Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140708_OR008_05 C20140708_OR008_05 TB429958.[MT7]-QLDLTK[MT7].2y4_1.heavy 503.313 / 620.374 4080.0 26.16502571105957 45 20 10 5 10 7.6218737246265 13.12013339671281 0.041900634765625 3 0.995026559146614 17.49257448507634 4080.0 13.319635641394425 0.0 - - - - - - - 224.14285714285714 8 7 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 3 1 C20140708_OR008_05 C20140708_OR008_05 TB429958.[MT7]-QLDLTK[MT7].2b3_1.heavy 503.313 / 501.279 7218.0 26.16502571105957 45 20 10 5 10 7.6218737246265 13.12013339671281 0.041900634765625 3 0.995026559146614 17.49257448507634 7218.0 60.09244019138756 0.0 - - - - - - - 139.66666666666666 14 12 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 5 1 C20140708_OR008_05 C20140708_OR008_05 TB429958.[MT7]-QLDLTK[MT7].2y5_1.heavy 503.313 / 733.458 5126.0 26.16502571105957 45 20 10 5 10 7.6218737246265 13.12013339671281 0.041900634765625 3 0.995026559146614 17.49257448507634 5126.0 20.789687028278152 0.0 - - - - - - - 222.375 10 8 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 7 1 C20140708_OR008_05 C20140708_OR008_05 TB429958.[MT7]-QLDLTK[MT7].2y3_1.heavy 503.313 / 505.347 5753.0 26.16502571105957 45 20 10 5 10 7.6218737246265 13.12013339671281 0.041900634765625 3 0.995026559146614 17.49257448507634 5753.0 24.184585987261148 1.0 - - - - - - - 251.0 11 10 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 9 2 C20140708_OR008_05 C20140708_OR008_05 TB430024.[MT7]-ASAPAADPPR.2y9_1.heavy 548.797 / 881.448 619.0 17.991300582885742 39 13 10 10 6 4.078482863843429 24.518921211247473 0.0 6 0.9157989627512785 4.222874238551981 619.0 4.3922598870056495 2.0 - - - - - - - 0.0 1 0 PDLIM7 PDZ and LIM domain 7 (enigma) 11 2 C20140708_OR008_05 C20140708_OR008_05 TB430024.[MT7]-ASAPAADPPR.2b7_1.heavy 548.797 / 728.37 6278.0 17.991300582885742 39 13 10 10 6 4.078482863843429 24.518921211247473 0.0 6 0.9157989627512785 4.222874238551981 6278.0 38.53103543550738 0.0 - - - - - - - 229.8 12 5 PDLIM7 PDZ and LIM domain 7 (enigma) 13 2 C20140708_OR008_05 C20140708_OR008_05 TB430024.[MT7]-ASAPAADPPR.2b5_1.heavy 548.797 / 542.305 354.0 17.991300582885742 39 13 10 10 6 4.078482863843429 24.518921211247473 0.0 6 0.9157989627512785 4.222874238551981 354.0 0.5777089234473616 27.0 - - - - - - - 206.22222222222223 2 9 PDLIM7 PDZ and LIM domain 7 (enigma) 15 2 C20140708_OR008_05 C20140708_OR008_05 TB430024.[MT7]-ASAPAADPPR.2y7_1.heavy 548.797 / 723.378 707.0 17.991300582885742 39 13 10 10 6 4.078482863843429 24.518921211247473 0.0 6 0.9157989627512785 4.222874238551981 707.0 1.8068181818181812 3.0 - - - - - - - 187.625 9 8 PDLIM7 PDZ and LIM domain 7 (enigma) 17 3 C20140708_OR008_05 C20140708_OR008_05 TB430165.[MT7]-GWLAPSPGVK[MT7].3y3_1.heavy 433.927 / 447.305 5037.0 32.08384895324707 39 13 10 6 10 3.4659841170808297 23.095255091427212 0.03459930419921875 3 0.9110279599440648 4.106404621225773 5037.0 29.172625000000004 0.0 - - - - - - - 264.0 10 5 PKD2L1 polycystic kidney disease 2-like 1 19 3 C20140708_OR008_05 C20140708_OR008_05 TB430165.[MT7]-GWLAPSPGVK[MT7].3b4_1.heavy 433.927 / 572.331 4797.0 32.08384895324707 39 13 10 6 10 3.4659841170808297 23.095255091427212 0.03459930419921875 3 0.9110279599440648 4.106404621225773 4797.0 27.9825 0.0 - - - - - - - 270.0 9 4 PKD2L1 polycystic kidney disease 2-like 1 21 3 C20140708_OR008_05 C20140708_OR008_05 TB430165.[MT7]-GWLAPSPGVK[MT7].3y4_1.heavy 433.927 / 544.357 5517.0 32.08384895324707 39 13 10 6 10 3.4659841170808297 23.095255091427212 0.03459930419921875 3 0.9110279599440648 4.106404621225773 5517.0 36.4735 0.0 - - - - - - - 240.0 11 1 PKD2L1 polycystic kidney disease 2-like 1 23 3 C20140708_OR008_05 C20140708_OR008_05 TB430165.[MT7]-GWLAPSPGVK[MT7].3b3_1.heavy 433.927 / 501.294 2039.0 32.08384895324707 39 13 10 6 10 3.4659841170808297 23.095255091427212 0.03459930419921875 3 0.9110279599440648 4.106404621225773 2039.0 15.2925 0.0 - - - - - - - 180.0 4 4 PKD2L1 polycystic kidney disease 2-like 1 25 4 C20140708_OR008_05 C20140708_OR008_05 TB429950.[MT7]-QISDLK[MT7].2y4_1.heavy 496.305 / 606.358 7231.0 24.41604995727539 44 18 10 6 10 4.368514624889098 18.305857053136293 0.035900115966796875 3 0.9876957232111975 11.114450835981735 7231.0 111.66329690198619 0.0 - - - - - - - 179.0 14 7 NIN;LRRFIP1 ninein (GSK3B interacting protein);leucine rich repeat (in FLII) interacting protein 1 27 4 C20140708_OR008_05 C20140708_OR008_05 TB429950.[MT7]-QISDLK[MT7].2y5_1.heavy 496.305 / 719.442 5399.0 24.41604995727539 44 18 10 6 10 4.368514624889098 18.305857053136293 0.035900115966796875 3 0.9876957232111975 11.114450835981735 5399.0 39.09306936550908 0.0 - - - - - - - 144.4 10 10 NIN;LRRFIP1 ninein (GSK3B interacting protein);leucine rich repeat (in FLII) interacting protein 1 29 4 C20140708_OR008_05 C20140708_OR008_05 TB429950.[MT7]-QISDLK[MT7].2b4_1.heavy 496.305 / 588.311 7424.0 24.41604995727539 44 18 10 6 10 4.368514624889098 18.305857053136293 0.035900115966796875 3 0.9876957232111975 11.114450835981735 7424.0 73.47745736434108 0.0 - - - - - - - 241.0 14 2 NIN;LRRFIP1 ninein (GSK3B interacting protein);leucine rich repeat (in FLII) interacting protein 1 31 4 C20140708_OR008_05 C20140708_OR008_05 TB429950.[MT7]-QISDLK[MT7].2y3_1.heavy 496.305 / 519.326 1543.0 24.41604995727539 44 18 10 6 10 4.368514624889098 18.305857053136293 0.035900115966796875 3 0.9876957232111975 11.114450835981735 1543.0 6.200941077055206 1.0 - - - - - - - 337.25 3 8 NIN;LRRFIP1 ninein (GSK3B interacting protein);leucine rich repeat (in FLII) interacting protein 1 33 5 C20140708_OR008_05 C20140708_OR008_05 TB430163.[MT7]-DVMLENYK[MT7].2y5_1.heavy 650.346 / 810.448 3394.0 30.589799880981445 40 14 10 6 10 2.6716744627342277 37.42970986729373 0.03279876708984375 3 0.9342651627775844 4.786921982189727 3394.0 10.85180169125074 0.0 - - - - - - - 259.75 6 8 ZNF846;ZNF559 zinc finger protein 846;zinc finger protein 559 35 5 C20140708_OR008_05 C20140708_OR008_05 TB430163.