115.[MT7]-DGTFVISK[MT7].2b5_1.heavy 577.837 / 664.342 2073.0 29.41160011291504 25 15 0 6 4 1.6025820927245331 49.570802697714555 0.034198760986328125 7 0.9534853705360905 5.699931333030273 2073.0 3.9391326789642918 4.0 - - - - - - - 725.75 60 8 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 1241 158 C20140707_OR007_01 C20140707_OR007_01 TB419445.[MT7]-LVHVWLDEYK[MT7].2b4_1.heavy 795.45 / 593.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1243 158 C20140707_OR007_01 C20140707_OR007_01 TB419445.[MT7]-LVHVWLDEYK[MT7].2y3_1.heavy 795.45 / 583.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1245 158 C20140707_OR007_01 C20140707_OR007_01 TB419445.[MT7]-LVHVWLDEYK[MT7].2y6_1.heavy 795.45 / 997.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1247 158 C20140707_OR007_01 C20140707_OR007_01 TB419445.[MT7]-LVHVWLDEYK[MT7].2y7_1.heavy 795.45 / 1096.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1249 159 C20140707_OR007_01 C20140707_OR007_01 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 143843.0 32.26969909667969 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 143843.0 601.9316088854648 0.0 - - - - - - - 334.3333333333333 287 6 1251 159 C20140707_OR007_01 C20140707_OR007_01 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 121659.0 32.26969909667969 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 121659.0 336.5097104519774 0.0 - - - - - - - 288.44444444444446 243 9 1253 159 C20140707_OR007_01 C20140707_OR007_01 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 278719.0 32.26969909667969 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 278719.0 1149.6648435865243 0.0 - - - - - - - 177.0 557 8 1255 160 C20140707_OR007_01 C20140707_OR007_01 TB449331.[MT7]-DLELQAASSR.2b3_1.heavy 617.331 / 502.263 7237.0 26.382925510406494 40 18 10 6 6 7.3151424052216845 13.670273859414976 0.03429985046386719 5 0.9837481123995658 9.66764131346502 7237.0 5.337344436419326 0.0 - - - - - - - 757.0 14 7 UNC13D unc-13 homolog D (C. elegans) 1257 160 C20140707_OR007_01 C20140707_OR007_01 TB449331.[MT7]-DLELQAASSR.2y9_1.heavy 617.331 / 974.526 5300.0 26.382925510406494 40 18 10 6 6 7.3151424052216845 13.670273859414976 0.03429985046386719 5 0.9837481123995658 9.66764131346502 5300.0 11.00169410909635 2.0 - - - - - - - 211.84615384615384 15 13 UNC13D unc-13 homolog D (C. elegans) 1259 160 C20140707_OR007_01 C20140707_OR007_01 TB449331.[MT7]-DLELQAASSR.2y6_1.heavy 617.331 / 619.316 4587.0 26.382925510406494 40 18 10 6 6 7.3151424052216845 13.670273859414976 0.03429985046386719 5 0.9837481123995658 9.66764131346502 4587.0 26.082941176470587 0.0 - - - - - - - 250.36363636363637 9 11 UNC13D unc-13 homolog D (C. elegans) 1261 160 C20140707_OR007_01 C20140707_OR007_01 TB449331.[MT7]-DLELQAASSR.2y7_1.heavy 617.331 / 732.4 3771.0 26.382925510406494 40 18 10 6 6 7.3151424052216845 13.670273859414976 0.03429985046386719 5 0.9837481123995658 9.66764131346502 3771.0 8.626470588235295 1.0 - - - - - - - 262.2857142857143 7 7 UNC13D unc-13 homolog D (C. elegans) 1263 161 C20140707_OR007_01 C20140707_OR007_01 TB439018.[MT7]-VVPMLPR.2y4_1.heavy 478.298 / 516.296 1636.0 33.24755096435547 35 10 10 5 10 1.1508551387012305 52.75977056749589 0.0406036376953125 3 0.8257484406697643 2.912432919383665 1636.0 5.843717018816356 1.0 - - - - - - - 163.8 3 10 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1265 161 C20140707_OR007_01 C20140707_OR007_01 TB439018.[MT7]-VVPMLPR.2y5_1.heavy 478.298 / 613.349 5663.0 33.24755096435547 35 10 10 5 10 1.1508551387012305 52.75977056749589 0.0406036376953125 3 0.8257484406697643 2.912432919383665 5663.0 44.786546772619545 1.0 - - - - - - - 220.5 14 4 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1267 161 C20140707_OR007_01 C20140707_OR007_01 TB439018.[MT7]-VVPMLPR.2b4_1.heavy 478.298 / 571.339 2391.0 33.24755096435547 35 10 10 5 10 1.1508551387012305 52.75977056749589 0.0406036376953125 3 0.8257484406697643 2.912432919383665 2391.0 6.842995220728609 0.0 - - - - - - - 198.0 4 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1269 161 C20140707_OR007_01 C20140707_OR007_01 TB439018.[MT7]-VVPMLPR.2y6_1.heavy 478.298 / 712.417 9312.0 33.24755096435547 35 10 10 5 10 1.1508551387012305 52.75977056749589 0.0406036376953125 3 0.8257484406697643 2.912432919383665 9312.0 35.12469857202604 0.0 - - - - - - - 176.4 18 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1271 162 C20140707_OR007_01 C20140707_OR007_01 TB419442.[MT7]-K[MT7]HEETEC[CAM]PLR.3y7_1.heavy 529.611 / 904.419 5511.0 17.139249801635742 43 17 10 6 10 7.469961888332009 13.386949156487503 0.037899017333984375 3 0.9734827323371628 7.561946347989159 5511.0 34.92757525083612 0.0 - - - - - - - 172.125 11 8 TRAFD1 TRAF-type zinc finger domain containing 1 1273 162 C20140707_OR007_01 C20140707_OR007_01 TB419442.[MT7]-K[MT7]HEETEC[CAM]PLR.3y6_1.heavy 529.611 / 775.377 4492.0 17.139249801635742 43 17 10 6 10 7.469961888332009 13.386949156487503 0.037899017333984375 3 0.9734827323371628 7.561946347989159 4492.0 77.56472553699284 0.0 - - - - - - - 167.8 8 5 TRAFD1 TRAF-type zinc finger domain containing 1 1275 162 C20140707_OR007_01 C20140707_OR007_01 TB419442.[MT7]-K[MT7]HEETEC[CAM]PLR.3y4_1.heavy 529.611 / 545.286 3714.0 17.139249801635742 43 17 10 6 10 7.469961888332009 13.386949156487503 0.037899017333984375 3 0.9734827323371628 7.561946347989159 3714.0 24.0121135097493 0.0 - - - - - - - 185.27272727272728 7 11 TRAFD1 TRAF-type zinc finger domain containing 1 1277 162 C20140707_OR007_01 C20140707_OR007_01 TB419442.[MT7]-K[MT7]HEETEC[CAM]PLR.3y8_1.heavy 529.611 / 1033.46 1438.0 17.139249801635742 43 17 10 6 10 7.469961888332009 13.386949156487503 0.037899017333984375 3 0.9734827323371628 7.561946347989159 1438.0 47.7416 0.0 - - - - - - - 105.0 2 4 TRAFD1 TRAF-type zinc finger domain containing 1 1279 163 C20140707_OR007_01 C20140707_OR007_01 TB419441.[MT7]-GVITMNEEYETR.2y4_1.heavy 793.386 / 568.273 3079.0 29.48040008544922 42 16 10 6 10 4.572414155692786 21.870284841870053 0.034999847412109375 3 0.967963751000158 6.876623364697854 3079.0 4.288300835654596 0.0 - - - - - - - 205.66666666666666 6 3 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 1281 163 C20140707_OR007_01 C20140707_OR007_01 TB419441.[MT7]-GVITMNEEYETR.2y8_1.heavy 793.386 / 1071.44 3489.0 29.48040008544922 42 16 10 6 10 4.572414155692786 21.870284841870053 0.034999847412109375 3 0.967963751000158 6.876623364697854 3489.0 35.418299199206295 0.0 - - - - - - - 211.8125 6 16 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 1283 163 C20140707_OR007_01 C20140707_OR007_01 TB419441.[MT7]-GVITMNEEYETR.2y5_1.heavy 793.386 / 697.315 513.0 29.48040008544922 42 16 10 6 10 4.572414155692786 21.870284841870053 0.034999847412109375 3 0.967963751000158 6.876623364697854 513.0 1.689527346186982 4.0 - - - - - - - 0.0 1 0 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 1285 163 C20140707_OR007_01 C20140707_OR007_01 TB419441.[MT7]-GVITMNEEYETR.2y9_1.heavy 793.386 / 1172.49 6055.0 29.48040008544922 42 16 10 6 10 4.572414155692786 21.870284841870053 0.034999847412109375 3 0.967963751000158 6.876623364697854 6055.0 20.838636363636365 0.0 - - - - - - - 160.0 12 9 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 1287 164 C20140707_OR007_01 C20140707_OR007_01 TB439019.[MT7]-AQEPPK[MT7].2b3_1.heavy 479.284 / 473.248 2101.0 15.698999881744385 40 20 10 6 4 15.445392140770847 6.474422862727603 0.03979969024658203 9 0.9993890932149022 49.9289902946099 2101.0 5.153457496136012 2.0 - - - - - - - 716.0 7 7 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1289 164 C20140707_OR007_01 C20140707_OR007_01 TB439019.[MT7]-AQEPPK[MT7].2y5_1.heavy 479.284 / 742.422 162.0 15.698999881744385 40 20 10 6 4 15.445392140770847 6.474422862727603 0.03979969024658203 9 0.9993890932149022 49.9289902946099 162.0 2.05 7.0 - - - - - - - 0.0 0 0 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1291 164 C20140707_OR007_01 C20140707_OR007_01 TB439019.[MT7]-AQEPPK[MT7].2b4_1.heavy 479.284 / 570.3 162.0 15.698999881744385 40 20 10 6 4 15.445392140770847 6.474422862727603 0.03979969024658203 9 0.9993890932149022 49.9289902946099 162.0 2.1 13.0 - - - - - - - 0.0 0 0 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1293 164 C20140707_OR007_01 C20140707_OR007_01 TB439019.[MT7]-AQEPPK[MT7].2y3_1.heavy 479.284 / 485.32 6088.0 15.698999881744385 40 20 10 6 4 15.445392140770847 6.474422862727603 0.03979969024658203 9 0.9993890932149022 49.9289902946099 6088.0 51.00763039327988 0.0 - - - - - - - 673.5 12 8 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1295 165 C20140707_OR007_01 C20140707_OR007_01 TB439672.[MT7]-IQQQAETTSEELGAVTVK[MT7].3y6_1.heavy 740.737 / 718.458 6620.0 33.91109848022461 48 18 10 10 10 3.893415877850013 20.571424084718522 0.0 3 0.9891774043366226 11.852342443054553 6620.0 31.6138775510204 0.0 - - - - - - - 299.55555555555554 13 9 UNC13D unc-13 homolog D (C. elegans) 1297 165 C20140707_OR007_01 C20140707_OR007_01 TB439672.[MT7]-IQQQAETTSEELGAVTVK[MT7].3b6_1.heavy 740.737 / 842.449 4781.0 33.91109848022461 48 18 10 10 10 3.893415877850013 20.571424084718522 0.0 3 0.9891774043366226 11.852342443054553 4781.0 47.97266215977377 0.0 - - - - - - - 231.55555555555554 9 9 UNC13D unc-13 homolog D (C. elegans) 1299 165 C20140707_OR007_01 C20140707_OR007_01 TB439672.[MT7]-IQQQAETTSEELGAVTVK[MT7].3b4_1.heavy 740.737 / 642.369 5639.0 33.91109848022461 48 18 10 10 10 3.893415877850013 20.571424084718522 0.0 3 0.9891774043366226 11.852342443054553 5639.0 23.173534293212285 0.0 - - - - - - - 278.6363636363636 11 11 UNC13D unc-13 homolog D (C. elegans) 1301 165 C20140707_OR007_01 C20140707_OR007_01 TB439672.[MT7]-IQQQAETTSEELGAVTVK[MT7].3b5_1.heavy 740.737 / 713.406 4413.0 33.91109848022461 48 18 10 10 10 3.893415877850013 20.571424084718522 0.0 3 0.9891774043366226 11.852342443054553 4413.0 7.197283101422997 0.0 - - - - - - - 260.625 8 16 UNC13D unc-13 homolog D (C. elegans) 1303 166 C20140707_OR007_01 C20140707_OR007_01 TB418202.[MT7]-MFIFYGNK[MT7].3y3_1.heavy 436.574 / 462.279 6461.0 39.694400787353516 43 13 10 10 10 1.4055477289342155 46.02427482237989 0.0 3 0.9076482904036899 4.029391867433287 6461.0 39.176584289496915 0.0 - - - - - - - 206.0 12 2 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1305 166 C20140707_OR007_01 C20140707_OR007_01 TB418202.[MT7]-MFIFYGNK[MT7].3b4_1.heavy 436.574 / 683.371 550.0 39.694400787353516 43 13 10 10 10 1.4055477289342155 46.02427482237989 0.0 3 0.9076482904036899 4.029391867433287 550.0 2.610218978102189 1.0 - - - - - - - 0.0 1 0 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1307 166 C20140707_OR007_01 C20140707_OR007_01 TB418202.[MT7]-MFIFYGNK[MT7].3y4_1.heavy 436.574 / 625.343 1650.0 39.694400787353516 43 13 10 10 10 1.4055477289342155 46.02427482237989 0.0 3 0.9076482904036899 4.029391867433287 1650.0 16.71941605839416 0.0 - - - - - - - 240.25 3 4 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1309 166 C20140707_OR007_01 C20140707_OR007_01 TB418202.[MT7]-MFIFYGNK[MT7].3b3_1.heavy 436.574 / 536.302 2337.0 39.694400787353516 43 13 10 10 10 1.4055477289342155 46.02427482237989 0.0 3 0.9076482904036899 4.029391867433287 2337.0 16.996363636363636 0.0 - - - - - - - 137.0 4 2 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1311 167 C20140707_OR007_01 C20140707_OR007_01 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 236138.0 26.46190071105957 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 236138.0 269.6038092075904 0.0 - - - - - - - 2680.6666666666665 472 3 1313 167 C20140707_OR007_01 C20140707_OR007_01 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 321453.0 26.46190071105957 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 321453.0 417.30817447602385 0.0 - - - - - - - 5772.0 642 7 1315 167 C20140707_OR007_01 C20140707_OR007_01 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 386568.0 26.46190071105957 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 386568.0 400.124398242529 0.0 - - - - - - - 2942.0 773 1 1317 168 C20140707_OR007_01 C20140707_OR007_01 TB418913.[MT7]-GTWAQVR.2y5_1.heavy 481.27 / 659.362 2114.0 25.32699966430664 32 18 0 10 4 24.312679636577624 4.113080149731966 0.0 8 0.9889926840357812 11.75228943838522 2114.0 23.910642065695406 0.0 - - - - - - - 215.85714285714286 4 7 CPT1C carnitine palmitoyltransferase 1C 1319 168 C20140707_OR007_01 C20140707_OR007_01 TB418913.[MT7]-GTWAQVR.2b4_1.heavy 481.27 / 560.295 1711.0 25.32699966430664 32 18 0 10 4 24.312679636577624 4.113080149731966 0.0 8 0.9889926840357812 11.75228943838522 1711.0 24.096098714349047 4.0 - - - - - - - 181.2 6 5 CPT1C carnitine palmitoyltransferase 1C 1321 168 C20140707_OR007_01 C20140707_OR007_01 TB418913.[MT7]-GTWAQVR.2y6_1.heavy 481.27 / 760.41 1208.0 25.32699966430664 32 18 0 10 4 24.312679636577624 4.113080149731966 0.0 8 0.9889926840357812 11.75228943838522 1208.0 3.4212606691314074 2.0 - - - - - - - 183.0909090909091 7 11 CPT1C carnitine palmitoyltransferase 1C 1323 168 C20140707_OR007_01 C20140707_OR007_01 TB418913.[MT7]-GTWAQVR.2b5_1.heavy 481.27 / 688.354 2315.0 25.32699966430664 32 18 0 10 4 24.312679636577624 4.113080149731966 0.0 8 0.9889926840357812 11.75228943838522 2315.0 7.620330656145789 3.0 - - - - - - - 214.0 22 8 CPT1C carnitine palmitoyltransferase 1C 1325 169 C20140707_OR007_01 C20140707_OR007_01 TB418824.[MT7]-IVTSASTDLQDYTYYFVPAPWLSVK[MT7].4y4_1.heavy 788.916 / 590.399 2524.0 51.98350143432617 50 20 10 10 10 4.066455913001055 19.633014773099084 0.0 3 0.9905832004430338 12.707768991236733 2524.0 11.344074493906383 0.0 - - - - - - - 182.91666666666666 5 12 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1327 169 C20140707_OR007_01 C20140707_OR007_01 TB418824.[MT7]-IVTSASTDLQDYTYYFVPAPWLSVK[MT7].4b8_1.heavy 788.916 / 919.485 3182.0 51.98350143432617 50 20 10 10 10 4.066455913001055 19.633014773099084 0.0 3 0.9905832004430338 12.707768991236733 3182.0 22.307831883478322 0.0 - - - - - - - 177.15384615384616 6 13 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1329 169 C20140707_OR007_01 C20140707_OR007_01 TB418824.[MT7]-IVTSASTDLQDYTYYFVPAPWLSVK[MT7].4y8_1.heavy 788.916 / 1041.62 3292.0 51.98350143432617 50 20 10 10 10 4.066455913001055 19.633014773099084 0.0 3 0.9905832004430338 12.707768991236733 3292.0 18.03013555936073 0.0 - - - - - - - 227.35714285714286 6 14 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1331 169 C20140707_OR007_01 C20140707_OR007_01 TB418824.[MT7]-IVTSASTDLQDYTYYFVPAPWLSVK[MT7].4y6_1.heavy 788.916 / 873.531 2524.0 51.98350143432617 50 20 10 10 10 4.066455913001055 19.633014773099084 0.0 3 0.9905832004430338 12.707768991236733 2524.0 28.146424242424242 0.0 - - - - - - - 133.42857142857142 5 14 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1333 170 C20140707_OR007_01 C20140707_OR007_01 TB418825.[MT7]-IIGFGSALLEEVDPNPANFVGAGIIHTK[MT7].3b10_1.heavy 1056.58 / 1145.67 392.0 50.666476249694824 43 18 10 5 10 3.2324418791167147 24.783204114099156 0.048099517822265625 3 0.9849548805967399 10.048900387673994 392.0 5.224615384615385 14.0 - - - - - - - 0.0 1 0 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1335 170 C20140707_OR007_01 C20140707_OR007_01 TB418825.[MT7]-IIGFGSALLEEVDPNPANFVGAGIIHTK[MT7].3y8_1.heavy 1056.58 / 940.57 1893.0 50.666476249694824 43 18 10 5 10 3.2324418791167147 24.783204114099156 0.048099517822265625 3 0.9849548805967399 10.048900387673994 1893.0 53.87769230769231 0.0 - - - - - - - 138.875 3 8 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1337 170 C20140707_OR007_01 C20140707_OR007_01 TB418825.[MT7]-IIGFGSALLEEVDPNPANFVGAGIIHTK[MT7].3b8_1.heavy 1056.58 / 903.542 1305.0 50.666476249694824 43 18 10 5 10 3.2324418791167147 24.783204114099156 0.048099517822265625 3 0.9849548805967399 10.048900387673994 1305.0 20.71153846153846 0.0 - - - - - - - 201.8181818181818 2 11 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1339 170 C20140707_OR007_01 C20140707_OR007_01 TB418825.[MT7]-IIGFGSALLEEVDPNPANFVGAGIIHTK[MT7].3b7_1.heavy 1056.58 / 790.458 1631.0 50.666476249694824 43 18 10 5 10 3.2324418791167147 24.783204114099156 0.048099517822265625 3 0.9849548805967399 10.048900387673994 1631.0 19.69129498364231 0.0 - - - - - - - 163.3 3 10 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1341 171 C20140707_OR007_01 C20140707_OR007_01 TB449878.[MT7]-VGAVLEQGQLQNTLHAQLQSALAGLGHEIR.4y8_1.heavy 824.705 / 852.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1343 171 C20140707_OR007_01 C20140707_OR007_01 TB449878.[MT7]-VGAVLEQGQLQNTLHAQLQSALAGLGHEIR.4b5_1.heavy 824.705 / 584.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1345 171 C20140707_OR007_01 C20140707_OR007_01 TB449878.[MT7]-VGAVLEQGQLQNTLHAQLQSALAGLGHEIR.4y7_1.heavy 824.705 / 781.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1347 171 C20140707_OR007_01 C20140707_OR007_01 TB449878.[MT7]-VGAVLEQGQLQNTLHAQLQSALAGLGHEIR.4b6_1.heavy 824.705 / 713.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1349 172 C20140707_OR007_01 C20140707_OR007_01 TB419727.[MT7]-LSY[MT7]EHAQSMIESPTEK[MT7].4y4_1.heavy 571.298 / 618.358 8146.0 27.623600006103516 46 16 10 10 10 2.4701067357046833 31.92728442083974 0.0 3 0.9613503083895052 6.257207481657863 8146.0 11.937633569212677 0.0 - - - - - - - 766.2857142857143 16 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1351 172 C20140707_OR007_01 C20140707_OR007_01 TB419727.[MT7]-LSY[MT7]EHAQSMIESPTEK[MT7].4b8_2.heavy 571.298 / 602.814 4768.0 27.623600006103516 46 16 10 10 10 2.4701067357046833 31.92728442083974 0.0 3 0.9613503083895052 6.257207481657863 4768.0 50.7006500045775 0.0 - - - - - - - 278.2 9 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1353 172 C20140707_OR007_01 C20140707_OR007_01 TB419727.[MT7]-LSY[MT7]EHAQSMIESPTEK[MT7].4b7_2.heavy 571.298 / 559.298 3973.0 27.623600006103516 46 16 10 10 10 2.4701067357046833 31.92728442083974 0.0 3 0.9613503083895052 6.257207481657863 3973.0 1.8297260997929756 0.0 - - - - - - - 370.1818181818182 7 11 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1355 172 C20140707_OR007_01 C20140707_OR007_01 TB419727.[MT7]-LSY[MT7]EHAQSMIESPTEK[MT7].4y3_1.heavy 571.298 / 521.305 6457.0 27.623600006103516 46 16 10 10 10 2.4701067357046833 31.92728442083974 0.0 3 0.9613503083895052 6.257207481657863 6457.0 31.973280353260506 0.0 - - - - - - - 794.5714285714286 12 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1357 173 C20140707_OR007_01 C20140707_OR007_01 TB419460.[MT7]-DC[CAM]PQDFVARPK[MT7].4y4_1.heavy 405.966 / 615.406 611.0 25.337849617004395 36 14 10 2 10 2.5432902263184656 31.02145837828308 0.08409881591796875 3 0.9376690814783519 4.917320833133462 611.0 4.532581699346405 3.0 - - - - - - - 229.375 4 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1359 173 C20140707_OR007_01 C20140707_OR007_01 TB419460.[MT7]-DC[CAM]PQDFVARPK[MT7].4y6_2.heavy 405.966 / 431.275 4380.0 25.337849617004395 36 14 10 2 10 2.5432902263184656 31.02145837828308 0.08409881591796875 3 0.9376690814783519 4.917320833133462 4380.0 8.340542500714333 1.0 - - - - - - - 261.85714285714283 8 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1361 173 C20140707_OR007_01 C20140707_OR007_01 TB419460.[MT7]-DC[CAM]PQDFVARPK[MT7].4y7_2.heavy 405.966 / 488.789 7436.0 25.337849617004395 36 14 10 2 10 2.5432902263184656 31.02145837828308 0.08409881591796875 3 0.9376690814783519 4.917320833133462 7436.0 35.53449859943978 0.0 - - - - - - - 203.83333333333334 14 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1363 173 C20140707_OR007_01 C20140707_OR007_01 TB419460.[MT7]-DC[CAM]PQDFVARPK[MT7].4y3_1.heavy 405.966 / 544.369 3056.0 25.337849617004395 36 14 10 2 10 2.5432902263184656 31.02145837828308 0.08409881591796875 3 0.9376690814783519 4.917320833133462 3056.0 14.566683046683046 1.0 - - - - - - - 254.75 6 4 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1365 174 C20140707_OR007_01 C20140707_OR007_01 TB419091.[MT7]-TTQIGC[CAM]LLR.2y8_1.heavy 603.343 / 960.529 7563.0 33.50149917602539 43 17 8 10 8 3.620762197876288 22.846557688874007 0.0 4 0.9767778519930912 8.082898713191085 7563.0 14.739179894179895 0.0 - - - - - - - 238.0 15 9 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1367 174 C20140707_OR007_01 C20140707_OR007_01 TB419091.[MT7]-TTQIGC[CAM]LLR.2y5_1.heavy 603.343 / 618.339 7689.0 33.50149917602539 43 17 8 10 8 3.620762197876288 22.846557688874007 0.0 4 0.9767778519930912 8.082898713191085 7689.0 19.597360544217686 0.0 - - - - - - - 236.25 15 8 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1369 174 C20140707_OR007_01 C20140707_OR007_01 TB419091.[MT7]-TTQIGC[CAM]LLR.2y6_1.heavy 603.343 / 731.423 4790.0 33.50149917602539 43 17 8 10 8 3.620762197876288 22.846557688874007 0.0 4 0.9767778519930912 8.082898713191085 4790.0 39.97097505668935 1.0 - - - - - - - 238.0 21 9 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1371 174 C20140707_OR007_01 C20140707_OR007_01 TB419091.[MT7]-TTQIGC[CAM]LLR.2y7_1.heavy 603.343 / 859.482 1765.0 33.50149917602539 43 17 8 10 8 3.620762197876288 22.846557688874007 0.0 4 0.9767778519930912 8.082898713191085 1765.0 6.07010582010582 0.0 - - - - - - - 302.4 3 5 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1373 175 C20140707_OR007_01 C20140707_OR007_01 TB419094.[MT7]-TELC[CAM]GNC[CAM]GR.2y8_1.heavy 605.775 / 965.393 4091.0 18.377699851989746 44 20 10 6 8 7.7051711465508985 12.978297055058079 0.03600120544433594 4 0.9947622901764669 17.04519253987643 4091.0 59.766953125 0.0 - - - - - - - 103.38461538461539 8 13 TRAFD1 TRAF-type zinc finger domain containing 1 1375 175 C20140707_OR007_01 C20140707_OR007_01 TB419094.[MT7]-TELC[CAM]GNC[CAM]GR.2y5_1.heavy 605.775 / 563.235 1662.0 18.377699851989746 44 20 10 6 8 7.7051711465508985 12.978297055058079 0.03600120544433594 4 0.9947622901764669 17.04519253987643 1662.0 7.880032276995304 1.0 - - - - - - - 241.23076923076923 3 13 TRAFD1 TRAF-type zinc finger domain containing 1 1377 175 C20140707_OR007_01 C20140707_OR007_01 TB419094.[MT7]-TELC[CAM]GNC[CAM]GR.2y6_1.heavy 605.775 / 723.266 2429.0 18.377699851989746 44 20 10 6 8 7.7051711465508985 12.978297055058079 0.03600120544433594 4 0.9947622901764669 17.04519253987643 2429.0 16.24063722826087 0.0 - - - - - - - 128.0 4 7 TRAFD1 TRAF-type zinc finger domain containing 1 1379 175 C20140707_OR007_01 C20140707_OR007_01 TB419094.[MT7]-TELC[CAM]GNC[CAM]GR.2y7_1.heavy 605.775 / 836.35 2813.0 18.377699851989746 44 20 10 6 8 7.7051711465508985 12.978297055058079 0.03600120544433594 4 0.9947622901764669 17.04519253987643 2813.0 18.606822916666665 1.0 - - - - - - - 192.0 6 12 TRAFD1 TRAF-type zinc finger domain containing 1 1381 176 C20140707_OR007_01 C20140707_OR007_01 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 240847.0 37.65829849243164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 240847.0 100.87774527909542 0.0 - - - - - - - 731.1428571428571 481 7 1383 176 C20140707_OR007_01 C20140707_OR007_01 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 511990.0 37.65829849243164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 511990.0 79.12297765172329 0.0 - - - - - - - 415.0 1023 1 1385 176 C20140707_OR007_01 C20140707_OR007_01 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 558102.0 37.65829849243164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 558102.0 88.72389757350969 0.0 - - - - - - - 277.0 1116 1 1387 177 C20140707_OR007_01 C20140707_OR007_01 TB418811.[MT7]-VVHLLNDQHLGVVTAATSLITTLAQK[MT7].4b8_1.heavy 758.444 / 1063.6 587.0 49.21135139465332 38 14 10 6 8 2.5741405797050816 34.30327966835695 0.036899566650390625 4 0.9456517137464631 5.2696602452279935 587.0 0.8013651877133106 2.0 - - - - - - - 0.0 1 0 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1389 177 C20140707_OR007_01 C20140707_OR007_01 TB418811.[MT7]-VVHLLNDQHLGVVTAATSLITTLAQK[MT7].4b12_2.heavy 758.444 / 735.421 807.0 49.21135139465332 38 14 10 6 8 2.5741405797050816 34.30327966835695 0.036899566650390625 4 0.9456517137464631 5.2696602452279935 807.0 2.5689792119143657 1.0 - - - - - - - 0.0 1 0 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1391 177 C20140707_OR007_01 C20140707_OR007_01 TB418811.[MT7]-VVHLLNDQHLGVVTAATSLITTLAQK[MT7].4b4_1.heavy 758.444 / 593.389 1027.0 49.21135139465332 38 14 10 6 8 2.5741405797050816 34.30327966835695 0.036899566650390625 4 0.9456517137464631 5.2696602452279935 1027.0 1.633466005885086 3.0 - - - - - - - 220.0 2 12 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1393 177 C20140707_OR007_01 C20140707_OR007_01 TB418811.[MT7]-VVHLLNDQHLGVVTAATSLITTLAQK[MT7].4y6_1.heavy 758.444 / 805.49 1833.0 49.21135139465332 38 14 10 6 8 2.5741405797050816 34.30327966835695 0.036899566650390625 4 0.9456517137464631 5.2696602452279935 1833.0 24.148348318804484 0.0 - - - - - - - 234.7 3 10 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1395 178 C20140707_OR007_01 C20140707_OR007_01 TB419337.[MT7]-QNIHSLSPQER.3y7_1.heavy 484.927 / 816.421 1729.0 20.70460033416748 40 14 10 6 10 7.254480734720513 13.784584129004873 0.035999298095703125 3 0.9437692143366742 5.179870751786421 1729.0 11.012738853503185 1.0 - - - - - - - 288.3333333333333 3 6 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1397 178 C20140707_OR007_01 C20140707_OR007_01 TB419337.[MT7]-QNIHSLSPQER.3y4_1.heavy 484.927 / 529.273 4794.0 20.70460033416748 40 14 10 6 10 7.254480734720513 13.784584129004873 0.035999298095703125 3 0.9437692143366742 5.179870751786421 4794.0 18.16567742681048 0.0 - - - - - - - 235.77777777777777 9 9 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1399 178 C20140707_OR007_01 C20140707_OR007_01 TB419337.[MT7]-QNIHSLSPQER.3b3_1.heavy 484.927 / 500.295 8173.0 20.70460033416748 40 14 10 6 10 7.254480734720513 13.784584129004873 0.035999298095703125 3 0.9437692143366742 5.179870751786421 8173.0 21.257337133163695 1.0 - - - - - - - 325.57142857142856 16 7 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1401 178 C20140707_OR007_01 C20140707_OR007_01 TB419337.[MT7]-QNIHSLSPQER.3y5_1.heavy 484.927 / 616.305 5030.0 20.70460033416748 40 14 10 6 10 7.254480734720513 13.784584129004873 0.035999298095703125 3 0.9437692143366742 5.179870751786421 5030.0 18.76678274268105 0.0 - - - - - - - 253.33333333333334 10 9 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1403 179 C20140707_OR007_01 C20140707_OR007_01 TB417971.[MT7]-EQFLGALDLAK[MT7].3b6_1.heavy 498.292 / 790.422 3200.0 40.80160140991211 42 12 10 10 10 0.7767563173219525 73.74780480998083 0.0 3 0.8892345030612693 3.6733930356207143 3200.0 32.06015037593985 0.0 - - - - - - - 133.0 6 1 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1405 179 C20140707_OR007_01 C20140707_OR007_01 TB417971.[MT7]-EQFLGALDLAK[MT7].3b5_1.heavy 498.292 / 719.385 3733.0 40.80160140991211 42 12 10 10 10 0.7767563173219525 73.74780480998083 0.0 3 0.8892345030612693 3.6733930356207143 3733.0 42.04894258117203 0.0 - - - - - - - 400.0 7 1 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1407 179 C20140707_OR007_01 C20140707_OR007_01 TB417971.[MT7]-EQFLGALDLAK[MT7].3y4_1.heavy 498.292 / 590.363 8933.0 40.80160140991211 42 12 10 10 10 0.7767563173219525 73.74780480998083 0.0 3 0.8892345030612693 3.6733930356207143 8933.0 92.58764833431894 0.0 - - - - - - - 240.2 17 5 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1409 179 C20140707_OR007_01 C20140707_OR007_01 TB417971.[MT7]-EQFLGALDLAK[MT7].3b3_1.heavy 498.292 / 549.279 7600.0 40.80160140991211 42 12 10 10 10 0.7767563173219525 73.74780480998083 0.0 3 0.8892345030612693 3.6733930356207143 7600.0 28.271182760679583 1.0 - - - - - - - 300.25 15 4 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1411 180 C20140707_OR007_01 C20140707_OR007_01 TB449726.[MT7]-FFQPTEMASQDFFQR.3y7_1.heavy 674.988 / 927.432 7877.0 43.24330139160156 50 20 10 10 10 8.688074719695543 11.51002992335042 0.0 3 0.9962451659547907 20.134043874344655 7877.0 -1.7123913043478254 0.0 - - - - - - - 138.0 15 2 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1413 180 C20140707_OR007_01 C20140707_OR007_01 TB449726.[MT7]-FFQPTEMASQDFFQR.3b6_1.heavy 674.988 / 894.448 5113.0 43.24330139160156 50 20 10 10 10 8.688074719695543 11.51002992335042 0.0 3 0.9962451659547907 20.134043874344655 5113.0 -0.7396745027124769 0.0 - - - - - - - 304.0 10 5 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1415 180 C20140707_OR007_01 C20140707_OR007_01 TB449726.[MT7]-FFQPTEMASQDFFQR.3y4_1.heavy 674.988 / 597.314 8982.0 43.24330139160156 50 20 10 10 10 8.688074719695543 11.51002992335042 0.0 3 0.9962451659547907 20.134043874344655 8982.0 -2.888102893890675 0.0 - - - - - - - 345.5 17 2 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1417 180 C20140707_OR007_01 C20140707_OR007_01 TB449726.[MT7]-FFQPTEMASQDFFQR.3b3_1.heavy 674.988 / 567.305 15339.0 43.24330139160156 50 20 10 10 10 8.688074719695543 11.51002992335042 0.0 3 0.9962451659547907 20.134043874344655 15339.0 -1.2 1.0 - - - - - - - 345.5 30 2 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1419 181 C20140707_OR007_01 C20140707_OR007_01 TB418093.[MT7]-NALEGFDK[MT7].2y4_1.heavy 591.324 / 610.332 10546.0 29.532899856567383 48 18 10 10 10 3.803057728710287 26.294631092521573 0.0 3 0.9820194043006105 9.189829131927954 10546.0 29.681417216182496 0.0 - - - - - - - 215.41666666666666 21 12 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1421 181 C20140707_OR007_01 C20140707_OR007_01 TB418093.[MT7]-NALEGFDK[MT7].2y5_1.heavy 591.324 / 739.374 6927.0 29.532899856567383 48 18 10 10 10 3.803057728710287 26.294631092521573 0.0 3 0.9820194043006105 9.189829131927954 6927.0 61.13245631067961 0.0 - - - - - - - 172.11111111111111 13 9 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1423 181 C20140707_OR007_01 C20140707_OR007_01 TB418093.[MT7]-NALEGFDK[MT7].2b4_1.heavy 591.324 / 572.316 8478.0 29.532899856567383 48 18 10 10 10 3.803057728710287 26.294631092521573 0.0 3 0.9820194043006105 9.189829131927954 8478.0 21.618554579648166 0.0 - - - - - - - 706.5833333333334 16 12 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1425 181 C20140707_OR007_01 C20140707_OR007_01 TB418093.[MT7]-NALEGFDK[MT7].2y7_1.heavy 591.324 / 923.495 6100.0 29.532899856567383 48 18 10 10 10 3.803057728710287 26.294631092521573 0.0 3 0.9820194043006105 9.189829131927954 6100.0 26.761290322580642 0.0 - - - - - - - 206.63636363636363 12 11 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1427 182 C20140707_OR007_01 C20140707_OR007_01 TB418517.[MT7]-HLHDSQHVAVFHR.4y4_1.heavy 432.481 / 558.315 2050.0 19.143974781036377 33 12 6 7 8 1.5237386659949252 44.660804820193036 0.029699325561523438 4 0.8974055444950165 3.8195792516668408 2050.0 15.40081092616304 1.0 - - - - - - - 261.94117647058823 4 17 CPT1C carnitine palmitoyltransferase 1C 1429 182 C20140707_OR007_01 C20140707_OR007_01 TB418517.[MT7]-HLHDSQHVAVFHR.4y5_1.heavy 432.481 / 629.352 1908.0 19.143974781036377 33 12 6 7 8 1.5237386659949252 44.660804820193036 0.029699325561523438 4 0.8974055444950165 3.8195792516668408 1908.0 17.752340425531916 0.0 - - - - - - - 149.11111111111111 3 9 CPT1C carnitine palmitoyltransferase 1C 1431 182 C20140707_OR007_01 C20140707_OR007_01 TB418517.[MT7]-HLHDSQHVAVFHR.4y3_1.heavy 432.481 / 459.246 2050.0 19.143974781036377 33 12 6 7 8 1.5237386659949252 44.660804820193036 0.029699325561523438 4 0.8974055444950165 3.8195792516668408 2050.0 6.388101983002832 2.0 - - - - - - - 235.57142857142858 6 21 CPT1C carnitine palmitoyltransferase 1C 1433 182 C20140707_OR007_01 C20140707_OR007_01 TB418517.[MT7]-HLHDSQHVAVFHR.4b6_1.heavy 432.481 / 862.429 212.0 19.143974781036377 33 12 6 7 8 1.5237386659949252 44.660804820193036 0.029699325561523438 4 0.8974055444950165 3.8195792516668408 212.0 0.792 4.0 - - - - - - - 0.0 0 0 CPT1C carnitine palmitoyltransferase 1C 1435 183 C20140707_OR007_01 C20140707_OR007_01 TB419739.[MT7]-DLDDALSC[CAM]K[MT7]PLADGNFK[MT7].4y4_1.heavy 578.555 / 609.348 8924.0 34.569000244140625 43 13 10 10 10 1.8421089469123562 32.497319916732046 0.0 3 0.9250363891898294 4.47905114798925 8924.0 78.6590466080275 0.0 - - - - - - - 241.69230769230768 17 13 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1437 183 C20140707_OR007_01 C20140707_OR007_01 TB419739.[MT7]-DLDDALSC[CAM]K[MT7]PLADGNFK[MT7].4y8_1.heavy 578.555 / 1005.55 7164.0 34.569000244140625 43 13 10 10 10 1.8421089469123562 32.497319916732046 0.0 3 0.9250363891898294 4.47905114798925 7164.0 43.66900398406374 0.0 - - - - - - - 183.69230769230768 14 13 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1439 183 C20140707_OR007_01 C20140707_OR007_01 TB419739.[MT7]-DLDDALSC[CAM]K[MT7]PLADGNFK[MT7].4b4_1.heavy 578.555 / 603.274 26520.0 34.569000244140625 43 13 10 10 10 1.8421089469123562 32.497319916732046 0.0 3 0.9250363891898294 4.47905114798925 26520.0 25.565225937371217 0.0 - - - - - - - 230.5 53 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1441 183 C20140707_OR007_01 C20140707_OR007_01 TB419739.[MT7]-DLDDALSC[CAM]K[MT7]PLADGNFK[MT7].4b5_1.heavy 578.555 / 674.311 28657.0 34.569000244140625 43 13 10 10 10 1.8421089469123562 32.497319916732046 0.0 3 0.9250363891898294 4.47905114798925 28657.0 40.049778480498944 0.0 - - - - - - - 233.42857142857142 57 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1443 184 C20140707_OR007_01 C20140707_OR007_01 TB419499.[MT7]-REDLLNNAAHAGK[MT7].3b9_1.heavy 566.316 / 1141.61 289.0 22.840299606323242 37 7 10 10 10 0.7769535219814138 80.73107264512313 0.0 3 0.7252275743070131 2.298205102608923 289.0 5.99675 1.0 - - - - - - - 0.0 0 0 ABAT 4-aminobutyrate aminotransferase 1445 184 C20140707_OR007_01 C20140707_OR007_01 TB419499.[MT7]-REDLLNNAAHAGK[MT7].3b6_1.heavy 566.316 / 885.491 3570.0 22.840299606323242 37 7 10 10 10 0.7769535219814138 80.73107264512313 0.0 3 0.7252275743070131 2.298205102608923 3570.0 19.057067967083206 0.0 - - - - - - - 289.3333333333333 7 3 ABAT 4-aminobutyrate aminotransferase 1447 184 C20140707_OR007_01 C20140707_OR007_01 TB419499.[MT7]-REDLLNNAAHAGK[MT7].3b3_1.heavy 566.316 / 545.28 2895.0 22.840299606323242 37 7 10 10 10 0.7769535219814138 80.73107264512313 0.0 3 0.7252275743070131 2.298205102608923 2895.0 20.01384083044983 0.0 - - - - - - - 263.46666666666664 5 15 ABAT 4-aminobutyrate aminotransferase 1449 184 C20140707_OR007_01 C20140707_OR007_01 TB419499.[MT7]-REDLLNNAAHAGK[MT7].3y4_1.heavy 566.316 / 556.332 11966.0 22.840299606323242 37 7 10 10 10 0.7769535219814138 80.73107264512313 0.0 3 0.7252275743070131 2.298205102608923 11966.0 19.166823751178136 0.0 - - - - - - - 305.25 23 12 ABAT 4-aminobutyrate aminotransferase 1451 185 C20140707_OR007_01 C20140707_OR007_01 TB418840.[MT7]-FFTSGTVTVQVLEAIPTSGLTAADVPALVDTC[CAM]HR.4y4_1.heavy 930.237 / 573.256 2143.0 50.52064895629883 39 14 10 5 10 3.5544316093496233 28.13389340139748 0.041900634765625 3 0.9483929721257145 5.409066221046459 2143.0 5.103073270013568 0.0 - - - - - - - 152.27272727272728 4 11 AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) 1453 185 C20140707_OR007_01 C20140707_OR007_01 TB418840.[MT7]-FFTSGTVTVQVLEAIPTSGLTAADVPALVDTC[CAM]HR.4y10_1.heavy 930.237 / 1167.59 1741.0 50.52064895629883 39 14 10 5 10 3.5544316093496233 28.13389340139748 0.041900634765625 3 0.9483929721257145 5.409066221046459 1741.0 5.197014925373134 0.0 - - - - - - - 159.76923076923077 3 13 AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) 1455 185 C20140707_OR007_01 C20140707_OR007_01 TB418840.[MT7]-FFTSGTVTVQVLEAIPTSGLTAADVPALVDTC[CAM]HR.4y9_1.heavy 930.237 / 1068.53 10514.0 50.52064895629883 39 14 10 5 10 3.5544316093496233 28.13389340139748 0.041900634765625 3 0.9483929721257145 5.409066221046459 10514.0 42.02112769485903 0.0 - - - - - - - 230.77777777777777 21 9 AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) 1457 185 C20140707_OR007_01 C20140707_OR007_01 TB418840.[MT7]-FFTSGTVTVQVLEAIPTSGLTAADVPALVDTC[CAM]HR.4b6_1.heavy 930.237 / 785.395 1473.0 50.52064895629883 39 14 10 5 10 3.5544316093496233 28.13389340139748 0.041900634765625 3 0.9483929721257145 5.409066221046459 1473.0 7.67907249466951 0.0 - - - - - - - 219.27272727272728 2 11 AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) 1459 186 C20140707_OR007_01 C20140707_OR007_01 TB419708.[MT7]-QLDWPDPEEAFMITVK[MT7].3b6_1.heavy 736.381 / 899.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1461 186 C20140707_OR007_01 C20140707_OR007_01 TB419708.[MT7]-QLDWPDPEEAFMITVK[MT7].3b4_1.heavy 736.381 / 687.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1463 186 C20140707_OR007_01 C20140707_OR007_01 TB419708.[MT7]-QLDWPDPEEAFMITVK[MT7].3b3_1.heavy 736.381 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1465 186 C20140707_OR007_01 C20140707_OR007_01 TB419708.[MT7]-QLDWPDPEEAFMITVK[MT7].3y5_1.heavy 736.381 / 735.456 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1467 187 C20140707_OR007_01 C20140707_OR007_01 TB419207.[MT7]-QASQHALRPAP.3y7_1.heavy 440.582 / 761.442 696.0 18.684600353240967 32 15 6 3 8 1.7204285123568532 46.22424479903534 0.05409812927246094 4 0.9541248011521031 5.739829184719611 696.0 1.6210834207377425 1.0 - - - - - - - 231.88888888888889 7 9 UNC13D unc-13 homolog D (C. elegans) 1469 187 C20140707_OR007_01 C20140707_OR007_01 TB419207.[MT7]-QASQHALRPAP.3y6_1.heavy 440.582 / 624.383 5008.0 18.684600353240967 32 15 6 3 8 1.7204285123568532 46.22424479903534 0.05409812927246094 4 0.9541248011521031 5.739829184719611 5008.0 21.57129645565844 1.0 - - - - - - - 238.64285714285714 14 14 UNC13D unc-13 homolog D (C. elegans) 1471 187 C20140707_OR007_01 C20140707_OR007_01 TB419207.[MT7]-QASQHALRPAP.3b4_1.heavy 440.582 / 559.296 1947.0 18.684600353240967 32 15 6 3 8 1.7204285123568532 46.22424479903534 0.05409812927246094 4 0.9541248011521031 5.739829184719611 1947.0 16.24110022326966 0.0 - - - - - - - 169.6875 3 16 UNC13D unc-13 homolog D (C. elegans) 1473 187 C20140707_OR007_01 C20140707_OR007_01 TB419207.[MT7]-QASQHALRPAP.3y5_1.heavy 440.582 / 553.346 4451.0 18.684600353240967 32 15 6 3 8 1.7204285123568532 46.22424479903534 0.05409812927246094 4 0.9541248011521031 5.739829184719611 4451.0 118.26942857142856 0.0 - - - - - - - 185.77777777777777 8 9 UNC13D unc-13 homolog D (C. elegans) 1475 188 C20140707_OR007_01 C20140707_OR007_01 TB449613.[MT7]-FVDGALRLDQLK[MT7].3b5_1.heavy 554.998 / 634.332 4662.0 37.0625 41 11 10 10 10 0.9708197677206525 63.467838236884404 0.0 3 0.868694318177631 3.3678270162353177 4662.0 18.134512195121953 3.0 - - - - - - - 226.8 21 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1477 188 C20140707_OR007_01 C20140707_OR007_01 TB449613.