[MT7]-DVMLENYK[MT7].2y3_1.heavy 650.346 / 568.321 3613.0 30.589799880981445 40 14 10 6 10 2.6716744627342277 37.42970986729373 0.03279876708984375 3 0.9342651627775844 4.786921982189727 3613.0 25.202274473772135 0.0 - - - - - - - 218.76923076923077 7 13 ZNF846;ZNF559 zinc finger protein 846;zinc finger protein 559 37 5 C20140708_OR008_05 C20140708_OR008_05 TB430163.[MT7]-DVMLENYK[MT7].2y6_1.heavy 650.346 / 941.488 3394.0 30.589799880981445 40 14 10 6 10 2.6716744627342277 37.42970986729373 0.03279876708984375 3 0.9342651627775844 4.786921982189727 3394.0 37.308265259101006 0.0 - - - - - - - 200.5 6 6 ZNF846;ZNF559 zinc finger protein 846;zinc finger protein 559 39 5 C20140708_OR008_05 C20140708_OR008_05 TB430163.[MT7]-DVMLENYK[MT7].2b5_1.heavy 650.346 / 732.372 1095.0 30.589799880981445 40 14 10 6 10 2.6716744627342277 37.42970986729373 0.03279876708984375 3 0.9342651627775844 4.786921982189727 1095.0 1.555668358714044 3.0 - - - - - - - 206.44444444444446 2 9 ZNF846;ZNF559 zinc finger protein 846;zinc finger protein 559 41 6 C20140708_OR008_05 C20140708_OR008_05 TB430575.[MT7]-ITRVEMLEIIEAIYK[MT7].4b8_1.heavy 528.061 / 1116.62 139.0 48.648499488830566 29 3 10 6 10 2.2227901535337073 44.988502329391636 0.037601470947265625 3 0.5425235177581557 1.7499524886312643 139.0 1.4 3.0 - - - - - - - 0.0 0 0 VSNL1 visinin-like 1 43 6 C20140708_OR008_05 C20140708_OR008_05 TB430575.[MT7]-ITRVEMLEIIEAIYK[MT7].4b8_2.heavy 528.061 / 558.814 10104.0 48.648499488830566 29 3 10 6 10 2.2227901535337073 44.988502329391636 0.037601470947265625 3 0.5425235177581557 1.7499524886312643 10104.0 85.24978279577294 0.0 - - - - - - - 220.66666666666666 20 6 VSNL1 visinin-like 1 45 6 C20140708_OR008_05 C20140708_OR008_05 TB430575.[MT7]-ITRVEMLEIIEAIYK[MT7].4b5_1.heavy 528.061 / 743.453 767.0 48.648499488830566 29 3 10 6 10 2.2227901535337073 44.988502329391636 0.037601470947265625 3 0.5425235177581557 1.7499524886312643 767.0 16.47512846865365 0.0 - - - - - - - 0.0 1 0 VSNL1 visinin-like 1 47 6 C20140708_OR008_05 C20140708_OR008_05 TB430575.[MT7]-ITRVEMLEIIEAIYK[MT7].4b6_1.heavy 528.061 / 874.494 1045.0 48.648499488830566 29 3 10 6 10 2.2227901535337073 44.988502329391636 0.037601470947265625 3 0.5425235177581557 1.7499524886312643 1045.0 29.409285714285716 0.0 - - - - - - - 181.2 2 5 VSNL1 visinin-like 1 49 7 C20140708_OR008_05 C20140708_OR008_05 TB430574.[MT7]-VVLEGPAPWGFRLQGGK[MT7].4y8_2.heavy 525.556 / 503.799 6989.0 40.29734992980957 38 13 10 5 10 1.22620155659604 54.368440741287806 0.04540252685546875 3 0.9236530277633869 4.43776051752127 6989.0 26.28177707266822 0.0 - - - - - - - 315.5 13 6 PDLIM7 PDZ and LIM domain 7 (enigma) 51 7 C20140708_OR008_05 C20140708_OR008_05 TB430574.[MT7]-VVLEGPAPWGFRLQGGK[MT7].4y10_2.heavy 525.556 / 645.365 13104.0 40.29734992980957 38 13 10 5 10 1.22620155659604 54.368440741287806 0.04540252685546875 3 0.9236530277633869 4.43776051752127 13104.0 51.37596074453278 0.0 - - - - - - - 242.66666666666666 26 6 PDLIM7 PDZ and LIM domain 7 (enigma) 53 7 C20140708_OR008_05 C20140708_OR008_05 TB430574.[MT7]-VVLEGPAPWGFRLQGGK[MT7].4y9_2.heavy 525.556 / 596.839 8299.0 40.29734992980957 38 13 10 5 10 1.22620155659604 54.368440741287806 0.04540252685546875 3 0.9236530277633869 4.43776051752127 8299.0 57.81958506268682 0.0 - - - - - - - 407.8 16 5 PDLIM7 PDZ and LIM domain 7 (enigma) 55 7 C20140708_OR008_05 C20140708_OR008_05 TB430574.[MT7]-VVLEGPAPWGFRLQGGK[MT7].4b5_1.heavy 525.556 / 642.394 7426.0 40.29734992980957 38 13 10 5 10 1.22620155659604 54.368440741287806 0.04540252685546875 3 0.9236530277633869 4.43776051752127 7426.0 73.57833074424516 0.0 - - - - - - - 182.25 14 4 PDLIM7 PDZ and LIM domain 7 (enigma) 57 8 C20140708_OR008_05 C20140708_OR008_05 TB430572.[MT7]-YYAFDEAFVREVLGK[MT7].3y10_2.heavy 699.042 / 646.378 3275.0 47.4286994934082 44 14 10 10 10 1.2253374224272984 50.31379023168151 0.0 3 0.9399277714585218 5.009876999812743 3275.0 12.975211084650356 0.0 - - - - - - - 183.53333333333333 6 15 FIBP fibroblast growth factor (acidic) intracellular binding protein 59 8 C20140708_OR008_05 C20140708_OR008_05 TB430572.[MT7]-YYAFDEAFVREVLGK[MT7].3y14_2.heavy 699.042 / 894.476 2308.0 47.4286994934082 44 14 10 10 10 1.2253374224272984 50.31379023168151 0.0 3 0.9399277714585218 5.009876999812743 2308.0 12.624500699165823 0.0 - - - - - - - 248.0 4 9 FIBP fibroblast growth factor (acidic) intracellular binding protein 61 8 C20140708_OR008_05 C20140708_OR008_05 TB430572.[MT7]-YYAFDEAFVREVLGK[MT7].3b3_1.heavy 699.042 / 542.273 1265.0 47.4286994934082 44 14 10 10 10 1.2253374224272984 50.31379023168151 0.0 3 0.9399277714585218 5.009876999812743 1265.0 3.302203746368827 0.0 - - - - - - - 232.625 2 16 FIBP fibroblast growth factor (acidic) intracellular binding protein 63 8 C20140708_OR008_05 C20140708_OR008_05 TB430572.[MT7]-YYAFDEAFVREVLGK[MT7].3y13_2.heavy 699.042 / 812.944 1489.0 47.4286994934082 44 14 10 10 10 1.2253374224272984 50.31379023168151 0.0 3 0.9399277714585218 5.009876999812743 1489.0 24.41603482677308 0.0 - - - - - - - 173.66666666666666 2 9 FIBP fibroblast growth factor (acidic) intracellular binding protein 65 9 C20140708_OR008_05 C20140708_OR008_05 TB448685.[MT7]-IESVETGLK[MT7].2y4_1.heavy 632.374 / 562.368 8672.0 29.193899154663086 45 15 10 10 10 15.890180526718575 6.2931947080056645 0.0 3 0.9599310972435356 6.144658213198642 8672.0 31.12194392523364 0.0 - - - - - - - 214.0 17 10 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 67 9 C20140708_OR008_05 C20140708_OR008_05 TB448685.