[MT7]-FVDGALRLDQLK[MT7].3y7_2.heavy 554.998 / 515.331 6300.0 37.0625 41 11 10 10 10 0.9708197677206525 63.467838236884404 0.0 3 0.868694318177631 3.3678270162353177 6300.0 11.166666666666668 0.0 - - - - - - - 204.75 12 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1479 188 C20140707_OR007_01 C20140707_OR007_01 TB449613.[MT7]-FVDGALRLDQLK[MT7].3b3_1.heavy 554.998 / 506.273 9324.0 37.0625 41 11 10 10 10 0.9708197677206525 63.467838236884404 0.0 3 0.868694318177631 3.3678270162353177 9324.0 26.269999999999996 0.0 - - - - - - - 740.25 18 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1481 188 C20140707_OR007_01 C20140707_OR007_01 TB449613.[MT7]-FVDGALRLDQLK[MT7].3y9_2.heavy 554.998 / 579.36 20286.0 37.0625 41 11 10 10 10 0.9708197677206525 63.467838236884404 0.0 3 0.868694318177631 3.3678270162353177 20286.0 83.72 0.0 - - - - - - - 614.25 40 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1483 189 C20140707_OR007_01 C20140707_OR007_01 TB418705.[MT7]-FVNLFPEVK[MT7]PTIQDVLR.4y8_1.heavy 576.59 / 941.542 2828.0 46.426673889160156 34 8 10 6 10 1.5533599289892948 43.12464925716917 0.0384979248046875 3 0.7899828041492706 2.6443766548307583 2828.0 0.0 0.0 - - - - - - - 214.25 5 4 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1485 189 C20140707_OR007_01 C20140707_OR007_01 TB418705.[MT7]-FVNLFPEVK[MT7]PTIQDVLR.4y12_2.heavy 576.59 / 769.955 5142.0 46.426673889160156 34 8 10 6 10 1.5533599289892948 43.12464925716917 0.0384979248046875 3 0.7899828041492706 2.6443766548307583 5142.0 -0.6382820258192652 2.0 - - - - - - - 142.66666666666666 10 6 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1487 189 C20140707_OR007_01 C20140707_OR007_01 TB418705.[MT7]-FVNLFPEVK[MT7]PTIQDVLR.4b4_1.heavy 576.59 / 618.373 5399.0 46.426673889160156 34 8 10 6 10 1.5533599289892948 43.12464925716917 0.0384979248046875 3 0.7899828041492706 2.6443766548307583 5399.0 0.0 1.0 - - - - - - - 214.0 10 6 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1489 189 C20140707_OR007_01 C20140707_OR007_01 TB418705.[MT7]-FVNLFPEVK[MT7]PTIQDVLR.4b3_1.heavy 576.59 / 505.289 2485.0 46.426673889160156 34 8 10 6 10 1.5533599289892948 43.12464925716917 0.0384979248046875 3 0.7899828041492706 2.6443766548307583 2485.0 4.927714142833329 0.0 - - - - - - - 257.2 4 5 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1491 190 C20140707_OR007_01 C20140707_OR007_01 TB419200.[MT7]-YPLEEFVK[MT7].3y3_1.heavy 438.251 / 537.352 4629.0 38.95269966125488 35 12 10 5 8 2.9906204313917155 33.437877622424985 0.047801971435546875 4 0.8976272787630603 3.823786951887381 4629.0 33.28429521998914 1.0 - - - - - - - 327.6666666666667 9 3 ABAT 4-aminobutyrate aminotransferase 1493 190 C20140707_OR007_01 C20140707_OR007_01 TB419200.[MT7]-YPLEEFVK[MT7].3b4_1.heavy 438.251 / 647.352 1262.0 38.95269966125488 35 12 10 5 8 2.9906204313917155 33.437877622424985 0.047801971435546875 4 0.8976272787630603 3.823786951887381 1262.0 1.1198669201520912 3.0 - - - - - - - 187.0 5 3 ABAT 4-aminobutyrate aminotransferase 1495 190 C20140707_OR007_01 C20140707_OR007_01 TB419200.[MT7]-YPLEEFVK[MT7].3b5_1.heavy 438.251 / 776.395 2385.0 38.95269966125488 35 12 10 5 8 2.9906204313917155 33.437877622424985 0.047801971435546875 4 0.8976272787630603 3.823786951887381 2385.0 16.8231474407945 2.0 - - - - - - - 233.66666666666666 4 3 ABAT 4-aminobutyrate aminotransferase 1497 190 C20140707_OR007_01 C20140707_OR007_01 TB419200.[MT7]-YPLEEFVK[MT7].3b3_1.heavy 438.251 / 518.31 4769.0 38.95269966125488 35 12 10 5 8 2.9906204313917155 33.437877622424985 0.047801971435546875 4 0.8976272787630603 3.823786951887381 4769.0 10.518772908392233 0.0 - - - - - - - 327.5 9 6 ABAT 4-aminobutyrate aminotransferase 1499 191 C20140707_OR007_01 C20140707_OR007_01 TB418843.[MT7]-GFSQEELETC[CAM]MINQAPGC[CAM]PDYSILSFMGAFHGR.4b7_1.heavy 974.193 / 935.459 5869.0 49.428025245666504 40 14 10 6 10 1.8729220916313278 43.130902605547845 0.036899566650390625 3 0.9479012622013866 5.383255344349825 5869.0 15.750730510309763 0.0 - - - - - - - 191.91666666666666 11 12 ABAT 4-aminobutyrate aminotransferase 1501 191 C20140707_OR007_01 C20140707_OR007_01 TB418843.[MT7]-GFSQEELETC[CAM]MINQAPGC[CAM]PDYSILSFMGAFHGR.4y9_1.heavy 974.193 / 1009.47 11144.0 49.428025245666504 40 14 10 6 10 1.8729220916313278 43.130902605547845 0.036899566650390625 3 0.9479012622013866 5.383255344349825 11144.0 56.11882373232149 0.0 - - - - - - - 159.35714285714286 22 14 ABAT 4-aminobutyrate aminotransferase 1503 191 C20140707_OR007_01 C20140707_OR007_01 TB418843.[MT7]-GFSQEELETC[CAM]MINQAPGC[CAM]PDYSILSFMGAFHGR.4b5_1.heavy 974.193 / 693.332 6018.0 49.428025245666504 40 14 10 6 10 1.8729220916313278 43.130902605547845 0.036899566650390625 3 0.9479012622013866 5.383255344349825 6018.0 40.020831107296964 0.0 - - - - - - - 198.25 12 12 ABAT 4-aminobutyrate aminotransferase 1505 191 C20140707_OR007_01 C20140707_OR007_01 TB418843.[MT7]-GFSQEELETC[CAM]MINQAPGC[CAM]PDYSILSFMGAFHGR.4b6_1.heavy 974.193 / 822.375 12184.0 49.428025245666504 40 14 10 6 10 1.8729220916313278 43.130902605547845 0.036899566650390625 3 0.9479012622013866 5.383255344349825 12184.0 88.55572043302985 0.0 - - - - - - - 279.9230769230769 24 13 ABAT 4-aminobutyrate aminotransferase 1507 192 C20140707_OR007_01 C20140707_OR007_01 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 151036.0 40.43629837036133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 151036.0 612.7969366299444 0.0 - - - - - - - 191.8 302 5 1509 192 C20140707_OR007_01 C20140707_OR007_01 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 240808.0 40.43629837036133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 240808.0 497.75443634026533 0.0 - - - - - - - 274.0 481 4 1511 192 C20140707_OR007_01 C20140707_OR007_01 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 280966.0 40.43629837036133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 280966.0 417.27443384341774 0.0 - - - - - - - 319.6666666666667 561 6 1513 193 C20140707_OR007_01 C20140707_OR007_01 TB418648.[MT7]-IVTSASTDLQDYTYYFVPAPWLSVK[MT7].3y6_1.heavy 1051.55 / 873.531 1997.0 51.98350143432617 42 12 10 10 10 1.534939369327558 52.924525863830084 0.0 3 0.8930920978953587 3.7403323236964967 1997.0 15.412498780368814 0.0 - - - - - - - 127.3 3 10 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1515 193 C20140707_OR007_01 C20140707_OR007_01 TB418648.[MT7]-IVTSASTDLQDYTYYFVPAPWLSVK[MT7].3b10_1.heavy 1051.55 / 1160.63 998.0 51.98350143432617 42 12 10 10 10 1.534939369327558 52.924525863830084 0.0 3 0.8930920978953587 3.7403323236964967 998.0 5.394594594594595 0.0 - - - - - - - 0.0 1 0 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1517 193 C20140707_OR007_01 C20140707_OR007_01 TB418648.[MT7]-IVTSASTDLQDYTYYFVPAPWLSVK[MT7].3y8_1.heavy 1051.55 / 1041.62 6711.0 51.98350143432617 42 12 10 10 10 1.534939369327558 52.924525863830084 0.0 3 0.8930920978953587 3.7403323236964967 6711.0 42.01932432432432 0.0 - - - - - - - 277.2307692307692 13 13 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1519 193 C20140707_OR007_01 C20140707_OR007_01 TB418648.[MT7]-IVTSASTDLQDYTYYFVPAPWLSVK[MT7].3b8_1.heavy 1051.55 / 919.485 2940.0 51.98350143432617 42 12 10 10 10 1.534939369327558 52.924525863830084 0.0 3 0.8930920978953587 3.7403323236964967 2940.0 65.36864864864864 0.0 - - - - - - - 120.0 5 12 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1521 194 C20140707_OR007_01 C20140707_OR007_01 TB418360.[MT7]-TMGC[CAM]LATTHSK[MT7].3y3_1.heavy 498.926 / 515.306 6880.0 21.82740020751953 48 18 10 10 10 38.753061481861984 2.5804412909881735 0.0 3 0.986830355465536 10.742307079994568 6880.0 81.53430359701379 0.0 - - - - - - - 208.33333333333334 13 6 ABAT 4-aminobutyrate aminotransferase 1523 194 C20140707_OR007_01 C20140707_OR007_01 TB418360.[MT7]-TMGC[CAM]LATTHSK[MT7].3b4_1.heavy 498.926 / 594.25 12957.0 21.82740020751953 48 18 10 10 10 38.753061481861984 2.5804412909881735 0.0 3 0.986830355465536 10.742307079994568 12957.0 53.17522688570571 0.0 - - - - - - - 223.16666666666666 25 12 ABAT 4-aminobutyrate aminotransferase 1525 194 C20140707_OR007_01 C20140707_OR007_01 TB418360.[MT7]-TMGC[CAM]LATTHSK[MT7].3b5_1.heavy 498.926 / 707.334 4021.0 21.82740020751953 48 18 10 10 10 38.753061481861984 2.5804412909881735 0.0 3 0.986830355465536 10.742307079994568 4021.0 26.920362254107054 2.0 - - - - - - - 198.55555555555554 8 9 ABAT 4-aminobutyrate aminotransferase 1527 194 C20140707_OR007_01 C20140707_OR007_01 TB418360.[MT7]-TMGC[CAM]LATTHSK[MT7].3y4_1.heavy 498.926 / 616.354 6970.0 21.82740020751953 48 18 10 10 10 38.753061481861984 2.5804412909881735 0.0 3 0.986830355465536 10.742307079994568 6970.0 98.47514908040927 0.0 - - - - - - - 233.69230769230768 13 13 ABAT 4-aminobutyrate aminotransferase 1529 195 C20140707_OR007_01 C20140707_OR007_01 TB418643.[MT7]-LAVC[CAM]QHC[CAM]DLELSILK[MT7].3y5_1.heavy 696.379 / 717.499 4014.0 38.22000026702881 33 13 10 2 8 2.363019034643443 42.3187450181031 0.0829010009765625 4 0.9222949995410321 4.398298547172345 4014.0 7.4232074303405575 2.0 - - - - - - - 761.5 8 8 TRAFD1 TRAF-type zinc finger domain containing 1 1531 195 C20140707_OR007_01 C20140707_OR007_01 TB418643.[MT7]-LAVC[CAM]QHC[CAM]DLELSILK[MT7].3b4_1.heavy 696.379 / 588.33 969.0 38.22000026702881 33 13 10 2 8 2.363019034643443 42.3187450181031 0.0829010009765625 4 0.9222949995410321 4.398298547172345 969.0 0.36046184734195985 18.0 - - - - - - - 322.8888888888889 3 9 TRAFD1 TRAF-type zinc finger domain containing 1 1533 195 C20140707_OR007_01 C20140707_OR007_01 TB418643.[MT7]-LAVC[CAM]QHC[CAM]DLELSILK[MT7].3b8_2.heavy 696.379 / 564.756 16057.0 38.22000026702881 33 13 10 2 8 2.363019034643443 42.3187450181031 0.0829010009765625 4 0.9222949995410321 4.398298547172345 16057.0 34.504303471410836 1.0 - - - - - - - 276.6666666666667 32 3 TRAFD1 TRAF-type zinc finger domain containing 1 1535 195 C20140707_OR007_01 C20140707_OR007_01 TB418643.[MT7]-LAVC[CAM]QHC[CAM]DLELSILK[MT7].3y4_1.heavy 696.379 / 604.415 10243.0 38.22000026702881 33 13 10 2 8 2.363019034643443 42.3187450181031 0.0829010009765625 4 0.9222949995410321 4.398298547172345 10243.0 17.12738480986461 0.0 - - - - - - - 755.1818181818181 20 11 TRAFD1 TRAF-type zinc finger domain containing 1 1537 196 C20140707_OR007_01 C20140707_OR007_01 TB419703.[MT7]-GVSAVAGPHDIGASPGDK[MT7]K[MT7].3b5_1.heavy 732.41 / 558.337 1767.0 23.056299209594727 42 12 10 10 10 1.0603538048327859 65.24763015656289 0.0 3 0.895877354511736 3.7909440709698354 1767.0 11.57354260788285 0.0 - - - - - - - 229.08333333333334 3 12 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1539 196 C20140707_OR007_01 C20140707_OR007_01 TB419703.[MT7]-GVSAVAGPHDIGASPGDK[MT7]K[MT7].3b10_2.heavy 732.41 / 518.271 3141.0 23.056299209594727 42 12 10 10 10 1.0603538048327859 65.24763015656289 0.0 3 0.895877354511736 3.7909440709698354 3141.0 9.681076089633095 0.0 - - - - - - - 171.75 6 4 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1541 196 C20140707_OR007_01 C20140707_OR007_01 TB419703.[MT7]-GVSAVAGPHDIGASPGDK[MT7]K[MT7].3y8_1.heavy 732.41 / 1047.6 1374.0 23.056299209594727 42 12 10 10 10 1.0603538048327859 65.24763015656289 0.0 3 0.895877354511736 3.7909440709698354 1374.0 4.517637307131078 1.0 - - - - - - - 278.1666666666667 3 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1543 196 C20140707_OR007_01 C20140707_OR007_01 TB419703.[MT7]-GVSAVAGPHDIGASPGDK[MT7]K[MT7].3y5_1.heavy 732.41 / 832.513 2062.0 23.056299209594727 42 12 10 10 10 1.0603538048327859 65.24763015656289 0.0 3 0.895877354511736 3.7909440709698354 2062.0 22.71722515482772 0.0 - - - - - - - 207.11111111111111 4 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1545 197 C20140707_OR007_01 C20140707_OR007_01 TB449616.[MT7]-LPAQLAWEALEQR.3y7_1.heavy 556.978 / 931.463 3889.0 45.217326164245605 46 20 10 6 10 35.683785838080546 2.802393234108118 0.033100128173828125 3 0.9997144111378785 73.02665369118465 3889.0 0.9845569620253164 0.0 - - - - - - - 223.0 7 6 UNC13D unc-13 homolog D (C. elegans) 1547 197 C20140707_OR007_01 C20140707_OR007_01 TB449616.[MT7]-LPAQLAWEALEQR.3y6_1.heavy 556.978 / 745.384 3889.0 45.217326164245605 46 20 10 6 10 35.683785838080546 2.802393234108118 0.033100128173828125 3 0.9997144111378785 73.02665369118465 3889.0 0.35548446069469825 0.0 - - - - - - - 324.1666666666667 7 6 UNC13D unc-13 homolog D (C. elegans) 1549 197 C20140707_OR007_01 C20140707_OR007_01 TB449616.[MT7]-LPAQLAWEALEQR.3b4_1.heavy 556.978 / 554.342 7535.0 45.217326164245605 46 20 10 6 10 35.683785838080546 2.802393234108118 0.033100128173828125 3 0.9997144111378785 73.02665369118465 7535.0 28.294797902925755 0.0 - - - - - - - 297.1111111111111 15 9 UNC13D unc-13 homolog D (C. elegans) 1551 197 C20140707_OR007_01 C20140707_OR007_01 TB449616.[MT7]-LPAQLAWEALEQR.3y5_1.heavy 556.978 / 616.341 5105.0 45.217326164245605 46 20 10 6 10 35.683785838080546 2.802393234108118 0.033100128173828125 3 0.9997144111378785 73.02665369118465 5105.0 12.867397260273973 0.0 - - - - - - - 216.33333333333334 10 9 UNC13D unc-13 homolog D (C. elegans) 1553 198 C20140707_OR007_01 C20140707_OR007_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 149204.0 35.47090148925781 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 149204.0 259.59465509011807 0.0 - - - - - - - 296.8333333333333 298 6 1555 198 C20140707_OR007_01 C20140707_OR007_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 44077.0 35.47090148925781 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 44077.0 154.43036496350368 1.0 - - - - - - - 365.3333333333333 128 3 1557 198 C20140707_OR007_01 C20140707_OR007_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 25734.0 35.47090148925781 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 25734.0 96.81556569343067 0.0 - - - - - - - 197.88888888888889 51 9 1559 199 C20140707_OR007_01 C20140707_OR007_01 TB449619.[MT7]-ADTRPWSGPYILR.3y7_1.heavy 559.306 / 805.457 9063.0 34.92509841918945 41 11 10 10 10 0.8442629115945732 64.91213663475057 0.0 3 0.8520245454041371 3.167820784643616 9063.0 145.32051724137932 0.0 - - - - - - - 167.66666666666666 18 9 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1561 199 C20140707_OR007_01 C20140707_OR007_01 TB449619.[MT7]-ADTRPWSGPYILR.3y6_1.heavy 559.306 / 718.425 10922.0 34.92509841918945 41 11 10 10 10 0.8442629115945732 64.91213663475057 0.0 3 0.8520245454041371 3.167820784643616 10922.0 67.27235205784204 0.0 - - - - - - - 223.30769230769232 21 13 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1563 199 C20140707_OR007_01 C20140707_OR007_01 TB449619.[MT7]-ADTRPWSGPYILR.3y11_2.heavy 559.306 / 673.372 31719.0 34.92509841918945 41 11 10 10 10 0.8442629115945732 64.91213663475057 0.0 3 0.8520245454041371 3.167820784643616 31719.0 -3.1855523672883805 0.0 - - - - - - - 197.4 63 10 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1565 199 C20140707_OR007_01 C20140707_OR007_01 TB449619.[MT7]-ADTRPWSGPYILR.3y9_1.heavy 559.306 / 1088.59 10805.0 34.92509841918945 41 11 10 10 10 0.8442629115945732 64.91213663475057 0.0 3 0.8520245454041371 3.167820784643616 10805.0 138.9746551724138 0.0 - - - - - - - 248.71428571428572 21 7 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1567 200 C20140707_OR007_01 C20140707_OR007_01 TB418642.[MT7]-LAVC[CAM]QHC[CAM]DLELSILK[MT7].4b8_2.heavy 522.536 / 564.756 6504.0 38.27180099487305 39 9 10 10 10 0.7019038759651092 92.7254667998746 0.0 3 0.8147829540021363 2.8221407743763764 6504.0 15.841836544734896 0.0 - - - - - - - 221.2 13 5 TRAFD1 TRAF-type zinc finger domain containing 1 1569 200 C20140707_OR007_01 C20140707_OR007_01 TB418642.[MT7]-LAVC[CAM]QHC[CAM]DLELSILK[MT7].4b4_1.heavy 522.536 / 588.33 969.0 38.27180099487305 39 9 10 10 10 0.7019038759651092 92.7254667998746 0.0 3 0.8147829540021363 2.8221407743763764 969.0 0.26698795180722884 10.0 - - - - - - - 276.6 8 10 TRAFD1 TRAF-type zinc finger domain containing 1 1571 200 C20140707_OR007_01 C20140707_OR007_01 TB418642.[MT7]-LAVC[CAM]QHC[CAM]DLELSILK[MT7].4b5_1.heavy 522.536 / 716.388 1245.0 38.27180099487305 39 9 10 10 10 0.7019038759651092 92.7254667998746 0.0 3 0.8147829540021363 2.8221407743763764 1245.0 11.179139852456444 0.0 - - - - - - - 184.33333333333334 2 3 TRAFD1 TRAF-type zinc finger domain containing 1 1573 200 C20140707_OR007_01 C20140707_OR007_01 TB418642.[MT7]-LAVC[CAM]QHC[CAM]DLELSILK[MT7].4b10_2.heavy 522.536 / 685.819 6504.0 38.27180099487305 39 9 10 10 10 0.7019038759651092 92.7254667998746 0.0 3 0.8147829540021363 2.8221407743763764 6504.0 29.819783393501805 0.0 - - - - - - - 207.5 13 4 TRAFD1 TRAF-type zinc finger domain containing 1 1575 201 C20140707_OR007_01 C20140707_OR007_01 TB418708.[MT7]-GFSDVFEEEITSGGFC[CAM]GGK[MT7].4y4_1.heavy 578.525 / 565.288 4226.0 43.639774322509766 27 5 10 2 10 0.3780078641358173 118.46123143453295 0.08510208129882812 3 0.662096610433415 2.0601552524760463 4226.0 39.58639943314101 0.0 - - - - - - - 264.125 8 8 DENND1B DENN/MADD domain containing 1B 1577 201 C20140707_OR007_01 C20140707_OR007_01 TB418708.[MT7]-GFSDVFEEEITSGGFC[CAM]GGK[MT7].4b5_1.heavy 578.525 / 650.327 4003.0 43.639774322509766 27 5 10 2 10 0.3780078641358173 118.46123143453295 0.08510208129882812 3 0.662096610433415 2.0601552524760463 4003.0 19.176047904191616 0.0 - - - - - - - 250.125 8 8 DENND1B DENN/MADD domain containing 1B 1579 201 C20140707_OR007_01 C20140707_OR007_01 TB418708.[MT7]-GFSDVFEEEITSGGFC[CAM]GGK[MT7].4y6_1.heavy 578.525 / 769.378 667.0 43.639774322509766 27 5 10 2 10 0.3780078641358173 118.46123143453295 0.08510208129882812 3 0.662096610433415 2.0601552524760463 667.0 3.483928316806015 8.0 - - - - - - - 0.0 1 0 DENND1B DENN/MADD domain containing 1B 1581 201 C20140707_OR007_01 C20140707_OR007_01 TB418708.[MT7]-GFSDVFEEEITSGGFC[CAM]GGK[MT7].4b4_1.heavy 578.525 / 551.258 1779.0 43.639774322509766 27 5 10 2 10 0.3780078641358173 118.46123143453295 0.08510208129882812 3 0.662096610433415 2.0601552524760463 1779.0 20.008752808988767 0.0 - - - - - - - 244.6 3 5 DENND1B DENN/MADD domain containing 1B 1583 202 C20140707_OR007_01 C20140707_OR007_01 TB418506.[MT7]-SC[CAM]VAC[CAM]GNDIALIK[MT7].3y3_1.heavy 570.304 / 517.383 49368.0 32.444801330566406 45 15 10 10 10 2.4790870483378318 32.116948639129085 0.0 3 0.9580743070338099 6.006107540517658 49368.0 33.092139644970416 0.0 - - - - - - - 281.6666666666667 98 3 CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 1585 202 C20140707_OR007_01 C20140707_OR007_01 TB418506.[MT7]-SC[CAM]VAC[CAM]GNDIALIK[MT7].3b4_1.heavy 570.304 / 562.278 54920.0 32.444801330566406 45 15 10 10 10 2.4790870483378318 32.116948639129085 0.0 3 0.9580743070338099 6.006107540517658 54920.0 117.51231474587561 0.0 - - - - - - - 410.4 109 5 CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 1587 202 C20140707_OR007_01 C20140707_OR007_01 TB418506.[MT7]-SC[CAM]VAC[CAM]GNDIALIK[MT7].3y4_1.heavy 570.304 / 588.42 87752.0 32.444801330566406 45 15 10 10 10 2.4790870483378318 32.116948639129085 0.0 3 0.9580743070338099 6.006107540517658 87752.0 87.70406604863126 0.0 - - - - - - - 483.0 175 1 CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 1589 202 C20140707_OR007_01 C20140707_OR007_01 TB418506.[MT7]-SC[CAM]VAC[CAM]GNDIALIK[MT7].3b8_1.heavy 570.304 / 1008.4 43212.0 32.444801330566406 45 15 10 10 10 2.4790870483378318 32.116948639129085 0.0 3 0.9580743070338099 6.006107540517658 43212.0 115.60365013611077 0.0 - - - - - - - 286.625 86 8 CELA3A;CELA3B chymotrypsin-like elastase family, member 3A;chymotrypsin-like elastase family, member 3B 1591 203 C20140707_OR007_01 C20140707_OR007_01 TB438968.[MT7]-ELANIR.2b3_1.heavy 430.26 / 458.273 15897.0 24.51259994506836 50 20 10 10 10 11.661901482664794 8.574930953468282 0.0 3 0.9981061640802712 28.35454163118502 15897.0 34.075416438757934 0.0 - - - - - - - 233.14285714285714 31 7 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1593 203 C20140707_OR007_01 C20140707_OR007_01 TB438968.[MT7]-ELANIR.2y5_1.heavy 430.26 / 586.367 43412.0 24.51259994506836 50 20 10 10 10 11.661901482664794 8.574930953468282 0.0 3 0.9981061640802712 28.35454163118502 43412.0 478.607769517623 0.0 - - - - - - - 204.0 86 7 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1595 203 C20140707_OR007_01 C20140707_OR007_01 TB438968.[MT7]-ELANIR.2b4_1.heavy 430.26 / 572.316 34037.0 24.51259994506836 50 20 10 10 10 11.661901482664794 8.574930953468282 0.0 3 0.9981061640802712 28.35454163118502 34037.0 82.54580311365879 0.0 - - - - - - - 260.6666666666667 68 9 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1597 203 C20140707_OR007_01 C20140707_OR007_01 TB438968.[MT7]-ELANIR.2b5_1.heavy 430.26 / 685.4 2548.0 24.51259994506836 50 20 10 10 10 11.661901482664794 8.574930953468282 0.0 3 0.9981061640802712 28.35454163118502 2548.0 2.5457270294380017 0.0 - - - - - - - 224.4 5 5 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1599 204 C20140707_OR007_01 C20140707_OR007_01 TB419589.[MT7]-SAPTSLQEEEMPMK[MT7].3y10_2.heavy 622.646 / 683.329 7817.0 30.101825714111328 39 15 10 6 8 2.4528679746405877 32.495291276727585 0.0363006591796875 4 0.9556728818553567 5.83996400645843 7817.0 75.89746719698212 0.0 - - - - - - - 234.5 15 8 SLC22A7 solute carrier family 22 (organic anion transporter), member 7 1601 204 C20140707_OR007_01 C20140707_OR007_01 TB419589.[MT7]-SAPTSLQEEEMPMK[MT7].3b4_1.heavy 622.646 / 501.279 9172.0 30.101825714111328 39 15 10 6 8 2.4528679746405877 32.495291276727585 0.0363006591796875 4 0.9556728818553567 5.83996400645843 9172.0 41.63302665814696 1.0 - - - - - - - 648.4444444444445 18 9 SLC22A7 solute carrier family 22 (organic anion transporter), member 7 1603 204 C20140707_OR007_01 C20140707_OR007_01 TB419589.[MT7]-SAPTSLQEEEMPMK[MT7].3b5_1.heavy 622.646 / 588.311 16989.0 30.101825714111328 39 15 10 6 8 2.4528679746405877 32.495291276727585 0.0363006591796875 4 0.9556728818553567 5.83996400645843 16989.0 48.649191708253355 0.0 - - - - - - - 755.625 33 8 SLC22A7 solute carrier family 22 (organic anion transporter), member 7 1605 204 C20140707_OR007_01 C20140707_OR007_01 TB419589.[MT7]-SAPTSLQEEEMPMK[MT7].3y4_1.heavy 622.646 / 650.349 15009.0 30.101825714111328 39 15 10 6 8 2.4528679746405877 32.495291276727585 0.0363006591796875 4 0.9556728818553567 5.83996400645843 15009.0 39.383615999999996 0.0 - - - - - - - 239.6 30 10 SLC22A7 solute carrier family 22 (organic anion transporter), member 7 1607 205 C20140707_OR007_01 C20140707_OR007_01 TB419312.[MT7]-GREDGDAPVTK[MT7].3y3_1.heavy 478.259 / 491.331 4631.0 16.816600799560547 41 13 10 10 8 0.9752353973941598 59.046083380059656 0.0 4 0.9042430813796248 3.9559357827870505 4631.0 34.35537823648729 0.0 - - - - - - - 168.91666666666666 9 12 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1609 205 C20140707_OR007_01 C20140707_OR007_01 TB419312.[MT7]-GREDGDAPVTK[MT7].3b4_1.heavy 478.259 / 602.302 1042.0 16.816600799560547 41 13 10 10 8 0.9752353973941598 59.046083380059656 0.0 4 0.9042430813796248 3.9559357827870505 1042.0 6.718216262239251 0.0 - - - - - - - 202.8 2 10 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1611 205 C20140707_OR007_01 C20140707_OR007_01 TB419312.[MT7]-GREDGDAPVTK[MT7].3y4_1.heavy 478.259 / 588.384 3300.0 16.816600799560547 41 13 10 10 8 0.9752353973941598 59.046083380059656 0.0 4 0.9042430813796248 3.9559357827870505 3300.0 64.67110130056079 1.0 - - - - - - - 178.9090909090909 7 11 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1613 205 C20140707_OR007_01 C20140707_OR007_01 TB419312.[MT7]-GREDGDAPVTK[MT7].3b7_1.heavy 478.259 / 845.387 1563.0 16.816600799560547 41 13 10 10 8 0.9752353973941598 59.046083380059656 0.0 4 0.9042430813796248 3.9559357827870505 1563.0 40.422413793103445 0.0 - - - - - - - 246.0 3 4 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1615 206 C20140707_OR007_01 C20140707_OR007_01 TB449700.[MT7]-IDIPSFDWPIAPFPR.3y7_1.heavy 639.013 / 797.467 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 1617 206 C20140707_OR007_01 C20140707_OR007_01 TB449700.[MT7]-IDIPSFDWPIAPFPR.3y4_1.heavy 639.013 / 516.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 1619 206 C20140707_OR007_01 C20140707_OR007_01 TB449700.[MT7]-IDIPSFDWPIAPFPR.3b7_1.heavy 639.013 / 932.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 1621 206 C20140707_OR007_01 C20140707_OR007_01 TB449700.[MT7]-IDIPSFDWPIAPFPR.3y5_1.heavy 639.013 / 587.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 1623 207 C20140707_OR007_01 C20140707_OR007_01 TB418833.[MT7]-LIQQPQNASMFVNRPALGILPPENFVEK[MT7].4y8_1.heavy 860.476 / 1103.59 23707.0 42.898799896240234 41 11 10 10 10 0.9650102076212946 69.08389791129454 0.0 3 0.8711165130148153 3.4000474618994136 23707.0 26.972396554365048 0.0 - - - - - - - 269.5 47 2 ABAT 4-aminobutyrate aminotransferase 1625 207 C20140707_OR007_01 C20140707_OR007_01 TB418833.[MT7]-LIQQPQNASMFVNRPALGILPPENFVEK[MT7].4y8_2.heavy 860.476 / 552.296 41702.0 42.898799896240234 41 11 10 10 10 0.9650102076212946 69.08389791129454 0.0 3 0.8711165130148153 3.4000474618994136 41702.0 26.997723777955258 0.0 - - - - - - - 108.0 83 1 ABAT 4-aminobutyrate aminotransferase 1627 207 C20140707_OR007_01 C20140707_OR007_01 TB418833.[MT7]-LIQQPQNASMFVNRPALGILPPENFVEK[MT7].4b4_1.heavy 860.476 / 627.395 21983.0 42.898799896240234 41 11 10 10 10 0.9650102076212946 69.08389791129454 0.0 3 0.8711165130148153 3.4000474618994136 21983.0 20.10702092742341 0.0 - - - - - - - 323.0 43 1 ABAT 4-aminobutyrate aminotransferase 1629 207 C20140707_OR007_01 C20140707_OR007_01 TB418833.[MT7]-LIQQPQNASMFVNRPALGILPPENFVEK[MT7].4y7_1.heavy 860.476 / 1006.53 13254.0 42.898799896240234 41 11 10 10 10 0.9650102076212946 69.08389791129454 0.0 3 0.8711165130148153 3.4000474618994136 13254.0 14.236553144862418 0.0 - - - - - - - 269.5 26 4 ABAT 4-aminobutyrate aminotransferase 1631 208 C20140707_OR007_01 C20140707_OR007_01 TB418637.[MT7]-QQHHQPMVQGIPEAGK[MT7].4y5_1.heavy 519.028 / 645.369 6184.0 23.2731990814209 36 8 10 10 8 0.8735353403855596 57.76923531698398 0.0 4 0.7667878857235328 2.504151479550329 6184.0 50.204921597956336 0.0 - - - - - - - 242.14285714285714 12 7 UNC13D unc-13 homolog D (C. elegans) 1633 208 C20140707_OR007_01 C20140707_OR007_01 TB418637.[MT7]-QQHHQPMVQGIPEAGK[MT7].4y4_1.heavy 519.028 / 548.316 2094.0 23.2731990814209 36 8 10 10 8 0.8735353403855596 57.76923531698398 0.0 4 0.7667878857235328 2.504151479550329 2094.0 4.3544288577154315 1.0 - - - - - - - 332.55555555555554 4 9 UNC13D unc-13 homolog D (C. elegans) 1635 208 C20140707_OR007_01 C20140707_OR007_01 TB418637.[MT7]-QQHHQPMVQGIPEAGK[MT7].4b5_1.heavy 519.028 / 803.403 1995.0 23.2731990814209 36 8 10 10 8 0.8735353403855596 57.76923531698398 0.0 4 0.7667878857235328 2.504151479550329 1995.0 21.297792642140468 1.0 - - - - - - - 199.5 3 6 UNC13D unc-13 homolog D (C. elegans) 1637 208 C20140707_OR007_01 C20140707_OR007_01 TB418637.[MT7]-QQHHQPMVQGIPEAGK[MT7].4b3_1.heavy 519.028 / 538.285 1297.0 23.2731990814209 36 8 10 10 8 0.8735353403855596 57.76923531698398 0.0 4 0.7667878857235328 2.504151479550329 1297.0 1.519222631879209 2.0 - - - - - - - 207.91666666666666 4 12 UNC13D unc-13 homolog D (C. elegans) 1639 209 C20140707_OR007_01 C20140707_OR007_01 TB419618.[MT7]-GVSAVAGPHDIGASPGDK[MT7].4b7_1.heavy 481.51 / 686.395 1528.0 24.848524570465088 38 17 8 5 8 4.414795244157696 22.65110712265414 0.04269981384277344 4 0.9770361426056088 8.128405072525387 1528.0 3.596471358680997 1.0 - - - - - - - 218.57142857142858 3 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1641 209 C20140707_OR007_01 C20140707_OR007_01 TB419618.[MT7]-GVSAVAGPHDIGASPGDK[MT7].4b12_2.heavy 481.51 / 603.323 2649.0 24.848524570465088 38 17 8 5 8 4.414795244157696 22.65110712265414 0.04269981384277344 4 0.9770361426056088 8.128405072525387 2649.0 4.623919526956721 1.0 - - - - - - - 181.33333333333334 8 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1643 209 C20140707_OR007_01 C20140707_OR007_01 TB419618.[MT7]-GVSAVAGPHDIGASPGDK[MT7].4b5_1.heavy 481.51 / 558.337 2242.0 24.848524570465088 38 17 8 5 8 4.414795244157696 22.65110712265414 0.04269981384277344 4 0.9770361426056088 8.128405072525387 2242.0 10.916928104575163 0.0 - - - - - - - 246.5 4 12 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1645 209 C20140707_OR007_01 C20140707_OR007_01 TB419618.[MT7]-GVSAVAGPHDIGASPGDK[MT7].4b10_2.heavy 481.51 / 518.271 3362.0 24.848524570465088 38 17 8 5 8 4.414795244157696 22.65110712265414 0.04269981384277344 4 0.9770361426056088 8.128405072525387 3362.0 11.13729445976864 0.0 - - - - - - - 246.5 6 12 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1647 210 C20140707_OR007_01 C20140707_OR007_01 TB418073.[MT7]-TIFMWYR.2y4_1.heavy 580.806 / 655.302 12086.0 43.41360092163086 45 15 10 10 10 5.234889279110708 19.10260077496573 0.0 3 0.953556990144118 5.704359199191502 12086.0 38.837505995203834 0.0 - - - - - - - 253.0 24 7 ABAT 4-aminobutyrate aminotransferase 1649 210 C20140707_OR007_01 C20140707_OR007_01 TB418073.[MT7]-TIFMWYR.2b3_1.heavy 580.806 / 506.31 11982.0 43.41360092163086 45 15 10 10 10 5.234889279110708 19.10260077496573 0.0 3 0.953556990144118 5.704359199191502 11982.0 28.599012345679014 0.0 - - - - - - - 231.55555555555554 23 9 ABAT 4-aminobutyrate aminotransferase 1651 210 C20140707_OR007_01 C20140707_OR007_01 TB418073.[MT7]-TIFMWYR.2y5_1.heavy 580.806 / 802.37 18130.0 43.41360092163086 45 15 10 10 10 5.234889279110708 19.10260077496573 0.0 3 0.953556990144118 5.704359199191502 18130.0 89.42476402979322 0.0 - - - - - - - 169.125 36 8 ABAT 4-aminobutyrate aminotransferase 1653 210 C20140707_OR007_01 C20140707_OR007_01 TB418073.[MT7]-TIFMWYR.2y6_1.heavy 580.806 / 915.455 23652.0 43.41360092163086 45 15 10 10 10 5.234889279110708 19.10260077496573 0.0 3 0.953556990144118 5.704359199191502 23652.0 270.5243857221915 0.0 - - - - - - - 208.3 47 10 ABAT 4-aminobutyrate aminotransferase 1655 211 C20140707_OR007_01 C20140707_OR007_01 TB418070.[MT7]-VVYILEK[MT7].2y4_1.heavy 576.368 / 646.426 13722.0 35.70454978942871 41 18 8 5 10 6.322475078140047 15.816590617454533 0.042499542236328125 3 0.9873427091493009 10.95803896817697 13722.0 16.779242424242423 2.0 - - - - - - - 297.0 90 4 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1657 211 C20140707_OR007_01 C20140707_OR007_01 TB418070.[MT7]-VVYILEK[MT7].2b3_1.heavy 576.368 / 506.31 23353.0 35.70454978942871 41 18 8 5 10 6.322475078140047 15.816590617454533 0.042499542236328125 3 0.9873427091493009 10.95803896817697 23353.0 49.95937541550325 0.0 - - - - - - - 343.2 46 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1659 211 C20140707_OR007_01 C20140707_OR007_01 TB418070.[MT7]-VVYILEK[MT7].2y5_1.heavy 576.368 / 809.489 18999.0 35.70454978942871 41 18 8 5 10 6.322475078140047 15.816590617454533 0.042499542236328125 3 0.9873427091493009 10.95803896817697 18999.0 117.66426136363637 0.0 - - - - - - - 264.0 37 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1661 211 C20140707_OR007_01 C20140707_OR007_01 TB418070.[MT7]-VVYILEK[MT7].2y3_1.heavy 576.368 / 533.341 32853.0 35.70454978942871 41 18 8 5 10 6.322475078140047 15.816590617454533 0.042499542236328125 3 0.9873427091493009 10.95803896817697 32853.0 43.27865385634773 0.0 - - - - - - - 735.4285714285714 65 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1663 212 C20140707_OR007_01 C20140707_OR007_01 TB449888.[MT7]-AFGELC[CAM]PNTAPLPQLVTEALQTGTTEWFHLK[MT7].4b4_1.heavy 940.243 / 549.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1665 212 C20140707_OR007_01 C20140707_OR007_01 TB449888.[MT7]-AFGELC[CAM]PNTAPLPQLVTEALQTGTTEWFHLK[MT7].4b5_1.heavy 940.243 / 662.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1667 212 C20140707_OR007_01 C20140707_OR007_01 TB449888.[MT7]-AFGELC[CAM]PNTAPLPQLVTEALQTGTTEWFHLK[MT7].4y7_1.heavy 940.243 / 1104.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1669 212 C20140707_OR007_01 C20140707_OR007_01 TB449888.[MT7]-AFGELC[CAM]PNTAPLPQLVTEALQTGTTEWFHLK[MT7].4b6_1.heavy 940.243 / 822.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1671 213 C20140707_OR007_01 C20140707_OR007_01 TB449293.[MT7]-ILDEWFGR.2y4_1.heavy 590.318 / 565.288 11928.0 44.42919921875 41 11 10 10 10 14.988187809962524 6.6719206663217046 0.0 3 0.8783827226431485 3.502367317767523 11928.0 95.4980773709406 0.0 - - - - - - - 280.7142857142857 23 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1673 213 C20140707_OR007_01 C20140707_OR007_01 TB449293.[MT7]-ILDEWFGR.2y5_1.heavy 590.318 / 694.331 26477.0 44.42919921875 41 11 10 10 10 14.988187809962524 6.6719206663217046 0.0 3 0.8783827226431485 3.502367317767523 26477.0 94.48853053435116 0.0 - - - - - - - 205.85714285714286 52 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1675 213 C20140707_OR007_01 C20140707_OR007_01 TB449293.[MT7]-ILDEWFGR.2y6_1.heavy 590.318 / 809.358 10224.0 44.42919921875 41 11 10 10 10 14.988187809962524 6.6719206663217046 0.0 3 0.8783827226431485 3.502367317767523 10224.0 75.31419847328243 0.0 - - - - - - - 224.57142857142858 20 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1677 213 C20140707_OR007_01 C20140707_OR007_01 TB449293.[MT7]-ILDEWFGR.2y7_1.heavy 590.318 / 922.442 9306.0 44.42919921875 41 11 10 10 10 14.988187809962524 6.6719206663217046 0.0 3 0.8783827226431485 3.502367317767523 9306.0 87.61374045801526 0.0 - - - - - - - 276.55555555555554 18 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1679 214 C20140707_OR007_01 C20140707_OR007_01 TB439600.[MT7]-AFESDVFHNRTTNQR.4y5_1.heavy 492.247 / 619.316 403.0 26.28605079650879 36 13 10 3 10 2.261394284318906 34.86901054309915 0.07139968872070312 3 0.9224556008234553 4.402911481815033 403.0 1.6013245033112584 26.0 - - - - - - - 0.0 1 0 TRAFD1 TRAF-type zinc finger domain containing 1 1681 214 C20140707_OR007_01 C20140707_OR007_01 TB439600.[MT7]-AFESDVFHNRTTNQR.4y8_2.heavy 492.247 / 513.763 2918.0 26.28605079650879 36 13 10 3 10 2.261394284318906 34.86901054309915 0.07139968872070312 3 0.9224556008234553 4.402911481815033 2918.0 3.864900662251656 0.0 - - - - - - - 184.66666666666666 5 6 TRAFD1 TRAF-type zinc finger domain containing 1 1683 214 C20140707_OR007_01 C20140707_OR007_01 TB439600.[MT7]-AFESDVFHNRTTNQR.4y9_2.heavy 492.247 / 587.297 5736.0 26.28605079650879 36 13 10 3 10 2.261394284318906 34.86901054309915 0.07139968872070312 3 0.9224556008234553 4.402911481815033 5736.0 24.098619400223967 0.0 - - - - - - - 173.9090909090909 11 11 TRAFD1 TRAF-type zinc finger domain containing 1 1685 214 C20140707_OR007_01 C20140707_OR007_01 TB439600.[MT7]-AFESDVFHNRTTNQR.4b4_1.heavy 492.247 / 579.289 2113.0 26.28605079650879 36 13 10 3 10 2.261394284318906 34.86901054309915 0.07139968872070312 3 0.9224556008234553 4.402911481815033 2113.0 14.989622417712761 0.0 - - - - - - - 222.92857142857142 4 14 TRAFD1 TRAF-type zinc finger domain containing 1 1687 215 C20140707_OR007_01 C20140707_OR007_01 TB418249.[MT7]-GNYLVDVDGNR.2y8_1.heavy 683.348 / 887.458 2608.0 29.92930030822754 42 12 10 10 10 1.521533865165343 54.11984136163857 0.0 3 0.8960663857871272 3.794452086039138 2608.0 32.80877438351122 0.0 - - - - - - - 191.16666666666666 5 6 ABAT 4-aminobutyrate aminotransferase 1689 215 C20140707_OR007_01 C20140707_OR007_01 TB418249.[MT7]-GNYLVDVDGNR.2y5_1.heavy 683.348 / 560.279 5216.0 29.92930030822754 42 12 10 10 10 1.521533865165343 54.11984136163857 0.0 3 0.8960663857871272 3.794452086039138 5216.0 21.240329076451758 0.0 - - - - - - - 208.5 10 12 ABAT 4-aminobutyrate aminotransferase 1691 215 C20140707_OR007_01 C20140707_OR007_01 TB418249.[MT7]-GNYLVDVDGNR.2b4_1.heavy 683.348 / 592.321 8449.0 29.92930030822754 42 12 10 10 10 1.521533865165343 54.11984136163857 0.0 3 0.8960663857871272 3.794452086039138 8449.0 52.18326070244282 0.0 - - - - - - - 238.42857142857142 16 14 ABAT 4-aminobutyrate aminotransferase 1693 215 C20140707_OR007_01 C20140707_OR007_01 TB418249.[MT7]-GNYLVDVDGNR.2y7_1.heavy 683.348 / 774.374 2816.0 29.92930030822754 42 12 10 10 10 1.521533865165343 54.11984136163857 0.0 3 0.8960663857871272 3.794452086039138 2816.0 8.32582036607136 0.0 - - - - - - - 295.5 5 12 ABAT 4-aminobutyrate aminotransferase 1695 216 C20140707_OR007_01 C20140707_OR007_01 TB419198.[MT7]-MFIFYGNK[MT7].2y4_1.heavy 654.357 / 625.343 3020.0 39.681875228881836 34 13 10 1 10 0.9930755135614467 60.96633813698968 0.0980987548828125 3 0.9049348644379961 3.970540467549563 3020.0 10.142419568434994 1.0 - - - - - - - 291.875 6 8 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1697 216 C20140707_OR007_01 C20140707_OR007_01 TB419198.[MT7]-MFIFYGNK[MT7].2b3_1.heavy 654.357 / 536.302 2059.0 39.681875228881836 34 13 10 1 10 0.9930755135614467 60.96633813698968 0.0980987548828125 3 0.9049348644379961 3.970540467549563 2059.0 14.829197080291971 3.0 - - - - - - - 247.0 4 5 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1699 216 C20140707_OR007_01 C20140707_OR007_01 TB419198.[MT7]-MFIFYGNK[MT7].2y5_1.heavy 654.357 / 772.411 4118.0 39.681875228881836 34 13 10 1 10 0.9930755135614467 60.96633813698968 0.0980987548828125 3 0.9049348644379961 3.970540467549563 4118.0 10.853209642059747 0.0 - - - - - - - 274.625 8 8 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1701 216 C20140707_OR007_01 C20140707_OR007_01 TB419198.[MT7]-MFIFYGNK[MT7].2y7_1.heavy 654.357 / 1032.56 5079.0 39.681875228881836 34 13 10 1 10 0.9930755135614467 60.96633813698968 0.0980987548828125 3 0.9049348644379961 3.970540467549563 5079.0 33.82826173666786 0.0 - - - - - - - 274.8 10 5 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1703 217 C20140707_OR007_01 C20140707_OR007_01 TB439707.[MT7]-YK[MT7]PGEPITFC[CAM]EESFVK[MT7].3y7_1.heavy 788.415 / 1042.5 2893.0 35.5989990234375 47 17 10 10 10 4.779005142060585 20.924857167423458 0.0 3 0.9765080583200232 8.036168335582913 2893.0 20.205079365079364 0.0 - - - - - - - 201.6 5 5 DENND1B DENN/MADD domain containing 1B 1705 217 C20140707_OR007_01 C20140707_OR007_01 TB439707.[MT7]-YK[MT7]PGEPITFC[CAM]EESFVK[MT7].3b5_1.heavy 788.415 / 863.487 4276.0 35.5989990234375 47 17 10 10 10 4.779005142060585 20.924857167423458 0.0 3 0.9765080583200232 8.036168335582913 4276.0 58.37079365079366 0.0 - - - - - - - 189.0 8 4 DENND1B DENN/MADD domain containing 1B 1707 217 C20140707_OR007_01 C20140707_OR007_01 TB439707.[MT7]-YK[MT7]PGEPITFC[CAM]EESFVK[MT7].3y4_1.heavy 788.415 / 624.384 3521.0 35.5989990234375 47 17 10 10 10 4.779005142060585 20.924857167423458 0.0 3 0.9765080583200232 8.036168335582913 3521.0 25.57556817703732 1.0 - - - - - - - 220.25 10 4 DENND1B DENN/MADD domain containing 1B 1709 217 C20140707_OR007_01 C20140707_OR007_01 TB439707.[MT7]-YK[MT7]PGEPITFC[CAM]EESFVK[MT7].3y5_1.heavy 788.415 / 753.426 2893.0 35.5989990234375 47 17 10 10 10 4.779005142060585 20.924857167423458 0.0 3 0.9765080583200232 8.036168335582913 2893.0 43.624603174603166 0.0 - - - - - - - 126.0 5 5 DENND1B DENN/MADD domain containing 1B 1711 218 C20140707_OR007_01 C20140707_OR007_01 TB449638.