[MT7]-IESVETGLK[MT7].2y8_1.heavy 632.374 / 1006.55 14989.0 29.193899154663086 45 15 10 10 10 15.890180526718575 6.2931947080056645 0.0 3 0.9599310972435356 6.144658213198642 14989.0 47.61551838180755 0.0 - - - - - - - 214.0 29 5 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 69 9 C20140708_OR008_05 C20140708_OR008_05 TB448685.[MT7]-IESVETGLK[MT7].2y5_1.heavy 632.374 / 691.411 11242.0 29.193899154663086 45 15 10 10 10 15.890180526718575 6.2931947080056645 0.0 3 0.9599310972435356 6.144658213198642 11242.0 41.605906542056076 0.0 - - - - - - - 229.28571428571428 22 7 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 71 9 C20140708_OR008_05 C20140708_OR008_05 TB448685.[MT7]-IESVETGLK[MT7].2y7_1.heavy 632.374 / 877.511 8886.0 29.193899154663086 45 15 10 10 10 15.890180526718575 6.2931947080056645 0.0 3 0.9599310972435356 6.144658213198642 8886.0 50.93532710280374 0.0 - - - - - - - 171.2 17 10 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 73 10 C20140708_OR008_05 C20140708_OR008_05 TB449047.[MT7]-VLQLETVLEGVVSQIDAVGSK[MT7].3y6_1.heavy 824.81 / 720.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 75 10 C20140708_OR008_05 C20140708_OR008_05 TB449047.[MT7]-VLQLETVLEGVVSQIDAVGSK[MT7].3b6_1.heavy 824.81 / 828.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 77 10 C20140708_OR008_05 C20140708_OR008_05 TB449047.[MT7]-VLQLETVLEGVVSQIDAVGSK[MT7].3b4_1.heavy 824.81 / 598.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 79 10 C20140708_OR008_05 C20140708_OR008_05 TB449047.[MT7]-VLQLETVLEGVVSQIDAVGSK[MT7].3b5_1.heavy 824.81 / 727.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 81 11 C20140708_OR008_05 C20140708_OR008_05 TB430471.[MT7]-SEQEITALEQNVIR.2y8_1.heavy 887.477 / 942.537 7992.0 38.07809829711914 47 17 10 10 10 6.216257392712908 16.086849961719146 0.0 3 0.9735119542485867 7.56613501627764 7992.0 47.492396166134185 0.0 - - - - - - - 287.0 15 6 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 83 11 C20140708_OR008_05 C20140708_OR008_05 TB430471.[MT7]-SEQEITALEQNVIR.2b4_1.heavy 887.477 / 618.285 16453.0 38.07809829711914 47 17 10 10 10 6.216257392712908 16.086849961719146 0.0 3 0.9735119542485867 7.56613501627764 16453.0 146.8686632343664 0.0 - - - - - - - 188.2 32 5 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 85 11 C20140708_OR008_05 C20140708_OR008_05 TB430471.[MT7]-SEQEITALEQNVIR.2y9_1.heavy 887.477 / 1043.58 24758.0 38.07809829711914 47 17 10 10 10 6.216257392712908 16.086849961719146 0.0 3 0.9735119542485867 7.56613501627764 24758.0 221.00372967583078 0.0 - - - - - - - 235.0 49 6 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 87 11 C20140708_OR008_05 C20140708_OR008_05 TB430471.[MT7]-SEQEITALEQNVIR.2y10_1.heavy 887.477 / 1156.67 5955.0 38.07809829711914 47 17 10 10 10 6.216257392712908 16.086849961719146 0.0 3 0.9735119542485867 7.56613501627764 5955.0 42.3024654862402 0.0 - - - - - - - 250.8 11 5 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 89 12 C20140708_OR008_05 C20140708_OR008_05 TB429942.[MT7]-NMVSSFR.2y4_1.heavy 492.756 / 496.251 2140.0 27.170750617980957 39 17 8 6 8 2.8304145467105326 28.16790330536994 0.039798736572265625 4 0.9719239946947816 7.348070870604597 2140.0 18.599999999999998 0.0 - - - - - - - 214.0 4 6 PIAS2 protein inhibitor of activated STAT, 2 91 12 C20140708_OR008_05 C20140708_OR008_05 TB429942.[MT7]-NMVSSFR.2y5_1.heavy 492.756 / 595.32 1177.0 27.170750617980957 39 17 8 6 8 2.8304145467105326 28.16790330536994 0.039798736572265625 4 0.9719239946947816 7.348070870604597 1177.0 1.1366666666666667 5.0 - - - - - - - 214.0 5 8 PIAS2 protein inhibitor of activated STAT, 2 93 12 C20140708_OR008_05 C20140708_OR008_05 TB429942.[MT7]-NMVSSFR.2b4_1.heavy 492.756 / 576.293 535.0 27.170750617980957 39 17 8 6 8 2.8304145467105326 28.16790330536994 0.039798736572265625 4 0.9719239946947816 7.348070870604597 535.0 2.0 14.0 - - - - - - - 0.0 1 0 PIAS2 protein inhibitor of activated STAT, 2 95 12 C20140708_OR008_05 C20140708_OR008_05 TB429942.[MT7]-NMVSSFR.2y6_1.heavy 492.756 / 726.36 2033.0 27.170750617980957 39 17 8 6 8 2.8304145467105326 28.16790330536994 0.039798736572265625 4 0.9719239946947816 7.348070870604597 2033.0 3.8 1.0 - - - - - - - 107.0 4 1 PIAS2 protein inhibitor of activated STAT, 2 97 13 C20140708_OR008_05 C20140708_OR008_05 TB430609.[MT7]-AAQAGVAVGDWVLSIDGENAGSLTHIEAQNK[MT7].3b11_1.heavy 1137.26 / 1170.6 1406.0 44.5010986328125 47 17 10 10 10 2.2170233053551787 31.456294193718694 0.0 3 0.9726662626939505 7.447639141601798 1406.0 16.626767441860466 0.0 - - - - - - - 163.0 2 8 PDLIM7 PDZ and LIM domain 7 (enigma) 99 13 C20140708_OR008_05 C20140708_OR008_05 TB430609.[MT7]-AAQAGVAVGDWVLSIDGENAGSLTHIEAQNK[MT7].3b6_1.heavy 1137.26 / 642.369 2911.0 44.5010986328125 47 17 10 10 10 2.2170233053551787 31.456294193718694 0.0 3 0.9726662626939505 7.447639141601798 2911.0 32.968767441860464 0.0 - - - - - - - 160.4 5 5 PDLIM7 PDZ and LIM domain 7 (enigma) 101 13 C20140708_OR008_05 C20140708_OR008_05 TB430609.[MT7]-AAQAGVAVGDWVLSIDGENAGSLTHIEAQNK[MT7].3b5_1.heavy 1137.26 / 543.301 3112.0 44.5010986328125 47 17 10 10 10 2.2170233053551787 31.456294193718694 0.0 3 0.9726662626939505 7.447639141601798 3112.0 31.08888 0.0 - - - - - - - 243.57142857142858 6 7 PDLIM7 PDZ and LIM domain 7 (enigma) 103 13 C20140708_OR008_05 C20140708_OR008_05 TB430609.[MT7]-AAQAGVAVGDWVLSIDGENAGSLTHIEAQNK[MT7].3b7_1.heavy 1137.26 / 713.406 3614.0 44.5010986328125 47 17 10 10 10 2.2170233053551787 31.456294193718694 0.0 3 0.9726662626939505 7.447639141601798 3614.0 8.981059701492537 0.0 - - - - - - - 244.0 7 7 PDLIM7 PDZ and LIM domain 7 (enigma) 105 14 C20140708_OR008_05 C20140708_OR008_05 TB430012.[MT7]-TFHMLER.2y4_1.heavy 539.285 / 548.286 1926.0 27.399700164794922 50 20 10 10 10 18.097696543557987 5.5255650772637015 0.0 3 0.999470007923845 53.60539475677502 1926.0 6.728571428571428 1.0 - - - - - - - 321.0 3 10 FIBP fibroblast growth factor (acidic) intracellular binding protein 107 14 C20140708_OR008_05 C20140708_OR008_05 TB430012.[MT7]-TFHMLER.2b3_1.heavy 539.285 / 530.284 N/A 27.399700164794922 50 20 10 10 10 18.097696543557987 5.5255650772637015 0.0 3 0.999470007923845 53.60539475677502 5457.0 12.133064516129032 0.0 - - - - - - - 291.8181818181818 10 11 FIBP fibroblast growth factor (acidic) intracellular binding protein 109 14 C20140708_OR008_05 C20140708_OR008_05 TB430012.[MT7]-TFHMLER.2y5_1.heavy 539.285 / 685.345 2033.0 27.399700164794922 50 20 10 10 10 18.097696543557987 5.5255650772637015 0.0 3 0.999470007923845 53.60539475677502 2033.0 27.169999999999998 0.0 - - - - - - - 187.25 4 4 FIBP fibroblast growth factor (acidic) intracellular binding protein 111 14 C20140708_OR008_05 C20140708_OR008_05 TB430012.[MT7]-TFHMLER.2y6_1.heavy 539.285 / 832.413 3638.0 27.399700164794922 50 20 10 10 10 18.097696543557987 5.5255650772637015 0.0 3 0.999470007923845 53.60539475677502 3638.0 3.758888888888889 0.0 - - - - - - - 233.45454545454547 7 11 FIBP fibroblast growth factor (acidic) intracellular binding protein 113 15 C20140708_OR008_05 C20140708_OR008_05 TB429947.[MT7]-NEIDVVR.2y5_1.heavy 494.781 / 601.367 4257.0 25.020649909973145 44 18 10 6 10 6.113117839165151 16.358264740019585 0.03970146179199219 3 0.9886673028124765 11.582031152329094 4257.0 45.01580114349463 0.0 - - - - - - - 202.5 8 10 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 115 15 C20140708_OR008_05 C20140708_OR008_05 TB429947.[MT7]-NEIDVVR.2b4_1.heavy 494.781 / 616.306 8008.0 25.020649909973145 44 18 10 6 10 6.113117839165151 16.358264740019585 0.03970146179199219 3 0.9886673028124765 11.582031152329094 8008.0 43.08462703053931 0.0 - - - - - - - 240.75 16 8 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 117 15 C20140708_OR008_05 C20140708_OR008_05 TB429947.[MT7]-NEIDVVR.2y6_1.heavy 494.781 / 730.409 3041.0 25.020649909973145 44 18 10 6 10 6.113117839165151 16.358264740019585 0.03970146179199219 3 0.9886673028124765 11.582031152329094 3041.0 44.19038872360142 0.0 - - - - - - - 202.83333333333334 6 6 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 119 15 C20140708_OR008_05 C20140708_OR008_05 TB429947.[MT7]-NEIDVVR.2b5_1.heavy 494.781 / 715.374 2027.0 25.020649909973145 44 18 10 6 10 6.113117839165151 16.358264740019585 0.03970146179199219 3 0.9886673028124765 11.582031152329094 2027.0 4.350150661068638 1.0 - - - - - - - 216.85714285714286 5 7 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 121 16 C20140708_OR008_05 C20140708_OR008_05 TB438795.[MT7]-INAAHGFSLIQVDNTK[MT7].3y3_1.heavy 672.709 / 506.306 5153.0 35.19990158081055 42 12 10 10 10 1.8909867898777482 52.882442402712385 0.0 3 0.898931144826563 3.848807263661083 5153.0 16.71006791171477 0.0 - - - - - - - 294.5 10 8 MAPKAP1 mitogen-activated protein kinase associated protein 1 123 16 C20140708_OR008_05 C20140708_OR008_05 TB438795.[MT7]-INAAHGFSLIQVDNTK[MT7].3b4_1.heavy 672.709 / 514.311 7803.0 35.19990158081055 42 12 10 10 10 1.8909867898777482 52.882442402712385 0.0 3 0.898931144826563 3.848807263661083 7803.0 10.429218550286583 1.0 - - - - - - - 343.44444444444446 19 9 MAPKAP1 mitogen-activated protein kinase associated protein 1 125 16 C20140708_OR008_05 C20140708_OR008_05 TB438795.[MT7]-INAAHGFSLIQVDNTK[MT7].3y4_1.heavy 672.709 / 621.332 7067.0 35.19990158081055 42 12 10 10 10 1.8909867898777482 52.882442402712385 0.0 3 0.898931144826563 3.848807263661083 7067.0 33.513216970998926 0.0 - - - - - - - 245.0 14 3 MAPKAP1 mitogen-activated protein kinase associated protein 1 127 16 C20140708_OR008_05 C20140708_OR008_05 TB438795.[MT7]-INAAHGFSLIQVDNTK[MT7].3y5_1.heavy 672.709 / 720.401 6331.0 35.19990158081055 42 12 10 10 10 1.8909867898777482 52.882442402712385 0.0 3 0.898931144826563 3.848807263661083 6331.0 58.78785714285715 0.0 - - - - - - - 240.63636363636363 12 11 MAPKAP1 mitogen-activated protein kinase associated protein 1 129 17 C20140708_OR008_05 C20140708_OR008_05 TB430604.[MT7]-DYAAIVFFANNRFETGK[MT7].3b6_1.heavy 751.063 / 777.426 366.0 42.52130126953125 42 17 10 5 10 2.3392152412222216 33.210577822755 0.042999267578125 3 0.9741930849880922 7.665771856662491 366.0 1.6800000000000002 12.0 - - - - - - - 0.0 1 0 FIBP fibroblast growth factor (acidic) intracellular binding protein 131 17 C20140708_OR008_05 C20140708_OR008_05 TB430604.[MT7]-DYAAIVFFANNRFETGK[MT7].3b4_1.heavy 751.063 / 565.274 2687.0 42.52130126953125 42 17 10 5 10 2.3392152412222216 33.210577822755 0.042999267578125 3 0.9741930849880922 7.665771856662491 2687.0 12.454013932188726 0.0 - - - - - - - 216.88888888888889 5 9 FIBP fibroblast growth factor (acidic) intracellular binding protein 133 17 C20140708_OR008_05 C20140708_OR008_05 TB430604.[MT7]-DYAAIVFFANNRFETGK[MT7].3b5_1.heavy 751.063 / 678.358 1466.0 42.52130126953125 42 17 10 5 10 2.3392152412222216 33.210577822755 0.042999267578125 3 0.9741930849880922 7.665771856662491 1466.0 5.398235743739313 0.0 - - - - - - - 312.0 2 9 FIBP fibroblast growth factor (acidic) intracellular binding protein 135 17 C20140708_OR008_05 C20140708_OR008_05 TB430604.[MT7]-DYAAIVFFANNRFETGK[MT7].3y12_2.heavy 751.063 / 787.416 855.0 42.52130126953125 42 17 10 5 10 2.3392152412222216 33.210577822755 0.042999267578125 3 0.9741930849880922 7.665771856662491 855.0 3.5508196721311474 0.0 - - - - - - - 0.0 1 0 FIBP fibroblast growth factor (acidic) intracellular binding protein 137 18 C20140708_OR008_05 C20140708_OR008_05 TB438794.[MT7]-INAAHGFSLIQVDNTK[MT7].4y4_1.heavy 504.783 / 621.332 5867.0 35.21112632751465 38 13 10 5 10 1.6690918434865893 50.434161008979046 0.04489898681640625 3 0.9188182830952678 4.301802386896193 5867.0 17.295701564193898 0.0 - - - - - - - 147.0 11 3 MAPKAP1 mitogen-activated protein kinase associated protein 1 139 18 C20140708_OR008_05 C20140708_OR008_05 TB438794.