[MT7]-ELEK[MT7]PIFC[CAM]LK[MT7].3y3_1.heavy 570.339 / 564.33 5411.0 35.449100494384766 42 17 10 5 10 1.9979696573713688 36.131678196002255 0.04360198974609375 3 0.9732236985145987 7.525116293071648 5411.0 4.814743534743535 1.0 - - - - - - - 1769.2857142857142 10 7 UNC13D unc-13 homolog D (C. elegans) 1713 218 C20140707_OR007_01 C20140707_OR007_01 TB449638.[MT7]-ELEK[MT7]PIFC[CAM]LK[MT7].3y6_1.heavy 570.339 / 921.535 3247.0 35.449100494384766 42 17 10 5 10 1.9979696573713688 36.131678196002255 0.04360198974609375 3 0.9732236985145987 7.525116293071648 3247.0 17.95844925124792 0.0 - - - - - - - 240.36363636363637 6 11 UNC13D unc-13 homolog D (C. elegans) 1715 218 C20140707_OR007_01 C20140707_OR007_01 TB449638.[MT7]-ELEK[MT7]PIFC[CAM]LK[MT7].3b3_1.heavy 570.339 / 516.279 3006.0 35.449100494384766 42 17 10 5 10 1.9979696573713688 36.131678196002255 0.04360198974609375 3 0.9732236985145987 7.525116293071648 3006.0 22.896057007125894 3.0 - - - - - - - 360.6666666666667 6 6 UNC13D unc-13 homolog D (C. elegans) 1717 218 C20140707_OR007_01 C20140707_OR007_01 TB449638.[MT7]-ELEK[MT7]PIFC[CAM]LK[MT7].3y4_1.heavy 570.339 / 711.398 5291.0 35.449100494384766 42 17 10 5 10 1.9979696573713688 36.131678196002255 0.04360198974609375 3 0.9732236985145987 7.525116293071648 5291.0 26.08818080976151 1.0 - - - - - - - 196.45454545454547 10 11 UNC13D unc-13 homolog D (C. elegans) 1719 219 C20140707_OR007_01 C20140707_OR007_01 TB439496.[MT7]-QIEALDPPMRLPR.2b3_1.heavy 840.473 / 515.295 1386.0 34.69060134887695 45 15 10 10 10 3.174413784384963 31.501879336557508 0.0 3 0.957775699556902 5.984681198275738 1386.0 6.764999999999999 5.0 - - - - - - - 162.0 4 7 TRAFD1 TRAF-type zinc finger domain containing 1 1721 219 C20140707_OR007_01 C20140707_OR007_01 TB439496.[MT7]-QIEALDPPMRLPR.2b4_1.heavy 840.473 / 586.332 2267.0 34.69060134887695 45 15 10 10 10 3.174413784384963 31.501879336557508 0.0 3 0.957775699556902 5.984681198275738 2267.0 9.895634920634919 0.0 - - - - - - - 252.0 4 4 TRAFD1 TRAF-type zinc finger domain containing 1 1723 219 C20140707_OR007_01 C20140707_OR007_01 TB439496.[MT7]-QIEALDPPMRLPR.2b6_1.heavy 840.473 / 814.443 5165.0 34.69060134887695 45 15 10 10 10 3.174413784384963 31.501879336557508 0.0 3 0.957775699556902 5.984681198275738 5165.0 20.05200755845397 1.0 - - - - - - - 210.0 12 6 TRAFD1 TRAF-type zinc finger domain containing 1 1725 219 C20140707_OR007_01 C20140707_OR007_01 TB439496.[MT7]-QIEALDPPMRLPR.2y7_1.heavy 840.473 / 866.503 5668.0 34.69060134887695 45 15 10 10 10 3.174413784384963 31.501879336557508 0.0 3 0.957775699556902 5.984681198275738 5668.0 42.71242857142857 0.0 - - - - - - - 201.6 11 5 TRAFD1 TRAF-type zinc finger domain containing 1 1727 220 C20140707_OR007_01 C20140707_OR007_01 TB449401.[MT7]-YPLEEFVK[MT7].2y4_1.heavy 656.873 / 666.394 2712.0 38.86934947967529 37 16 10 5 6 2.620667432577845 31.485465254838907 0.047000885009765625 6 0.9623470829440841 6.340023181259974 2712.0 -1.0501452081316556 2.0 - - - - - - - 301.0 9 3 ABAT 4-aminobutyrate aminotransferase 1729 220 C20140707_OR007_01 C20140707_OR007_01 TB449401.[MT7]-YPLEEFVK[MT7].2y5_1.heavy 656.873 / 795.437 1937.0 38.86934947967529 37 16 10 5 6 2.620667432577845 31.485465254838907 0.047000885009765625 6 0.9623470829440841 6.340023181259974 1937.0 0.30790970911281523 5.0 - - - - - - - 301.0 5 3 ABAT 4-aminobutyrate aminotransferase 1731 220 C20140707_OR007_01 C20140707_OR007_01 TB449401.[MT7]-YPLEEFVK[MT7].2y3_1.heavy 656.873 / 537.352 2453.0 38.86934947967529 37 16 10 5 6 2.620667432577845 31.485465254838907 0.047000885009765625 6 0.9623470829440841 6.340023181259974 2453.0 0.44403523158055397 4.0 - - - - - - - 322.5 5 2 ABAT 4-aminobutyrate aminotransferase 1733 220 C20140707_OR007_01 C20140707_OR007_01 TB449401.[MT7]-YPLEEFVK[MT7].2y7_1.heavy 656.873 / 1005.57 18852.0 38.86934947967529 37 16 10 5 6 2.620667432577845 31.485465254838907 0.047000885009765625 6 0.9623470829440841 6.340023181259974 18852.0 6.887432708278855 1.0 - - - - - - - 129.0 39 2 ABAT 4-aminobutyrate aminotransferase 1735 221 C20140707_OR007_01 C20140707_OR007_01 TB449830.[MT7]-ENQQEEARC[CAM]LEEVEDLIVK[MT7].4b11_2.heavy 655.585 / 766.35 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 1737 221 C20140707_OR007_01 C20140707_OR007_01 TB449830.[MT7]-ENQQEEARC[CAM]LEEVEDLIVK[MT7].4b15_2.heavy 655.585 / 1002.44 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 1739 221 C20140707_OR007_01 C20140707_OR007_01 TB449830.[MT7]-ENQQEEARC[CAM]LEEVEDLIVK[MT7].4b12_2.heavy 655.585 / 830.871 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 1741 221 C20140707_OR007_01 C20140707_OR007_01 TB449830.[MT7]-ENQQEEARC[CAM]LEEVEDLIVK[MT7].4y3_1.heavy 655.585 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABAT 4-aminobutyrate aminotransferase 1743 222 C20140707_OR007_01 C20140707_OR007_01 TB438970.[MT7]-EVPDTR.2b3_1.heavy 430.733 / 470.273 732.0 17.51110076904297 47 17 10 10 10 3.2968092826052624 26.036305203660596 0.0 3 0.9795990368277468 8.625731218406914 732.0 4.0 4.0 - - - - - - - 160.8181818181818 2 11 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1745 222 C20140707_OR007_01 C20140707_OR007_01 TB438970.[MT7]-EVPDTR.2y4_1.heavy 430.733 / 488.246 5005.0 17.51110076904297 47 17 10 10 10 3.2968092826052624 26.036305203660596 0.0 3 0.9795990368277468 8.625731218406914 5005.0 114.04836065573771 0.0 - - - - - - - 213.5 10 12 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1747 222 C20140707_OR007_01 C20140707_OR007_01 TB438970.[MT7]-EVPDTR.2y5_1.heavy 430.733 / 587.315 3784.0 17.51110076904297 47 17 10 10 10 3.2968092826052624 26.036305203660596 0.0 3 0.9795990368277468 8.625731218406914 3784.0 25.699297423887586 0.0 - - - - - - - 222.21428571428572 7 14 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1749 222 C20140707_OR007_01 C20140707_OR007_01 TB438970.[MT7]-EVPDTR.2b4_1.heavy 430.733 / 585.3 16480.0 17.51110076904297 47 17 10 10 10 3.2968092826052624 26.036305203660596 0.0 3 0.9795990368277468 8.625731218406914 16480.0 402.544262295082 0.0 - - - - - - - 165.57142857142858 32 7 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1751 223 C20140707_OR007_01 C20140707_OR007_01 TB439339.[MT7]-GREDGDAPVTK[MT7].2y4_1.heavy 716.885 / 588.384 584.0 16.826100826263428 26 14 0 6 6 3.0612275850913493 25.974792555399425 0.03800010681152344 5 0.9423816275948393 5.116514557416814 584.0 5.064952152053954 6.0 - - - - - - - 174.91666666666666 12 12 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1753 223 C20140707_OR007_01 C20140707_OR007_01 TB439339.[MT7]-GREDGDAPVTK[MT7].2b4_1.heavy 716.885 / 602.302 1051.0 16.826100826263428 26 14 0 6 6 3.0612275850913493 25.974792555399425 0.03800010681152344 5 0.9423816275948393 5.116514557416814 1051.0 6.288034188034188 0.0 - - - - - - - 111.36363636363636 2 11 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1755 223 C20140707_OR007_01 C20140707_OR007_01 TB439339.[MT7]-GREDGDAPVTK[MT7].2b7_1.heavy 716.885 / 845.387 350.0 16.826100826263428 26 14 0 6 6 3.0612275850913493 25.974792555399425 0.03800010681152344 5 0.9423816275948393 5.116514557416814 350.0 8.965590922487474 2.0 - - - - - - - 155.33333333333334 2 3 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1757 223 C20140707_OR007_01 C20140707_OR007_01 TB439339.[MT7]-GREDGDAPVTK[MT7].2b9_1.heavy 716.885 / 1041.51 642.0 16.826100826263428 26 14 0 6 6 3.0612275850913493 25.974792555399425 0.03800010681152344 5 0.9423816275948393 5.116514557416814 642.0 4.762871794871796 0.0 - - - - - - - 0.0 1 0 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1759 224 C20140707_OR007_01 C20140707_OR007_01 TB439607.[MT7]-VGGYILGEFGNLIAGDPR.3b6_1.heavy 664.694 / 747.452 1470.0 50.468350410461426 45 20 10 5 10 7.766978183565256 12.875020070430693 0.041797637939453125 3 0.9908915752562764 12.921428709215554 1470.0 1.2970588235294116 1.0 - - - - - - - 231.53846153846155 2 13 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1761 224 C20140707_OR007_01 C20140707_OR007_01 TB439607.[MT7]-VGGYILGEFGNLIAGDPR.3b4_1.heavy 664.694 / 521.284 3221.0 50.468350410461426 45 20 10 5 10 7.766978183565256 12.875020070430693 0.041797637939453125 3 0.9908915752562764 12.921428709215554 3221.0 16.71852380952381 0.0 - - - - - - - 238.0 6 10 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1763 224 C20140707_OR007_01 C20140707_OR007_01 TB439607.[MT7]-VGGYILGEFGNLIAGDPR.3b5_1.heavy 664.694 / 634.368 3501.0 50.468350410461426 45 20 10 5 10 7.766978183565256 12.875020070430693 0.041797637939453125 3 0.9908915752562764 12.921428709215554 3501.0 12.575020408163265 0.0 - - - - - - - 264.44444444444446 7 9 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1765 224 C20140707_OR007_01 C20140707_OR007_01 TB439607.[MT7]-VGGYILGEFGNLIAGDPR.3b8_1.heavy 664.694 / 933.516 1610.0 50.468350410461426 45 20 10 5 10 7.766978183565256 12.875020070430693 0.041797637939453125 3 0.9908915752562764 12.921428709215554 1610.0 32.797999999999995 0.0 - - - - - - - 84.0 3 5 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1767 225 C20140707_OR007_01 C20140707_OR007_01 TB418446.[MT7]-DC[CAM]PQDFVARPK[MT7].3y7_1.heavy 540.952 / 976.57 8051.0 25.32699966430664 45 15 10 10 10 2.8800037485431114 34.722177028618916 0.0 3 0.9501280609011533 5.503165621837151 8051.0 115.23980392156864 0.0 - - - - - - - 285.6 16 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1769 225 C20140707_OR007_01 C20140707_OR007_01 TB418446.[MT7]-DC[CAM]PQDFVARPK[MT7].3y6_1.heavy 540.952 / 861.543 5605.0 25.32699966430664 45 15 10 10 10 2.8800037485431114 34.722177028618916 0.0 3 0.9501280609011533 5.503165621837151 5605.0 12.43872549019608 1.0 - - - - - - - 221.0 11 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1771 225 C20140707_OR007_01 C20140707_OR007_01 TB418446.[MT7]-DC[CAM]PQDFVARPK[MT7].3b5_1.heavy 540.952 / 760.305 20381.0 25.32699966430664 45 15 10 10 10 2.8800037485431114 34.722177028618916 0.0 3 0.9501280609011533 5.503165621837151 20381.0 90.23845667299177 0.0 - - - - - - - 140.25 40 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1773 225 C20140707_OR007_01 C20140707_OR007_01 TB418446.[MT7]-DC[CAM]PQDFVARPK[MT7].3y9_2.heavy 540.952 / 601.344 18241.0 25.32699966430664 45 15 10 10 10 2.8800037485431114 34.722177028618916 0.0 3 0.9501280609011533 5.503165621837151 18241.0 56.101978887897715 0.0 - - - - - - - 221.0 36 12 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1775 226 C20140707_OR007_01 C20140707_OR007_01 TB439591.[MT7]-AVQMDELVPLGELTK[MT7].2y8_1.heavy 966.042 / 1000.62 2889.0 43.43490028381348 36 15 10 5 6 4.330631864747546 23.091318570397465 0.042598724365234375 5 0.9558082083510262 5.848965948377202 2889.0 28.853467451168914 1.0 - - - - - - - 206.3 8 10 UNC13D unc-13 homolog D (C. elegans) 1777 226 C20140707_OR007_01 C20140707_OR007_01 TB439591.[MT7]-AVQMDELVPLGELTK[MT7].2b6_1.heavy 966.042 / 818.383 2064.0 43.43490028381348 36 15 10 5 6 4.330631864747546 23.091318570397465 0.042598724365234375 5 0.9558082083510262 5.848965948377202 2064.0 4.856513239565199 1.0 - - - - - - - 309.8 7 10 UNC13D unc-13 homolog D (C. elegans) 1779 226 C20140707_OR007_01 C20140707_OR007_01 TB439591.[MT7]-AVQMDELVPLGELTK[MT7].2b5_1.heavy 966.042 / 689.341 3302.0 43.43490028381348 36 15 10 5 6 4.330631864747546 23.091318570397465 0.042598724365234375 5 0.9558082083510262 5.848965948377202 3302.0 41.69744503601628 2.0 - - - - - - - 272.1818181818182 9 11 UNC13D unc-13 homolog D (C. elegans) 1781 226 C20140707_OR007_01 C20140707_OR007_01 TB439591.[MT7]-AVQMDELVPLGELTK[MT7].2y7_1.heavy 966.042 / 901.547 11248.0 43.43490028381348 36 15 10 5 6 4.330631864747546 23.091318570397465 0.042598724365234375 5 0.9558082083510262 5.848965948377202 11248.0 61.069356869483705 0.0 - - - - - - - 232.0 22 8 UNC13D unc-13 homolog D (C. elegans) 1783 227 C20140707_OR007_01 C20140707_OR007_01 TB439590.[MT7]-AVQMDELVPLGELTK[MT7].3y7_1.heavy 644.364 / 901.547 24381.0 43.456199645996094 47 17 10 10 10 2.0774938305532715 38.38149112789984 0.0 3 0.9721334705509547 7.375767391434856 24381.0 93.93015874532374 0.0 - - - - - - - 223.14285714285714 48 7 UNC13D unc-13 homolog D (C. elegans) 1785 227 C20140707_OR007_01 C20140707_OR007_01 TB439590.[MT7]-AVQMDELVPLGELTK[MT7].3b6_1.heavy 644.364 / 818.383 26257.0 43.456199645996094 47 17 10 10 10 2.0774938305532715 38.38149112789984 0.0 3 0.9721334705509547 7.375767391434856 26257.0 119.18564017891373 0.0 - - - - - - - 239.7 52 10 UNC13D unc-13 homolog D (C. elegans) 1787 227 C20140707_OR007_01 C20140707_OR007_01 TB439590.[MT7]-AVQMDELVPLGELTK[MT7].3b5_1.heavy 644.364 / 689.341 13441.0 43.456199645996094 47 17 10 10 10 2.0774938305532715 38.38149112789984 0.0 3 0.9721334705509547 7.375767391434856 13441.0 72.63364728555027 0.0 - - - - - - - 250.1 26 10 UNC13D unc-13 homolog D (C. elegans) 1789 227 C20140707_OR007_01 C20140707_OR007_01 TB439590.[MT7]-AVQMDELVPLGELTK[MT7].3y5_1.heavy 644.364 / 691.411 12191.0 43.456199645996094 47 17 10 10 10 2.0774938305532715 38.38149112789984 0.0 3 0.9721334705509547 7.375767391434856 12191.0 26.756917155489504 1.0 - - - - - - - 286.625 35 8 UNC13D unc-13 homolog D (C. elegans) 1791 228 C20140707_OR007_01 C20140707_OR007_01 TB449517.[MT7]-GQDDFLGNVVLR.2y8_1.heavy 738.9 / 917.557 4428.0 39.50080108642578 45 15 10 10 10 1.6409299000034894 42.30256727258768 0.0 3 0.9529072831082986 5.664560837335196 4428.0 21.667533498759305 0.0 - - - - - - - 238.44444444444446 8 9 UNC13D unc-13 homolog D (C. elegans) 1793 228 C20140707_OR007_01 C20140707_OR007_01 TB449517.[MT7]-GQDDFLGNVVLR.2y9_1.heavy 738.9 / 1032.58 5636.0 39.50080108642578 45 15 10 10 10 1.6409299000034894 42.30256727258768 0.0 3 0.9529072831082986 5.664560837335196 5636.0 49.32569756675679 0.0 - - - - - - - 229.85714285714286 11 7 UNC13D unc-13 homolog D (C. elegans) 1795 228 C20140707_OR007_01 C20140707_OR007_01 TB449517.[MT7]-GQDDFLGNVVLR.2b4_1.heavy 738.9 / 560.243 4965.0 39.50080108642578 45 15 10 10 10 1.6409299000034894 42.30256727258768 0.0 3 0.9529072831082986 5.664560837335196 4965.0 8.671565495207666 0.0 - - - - - - - 201.125 9 8 UNC13D unc-13 homolog D (C. elegans) 1797 228 C20140707_OR007_01 C20140707_OR007_01 TB449517.[MT7]-GQDDFLGNVVLR.2b5_1.heavy 738.9 / 707.312 2281.0 39.50080108642578 45 15 10 10 10 1.6409299000034894 42.30256727258768 0.0 3 0.9529072831082986 5.664560837335196 2281.0 18.72107524968303 0.0 - - - - - - - 246.0 4 6 UNC13D unc-13 homolog D (C. elegans) 1799 229 C20140707_OR007_01 C20140707_OR007_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 225520.0 43.91189956665039 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 225520.0 373.19922580645164 0.0 - - - - - - - 330.6 451 10 1801 229 C20140707_OR007_01 C20140707_OR007_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 321433.0 43.91189956665039 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 321433.0 545.241865530303 0.0 - - - - - - - 206.8 642 5 1803 229 C20140707_OR007_01 C20140707_OR007_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 234409.0 43.91189956665039 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 234409.0 125.85958564906366 0.0 - - - - - - - 263.0 468 11 1805 230 C20140707_OR007_01 C20140707_OR007_01 TB439075.[MT7]-VQHSNAK[MT7].2b3_1.heavy 536.311 / 509.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1807 230 C20140707_OR007_01 C20140707_OR007_01 TB439075.[MT7]-VQHSNAK[MT7].2y4_1.heavy 536.311 / 563.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1809 230 C20140707_OR007_01 C20140707_OR007_01 TB439075.[MT7]-VQHSNAK[MT7].2y5_1.heavy 536.311 / 700.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1811 230 C20140707_OR007_01 C20140707_OR007_01 TB439075.[MT7]-VQHSNAK[MT7].2y6_1.heavy 536.311 / 828.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 1813 231 C20140707_OR007_01 C20140707_OR007_01 TB418239.[MT7]-TPC[CAM]YITGWGR.3b4_1.heavy 452.228 / 666.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A chymotrypsin-like elastase family, member 3A 1815 231 C20140707_OR007_01 C20140707_OR007_01 TB418239.[MT7]-TPC[CAM]YITGWGR.3y4_1.heavy 452.228 / 475.241 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A chymotrypsin-like elastase family, member 3A 1817 231 C20140707_OR007_01 C20140707_OR007_01 TB418239.[MT7]-TPC[CAM]YITGWGR.3b3_1.heavy 452.228 / 503.24 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A chymotrypsin-like elastase family, member 3A 1819 231 C20140707_OR007_01 C20140707_OR007_01 TB418239.[MT7]-TPC[CAM]YITGWGR.3y5_1.heavy 452.228 / 576.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A chymotrypsin-like elastase family, member 3A 1821 232 C20140707_OR007_01 C20140707_OR007_01 TB449768.[MT7]-VYGTVFHINHGNPFNLK[MT7].4b4_1.heavy 562.058 / 565.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLYAT glycine-N-acyltransferase 1823 232 C20140707_OR007_01 C20140707_OR007_01 TB449768.[MT7]-VYGTVFHINHGNPFNLK[MT7].4b5_1.heavy 562.058 / 664.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLYAT glycine-N-acyltransferase 1825 232 C20140707_OR007_01 C20140707_OR007_01 TB449768.[MT7]-VYGTVFHINHGNPFNLK[MT7].4y3_1.heavy 562.058 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLYAT glycine-N-acyltransferase 1827 232 C20140707_OR007_01 C20140707_OR007_01 TB449768.[MT7]-VYGTVFHINHGNPFNLK[MT7].4b6_1.heavy 562.058 / 811.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLYAT glycine-N-acyltransferase 1829 233 C20140707_OR007_01 C20140707_OR007_01 TB449388.[MT7]-ATSVYLVQK[MT7].2y4_1.heavy 648.892 / 631.426 5680.0 28.83234977722168 42 16 10 6 10 2.5835013646863727 26.61869619015411 0.03620147705078125 3 0.9664544057396482 6.719284549217865 5680.0 5.286280801672415 2.0 - - - - - - - 746.875 14 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1831 233 C20140707_OR007_01 C20140707_OR007_01 TB449388.[MT7]-ATSVYLVQK[MT7].2y5_1.heavy 648.892 / 794.489 11557.0 28.83234977722168 42 16 10 6 10 2.5835013646863727 26.61869619015411 0.03620147705078125 3 0.9664544057396482 6.719284549217865 11557.0 55.886840983054654 0.0 - - - - - - - 213.8181818181818 23 11 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1833 233 C20140707_OR007_01 C20140707_OR007_01 TB449388.[MT7]-ATSVYLVQK[MT7].2y3_1.heavy 648.892 / 518.342 7639.0 28.83234977722168 42 16 10 6 10 2.5835013646863727 26.61869619015411 0.03620147705078125 3 0.9664544057396482 6.719284549217865 7639.0 19.710651451272902 0.0 - - - - - - - 233.69230769230768 15 13 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1835 233 C20140707_OR007_01 C20140707_OR007_01 TB449388.[MT7]-ATSVYLVQK[MT7].2b5_1.heavy 648.892 / 666.358 7933.0 28.83234977722168 42 16 10 6 10 2.5835013646863727 26.61869619015411 0.03620147705078125 3 0.9664544057396482 6.719284549217865 7933.0 27.13485663560128 0.0 - - - - - - - 273.0 15 14 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1837 234 C20140707_OR007_01 C20140707_OR007_01 TB449287.[MT7]-AAITSYEK[MT7].2y4_1.heavy 585.834 / 670.353 9870.0 24.08650016784668 50 20 10 10 10 7.771727857603926 12.867151530809089 0.0 3 0.9936620858106493 15.493857186441295 9870.0 52.395514568297244 0.0 - - - - - - - 213.0 19 10 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 1839 234 C20140707_OR007_01 C20140707_OR007_01 TB449287.