[MT7]-INAAHGFSLIQVDNTK[MT7].4b8_2.heavy 504.783 / 471.749 8067.0 35.21112632751465 38 13 10 5 10 1.6690918434865893 50.434161008979046 0.04489898681640625 3 0.9188182830952678 4.301802386896193 8067.0 12.801847761379138 0.0 - - - - - - - 293.5 16 4 MAPKAP1 mitogen-activated protein kinase associated protein 1 141 18 C20140708_OR008_05 C20140708_OR008_05 TB438794.[MT7]-INAAHGFSLIQVDNTK[MT7].4b4_1.heavy 504.783 / 514.311 6600.0 35.21112632751465 38 13 10 5 10 1.6690918434865893 50.434161008979046 0.04489898681640625 3 0.9188182830952678 4.301802386896193 6600.0 41.22184300341297 0.0 - - - - - - - 264.0 13 5 MAPKAP1 mitogen-activated protein kinase associated protein 1 143 18 C20140708_OR008_05 C20140708_OR008_05 TB438794.[MT7]-INAAHGFSLIQVDNTK[MT7].4b6_2.heavy 504.783 / 354.699 3373.0 35.21112632751465 38 13 10 5 10 1.6690918434865893 50.434161008979046 0.04489898681640625 3 0.9188182830952678 4.301802386896193 3373.0 14.718545454545454 0.0 - - - - - - - 335.2857142857143 6 7 MAPKAP1 mitogen-activated protein kinase associated protein 1 145 19 C20140708_OR008_05 C20140708_OR008_05 TB430603.[MT7]-YTSEDNASFQEIMEVAK[MT7].3b6_1.heavy 750.699 / 854.365 1329.0 40.41190147399902 29 8 10 5 6 1.7019264999464803 47.14449853520355 0.04560089111328125 6 0.7652970738024654 2.4958461793275926 1329.0 6.892779661016949 0.0 - - - - - - - 236.2 2 5 DGCR14 DiGeorge syndrome critical region gene 14 147 19 C20140708_OR008_05 C20140708_OR008_05 TB430603.[MT7]-YTSEDNASFQEIMEVAK[MT7].3b4_1.heavy 750.699 / 625.295 738.0 40.41190147399902 29 8 10 5 6 1.7019264999464803 47.14449853520355 0.04560089111328125 6 0.7652970738024654 2.4958461793275926 738.0 2.111269035532995 8.0 - - - - - - - 295.5 2 2 DGCR14 DiGeorge syndrome critical region gene 14 149 19 C20140708_OR008_05 C20140708_OR008_05 TB430603.[MT7]-YTSEDNASFQEIMEVAK[MT7].3b5_1.heavy 750.699 / 740.322 295.0 40.41190147399902 29 8 10 5 6 1.7019264999464803 47.14449853520355 0.04560089111328125 6 0.7652970738024654 2.4958461793275926 295.0 -0.07612288292851184 15.0 - - - - - - - 274.2857142857143 2 7 DGCR14 DiGeorge syndrome critical region gene 14 151 19 C20140708_OR008_05 C20140708_OR008_05 TB430603.[MT7]-YTSEDNASFQEIMEVAK[MT7].3y5_1.heavy 750.699 / 721.404 2805.0 40.41190147399902 29 8 10 5 6 1.7019264999464803 47.14449853520355 0.04560089111328125 6 0.7652970738024654 2.4958461793275926 2805.0 26.468894869445716 0.0 - - - - - - - 265.8 5 5 DGCR14 DiGeorge syndrome critical region gene 14 153 20 C20140708_OR008_05 C20140708_OR008_05 TB438895.[MT7]-RVLQLETVLEGVVSQIDAVGSK[MT7].4y4_1.heavy 657.885 / 534.337 1508.0 53.58389854431152 44 18 10 6 10 3.9261130583908725 20.351597614592954 0.03279876708984375 3 0.9897260757110423 12.165267449805354 1508.0 8.893333333333333 1.0 - - - - - - - 162.93333333333334 3 15 PKD2L1 polycystic kidney disease 2-like 1 155 20 C20140708_OR008_05 C20140708_OR008_05 TB438895.[MT7]-RVLQLETVLEGVVSQIDAVGSK[MT7].4b8_1.heavy 657.885 / 1083.66 1508.0 53.58389854431152 44 18 10 6 10 3.9261130583908725 20.351597614592954 0.03279876708984375 3 0.9897260757110423 12.165267449805354 1508.0 24.0555 0.0 - - - - - - - 175.5 3 8 PKD2L1 polycystic kidney disease 2-like 1 157 20 C20140708_OR008_05 C20140708_OR008_05 TB438895.[MT7]-RVLQLETVLEGVVSQIDAVGSK[MT7].4b11_2.heavy 657.885 / 691.91 1664.0 53.58389854431152 44 18 10 6 10 3.9261130583908725 20.351597614592954 0.03279876708984375 3 0.9897260757110423 12.165267449805354 1664.0 4.266666666666666 0.0 - - - - - - - 201.5 3 8 PKD2L1 polycystic kidney disease 2-like 1 159 20 C20140708_OR008_05 C20140708_OR008_05 TB438895.[MT7]-RVLQLETVLEGVVSQIDAVGSK[MT7].4y6_1.heavy 657.885 / 720.401 1768.0 53.58389854431152 44 18 10 6 10 3.9261130583908725 20.351597614592954 0.03279876708984375 3 0.9897260757110423 12.165267449805354 1768.0 27.200000000000003 1.0 - - - - - - - 146.54545454545453 4 11 PKD2L1 polycystic kidney disease 2-like 1 161 21 C20140708_OR008_05 C20140708_OR008_05 TB438792.[MT7]-TMEAFHFVSYVPITGR.2b3_1.heavy 1000.02 / 506.24 567.0 41.143699645996094 42 12 10 10 10 2.80085857213672 28.452998028195076 0.0 3 0.8907675362343562 3.6995730805666596 567.0 3.5135775442499853 8.0 - - - - - - - 0.0 1 0 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 163 21 C20140708_OR008_05 C20140708_OR008_05 TB438792.[MT7]-TMEAFHFVSYVPITGR.2y5_1.heavy 1000.02 / 543.325 1985.0 41.143699645996094 42 12 10 10 10 2.80085857213672 28.452998028195076 0.0 3 0.8907675362343562 3.6995730805666596 1985.0 21.38767605633803 0.0 - - - - - - - 212.9 3 10 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 165 21 C20140708_OR008_05 C20140708_OR008_05 TB438792.[MT7]-TMEAFHFVSYVPITGR.2b4_1.heavy 1000.02 / 577.277 2268.0 41.143699645996094 42 12 10 10 10 2.80085857213672 28.452998028195076 0.0 3 0.8907675362343562 3.6995730805666596 2268.0 23.94976056338028 0.0 - - - - - - - 248.5 4 4 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 167 21 C20140708_OR008_05 C20140708_OR008_05 TB438792.[MT7]-TMEAFHFVSYVPITGR.2y10_1.heavy 1000.02 / 1138.63 1276.0 41.143699645996094 42 12 10 10 10 2.80085857213672 28.452998028195076 0.0 3 0.8907675362343562 3.6995730805666596 1276.0 4.628538887646869 1.0 - - - - - - - 297.9 2 10 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 169 22 C20140708_OR008_05 C20140708_OR008_05 TB438790.[MT7]-GFC[CAM]YVEFDEVDSLK[MT7].3b6_1.heavy 665.992 / 900.404 824.0 41.51165008544922 30 17 2 5 6 3.030667982476036 32.99602614942355 0.04489898681640625 6 0.9787874755378928 8.458541446281915 824.0 3.6978181818181817 4.0 - - - - - - - 274.7142857142857 5 7 EIF4H eukaryotic translation initiation factor 4H 171 22 C20140708_OR008_05 C20140708_OR008_05 TB438790.[MT7]-GFC[CAM]YVEFDEVDSLK[MT7].3b4_1.heavy 665.992 / 672.293 1237.0 41.51165008544922 30 17 2 5 6 3.030667982476036 32.99602614942355 0.04489898681640625 6 0.9787874755378928 8.458541446281915 1237.0 2.8270854368932037 3.0 - - - - - - - 219.6 2 5 EIF4H eukaryotic translation initiation factor 4H 173 22 C20140708_OR008_05 C20140708_OR008_05 TB438790.[MT7]-GFC[CAM]YVEFDEVDSLK[MT7].3b5_1.heavy 665.992 / 771.362 1099.0 41.51165008544922 30 17 2 5 6 3.030667982476036 32.99602614942355 0.04489898681640625 6 0.9787874755378928 8.458541446281915 1099.0 5.850598764342454 2.0 - - - - - - - 274.6 2 5 EIF4H eukaryotic translation initiation factor 4H 175 22 C20140708_OR008_05 C20140708_OR008_05 TB438790.[MT7]-GFC[CAM]YVEFDEVDSLK[MT7].3b3_1.heavy 665.992 / 509.23 1099.0 41.51165008544922 30 17 2 5 6 3.030667982476036 32.99602614942355 0.04489898681640625 6 0.9787874755378928 8.458541446281915 1099.0 4.795636363636364 3.0 - - - - - - - 292.0 3 8 EIF4H eukaryotic translation initiation factor 4H 177 23 C20140708_OR008_05 C20140708_OR008_05 TB430152.[MT7]-EK[MT7]PPISGK[MT7].2y4_1.heavy 644.403 / 548.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAP1 mitogen-activated protein kinase associated protein 1 179 23 C20140708_OR008_05 C20140708_OR008_05 TB430152.[MT7]-EK[MT7]PPISGK[MT7].2y6_1.heavy 644.403 / 742.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAP1 mitogen-activated protein kinase associated protein 1 181 23 C20140708_OR008_05 C20140708_OR008_05 TB430152.[MT7]-EK[MT7]PPISGK[MT7].2y7_2.heavy 644.403 / 507.831 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAP1 mitogen-activated protein kinase associated protein 1 183 23 C20140708_OR008_05 C20140708_OR008_05 TB430152.[MT7]-EK[MT7]PPISGK[MT7].2y7_1.heavy 644.403 / 1014.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAP1 mitogen-activated protein kinase associated protein 1 185 24 C20140708_OR008_05 C20140708_OR008_05 TB438295.[MT7]-LESQVSR.2y5_1.heavy 481.773 / 576.31 4583.0 19.97320032119751 36 16 6 6 8 2.3882547992541188 35.52507284344529 0.03840065002441406 4 0.9638446721327728 6.470814527550533 4583.0 68.12435138987883 0.0 - - - - - - - 219.9 9 10 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 187 24 C20140708_OR008_05 C20140708_OR008_05 TB438295.[MT7]-LESQVSR.2b4_1.heavy 481.773 / 602.327 3391.0 19.97320032119751 36 16 6 6 8 2.3882547992541188 35.52507284344529 0.03840065002441406 4 0.9638446721327728 6.470814527550533 3391.0 40.746434367965875 0.0 - - - - - - - 183.44444444444446 6 9 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 189 24 C20140708_OR008_05 C20140708_OR008_05 TB438295.[MT7]-LESQVSR.2y6_1.heavy 481.773 / 705.353 4308.0 19.97320032119751 36 16 6 6 8 2.3882547992541188 35.52507284344529 0.03840065002441406 4 0.9638446721327728 6.470814527550533 4308.0 59.08839177865613 1.0 - - - - - - - 168.16666666666666 14 6 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 191 24 C20140708_OR008_05 C20140708_OR008_05 TB438295.[MT7]-LESQVSR.2b5_1.heavy 481.773 / 701.395 550.0 19.97320032119751 36 16 6 6 8 2.3882547992541188 35.52507284344529 0.03840065002441406 4 0.9638446721327728 6.470814527550533 550.0 2.26 1.0 - - - - - - - 0.0 1 0 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 193 25 C20140708_OR008_05 C20140708_OR008_05 TB448539.[MT7]-FGSALGK[MT7].2y4_1.heavy 484.294 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGCR14 DiGeorge syndrome critical region gene 14 195 25 C20140708_OR008_05 C20140708_OR008_05 TB448539.[MT7]-FGSALGK[MT7].2y5_1.heavy 484.294 / 619.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGCR14 DiGeorge syndrome critical region gene 14 197 25 C20140708_OR008_05 C20140708_OR008_05 TB448539.[MT7]-FGSALGK[MT7].2b4_1.heavy 484.294 / 507.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGCR14 DiGeorge syndrome critical region gene 14 199 25 C20140708_OR008_05 C20140708_OR008_05 TB448539.[MT7]-FGSALGK[MT7].2y6_1.heavy 484.294 / 676.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGCR14 DiGeorge syndrome critical region gene 14 201 26 C20140708_OR008_05 C20140708_OR008_05 TB449050.[MT7]-IQVSERPLMFLLDTPGVLAPR.3y7_1.heavy 832.809 / 709.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 203 26 C20140708_OR008_05 C20140708_OR008_05 TB449050.[MT7]-IQVSERPLMFLLDTPGVLAPR.3y8_1.heavy 832.809 / 810.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 205 26 C20140708_OR008_05 C20140708_OR008_05 TB449050.[MT7]-IQVSERPLMFLLDTPGVLAPR.3y10_1.heavy 832.809 / 1038.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 207 26 C20140708_OR008_05 C20140708_OR008_05 TB449050.[MT7]-IQVSERPLMFLLDTPGVLAPR.3y9_1.heavy 832.809 / 925.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 209 27 C20140708_OR008_05 C20140708_OR008_05 TB438593.[MT7]-EPLPSLDVFLSR.2y8_1.heavy 758.928 / 936.515 325.0 45.794498443603516 34 8 10 10 6 0.7835269731189826 79.48131127636603 0.0 5 0.7970203866519434 2.691536818217203 325.0 -0.09999999999999998 12.0 - - - - - - - 0.0 0 0 DGCR14 DiGeorge syndrome critical region gene 14 211 27 C20140708_OR008_05 C20140708_OR008_05 TB438593.[MT7]-EPLPSLDVFLSR.2y5_1.heavy 758.928 / 621.372 1544.0 45.794498443603516 34 8 10 10 6 0.7835269731189826 79.48131127636603 0.0 5 0.7970203866519434 2.691536818217203 1544.0 18.16020238818053 0.0 - - - - - - - 200.0 3 13 DGCR14 DiGeorge syndrome critical region gene 14 213 27 C20140708_OR008_05 C20140708_OR008_05 TB438593.[MT7]-EPLPSLDVFLSR.2y9_1.heavy 758.928 / 1033.57 5689.0 45.794498443603516 34 8 10 10 6 0.7835269731189826 79.48131127636603 0.0 5 0.7970203866519434 2.691536818217203 5689.0 60.03116564417178 0.0 - - - - - - - 174.28571428571428 11 14 DGCR14 DiGeorge syndrome critical region gene 14 215 27 C20140708_OR008_05 C20140708_OR008_05 TB438593.[MT7]-EPLPSLDVFLSR.2y11_1.heavy 758.928 / 1243.7 1219.0 45.794498443603516 34 8 10 10 6 0.7835269731189826 79.48131127636603 0.0 5 0.7970203866519434 2.691536818217203 1219.0 6.694508196721311 3.0 - - - - - - - 206.53846153846155 3 13 DGCR14 DiGeorge syndrome critical region gene 14 217 28 C20140708_OR008_05 C20140708_OR008_05 TB448910.