[MT7]-AAITSYEK[MT7].2y5_1.heavy 585.834 / 771.401 21190.0 24.08650016784668 50 20 10 10 10 7.771727857603926 12.867151530809089 0.0 3 0.9936620858106493 15.493857186441295 21190.0 55.751929252189996 0.0 - - - - - - - 242.0 42 6 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 1841 234 C20140707_OR007_01 C20140707_OR007_01 TB449287.[MT7]-AAITSYEK[MT7].2y3_1.heavy 585.834 / 583.321 6193.0 24.08650016784668 50 20 10 10 10 7.771727857603926 12.867151530809089 0.0 3 0.9936620858106493 15.493857186441295 6193.0 39.17533758006991 0.0 - - - - - - - 290.3333333333333 12 6 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 1843 234 C20140707_OR007_01 C20140707_OR007_01 TB449287.[MT7]-AAITSYEK[MT7].2y7_1.heavy 585.834 / 955.522 8708.0 24.08650016784668 50 20 10 10 10 7.771727857603926 12.867151530809089 0.0 3 0.9936620858106493 15.493857186441295 8708.0 83.65789800154153 1.0 - - - - - - - 116.4 17 5 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 1845 235 C20140707_OR007_01 C20140707_OR007_01 TB449622.[MT7]-QIEALDPPMRLPR.3y6_1.heavy 560.651 / 769.45 6762.0 34.63059997558594 42 17 10 5 10 4.94390150408998 20.22694018423956 0.04000091552734375 3 0.9744769312679442 7.7084642249706885 6762.0 7.509665735527516 0.0 - - - - - - - 291.625 13 8 TRAFD1 TRAF-type zinc finger domain containing 1 1847 235 C20140707_OR007_01 C20140707_OR007_01 TB449622.[MT7]-QIEALDPPMRLPR.3b6_1.heavy 560.651 / 814.443 33575.0 34.63059997558594 42 17 10 5 10 4.94390150408998 20.22694018423956 0.04000091552734375 3 0.9744769312679442 7.7084642249706885 33575.0 66.88115080763897 0.0 - - - - - - - 350.0 67 2 TRAFD1 TRAF-type zinc finger domain containing 1 1849 235 C20140707_OR007_01 C20140707_OR007_01 TB449622.[MT7]-QIEALDPPMRLPR.3b4_1.heavy 560.651 / 586.332 23316.0 34.63059997558594 42 17 10 5 10 4.94390150408998 20.22694018423956 0.04000091552734375 3 0.9744769312679442 7.7084642249706885 23316.0 39.98487187177907 0.0 - - - - - - - 279.8 46 5 TRAFD1 TRAF-type zinc finger domain containing 1 1851 235 C20140707_OR007_01 C20140707_OR007_01 TB449622.[MT7]-QIEALDPPMRLPR.3b3_1.heavy 560.651 / 515.295 22850.0 34.63059997558594 42 17 10 5 10 4.94390150408998 20.22694018423956 0.04000091552734375 3 0.9744769312679442 7.7084642249706885 22850.0 6.979721539412238 1.0 - - - - - - - 466.0 45 4 TRAFD1 TRAF-type zinc finger domain containing 1 1853 236 C20140707_OR007_01 C20140707_OR007_01 TB449760.[MT7]-EIPVFNFTIHEIHC[CAM]QR.4y5_1.heavy 546.784 / 713.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRAFD1 TRAF-type zinc finger domain containing 1 1855 236 C20140707_OR007_01 C20140707_OR007_01 TB449760.[MT7]-EIPVFNFTIHEIHC[CAM]QR.4b4_1.heavy 546.784 / 583.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRAFD1 TRAF-type zinc finger domain containing 1 1857 236 C20140707_OR007_01 C20140707_OR007_01 TB449760.[MT7]-EIPVFNFTIHEIHC[CAM]QR.4y7_1.heavy 546.784 / 979.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRAFD1 TRAF-type zinc finger domain containing 1 1859 236 C20140707_OR007_01 C20140707_OR007_01 TB449760.[MT7]-EIPVFNFTIHEIHC[CAM]QR.4y6_1.heavy 546.784 / 842.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRAFD1 TRAF-type zinc finger domain containing 1 1861 237 C20140707_OR007_01 C20140707_OR007_01 TB449419.[MT7]-LLPEEHWK[MT7].3y6_1.heavy 447.259 / 969.491 N/A 31.708799362182617 45 15 10 10 10 1.6265155998311789 42.18868285611059 0.0 3 0.9537315633214336 5.715195070436896 0.0 0.0 11.0 - - - - - - - 0.0 0 0 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1863 237 C20140707_OR007_01 C20140707_OR007_01 TB449419.[MT7]-LLPEEHWK[MT7].3y3_1.heavy 447.259 / 614.353 4795.0 31.708799362182617 45 15 10 10 10 1.6265155998311789 42.18868285611059 0.0 3 0.9537315633214336 5.715195070436896 4795.0 38.31299019607843 0.0 - - - - - - - 158.66666666666666 9 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1865 237 C20140707_OR007_01 C20140707_OR007_01 TB449419.[MT7]-LLPEEHWK[MT7].3b4_1.heavy 447.259 / 597.373 6632.0 31.708799362182617 45 15 10 10 10 1.6265155998311789 42.18868285611059 0.0 3 0.9537315633214336 5.715195070436896 6632.0 82.03307189542483 0.0 - - - - - - - 136.0 13 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1867 237 C20140707_OR007_01 C20140707_OR007_01 TB449419.[MT7]-LLPEEHWK[MT7].3b5_1.heavy 447.259 / 726.415 3673.0 31.708799362182617 45 15 10 10 10 1.6265155998311789 42.18868285611059 0.0 3 0.9537315633214336 5.715195070436896 3673.0 53.88867156862745 0.0 - - - - - - - 204.0 7 4 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1869 238 C20140707_OR007_01 C20140707_OR007_01 TB438986.[MT7]-AVEYLR.2y4_1.heavy 447.762 / 580.309 2561.0 26.52507448196411 42 16 10 6 10 2.6863729125195284 37.22491376158598 0.03610038757324219 3 0.9693319805971409 7.029157891671519 2561.0 48.86806122448979 0.0 - - - - - - - 163.83333333333334 5 6 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1871 238 C20140707_OR007_01 C20140707_OR007_01 TB438986.[MT7]-AVEYLR.2y5_1.heavy 447.762 / 679.377 2955.0 26.52507448196411 42 16 10 6 10 2.6863729125195284 37.22491376158598 0.03610038757324219 3 0.9693319805971409 7.029157891671519 2955.0 18.002177068214802 0.0 - - - - - - - 255.8 5 5 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1873 238 C20140707_OR007_01 C20140707_OR007_01 TB438986.[MT7]-AVEYLR.2b4_1.heavy 447.762 / 607.321 2462.0 26.52507448196411 42 16 10 6 10 2.6863729125195284 37.22491376158598 0.03610038757324219 3 0.9693319805971409 7.029157891671519 2462.0 10.246331504760029 0.0 - - - - - - - 245.9 4 10 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1875 238 C20140707_OR007_01 C20140707_OR007_01 TB438986.[MT7]-AVEYLR.2y3_1.heavy 447.762 / 451.266 2659.0 26.52507448196411 42 16 10 6 10 2.6863729125195284 37.22491376158598 0.03610038757324219 3 0.9693319805971409 7.029157891671519 2659.0 19.368857868020303 0.0 - - - - - - - 262.55555555555554 5 9 AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1877 239 C20140707_OR007_01 C20140707_OR007_01 TB439320.[MT7]-LAC[CAM]SFQHSYR.3b4_1.heavy 471.567 / 576.293 6755.0 25.958799362182617 46 16 10 10 10 2.7466724635008757 36.407690151937956 0.0 3 0.9690952269795753 7.002042103887078 6755.0 19.484480235634017 0.0 - - - - - - - 189.0 13 8 ABAT 4-aminobutyrate aminotransferase 1879 239 C20140707_OR007_01 C20140707_OR007_01 TB439320.[MT7]-LAC[CAM]SFQHSYR.3b3_1.heavy 471.567 / 489.261 3126.0 25.958799362182617 46 16 10 10 10 2.7466724635008757 36.407690151937956 0.0 3 0.9690952269795753 7.002042103887078 3126.0 9.771443341604632 0.0 - - - - - - - 302.3333333333333 6 9 ABAT 4-aminobutyrate aminotransferase 1881 239 C20140707_OR007_01 C20140707_OR007_01 TB439320.[MT7]-LAC[CAM]SFQHSYR.3y4_1.heavy 471.567 / 562.273 8066.0 25.958799362182617 46 16 10 10 10 2.7466724635008757 36.407690151937956 0.0 3 0.9690952269795753 7.002042103887078 8066.0 37.91031929403644 0.0 - - - - - - - 221.8 16 10 ABAT 4-aminobutyrate aminotransferase 1883 239 C20140707_OR007_01 C20140707_OR007_01 TB439320.[MT7]-LAC[CAM]SFQHSYR.3y5_1.heavy 471.567 / 690.332 2017.0 25.958799362182617 46 16 10 10 10 2.7466724635008757 36.407690151937956 0.0 3 0.9690952269795753 7.002042103887078 2017.0 0.0 2.0 - - - - - - - 201.7 6 10 ABAT 4-aminobutyrate aminotransferase 1885 240 C20140707_OR007_01 C20140707_OR007_01 TB439718.[MT7]-IVDWK[MT7]EDC[CAM]NFALGQLAK[MT7].4y5_1.heavy 610.582 / 660.416 11212.0 39.980499267578125 45 15 10 10 10 2.189823384078887 37.605864709253595 0.0 3 0.9575985674224164 5.97207805562927 11212.0 55.25399816457632 0.0 - - - - - - - 297.5 22 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1887 240 C20140707_OR007_01 C20140707_OR007_01 TB439718.[MT7]-IVDWK[MT7]EDC[CAM]NFALGQLAK[MT7].4b7_2.heavy 610.582 / 587.821 6447.0 39.980499267578125 45 15 10 10 10 2.189823384078887 37.605864709253595 0.0 3 0.9575985674224164 5.97207805562927 6447.0 24.1577807486631 0.0 - - - - - - - 350.0 12 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1889 240 C20140707_OR007_01 C20140707_OR007_01 TB439718.[MT7]-IVDWK[MT7]EDC[CAM]NFALGQLAK[MT7].4b10_2.heavy 610.582 / 798.392 14015.0 39.980499267578125 45 15 10 10 10 2.189823384078887 37.605864709253595 0.0 3 0.9575985674224164 5.97207805562927 14015.0 49.225295496229876 0.0 - - - - - - - 280.0 28 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1891 240 C20140707_OR007_01 C20140707_OR007_01 TB439718.[MT7]-IVDWK[MT7]EDC[CAM]NFALGQLAK[MT7].4b9_2.heavy 610.582 / 724.858 19340.0 39.980499267578125 45 15 10 10 10 2.189823384078887 37.605864709253595 0.0 3 0.9575985674224164 5.97207805562927 19340.0 72.51711363327442 0.0 - - - - - - - 280.0 38 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1893 241 C20140707_OR007_01 C20140707_OR007_01 TB418432.[MT7]-LVHVWLDEYK[MT7].3y3_1.heavy 530.636 / 583.321 7359.0 37.522826194763184 40 15 10 5 10 3.4324040770550437 23.201618265422624 0.042301177978515625 3 0.9535112984499715 5.701533141967295 7359.0 40.973186813186814 0.0 - - - - - - - 272.6666666666667 14 6 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1895 241 C20140707_OR007_01 C20140707_OR007_01 TB418432.[MT7]-LVHVWLDEYK[MT7].3b4_1.heavy 530.636 / 593.389 5179.0 37.522826194763184 40 15 10 5 10 3.4324040770550437 23.201618265422624 0.042301177978515625 3 0.9535112984499715 5.701533141967295 5179.0 5.874082905423188 0.0 - - - - - - - 272.7142857142857 10 7 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1897 241 C20140707_OR007_01 C20140707_OR007_01 TB418432.[MT7]-LVHVWLDEYK[MT7].3y4_1.heavy 530.636 / 698.348 6814.0 37.522826194763184 40 15 10 5 10 3.4324040770550437 23.201618265422624 0.042301177978515625 3 0.9535112984499715 5.701533141967295 6814.0 19.74456651936924 0.0 - - - - - - - 238.625 13 8 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1899 241 C20140707_OR007_01 C20140707_OR007_01 TB418432.[MT7]-LVHVWLDEYK[MT7].3y5_1.heavy 530.636 / 811.432 2453.0 37.522826194763184 40 15 10 5 10 3.4324040770550437 23.201618265422624 0.042301177978515625 3 0.9535112984499715 5.701533141967295 2453.0 13.179835845491102 0.0 - - - - - - - 227.16666666666666 4 6 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1901 242 C20140707_OR007_01 C20140707_OR007_01 TB439717.[MT7]-VGVHIADVSYFVPEGSDLDK[MT7].3y6_1.heavy 812.428 / 778.406 1543.0 39.53597450256348 35 10 10 5 10 0.8187380899061124 78.79749723901959 0.04689788818359375 3 0.8476171837911662 3.1204596616616125 1543.0 3.8327364291208497 1.0 - - - - - - - 308.8 3 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1903 242 C20140707_OR007_01 C20140707_OR007_01 TB439717.[MT7]-VGVHIADVSYFVPEGSDLDK[MT7].3b4_1.heavy 812.428 / 537.326 1684.0 39.53597450256348 35 10 10 5 10 0.8187380899061124 78.79749723901959 0.04689788818359375 3 0.8476171837911662 3.1204596616616125 1684.0 3.7787840670859536 2.0 - - - - - - - 210.33333333333334 4 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1905 242 C20140707_OR007_01 C20140707_OR007_01 TB439717.[MT7]-VGVHIADVSYFVPEGSDLDK[MT7].3y8_1.heavy 812.428 / 1004.5 12487.0 39.53597450256348 35 10 10 5 10 0.8187380899061124 78.79749723901959 0.04689788818359375 3 0.8476171837911662 3.1204596616616125 12487.0 130.96431621759024 0.0 - - - - - - - 280.75 24 4 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1907 242 C20140707_OR007_01 C20140707_OR007_01 TB439717.[MT7]-VGVHIADVSYFVPEGSDLDK[MT7].3y8_2.heavy 812.428 / 502.754 8278.0 39.53597450256348 35 10 10 5 10 0.8187380899061124 78.79749723901959 0.04689788818359375 3 0.8476171837911662 3.1204596616616125 8278.0 34.76758321420243 0.0 - - - - - - - 263.125 16 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1909 243 C20140707_OR007_01 C20140707_OR007_01 TB449821.[MT7]-SAQLGDAVQLASLPPAGDILPNK[MT7].3b6_1.heavy 855.149 / 716.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A chymotrypsin-like elastase family, member 3A 1911 243 C20140707_OR007_01 C20140707_OR007_01 TB449821.[MT7]-SAQLGDAVQLASLPPAGDILPNK[MT7].3y3_1.heavy 855.149 / 502.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A chymotrypsin-like elastase family, member 3A 1913 243 C20140707_OR007_01 C20140707_OR007_01 TB449821.[MT7]-SAQLGDAVQLASLPPAGDILPNK[MT7].3b8_1.heavy 855.149 / 886.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A chymotrypsin-like elastase family, member 3A 1915 243 C20140707_OR007_01 C20140707_OR007_01 TB449821.[MT7]-SAQLGDAVQLASLPPAGDILPNK[MT7].3b7_1.heavy 855.149 / 787.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - CELA3A chymotrypsin-like elastase family, member 3A 1917 244 C20140707_OR007_01 C20140707_OR007_01 TB439321.[MT7]-NQETYETLK[MT7].3y3_1.heavy 471.92 / 505.347 14253.0 24.685100555419922 50 20 10 10 10 7.188811747797727 13.910504754924862 0.0 3 0.9917811667961666 13.603773351179585 14253.0 48.24953906604201 0.0 - - - - - - - 220.75 28 12 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 1919 244 C20140707_OR007_01 C20140707_OR007_01 TB439321.[MT7]-NQETYETLK[MT7].3b4_1.heavy 471.92 / 617.301 13541.0 24.685100555419922 50 20 10 10 10 7.188811747797727 13.910504754924862 0.0 3 0.9917811667961666 13.603773351179585 13541.0 44.220856182734664 0.0 - - - - - - - 260.22222222222223 27 9 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 1921 244 C20140707_OR007_01 C20140707_OR007_01 TB439321.[MT7]-NQETYETLK[MT7].3b5_1.heavy 471.92 / 780.364 2342.0 24.685100555419922 50 20 10 10 10 7.188811747797727 13.910504754924862 0.0 3 0.9917811667961666 13.603773351179585 2342.0 18.470257152041142 0.0 - - - - - - - 183.4 4 5 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 1923 244 C20140707_OR007_01 C20140707_OR007_01 TB439321.[MT7]-NQETYETLK[MT7].3y4_1.heavy 471.92 / 634.389 6821.0 24.685100555419922 50 20 10 10 10 7.188811747797727 13.910504754924862 0.0 3 0.9917811667961666 13.603773351179585 6821.0 54.57348135647702 0.0 - - - - - - - 158.44444444444446 13 9 FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 1925 245 C20140707_OR007_01 C20140707_OR007_01 TB449411.[MT7]-ILPGAQGQFPR.2y8_1.heavy 664.384 / 860.437 1615.0 32.57210159301758 46 20 10 10 6 6.315238594367334 15.834714477643278 0.0 5 0.9980437538239785 27.898431842010584 1615.0 1.949483502194085 1.0 - - - - - - - 188.625 3 8 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1927 245 C20140707_OR007_01 C20140707_OR007_01 TB449411.[MT7]-ILPGAQGQFPR.2y5_1.heavy 664.384 / 604.32 1184.0 32.57210159301758 46 20 10 10 6 6.315238594367334 15.834714477643278 0.0 5 0.9980437538239785 27.898431842010584 1184.0 0.34662538699690393 13.0 - - - - - - - 753.6666666666666 3 9 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1929 245 C20140707_OR007_01 C20140707_OR007_01 TB449411.[MT7]-ILPGAQGQFPR.2y9_1.heavy 664.384 / 957.49 18736.0 32.57210159301758 46 20 10 10 6 6.315238594367334 15.834714477643278 0.0 5 0.9980437538239785 27.898431842010584 18736.0 176.32117684007451 0.0 - - - - - - - 215.5 37 4 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1931 245 C20140707_OR007_01 C20140707_OR007_01 TB449411.[MT7]-ILPGAQGQFPR.2y10_1.heavy 664.384 / 1070.57 6138.0 32.57210159301758 46 20 10 10 6 6.315238594367334 15.834714477643278 0.0 5 0.9980437538239785 27.898431842010584 6138.0 0.403136002523775 2.0 - - - - - - - 269.3333333333333 13 6 DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) 1933 246 C20140707_OR007_01 C20140707_OR007_01 TB419194.[MT7]-LQYDYPFSQ.2b3_1.heavy 652.818 / 549.315 6030.0 39.098649978637695 45 20 10 5 10 5.496019336071432 18.194986932393192 0.048496246337890625 3 0.9910267345104927 13.018526223401281 6030.0 32.17685236822001 0.0 - - - - - - - 256.8333333333333 12 6 DENND1B DENN/MADD domain containing 1B 1935 246 C20140707_OR007_01 C20140707_OR007_01 TB419194.[MT7]-LQYDYPFSQ.2b4_1.heavy 652.818 / 664.342 56374.0 39.098649978637695 45 20 10 5 10 5.496019336071432 18.194986932393192 0.048496246337890625 3 0.9910267345104927 13.018526223401281 56374.0 91.35791345502932 0.0 - - - - - - - 327.0 112 3 DENND1B DENN/MADD domain containing 1B 1937 246 C20140707_OR007_01 C20140707_OR007_01 TB419194.[MT7]-LQYDYPFSQ.2b6_1.heavy 652.818 / 924.458 4908.0 39.098649978637695 45 20 10 5 10 5.496019336071432 18.194986932393192 0.048496246337890625 3 0.9910267345104927 13.018526223401281 4908.0 9.57328250759663 0.0 - - - - - - - 252.0 9 5 DENND1B DENN/MADD domain containing 1B 1939 246 C20140707_OR007_01 C20140707_OR007_01 TB419194.[MT7]-LQYDYPFSQ.2b5_1.heavy 652.818 / 827.406 25382.0 39.098649978637695 45 20 10 5 10 5.496019336071432 18.194986932393192 0.048496246337890625 3 0.9910267345104927 13.018526223401281 25382.0 88.67864527629233 0.0 - - - - - - - 308.4 50 5 DENND1B DENN/MADD domain containing 1B 1941 247 C20140707_OR007_01 C20140707_OR007_01 TB439083.[MT7]-TYNEALAR.2b3_1.heavy 541.292 / 523.263 N/A 22.88279914855957 37 17 4 10 6 3.05529159279612 26.23671800997233 0.0 5 0.9794880412699699 8.602281349922803 2463.0 2.4287261758388197 11.0 - - - - - - - 1271.909090909091 4 11 UNC13D unc-13 homolog D (C. elegans) 1943 247 C20140707_OR007_01 C20140707_OR007_01 TB439083.[MT7]-TYNEALAR.2b4_1.heavy 541.292 / 652.306 2956.0 22.88279914855957 37 17 4 10 6 3.05529159279612 26.23671800997233 0.0 5 0.9794880412699699 8.602281349922803 2956.0 27.90944162436548 0.0 - - - - - - - 206.27272727272728 5 11 UNC13D unc-13 homolog D (C. elegans) 1945 247 C20140707_OR007_01 C20140707_OR007_01 TB439083.[MT7]-TYNEALAR.2y6_1.heavy 541.292 / 673.363 2365.0 22.88279914855957 37 17 4 10 6 3.05529159279612 26.23671800997233 0.0 5 0.9794880412699699 8.602281349922803 2365.0 5.630419704005062 2.0 - - - - - - - 235.15384615384616 14 13 UNC13D unc-13 homolog D (C. elegans) 1947 247 C20140707_OR007_01 C20140707_OR007_01 TB439083.[MT7]-TYNEALAR.2b5_1.heavy 541.292 / 723.343 3646.0 22.88279914855957 37 17 4 10 6 3.05529159279612 26.23671800997233 0.0 5 0.9794880412699699 8.602281349922803 3646.0 23.072825719120132 1.0 - - - - - - - 197.22222222222223 12 9 UNC13D unc-13 homolog D (C. elegans) 1949 248 C20140707_OR007_01 C20140707_OR007_01 TB438980.[MT7]-QTGASK[MT7].2y4_1.heavy 440.261 / 506.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT1C carnitine palmitoyltransferase 1C 1951 248 C20140707_OR007_01 C20140707_OR007_01 TB438980.[MT7]-QTGASK[MT7].2y5_1.heavy 440.261 / 607.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT1C carnitine palmitoyltransferase 1C 1953 248 C20140707_OR007_01 C20140707_OR007_01 TB438980.[MT7]-QTGASK[MT7].2b4_1.heavy 440.261 / 502.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT1C carnitine palmitoyltransferase 1C 1955 248 C20140707_OR007_01 C20140707_OR007_01 TB438980.[MT7]-QTGASK[MT7].2b5_1.heavy 440.261 / 589.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - CPT1C carnitine palmitoyltransferase 1C 1957 249 C20140707_OR007_01 C20140707_OR007_01 TB439325.[MT7]-DYANTLFIC[CAM]R.2y8_1.heavy 708.857 / 994.514 5696.0 36.805599212646484 44 14 10 10 10 3.910477359676986 20.462466402012566 0.0 3 0.9413136806220879 5.069285790722738 5696.0 54.94083476272155 0.0 - - - - - - - 151.0 11 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1959 249 C20140707_OR007_01 C20140707_OR007_01 TB439325.[MT7]-DYANTLFIC[CAM]R.2b4_1.heavy 708.857 / 608.28 5299.0 36.805599212646484 44 14 10 10 10 3.910477359676986 20.462466402012566 0.0 3 0.9413136806220879 5.069285790722738 5299.0 10.641465368097537 0.0 - - - - - - - 264.72727272727275 10 11 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1961 249 C20140707_OR007_01 C20140707_OR007_01 TB439325.