[MT7]-LTADPDSEIATTSLR.2y9_1.heavy 867.456 / 977.526 2533.0 32.7116003036499 33 8 10 5 10 0.9183329484784302 67.71476266588623 0.046398162841796875 3 0.7565837764665952 2.4488166554252184 2533.0 33.965227272727276 0.0 - - - - - - - 220.0 5 7 PIAS1;PIAS2 protein inhibitor of activated STAT, 1;protein inhibitor of activated STAT, 2 219 28 C20140708_OR008_05 C20140708_OR008_05 TB448910.[MT7]-LTADPDSEIATTSLR.2b4_1.heavy 867.456 / 545.305 16406.0 32.7116003036499 33 8 10 5 10 0.9183329484784302 67.71476266588623 0.046398162841796875 3 0.7565837764665952 2.4488166554252184 16406.0 187.92327272727272 0.0 - - - - - - - 206.25 32 8 PIAS1;PIAS2 protein inhibitor of activated STAT, 1;protein inhibitor of activated STAT, 2 221 28 C20140708_OR008_05 C20140708_OR008_05 TB448910.[MT7]-LTADPDSEIATTSLR.2y11_1.heavy 867.456 / 1189.61 6937.0 32.7116003036499 33 8 10 5 10 0.9183329484784302 67.71476266588623 0.046398162841796875 3 0.7565837764665952 2.4488166554252184 6937.0 121.08218181818182 0.0 - - - - - - - 220.0 13 7 PIAS1;PIAS2 protein inhibitor of activated STAT, 1;protein inhibitor of activated STAT, 2 223 28 C20140708_OR008_05 C20140708_OR008_05 TB448910.[MT7]-LTADPDSEIATTSLR.2y7_1.heavy 867.456 / 761.452 991.0 32.7116003036499 33 8 10 5 10 0.9183329484784302 67.71476266588623 0.046398162841796875 3 0.7565837764665952 2.4488166554252184 991.0 10.540636363636363 0.0 - - - - - - - 0.0 1 0 PIAS1;PIAS2 protein inhibitor of activated STAT, 1;protein inhibitor of activated STAT, 2 225 29 C20140708_OR008_05 C20140708_OR008_05 TB448672.[MT7]-LFELDGLK[MT7].2y4_1.heavy 611.868 / 576.347 7920.0 40.785499572753906 44 14 10 10 10 3.910047420157373 25.57513739717642 0.0 3 0.9439704879235741 5.189255050878302 7920.0 28.782313732525566 0.0 - - - - - - - 355.14285714285717 15 7 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 227 29 C20140708_OR008_05 C20140708_OR008_05 TB448672.[MT7]-LFELDGLK[MT7].2b3_1.heavy 611.868 / 534.304 8386.0 40.785499572753906 44 14 10 10 10 3.910047420157373 25.57513739717642 0.0 3 0.9439704879235741 5.189255050878302 8386.0 28.34976052746159 0.0 - - - - - - - 310.625 16 8 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 229 29 C20140708_OR008_05 C20140708_OR008_05 TB448672.[MT7]-LFELDGLK[MT7].2y6_1.heavy 611.868 / 818.474 2795.0 40.785499572753906 44 14 10 10 10 3.910047420157373 25.57513739717642 0.0 3 0.9439704879235741 5.189255050878302 2795.0 24.317456695363553 0.0 - - - - - - - 221.71428571428572 5 7 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 231 29 C20140708_OR008_05 C20140708_OR008_05 TB448672.[MT7]-LFELDGLK[MT7].2y7_1.heavy 611.868 / 965.542 13821.0 40.785499572753906 44 14 10 10 10 3.910047420157373 25.57513739717642 0.0 3 0.9439704879235741 5.189255050878302 13821.0 45.332861654351575 0.0 - - - - - - - 310.8333333333333 27 6 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 233 30 C20140708_OR008_05 C20140708_OR008_05 TB438592.[MT7]-EATSVHDLNDK[MT7].3y3_1.heavy 506.266 / 520.285 914.0 20.271799087524414 43 15 10 10 8 10.361469922090745 9.651140306531135 0.0 4 0.9556847982462412 5.840755035100602 914.0 3.1724043715846992 2.0 - - - - - - - 237.7 2 10 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 235 30 C20140708_OR008_05 C20140708_OR008_05 TB438592.[MT7]-EATSVHDLNDK[MT7].3b4_1.heavy 506.266 / 533.269 1280.0 20.271799087524414 43 15 10 10 8 10.361469922090745 9.651140306531135 0.0 4 0.9556847982462412 5.840755035100602 1280.0 5.13868613138686 0.0 - - - - - - - 210.0 2 10 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 237 30 C20140708_OR008_05 C20140708_OR008_05 TB438592.[MT7]-EATSVHDLNDK[MT7].3y4_1.heavy 506.266 / 633.369 366.0 20.271799087524414 43 15 10 10 8 10.361469922090745 9.651140306531135 0.0 4 0.9556847982462412 5.840755035100602 366.0 2.815384615384615 8.0 - - - - - - - 0.0 0 0 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 239 30 C20140708_OR008_05 C20140708_OR008_05 TB438592.[MT7]-EATSVHDLNDK[MT7].3y5_1.heavy 506.266 / 748.396 1006.0 20.271799087524414 43 15 10 10 8 10.361469922090745 9.651140306531135 0.0 4 0.9556847982462412 5.840755035100602 1006.0 7.467623249751886 0.0 - - - - - - - 274.1666666666667 2 6 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 241 31 C20140708_OR008_05 C20140708_OR008_05 TB430158.[MT7]-DFNVPLSISR.2b3_1.heavy 646.36 / 521.248 36689.0 36.1265983581543 47 17 10 10 10 2.8834858493951248 34.68024648741634 0.0 3 0.9785472204928911 8.410873698471175 36689.0 125.9718859345949 0.0 - - - - - - - 306.0 73 5 PDLIM7 PDZ and LIM domain 7 (enigma) 243 31 C20140708_OR008_05 C20140708_OR008_05 TB430158.[MT7]-DFNVPLSISR.2y9_1.heavy 646.36 / 1032.58 17121.0 36.1265983581543 47 17 10 10 10 2.8834858493951248 34.68024648741634 0.0 3 0.9785472204928911 8.410873698471175 17121.0 3.803399631940735 1.0 - - - - - - - 306.0 38 5 PDLIM7 PDZ and LIM domain 7 (enigma) 245 31 C20140708_OR008_05 C20140708_OR008_05 TB430158.[MT7]-DFNVPLSISR.2b4_1.heavy 646.36 / 620.316 32408.0 36.1265983581543 47 17 10 10 10 2.8834858493951248 34.68024648741634 0.0 3 0.9785472204928911 8.410873698471175 32408.0 235.86064760764356 0.0 - - - - - - - 229.5 64 4 PDLIM7 PDZ and LIM domain 7 (enigma) 247 31 C20140708_OR008_05 C20140708_OR008_05 TB430158.[MT7]-DFNVPLSISR.2y6_1.heavy 646.36 / 672.404 54116.0 36.1265983581543 47 17 10 10 10 2.8834858493951248 34.68024648741634 0.0 3 0.9785472204928911 8.410873698471175 54116.0 169.1678559738134 0.0 - - - - - - - 459.0 108 3 PDLIM7 PDZ and LIM domain 7 (enigma) 249 32 C20140708_OR008_05 C20140708_OR008_05 TB438590.