[MT7]-DYANTLFIC[CAM]R.2y9_1.heavy 708.857 / 1157.58 3312.0 36.805599212646484 44 14 10 10 10 3.910477359676986 20.462466402012566 0.0 3 0.9413136806220879 5.069285790722738 3312.0 8.157386155179784 1.0 - - - - - - - 226.85714285714286 7 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1963 249 C20140707_OR007_01 C20140707_OR007_01 TB439325.[MT7]-DYANTLFIC[CAM]R.2y7_1.heavy 708.857 / 923.477 4901.0 36.805599212646484 44 14 10 10 10 3.910477359676986 20.462466402012566 0.0 3 0.9413136806220879 5.069285790722738 4901.0 34.7010606060606 1.0 - - - - - - - 245.71428571428572 9 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 1965 250 C20140707_OR007_01 C20140707_OR007_01 TB449134.[MT7]-QFIDGR.2b3_1.heavy 440.244 / 533.32 2501.0 23.2731990814209 42 16 10 10 6 2.9467605552333724 25.659426574944497 0.0 5 0.9613789528266539 6.259542629523101 2501.0 13.382149280575538 0.0 - - - - - - - 231.5 5 10 DENND1B;DENND1A DENN/MADD domain containing 1B;DENN/MADD domain containing 1A 1967 250 C20140707_OR007_01 C20140707_OR007_01 TB449134.[MT7]-QFIDGR.2y4_1.heavy 440.244 / 460.251 2686.0 23.2731990814209 42 16 10 10 6 2.9467605552333724 25.659426574944497 0.0 5 0.9613789528266539 6.259542629523101 2686.0 8.181751161296438 2.0 - - - - - - - 238.14285714285714 10 7 DENND1B;DENND1A DENN/MADD domain containing 1B;DENN/MADD domain containing 1A 1969 250 C20140707_OR007_01 C20140707_OR007_01 TB449134.[MT7]-QFIDGR.2y5_1.heavy 440.244 / 607.32 8891.0 23.2731990814209 42 16 10 10 6 2.9467605552333724 25.659426574944497 0.0 5 0.9613789528266539 6.259542629523101 8891.0 23.240263788968825 0.0 - - - - - - - 246.88888888888889 17 9 DENND1B;DENND1A DENN/MADD domain containing 1B;DENN/MADD domain containing 1A 1971 250 C20140707_OR007_01 C20140707_OR007_01 TB449134.[MT7]-QFIDGR.2b4_1.heavy 440.244 / 648.347 10002.0 23.2731990814209 42 16 10 10 6 2.9467605552333724 25.659426574944497 0.0 5 0.9613789528266539 6.259542629523101 10002.0 42.46198065130254 0.0 - - - - - - - 250.0 20 10 DENND1B;DENND1A DENN/MADD domain containing 1B;DENN/MADD domain containing 1A 1973 251 C20140707_OR007_01 C20140707_OR007_01 TB449758.[MT7]-ALLGLVQDVIGDLHQC[CAM]QR.4y5_1.heavy 545.55 / 728.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1975 251 C20140707_OR007_01 C20140707_OR007_01 TB449758.[MT7]-ALLGLVQDVIGDLHQC[CAM]QR.4y4_1.heavy 545.55 / 591.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1977 251 C20140707_OR007_01 C20140707_OR007_01 TB449758.[MT7]-ALLGLVQDVIGDLHQC[CAM]QR.4y8_1.heavy 545.55 / 1013.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1979 251 C20140707_OR007_01 C20140707_OR007_01 TB449758.[MT7]-ALLGLVQDVIGDLHQC[CAM]QR.4y6_1.heavy 545.55 / 841.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 1981 252 C20140707_OR007_01 C20140707_OR007_01 TB418228.[MT7]-HPMDTEVTK[MT7].2y8_1.heavy 673.355 / 1064.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1983 252 C20140707_OR007_01 C20140707_OR007_01 TB418228.[MT7]-HPMDTEVTK[MT7].2y5_1.heavy 673.355 / 721.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1985 252 C20140707_OR007_01 C20140707_OR007_01 TB418228.[MT7]-HPMDTEVTK[MT7].2y6_1.heavy 673.355 / 836.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1987 252 C20140707_OR007_01 C20140707_OR007_01 TB418228.[MT7]-HPMDTEVTK[MT7].2y7_1.heavy 673.355 / 967.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - AP2A2 adaptor-related protein complex 2, alpha 2 subunit 1989 253 C20140707_OR007_01 C20140707_OR007_01 TB418120.[MT7]-YGFNVIISR.2y8_1.heavy 606.846 / 905.52 12299.0 37.708001136779785 37 11 10 6 10 3.4110870241368105 29.316167923128674 0.039600372314453125 3 0.8753295284041814 3.458292893594108 12299.0 25.647010377437336 0.0 - - - - - - - 259.0 24 8 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1991 253 C20140707_OR007_01 C20140707_OR007_01 TB418120.[MT7]-YGFNVIISR.2b4_1.heavy 606.846 / 626.305 2211.0 37.708001136779785 37 11 10 6 10 3.4110870241368105 29.316167923128674 0.039600372314453125 3 0.8753295284041814 3.458292893594108 2211.0 3.417285188658827 2.0 - - - - - - - 262.5 8 10 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1993 253 C20140707_OR007_01 C20140707_OR007_01 TB418120.[MT7]-YGFNVIISR.2y6_1.heavy 606.846 / 701.43 4699.0 37.708001136779785 37 11 10 6 10 3.4110870241368105 29.316167923128674 0.039600372314453125 3 0.8753295284041814 3.458292893594108 4699.0 15.63500904159132 0.0 - - - - - - - 276.25 9 8 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1995 253 C20140707_OR007_01 C20140707_OR007_01 TB418120.[MT7]-YGFNVIISR.2b5_1.heavy 606.846 / 725.374 4837.0 37.708001136779785 37 11 10 6 10 3.4110870241368105 29.316167923128674 0.039600372314453125 3 0.8753295284041814 3.458292893594108 4837.0 39.66768115942028 0.0 - - - - - - - 260.77777777777777 9 9 GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 1997 254 C20140707_OR007_01 C20140707_OR007_01 TB418121.[MT7]-NRGQQPPK[MT7].2b4_1.heavy 606.856 / 600.333 700.0 13.678999900817871 48 18 10 10 10 3.4718553101013576 28.803043637518577 0.0 3 0.9825119845028927 9.318739117048228 700.0 1.7564980742175784 1.0 - - - - - - - 0.0 1 0 TRAFD1 TRAF-type zinc finger domain containing 1 1999 254 C20140707_OR007_01 C20140707_OR007_01 TB418121.[MT7]-NRGQQPPK[MT7].2y3_1.heavy 606.856 / 485.32 3461.0 13.678999900817871 48 18 10 10 10 3.4718553101013576 28.803043637518577 0.0 3 0.9825119845028927 9.318739117048228 3461.0 33.33597722020469 0.0 - - - - - - - 141.76470588235293 6 17 TRAFD1 TRAF-type zinc finger domain containing 1 2001 254 C20140707_OR007_01 C20140707_OR007_01 TB418121.[MT7]-NRGQQPPK[MT7].2b6_1.heavy 606.856 / 825.445 233.0 13.678999900817871 48 18 10 10 10 3.4718553101013576 28.803043637518577 0.0 3 0.9825119845028927 9.318739117048228 233.0 9.784763925729443 0.0 - - - - - - - 0.0 0 0 TRAFD1 TRAF-type zinc finger domain containing 1 2003 254 C20140707_OR007_01 C20140707_OR007_01 TB418121.[MT7]-NRGQQPPK[MT7].2b5_1.heavy 606.856 / 728.392 2061.0 13.678999900817871 48 18 10 10 10 3.4718553101013576 28.803043637518577 0.0 3 0.9825119845028927 9.318739117048228 2061.0 108.81460150375939 0.0 - - - - - - - 97.23076923076923 4 13 TRAFD1 TRAF-type zinc finger domain containing 1 2005 255 C20140707_OR007_01 C20140707_OR007_01 TB418882.[MT7]-GNSGEPGAPGSK[MT7].3b4_1.heavy 449.237 / 460.227 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL1A1 collagen, type I, alpha 1 2007 255 C20140707_OR007_01 C20140707_OR007_01 TB418882.[MT7]-GNSGEPGAPGSK[MT7].3b5_1.heavy 449.237 / 589.27 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL1A1 collagen, type I, alpha 1 2009 255 C20140707_OR007_01 C20140707_OR007_01 TB418882.[MT7]-GNSGEPGAPGSK[MT7].3y4_1.heavy 449.237 / 532.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL1A1 collagen, type I, alpha 1 2011 255 C20140707_OR007_01 C20140707_OR007_01 TB418882.[MT7]-GNSGEPGAPGSK[MT7].3b7_1.heavy 449.237 / 743.344 N/A N/A - - - - - - - - - 0.0 - - - - - - - COL1A1 collagen, type I, alpha 1 2013 256 C20140707_OR007_01 C20140707_OR007_01 TB439188.[MT7]-ELTPFLLK[MT7].2y4_1.heavy 624.894 / 664.451 4888.0 41.256500244140625 47 17 10 10 10 1.3450158369225709 44.236248065546455 0.0 3 0.9702441467184568 7.136632638037425 4888.0 3.1066529829471827 2.0 - - - - - - - 257.2857142857143 12 7 GLYAT glycine-N-acyltransferase 2015 256 C20140707_OR007_01 C20140707_OR007_01 TB439188.[MT7]-ELTPFLLK[MT7].2y5_1.heavy 624.894 / 761.504 76529.0 41.256500244140625 47 17 10 10 10 1.3450158369225709 44.236248065546455 0.0 3 0.9702441467184568 7.136632638037425 76529.0 201.2497260807914 0.0 - - - - - - - 180.2 153 5 GLYAT glycine-N-acyltransferase 2017 256 C20140707_OR007_01 C20140707_OR007_01 TB439188.[MT7]-ELTPFLLK[MT7].2y3_1.heavy 624.894 / 517.383 11319.0 41.256500244140625 47 17 10 10 10 1.3450158369225709 44.236248065546455 0.0 3 0.9702441467184568 7.136632638037425 11319.0 25.395092055267703 0.0 - - - - - - - 321.5 22 4 GLYAT glycine-N-acyltransferase 2019 256 C20140707_OR007_01 C20140707_OR007_01 TB439188.[MT7]-ELTPFLLK[MT7].2y6_1.heavy 624.894 / 862.552 16849.0 41.256500244140625 47 17 10 10 10 1.3450158369225709 44.236248065546455 0.0 3 0.9702441467184568 7.136632638037425 16849.0 72.09935787584928 0.0 - - - - - - - 257.4 33 5 GLYAT glycine-N-acyltransferase 2021 257 C20140707_OR007_01 C20140707_OR007_01 TB449750.[MT7]-LSTVDMTGIPTLDNLQK[MT7].3y6_1.heavy 712.06 / 874.511 5464.0 41.30329895019531 44 14 10 10 10 1.5892322815248499 41.002674387791686 0.0 3 0.9313735100436006 4.683828101777229 5464.0 -0.321694351668014 2.0 - - - - - - - 240.0 15 7 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 2023 257 C20140707_OR007_01 C20140707_OR007_01 TB449750.[MT7]-LSTVDMTGIPTLDNLQK[MT7].3b5_1.heavy 712.06 / 660.369 31524.0 41.30329895019531 44 14 10 10 10 1.5892322815248499 41.002674387791686 0.0 3 0.9313735100436006 4.683828101777229 31524.0 78.93071328372412 0.0 - - - - - - - 233.33333333333334 63 6 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 2025 257 C20140707_OR007_01 C20140707_OR007_01 TB449750.[MT7]-LSTVDMTGIPTLDNLQK[MT7].3b8_1.heavy 712.06 / 949.478 14151.0 41.30329895019531 44 14 10 10 10 1.5892322815248499 41.002674387791686 0.0 3 0.9313735100436006 4.683828101777229 14151.0 39.37716155526431 0.0 - - - - - - - 280.0 28 5 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 2027 257 C20140707_OR007_01 C20140707_OR007_01 TB449750.[MT7]-LSTVDMTGIPTLDNLQK[MT7].3y8_1.heavy 712.06 / 1072.61 32224.0 41.30329895019531 44 14 10 10 10 1.5892322815248499 41.002674387791686 0.0 3 0.9313735100436006 4.683828101777229 32224.0 95.09227409546459 0.0 - - - - - - - 360.0 64 7 PTPMT1 protein tyrosine phosphatase, mitochondrial 1 2029 258 C20140707_OR007_01 C20140707_OR007_01 TB439726.[MT7]-DPQNC[CAM]QEFLGSPELINWK[MT7].3y7_1.heavy 821.745 / 1043.6 31029.0 41.863800048828125 44 14 10 10 10 4.9255188245315775 20.302429766778957 0.0 3 0.9476202610673645 5.368667994656776 31029.0 92.47264061909867 0.0 - - - - - - - 285.4 62 10 GLYAT glycine-N-acyltransferase 2031 258 C20140707_OR007_01 C20140707_OR007_01 TB439726.[MT7]-DPQNC[CAM]QEFLGSPELINWK[MT7].3y3_1.heavy 821.745 / 591.337 32457.0 41.863800048828125 44 14 10 10 10 4.9255188245315775 20.302429766778957 0.0 3 0.9476202610673645 5.368667994656776 32457.0 115.09488629876151 0.0 - - - - - - - 194.83333333333334 64 6 GLYAT glycine-N-acyltransferase 2033 258 C20140707_OR007_01 C20140707_OR007_01 TB439726.[MT7]-DPQNC[CAM]QEFLGSPELINWK[MT7].3b4_1.heavy 821.745 / 599.291 11425.0 41.863800048828125 44 14 10 10 10 4.9255188245315775 20.302429766778957 0.0 3 0.9476202610673645 5.368667994656776 11425.0 16.21025304445264 1.0 - - - - - - - 259.7142857142857 28 7 GLYAT glycine-N-acyltransferase 2035 258 C20140707_OR007_01 C20140707_OR007_01 TB439726.[MT7]-DPQNC[CAM]QEFLGSPELINWK[MT7].3b7_1.heavy 821.745 / 1016.42 38818.0 41.863800048828125 44 14 10 10 10 4.9255188245315775 20.302429766778957 0.0 3 0.9476202610673645 5.368667994656776 38818.0 65.2361228845348 0.0 - - - - - - - 238.0 77 6 GLYAT glycine-N-acyltransferase 2037 259 C20140707_OR007_01 C20140707_OR007_01 TB418883.[MT7]-TEVPGPR.2b3_1.heavy 450.257 / 474.268 6494.0 19.334750652313232 42 16 10 6 10 3.1240715612786887 32.00951003794222 0.030599594116210938 3 0.9648310927189272 6.561480464469618 6494.0 1.2608857905215065 1.0 - - - - - - - 212.91666666666666 12 12 ABAT 4-aminobutyrate aminotransferase 2039 259 C20140707_OR007_01 C20140707_OR007_01 TB418883.[MT7]-TEVPGPR.2y5_1.heavy 450.257 / 525.314 6567.0 19.334750652313232 42 16 10 6 10 3.1240715612786887 32.00951003794222 0.030599594116210938 3 0.9648310927189272 6.561480464469618 6567.0 2.571372695172907 0.0 - - - - - - - 232.27272727272728 13 11 ABAT 4-aminobutyrate aminotransferase 2041 259 C20140707_OR007_01 C20140707_OR007_01 TB418883.[MT7]-TEVPGPR.2y6_1.heavy 450.257 / 654.357 5838.0 19.334750652313232 42 16 10 6 10 3.1240715612786887 32.00951003794222 0.030599594116210938 3 0.9648310927189272 6.561480464469618 5838.0 2.034910093573084 1.0 - - - - - - - 283.8888888888889 11 9 ABAT 4-aminobutyrate aminotransferase 2043 259 C20140707_OR007_01 C20140707_OR007_01 TB418883.[MT7]-TEVPGPR.2b5_1.heavy 450.257 / 628.342 2554.0 19.334750652313232 42 16 10 6 10 3.1240715612786887 32.00951003794222 0.030599594116210938 3 0.9648310927189272 6.561480464469618 2554.0 1.8949032258064515 2.0 - - - - - - - 174.07692307692307 5 13 ABAT 4-aminobutyrate aminotransferase 2045 260 C20140707_OR007_01 C20140707_OR007_01 TB418224.[MT7]-LLPEEHWK[MT7].2y4_1.heavy 670.384 / 743.396 569.0 31.696924686431885 40 17 10 5 8 1.6272712752146286 46.43648640737509 0.04749870300292969 4 0.9759645098799886 7.944419091970405 569.0 1.3518181818181818 15.0 - - - - - - - 255.625 2 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 2047 260 C20140707_OR007_01 C20140707_OR007_01 TB418224.[MT7]-LLPEEHWK[MT7].2y3_1.heavy 670.384 / 614.353 1364.0 31.696924686431885 40 17 10 5 8 1.6272712752146286 46.43648640737509 0.04749870300292969 4 0.9759645098799886 7.944419091970405 1364.0 8.575438596491228 8.0 - - - - - - - 278.0 2 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 2049 260 C20140707_OR007_01 C20140707_OR007_01 TB418224.[MT7]-LLPEEHWK[MT7].2y6_1.heavy 670.384 / 969.491 6822.0 31.696924686431885 40 17 10 5 8 1.6272712752146286 46.43648640737509 0.04749870300292969 4 0.9759645098799886 7.944419091970405 6822.0 47.05344219515031 0.0 - - - - - - - 194.85714285714286 13 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 2051 260 C20140707_OR007_01 C20140707_OR007_01 TB418224.[MT7]-LLPEEHWK[MT7].2y7_1.heavy 670.384 / 1082.58 2501.0 31.696924686431885 40 17 10 5 8 1.6272712752146286 46.43648640737509 0.04749870300292969 4 0.9759645098799886 7.944419091970405 2501.0 22.707989624764895 1.0 - - - - - - - 290.55555555555554 12 9 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 2053 261 C20140707_OR007_01 C20140707_OR007_01 TB449850.[MT7]-QHLQIQSSQPSLNEAIQNLAAIK[MT7].3b9_1.heavy 940.525 / 1194.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLYAT glycine-N-acyltransferase 2055 261 C20140707_OR007_01 C20140707_OR007_01 TB449850.[MT7]-QHLQIQSSQPSLNEAIQNLAAIK[MT7].3b4_1.heavy 940.525 / 651.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLYAT glycine-N-acyltransferase 2057 261 C20140707_OR007_01 C20140707_OR007_01 TB449850.[MT7]-QHLQIQSSQPSLNEAIQNLAAIK[MT7].3b5_1.heavy 940.525 / 764.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLYAT glycine-N-acyltransferase 2059 261 C20140707_OR007_01 C20140707_OR007_01 TB449850.[MT7]-QHLQIQSSQPSLNEAIQNLAAIK[MT7].3b3_1.heavy 940.525 / 523.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLYAT glycine-N-acyltransferase 2061 262 C20140707_OR007_01 C20140707_OR007_01 TB439190.[MT7]-GVVLGGC[CAM]GDK[MT7].3b6_1.heavy 417.232 / 627.395 2751.0 24.212299346923828 38 18 4 10 6 5.073407890978139 19.710617034720677 0.0 5 0.9877225349429998 11.12660515143486 2751.0 27.509999999999998 1.0 - - - - - - - 249.33333333333334 5 9 ABAT 4-aminobutyrate aminotransferase 2063 262 C20140707_OR007_01 C20140707_OR007_01 TB439190.[MT7]-GVVLGGC[CAM]GDK[MT7].3y3_1.heavy 417.232 / 463.263 8866.0 24.212299346923828 38 18 4 10 6 5.073407890978139 19.710617034720677 0.0 5 0.9877225349429998 11.12660515143486 8866.0 1.8543364936658837 3.0 - - - - - - - 320.57142857142856 35 7 ABAT 4-aminobutyrate aminotransferase 2065 262 C20140707_OR007_01 C20140707_OR007_01 TB439190.[MT7]-GVVLGGC[CAM]GDK[MT7].3b4_1.heavy 417.232 / 513.352 4789.0 24.212299346923828 38 18 4 10 6 5.073407890978139 19.710617034720677 0.0 5 0.9877225349429998 11.12660515143486 4789.0 50.08104575163399 0.0 - - - - - - - 320.57142857142856 9 7 ABAT 4-aminobutyrate aminotransferase 2067 262 C20140707_OR007_01 C20140707_OR007_01 TB439190.[MT7]-GVVLGGC[CAM]GDK[MT7].3b5_1.heavy 417.232 / 570.373 2751.0 24.212299346923828 38 18 4 10 6 5.073407890978139 19.710617034720677 0.0 5 0.9877225349429998 11.12660515143486 2751.0 38.298235294117646 1.0 - - - - - - - 119.0 5 6 ABAT 4-aminobutyrate aminotransferase 2069 263 C20140707_OR007_01 C20140707_OR007_01 TB438999.[MT7]-FVDGALR.2b3_1.heavy 461.267 / 506.273 N/A 29.25279998779297 48 20 10 10 8 10.665771015481953 9.37578725952812 0.0 4 0.9964838985021839 20.80675407680644 6307.0 1.71882145998241 1.0 - - - - - - - 250.85714285714286 12 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 2071 263 C20140707_OR007_01 C20140707_OR007_01 TB438999.[MT7]-FVDGALR.2y4_1.heavy 461.267 / 416.262 9512.0 29.25279998779297 48 20 10 10 8 10.665771015481953 9.37578725952812 0.0 4 0.9964838985021839 20.80675407680644 9512.0 17.466501526372223 0.0 - - - - - - - 248.2 19 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 2073 263 C20140707_OR007_01 C20140707_OR007_01 TB438999.[MT7]-FVDGALR.2y5_1.heavy 461.267 / 531.289 3309.0 29.25279998779297 48 20 10 10 8 10.665771015481953 9.37578725952812 0.0 4 0.9964838985021839 20.80675407680644 3309.0 13.944575464455706 0.0 - - - - - - - 284.375 6 8 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 2075 263 C20140707_OR007_01 C20140707_OR007_01 TB438999.[MT7]-FVDGALR.2b4_1.heavy 461.267 / 563.295 3309.0 29.25279998779297 48 20 10 10 8 10.665771015481953 9.37578725952812 0.0 4 0.9964838985021839 20.80675407680644 3309.0 30.198640776699026 2.0 - - - - - - - 227.4 14 10 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 2077 264 C20140707_OR007_01 C20140707_OR007_01 TB439314.[MT7]-ILYMAAETAK[MT7].2b3_1.heavy 699.899 / 534.341 23856.0 35.5989990234375 47 17 10 10 10 12.053684474460953 8.296218489199507 0.0 3 0.9792739209589579 8.557577211851656 23856.0 111.69585399460972 0.0 - - - - - - - 256.8 47 10 GLYAT glycine-N-acyltransferase 2079 264 C20140707_OR007_01 C20140707_OR007_01 TB439314.[MT7]-ILYMAAETAK[MT7].2y8_1.heavy 699.899 / 1028.52 17315.0 35.5989990234375 47 17 10 10 10 12.053684474460953 8.296218489199507 0.0 3 0.9792739209589579 8.557577211851656 17315.0 78.77549481951745 0.0 - - - - - - - 185.22222222222223 34 9 GLYAT glycine-N-acyltransferase 2081 264 C20140707_OR007_01 C20140707_OR007_01 TB439314.[MT7]-ILYMAAETAK[MT7].2y6_1.heavy 699.899 / 734.417 21804.0 35.5989990234375 47 17 10 10 10 12.053684474460953 8.296218489199507 0.0 3 0.9792739209589579 8.557577211851656 21804.0 217.33650243506494 0.0 - - - - - - - 181.66666666666666 43 12 GLYAT glycine-N-acyltransferase 2083 264 C20140707_OR007_01 C20140707_OR007_01 TB439314.[MT7]-ILYMAAETAK[MT7].2b5_1.heavy 699.899 / 736.418 6413.0 35.5989990234375 47 17 10 10 10 12.053684474460953 8.296218489199507 0.0 3 0.9792739209589579 8.557577211851656 6413.0 7.803744149765991 1.0 - - - - - - - 308.2 12 5 GLYAT glycine-N-acyltransferase 2085 265 C20140707_OR007_01 C20140707_OR007_01 TB418323.[MT7]-TIFVGGVPRPLR.3y10_2.heavy 485.969 / 549.333 2521.0 33.789398193359375 25 5 6 10 4 0.6785559457323038 97.97514065716426 0.0 7 0.6672523699036619 2.0770741547174665 2521.0 9.967590187590188 1.0 - - - - - - - 294.0 7 9 CPEB2;CPEB3;CPEB4 cytoplasmic polyadenylation element binding protein 2;cytoplasmic polyadenylation element binding protein 3;cytoplasmic polyadenylation element binding protein 4 2087 265 C20140707_OR007_01 C20140707_OR007_01 TB418323.[MT7]-TIFVGGVPRPLR.3b6_1.heavy 485.969 / 719.421 252.0 33.789398193359375 25 5 6 10 4 0.6785559457323038 97.97514065716426 0.0 7 0.6672523699036619 2.0770741547174665 252.0 2.013333333333333 9.0 - - - - - - - 0.0 1 0 CPEB2;CPEB3;CPEB4 cytoplasmic polyadenylation element binding protein 2;cytoplasmic polyadenylation element binding protein 3;cytoplasmic polyadenylation element binding protein 4 2089 265 C20140707_OR007_01 C20140707_OR007_01 TB418323.[MT7]-TIFVGGVPRPLR.3b3_1.heavy 485.969 / 506.31 630.0 33.789398193359375 25 5 6 10 4 0.6785559457323038 97.97514065716426 0.0 7 0.6672523699036619 2.0770741547174665 630.0 1.0071428571428573 11.0 - - - - - - - 252.0 3 6 CPEB2;CPEB3;CPEB4 cytoplasmic polyadenylation element binding protein 2;cytoplasmic polyadenylation element binding protein 3;cytoplasmic polyadenylation element binding protein 4 2091 265 C20140707_OR007_01 C20140707_OR007_01 TB418323.[MT7]-TIFVGGVPRPLR.3y8_1.heavy 485.969 / 851.521 630.0 33.789398193359375 25 5 6 10 4 0.6785559457323038 97.97514065716426 0.0 7 0.6672523699036619 2.0770741547174665 630.0 6.45 0.0 - - - - - - - 0.0 1 0 CPEB2;CPEB3;CPEB4 cytoplasmic polyadenylation element binding protein 2;cytoplasmic polyadenylation element binding protein 3;cytoplasmic polyadenylation element binding protein 4 2093 266 C20140707_OR007_01 C20140707_OR007_01 TB439092.[MT7]-VTPAAANYR.2y8_1.heavy 553.807 / 863.437 14906.0 22.282975673675537 43 20 10 5 8 9.780878052080462 10.22403095790866 0.04210090637207031 4 0.9966060396330532 21.178055323199384 14906.0 173.91295314648897 0.0 - - - - - - - 182.5 29 6 TRAFD1 TRAF-type zinc finger domain containing 1 2095 266 C20140707_OR007_01 C20140707_OR007_01 TB439092.[MT7]-VTPAAANYR.2y5_1.heavy 553.807 / 594.299 1372.0 22.282975673675537 43 20 10 5 8 9.780878052080462 10.22403095790866 0.04210090637207031 4 0.9966060396330532 21.178055323199384 1372.0 1.5629224392030556 1.0 - - - - - - - 223.44444444444446 2 9 TRAFD1 TRAF-type zinc finger domain containing 1 2097 266 C20140707_OR007_01 C20140707_OR007_01 TB439092.[MT7]-VTPAAANYR.2y6_1.heavy 553.807 / 665.337 2469.0 22.282975673675537 43 20 10 5 8 9.780878052080462 10.22403095790866 0.04210090637207031 4 0.9966060396330532 21.178055323199384 2469.0 26.30901639344262 1.0 - - - - - - - 174.45454545454547 24 11 TRAFD1 TRAF-type zinc finger domain containing 1 2099 266 C20140707_OR007_01 C20140707_OR007_01 TB439092.[MT7]-VTPAAANYR.2y7_1.heavy 553.807 / 762.389 29080.0 22.282975673675537 43 20 10 5 8 9.780878052080462 10.22403095790866 0.04210090637207031 4 0.9966060396330532 21.178055323199384 29080.0 111.56369606066039 0.0 - - - - - - - 236.08333333333334 58 12 TRAFD1 TRAF-type zinc finger domain containing 1 2101 267 C20140707_OR007_01 C20140707_OR007_01 TB449263.[MT7]-LPVVDYK[MT7].2y6_1.heavy 561.344 / 864.495 51171.0 32.357398986816406 36 14 10 2 10 5.394688157488049 18.53675265014084 0.08679962158203125 3 0.9343791139787467 4.791123066063791 51171.0 162.65075121231393 0.0 - - - - - - - 236.0 102 5 CELA3A chymotrypsin-like elastase family, member 3A 2103 267 C20140707_OR007_01 C20140707_OR007_01 TB449263.[MT7]-LPVVDYK[MT7].2y5_1.heavy 561.344 / 767.442 3004.0 32.357398986816406 36 14 10 2 10 5.394688157488049 18.53675265014084 0.08679962158203125 3 0.9343791139787467 4.791123066063791 3004.0 29.548785046728973 0.0 - - - - - - - 214.5 6 8 CELA3A chymotrypsin-like elastase family, member 3A 2105 267 C20140707_OR007_01 C20140707_OR007_01 TB449263.[MT7]-LPVVDYK[MT7].2b6_2.heavy 561.344 / 416.24 536.0 32.357398986816406 36 14 10 2 10 5.394688157488049 18.53675265014084 0.08679962158203125 3 0.9343791139787467 4.791123066063791 536.0 0.8866982293069249 35.0 - - - - - - - 286.1111111111111 28 9 CELA3A chymotrypsin-like elastase family, member 3A 2107 267 C20140707_OR007_01 C20140707_OR007_01 TB449263.[MT7]-LPVVDYK[MT7].2y3_1.heavy 561.344 / 569.305 10513.0 32.357398986816406 36 14 10 2 10 5.394688157488049 18.53675265014084 0.08679962158203125 3 0.9343791139787467 4.791123066063791 10513.0 27.605374167776297 0.0 - - - - - - - 230.0 21 7 CELA3A chymotrypsin-like elastase family, member 3A 2109 268 C20140707_OR007_01 C20140707_OR007_01 TB418878.[MT7]-LLVPGSR.2y4_1.heavy 443.286 / 416.225 45225.0 29.072200775146484 47 17 10 10 10 2.6362844640157013 37.93217361971467 0.0 3 0.9751691860964008 7.815632243267595 45225.0 186.2184440943728 0.0 - - - - - - - 731.4285714285714 90 7 ABAT 4-aminobutyrate aminotransferase 2111 268 C20140707_OR007_01 C20140707_OR007_01 TB418878.[MT7]-LLVPGSR.2b3_1.heavy 443.286 / 470.346 23786.0 29.072200775146484 47 17 10 10 10 2.6362844640157013 37.93217361971467 0.0 3 0.9751691860964008 7.815632243267595 23786.0 121.4924262295082 0.0 - - - - - - - 271.45454545454544 47 11 ABAT 4-aminobutyrate aminotransferase 2113 268 C20140707_OR007_01 C20140707_OR007_01 TB418878.[MT7]-LLVPGSR.2y5_1.heavy 443.286 / 515.294 15786.0 29.072200775146484 47 17 10 10 10 2.6362844640157013 37.93217361971467 0.0 3 0.9751691860964008 7.815632243267595 15786.0 54.93270054456703 0.0 - - - - - - - 240.0 31 12 ABAT 4-aminobutyrate aminotransferase 2115 268 C20140707_OR007_01 C20140707_OR007_01 TB418878.[MT7]-LLVPGSR.2y6_1.heavy 443.286 / 628.378 35946.0 29.072200775146484 47 17 10 10 10 2.6362844640157013 37.93217361971467 0.0 3 0.9751691860964008 7.815632243267595 35946.0 133.78431617647058 0.0 - - - - - - - 213.4 71 10 ABAT 4-aminobutyrate aminotransferase 2117 269 C20140707_OR007_01 C20140707_OR007_01 TB418730.[MT7]-DQGQAANMLC[CAM]VVVNDMEQLR.3b6_1.heavy 812.391 / 715.349 857.0 52.93190002441406 39 16 9 6 8 3.070446013478146 32.568558300988265 0.033599853515625 4 0.9610433239335507 6.232343109543876 857.0 5.3917218543046355 2.0 - - - - - - - 189.84615384615384 3 13 UNC13D unc-13 homolog D (C. elegans) 2119 269 C20140707_OR007_01 C20140707_OR007_01 TB418730.[MT7]-DQGQAANMLC[CAM]VVVNDMEQLR.3b4_1.heavy 812.391 / 573.275 1563.0 52.93190002441406 39 16 9 6 8 3.070446013478146 32.568558300988265 0.033599853515625 4 0.9610433239335507 6.232343109543876 1563.0 5.160688271470319 0.0 - - - - - - - 209.83333333333334 3 18 UNC13D unc-13 homolog D (C. elegans) 2121 269 C20140707_OR007_01 C20140707_OR007_01 TB418730.[MT7]-DQGQAANMLC[CAM]VVVNDMEQLR.3b5_1.heavy 812.391 / 644.312 1411.0 52.93190002441406 39 16 9 6 8 3.070446013478146 32.568558300988265 0.033599853515625 4 0.9610433239335507 6.232343109543876 1411.0 11.815434150557913 1.0 - - - - - - - 145.78947368421052 3 19 UNC13D unc-13 homolog D (C. elegans) 2123 269 C20140707_OR007_01 C20140707_OR007_01 TB418730.[MT7]-DQGQAANMLC[CAM]VVVNDMEQLR.3b7_1.heavy 812.391 / 829.392 1613.0 52.93190002441406 39 16 9 6 8 3.070446013478146 32.568558300988265 0.033599853515625 4 0.9610433239335507 6.232343109543876 1613.0 1.477557251908397 1.0 - - - - - - - 151.13333333333333 3 15 UNC13D unc-13 homolog D (C. elegans) 2125 270 C20140707_OR007_01 C20140707_OR007_01 TB439099.[MT7]-HISQAAAK[MT7].2y4_1.heavy 557.335 / 504.326 2526.0 15.679100036621094 50 20 10 10 10 9.819178694984767 10.184151150144144 0.0 3 0.9974685911746318 24.523901749432945 2526.0 30.618181818181817 0.0 - - - - - - - 187.0 5 10 ABAT 4-aminobutyrate aminotransferase 2127 270 C20140707_OR007_01 C20140707_OR007_01 TB439099.[MT7]-HISQAAAK[MT7].2y6_1.heavy 557.335 / 719.417 6096.0 15.679100036621094 50 20 10 10 10 9.819178694984767 10.184151150144144 0.0 3 0.9974685911746318 24.523901749432945 6096.0 83.12727272727273 0.0 - - - - - - - 164.85714285714286 12 7 ABAT 4-aminobutyrate aminotransferase 2129 270 C20140707_OR007_01 C20140707_OR007_01 TB439099.[MT7]-HISQAAAK[MT7].2b5_1.heavy 557.335 / 681.38 824.0 15.679100036621094 50 20 10 10 10 9.819178694984767 10.184151150144144 0.0 3 0.9974685911746318 24.523901749432945 824.0 28.91490909090909 0.0 - - - - - - - 0.0 1 0 ABAT 4-aminobutyrate aminotransferase 2131 270 C20140707_OR007_01 C20140707_OR007_01 TB439099.[MT7]-HISQAAAK[MT7].2y7_1.heavy 557.335 / 832.501 3515.0 15.679100036621094 50 20 10 10 10 9.819178694984767 10.184151150144144 0.0 3 0.9974685911746318 24.523901749432945 3515.0 73.49545454545455 0.0 - - - - - - - 143.0 7 5 ABAT 4-aminobutyrate aminotransferase 2133 271 C20140707_OR007_01 C20140707_OR007_01 TB449740.[MT7]-LLC[CAM]EELC[CAM]SLNPMSDK[MT7].3b6_1.heavy 699.68 / 902.477 5945.0 43.15769958496094 46 16 10 10 10 2.037717289202018 38.15567728379195 0.0 3 0.9654935034762714 6.624530867433593 5945.0 -0.4307971014492793 0.0 - - - - - - - 249.0 11 5 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 2135 271 C20140707_OR007_01 C20140707_OR007_01 TB449740.[MT7]-LLC[CAM]EELC[CAM]SLNPMSDK[MT7].3b4_1.heavy 699.68 / 660.351 3595.0 43.15769958496094 46 16 10 10 10 2.037717289202018 38.15567728379195 0.0 3 0.9654935034762714 6.624530867433593 3595.0 -1.7325301204819272 0.0 - - - - - - - 276.6666666666667 7 6 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 2137 271 C20140707_OR007_01 C20140707_OR007_01 TB449740.[MT7]-LLC[CAM]EELC[CAM]SLNPMSDK[MT7].3b5_1.heavy 699.68 / 789.393 9401.0 43.15769958496094 46 16 10 10 10 2.037717289202018 38.15567728379195 0.0 3 0.9654935034762714 6.624530867433593 9401.0 -4.0873913043478325 0.0 - - - - - - - 217.28571428571428 18 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 2139 271 C20140707_OR007_01 C20140707_OR007_01 TB449740.[MT7]-LLC[CAM]EELC[CAM]SLNPMSDK[MT7].3b3_1.heavy 699.68 / 531.308 2489.0 43.15769958496094 46 16 10 10 10 2.037717289202018 38.15567728379195 0.0 3 0.9654935034762714 6.624530867433593 2489.0 -0.5997590361445782 0.0 - - - - - - - 790.2857142857143 4 7 DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 2141 272 C20140707_OR007_01 C20140707_OR007_01 TB418872.[MT7]-ALLLSTYIK[MT7].3y3_1.heavy 437.283 / 567.362 645.0 40.816900889078774 45 20 10 5 10 4.001699722801072 19.81388738073231 0.0458984375 3 0.991310174885202 13.229451977098911 645.0 1.25 2.0 - - - - - - - 0.0 1 0 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 2143 272 C20140707_OR007_01 C20140707_OR007_01 TB418872.[MT7]-ALLLSTYIK[MT7].3b4_1.heavy 437.283 / 555.399 903.0 40.816900889078774 45 20 10 5 10 4.001699722801072 19.81388738073231 0.0458984375 3 0.991310174885202 13.229451977098911 903.0 13.509999999999998 2.0 - - - - - - - 0.0 1 0 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 2145 272 C20140707_OR007_01 C20140707_OR007_01 TB418872.[MT7]-ALLLSTYIK[MT7].3y4_1.heavy 437.283 / 668.41 N/A 40.816900889078774 45 20 10 5 10 4.001699722801072 19.81388738073231 0.0458984375 3 0.991310174885202 13.229451977098911 0.0 0.0 4.0 - - - - - - - 0.0 0 0 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 2147 272 C20140707_OR007_01 C20140707_OR007_01 TB418872.[MT7]-ALLLSTYIK[MT7].3b3_1.heavy 437.283 / 442.315 2451.0 40.816900889078774 45 20 10 5 10 4.001699722801072 19.81388738073231 0.0458984375 3 0.991310174885202 13.229451977098911 2451.0 15.516666666666666 0.0 - - - - - - - 387.0 4 2 AP2A1;AP2A2 adaptor-related protein complex 2, alpha 1 subunit;adaptor-related protein complex 2, alpha 2 subunit 2149 273 C20140707_OR007_01 C20140707_OR007_01 TB449842.[MT7]-FWAHEHWGLDDPADVMTFSK[MT7].3y3_1.heavy 893.096 / 525.315 684.0 37.201775550842285 35 18 6 5 6 4.035288338121052 24.78137660085101 0.042301177978515625 5 0.9812066238310132 8.98829785737633 684.0 5.1924087591240875 3.0 - - - - - - - 0.0 1 0 ABAT 4-aminobutyrate aminotransferase 2151 273 C20140707_OR007_01 C20140707_OR007_01 TB449842.[MT7]-FWAHEHWGLDDPADVMTFSK[MT7].3b5_1.heavy 893.096 / 815.396 1094.0 37.201775550842285 35 18 6 5 6 4.035288338121052 24.78137660085101 0.042301177978515625 5 0.9812066238310132 8.98829785737633 1094.0 2.1596491228070174 2.0 - - - - - - - 171.25 3 4 ABAT 4-aminobutyrate aminotransferase 2153 273 C20140707_OR007_01 C20140707_OR007_01 TB449842.[MT7]-FWAHEHWGLDDPADVMTFSK[MT7].3b3_1.heavy 893.096 / 549.294 1094.0 37.201775550842285 35 18 6 5 6 4.035288338121052 24.78137660085101 0.042301177978515625 5 0.9812066238310132 8.98829785737633 1094.0 5.82870802919708 0.0 - - - - - - - 342.0 2 4 ABAT 4-aminobutyrate aminotransferase 2155 273 C20140707_OR007_01 C20140707_OR007_01 TB449842.[MT7]-FWAHEHWGLDDPADVMTFSK[MT7].3y9_1.heavy 893.096 / 1139.59 547.0 37.201775550842285 35 18 6 5 6 4.035288338121052 24.78137660085101 0.042301177978515625 5 0.9812066238310132 8.98829785737633 547.0 3.593430656934307 18.0 - - - - - - - 205.375 2 8 ABAT 4-aminobutyrate aminotransferase 2157 274 C20140707_OR007_01 C20140707_OR007_01 TB418415.[MT7]-TLAEQLEVGIAK[MT7].2y4_1.heavy 780.466 / 532.357 1657.0 38.07487392425537 35 14 8 5 8 2.8704334986229028 24.40992632614318 0.041500091552734375 4 0.9369103863612506 4.887348050091939 1657.0 11.166739130434781 2.0 - - - - - - - 214.66666666666666 5 9 UNC13D unc-13 homolog D (C. elegans) 2159 274 C20140707_OR007_01 C20140707_OR007_01 TB418415.[MT7]-TLAEQLEVGIAK[MT7].2b4_1.heavy 780.466 / 559.321 2072.0 38.07487392425537 35 14 8 5 8 2.8704334986229028 24.40992632614318 0.041500091552734375 4 0.9369103863612506 4.887348050091939 2072.0 6.703865992715172 0.0 - - - - - - - 253.0 4 6 UNC13D unc-13 homolog D (C. elegans) 2161 274 C20140707_OR007_01 C20140707_OR007_01 TB418415.[MT7]-TLAEQLEVGIAK[MT7].2b5_1.heavy 780.466 / 687.379 1934.0 38.07487392425537 35 14 8 5 8 2.8704334986229028 24.40992632614318 0.041500091552734375 4 0.9369103863612506 4.887348050091939 1934.0 17.79840579710145 0.0 - - - - - - - 236.57142857142858 3 7 UNC13D unc-13 homolog D (C. elegans) 2163 274 C20140707_OR007_01 C20140707_OR007_01 TB418415.[MT7]-TLAEQLEVGIAK[MT7].2y7_1.heavy 780.466 / 873.553 138.0 38.07487392425537 35 14 8 5 8 2.8704334986229028 24.40992632614318 0.041500091552734375 4 0.9369103863612506 4.887348050091939 138.0 0.1333333333333333 39.0 - - - - - - - 0.0 1 0 UNC13D unc-13 homolog D (C. elegans) 2165 275 C20140707_OR007_01 C20140707_OR007_01 TB439303.[MT7]-GLPGTAGLPGMK[MT7].3y3_1.heavy 462.939 / 479.277 4871.0 33.62580108642578 42 14 10 10 8 2.7647432777798198 36.169723534079196 0.0 4 0.9414368969459556 5.074669112477946 4871.0 18.654048061260006 2.0 - - - - - - - 196.42857142857142 12 7 COL1A1 collagen, type I, alpha 1 2167 275 C20140707_OR007_01 C20140707_OR007_01 TB439303.[MT7]-GLPGTAGLPGMK[MT7].3b5_1.heavy 462.939 / 570.337 749.0 33.62580108642578 42 14 10 10 8 2.7647432777798198 36.169723534079196 0.0 4 0.9414368969459556 5.074669112477946 749.0 1.5978666666666668 6.0 - - - - - - - 250.0 2 7 COL1A1 collagen, type I, alpha 1 2169 275 C20140707_OR007_01 C20140707_OR007_01 TB439303.[MT7]-GLPGTAGLPGMK[MT7].3y4_1.heavy 462.939 / 576.33 10866.0 33.62580108642578 42 14 10 10 8 2.7647432777798198 36.169723534079196 0.0 4 0.9414368969459556 5.074669112477946 10866.0 126.827952 0.0 - - - - - - - 225.0 21 5 COL1A1 collagen, type I, alpha 1 2171 275 C20140707_OR007_01 C20140707_OR007_01 TB439303.[MT7]-GLPGTAGLPGMK[MT7].3b7_1.heavy 462.939 / 698.395 3122.0 33.62580108642578 42 14 10 10 8 2.7647432777798198 36.169723534079196 0.0 4 0.9414368969459556 5.074669112477946 3122.0 20.314168926855313 0.0 - - - - - - - 225.0 6 5 COL1A1 collagen, type I, alpha 1 2173 276 C20140707_OR007_01 C20140707_OR007_01 TB418419.[MT7]-IFNTWLGDPSK[MT7].3y6_1.heavy 522.624 / 760.432 2673.0 40.80160140991211 48 18 10 10 10 3.713198168166587 22.553395332404847 0.0 3 0.9864671714938389 10.596857433898547 2673.0 18.99580693787918 0.0 - - - - - - - 200.75 5 4 ABAT 4-aminobutyrate aminotransferase 2175 276 C20140707_OR007_01 C20140707_OR007_01 TB418419.[MT7]-IFNTWLGDPSK[MT7].3b4_1.heavy 522.624 / 620.352 9087.0 40.80160140991211 48 18 10 10 10 3.713198168166587 22.553395332404847 0.0 3 0.9864671714938389 10.596857433898547 9087.0 61.79680861279636 0.0 - - - - - - - 160.6 18 5 ABAT 4-aminobutyrate aminotransferase 2177 276 C20140707_OR007_01 C20140707_OR007_01 TB418419.[MT7]-IFNTWLGDPSK[MT7].3b3_1.heavy 522.624 / 519.305 6815.0 40.80160140991211 48 18 10 10 10 3.713198168166587 22.553395332404847 0.0 3 0.9864671714938389 10.596857433898547 6815.0 23.94803738317757 0.0 - - - - - - - 267.14285714285717 13 7 ABAT 4-aminobutyrate aminotransferase 2179 276 C20140707_OR007_01 C20140707_OR007_01 TB418419.[MT7]-IFNTWLGDPSK[MT7].3y5_1.heavy 522.624 / 647.348 5613.0 40.80160140991211 48 18 10 10 10 3.713198168166587 22.553395332404847 0.0 3 0.9864671714938389 10.596857433898547 5613.0 16.207777016061335 1.0 - - - - - - - 320.6 11 5 ABAT 4-aminobutyrate aminotransferase 2181 277 C20140707_OR007_01 C20140707_OR007_01 TB449533.[MT7]-LRQSLLSVAPK[MT7].3y3_1.heavy 500.655 / 459.305 23402.0 31.03339958190918 41 11 10 10 10 1.385974321657833 59.762247034232274 0.0 3 0.8575077968899009 3.2297550466157485 23402.0 124.50260454940678 0.0 - - - - - - - 209.14285714285714 46 14 ABAT 4-aminobutyrate aminotransferase 2183 277 C20140707_OR007_01 C20140707_OR007_01 TB449533.[MT7]-LRQSLLSVAPK[MT7].3b4_1.heavy 500.655 / 629.385 2723.0 31.03339958190918 41 11 10 10 10 1.385974321657833 59.762247034232274 0.0 3 0.8575077968899009 3.2297550466157485 2723.0 12.59007700770077 0.0 - - - - - - - 202.0 5 7 ABAT 4-aminobutyrate aminotransferase 2185 277 C20140707_OR007_01 C20140707_OR007_01 TB449533.[MT7]-LRQSLLSVAPK[MT7].3b5_1.heavy 500.655 / 742.469 9482.0 31.03339958190918 41 11 10 10 10 1.385974321657833 59.762247034232274 0.0 3 0.8575077968899009 3.2297550466157485 9482.0 59.18009188511903 0.0 - - - - - - - 222.0 18 10 ABAT 4-aminobutyrate aminotransferase 2187 277 C20140707_OR007_01 C20140707_OR007_01 TB449533.[MT7]-LRQSLLSVAPK[MT7].3b7_1.heavy 500.655 / 942.585 3833.0 31.03339958190918 41 11 10 10 10 1.385974321657833 59.762247034232274 0.0 3 0.8575077968899009 3.2297550466157485 3833.0 28.48641377785421 0.0 - - - - - - - 302.6666666666667 7 3 ABAT 4-aminobutyrate aminotransferase 2189 278 C20140707_OR007_01 C20140707_OR007_01 TB439306.[MT7]-HTIPEEETHR.3y7_1.heavy 464.904 / 897.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 2191 278 C20140707_OR007_01 C20140707_OR007_01 TB439306.[MT7]-HTIPEEETHR.3y6_1.heavy 464.904 / 800.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 2193 278 C20140707_OR007_01 C20140707_OR007_01 TB439306.[MT7]-HTIPEEETHR.3y4_1.heavy 464.904 / 542.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 2195 278 C20140707_OR007_01 C20140707_OR007_01 TB439306.[MT7]-HTIPEEETHR.3y5_1.heavy 464.904 / 671.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - UNC13D unc-13 homolog D (C. elegans) 2197 279 C20140707_OR007_01 C20140707_OR007_01 TB449534.[MT7]-ALHTATFQALQR.3y7_1.heavy 500.952 / 863.473 3255.0 28.9310245513916 31 16 4 3 8 3.7147974514465756 22.93671910227587 0.07049942016601562 4 0.9657643511138083 6.650835518320457 3255.0 48.74071681279803 0.0 - - - - - - - 256.6 6 5 UNC13D unc-13 homolog D (C. elegans) 2199 279 C20140707_OR007_01 C20140707_OR007_01 TB449534.[MT7]-ALHTATFQALQR.3y6_1.heavy 500.952 / 762.426 3847.0 28.9310245513916 31 16 4 3 8 3.7147974514465756 22.93671910227587 0.07049942016601562 4 0.9657643511138083 6.650835518320457 3847.0 73.05414141414141 0.0 - - - - - - - 168.0 7 10 UNC13D unc-13 homolog D (C. elegans) 2201 279 C20140707_OR007_01 C20140707_OR007_01 TB449534.[MT7]-ALHTATFQALQR.3y4_1.heavy 500.952 / 487.299 7989.0 28.9310245513916 31 16 4 3 8 3.7147974514465756 22.93671910227587 0.07049942016601562 4 0.9657643511138083 6.650835518320457 7989.0 9.853415911993311 1.0 - - - - - - - 241.22222222222223 26 9 UNC13D unc-13 homolog D (C. elegans) 2203 279 C20140707_OR007_01 C20140707_OR007_01 TB449534.[MT7]-ALHTATFQALQR.3y5_1.heavy 500.952 / 615.357 6115.0 28.9310245513916 31 16 4 3 8 3.7147974514465756 22.93671910227587 0.07049942016601562 4 0.9657643511138083 6.650835518320457 6115.0 40.66655371107147 0.0 - - - - - - - 253.71428571428572 12 14 UNC13D unc-13 homolog D (C. elegans)