[MT7]-QIIPMVTELIGR.3y7_1.heavy 505.301 / 787.467 1218.0 47.66260051727295 31 8 10 3 10 3.9024836762330097 20.23677008054593 0.06319808959960938 3 0.7856934041158274 2.6167636043448588 1218.0 3.2539875212705613 1.0 - - - - - - - 198.46153846153845 2 13 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 251 32 C20140708_OR008_05 C20140708_OR008_05 TB438590.[MT7]-QIIPMVTELIGR.3y6_1.heavy 505.301 / 688.399 932.0 47.66260051727295 31 8 10 3 10 3.9024836762330097 20.23677008054593 0.06319808959960938 3 0.7856934041158274 2.6167636043448588 932.0 12.938853820598005 1.0 - - - - - - - 179.25 3 8 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 253 32 C20140708_OR008_05 C20140708_OR008_05 TB438590.[MT7]-QIIPMVTELIGR.3b5_1.heavy 505.301 / 727.429 1792.0 47.66260051727295 31 8 10 3 10 3.9024836762330097 20.23677008054593 0.06319808959960938 3 0.7856934041158274 2.6167636043448588 1792.0 3.5590108700359444 0.0 - - - - - - - 259.75 3 8 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 255 32 C20140708_OR008_05 C20140708_OR008_05 TB438590.[MT7]-QIIPMVTELIGR.3y5_1.heavy 505.301 / 587.351 2508.0 47.66260051727295 31 8 10 3 10 3.9024836762330097 20.23677008054593 0.06319808959960938 3 0.7856934041158274 2.6167636043448588 2508.0 17.711643137044394 0.0 - - - - - - - 170.125 5 8 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 257 33 C20140708_OR008_05 C20140708_OR008_05 TB430201.[MT7]-LDSSIISEGK[MT7].3y3_1.heavy 446.257 / 477.279 1977.0 30.565200328826904 39 16 10 3 10 3.493741855022633 28.622606978314426 0.06559944152832031 3 0.9670020617487255 6.775127003298785 1977.0 8.447181818181818 3.0 - - - - - - - 198.0 3 5 CDC27 cell division cycle 27 homolog (S. cerevisiae) 259 33 C20140708_OR008_05 C20140708_OR008_05 TB430201.[MT7]-LDSSIISEGK[MT7].3b4_1.heavy 446.257 / 547.284 2307.0 30.565200328826904 39 16 10 3 10 3.493741855022633 28.622606978314426 0.06559944152832031 3 0.9670020617487255 6.775127003298785 2307.0 6.431636363636364 0.0 - - - - - - - 198.0 4 10 CDC27 cell division cycle 27 homolog (S. cerevisiae) 261 33 C20140708_OR008_05 C20140708_OR008_05 TB430201.[MT7]-LDSSIISEGK[MT7].3b5_1.heavy 446.257 / 660.369 989.0 30.565200328826904 39 16 10 3 10 3.493741855022633 28.622606978314426 0.06559944152832031 3 0.9670020617487255 6.775127003298785 989.0 9.440454545454545 0.0 - - - - - - - 0.0 1 0 CDC27 cell division cycle 27 homolog (S. cerevisiae) 263 33 C20140708_OR008_05 C20140708_OR008_05 TB430201.[MT7]-LDSSIISEGK[MT7].3y4_1.heavy 446.257 / 564.311 5823.0 30.565200328826904 39 16 10 3 10 3.493741855022633 28.622606978314426 0.06559944152832031 3 0.9670020617487255 6.775127003298785 5823.0 16.346813353566006 0.0 - - - - - - - 274.8333333333333 11 12 CDC27 cell division cycle 27 homolog (S. cerevisiae) 265 34 C20140708_OR008_05 C20140708_OR008_05 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 105092.0 30.01110076904297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 105092.0 1187.1644272312162 0.0 - - - - - - - 298.90909090909093 210 11 267 34 C20140708_OR008_05 C20140708_OR008_05 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 44820.0 30.01110076904297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 44820.0 766.0145454545454 0.0 - - - - - - - 249.0909090909091 89 11 269 34 C20140708_OR008_05 C20140708_OR008_05 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 48217.0 30.01110076904297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 48217.0 327.1710593607306 0.0 - - - - - - - 226.6 96 15 271 35 C20140708_OR008_05 C20140708_OR008_05 TB430308.[MT7]-FGYVQHYGLGSAC[CAM]DNVER.3y11_1.heavy 739.349 / 1177.53 4765.0 31.84742546081543 43 20 10 3 10 8.658258896997692 11.549666184580788 0.06890106201171875 3 0.9958859953646759 19.2345034046665 4765.0 22.77408943932646 0.0 - - - - - - - 234.22222222222223 9 9 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 273 35 C20140708_OR008_05 C20140708_OR008_05 TB430308.[MT7]-FGYVQHYGLGSAC[CAM]DNVER.3b4_1.heavy 739.349 / 611.331 4433.0 31.84742546081543 43 20 10 3 10 8.658258896997692 11.549666184580788 0.06890106201171875 3 0.9958859953646759 19.2345034046665 4433.0 14.861486386871459 0.0 - - - - - - - 235.5 8 8 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 275 35 C20140708_OR008_05 C20140708_OR008_05 TB430308.[MT7]-FGYVQHYGLGSAC[CAM]DNVER.3y4_1.heavy 739.349 / 517.273 3546.0 31.84742546081543 43 20 10 3 10 8.658258896997692 11.549666184580788 0.06890106201171875 3 0.9958859953646759 19.2345034046665 3546.0 19.167567567567566 1.0 - - - - - - - 247.23076923076923 9 13 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 277 35 C20140708_OR008_05 C20140708_OR008_05 TB430308.[MT7]-FGYVQHYGLGSAC[CAM]DNVER.3b3_1.heavy 739.349 / 512.263 4876.0 31.84742546081543 43 20 10 3 10 8.658258896997692 11.549666184580788 0.06890106201171875 3 0.9958859953646759 19.2345034046665 4876.0 37.352521993777074 0.0 - - - - - - - 277.0 9 8 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 279 36 C20140708_OR008_05 C20140708_OR008_05 TB438395.[MT7]-VNYILESR.2b3_1.heavy 569.323 / 521.284 8480.0 31.79615020751953 43 17 10 6 10 3.286415197918226 30.428291611889097 0.03369903564453125 3 0.972872011458382 7.475958100685582 8480.0 20.343370183982408 0.0 - - - - - - - 260.45454545454544 16 11 MAPKAP1 mitogen-activated protein kinase associated protein 1 281 36 C20140708_OR008_05 C20140708_OR008_05 TB438395.[MT7]-VNYILESR.2b4_1.heavy 569.323 / 634.368 6417.0 31.79615020751953 43 17 10 6 10 3.286415197918226 30.428291611889097 0.03369903564453125 3 0.972872011458382 7.475958100685582 6417.0 23.562741692280927 0.0 - - - - - - - 687.7 12 10 MAPKAP1 mitogen-activated protein kinase associated protein 1 283 36 C20140708_OR008_05 C20140708_OR008_05 TB438395.[MT7]-VNYILESR.2y6_1.heavy 569.323 / 780.425 4813.0 31.79615020751953 43 17 10 6 10 3.286415197918226 30.428291611889097 0.03369903564453125 3 0.972872011458382 7.475958100685582 4813.0 46.90184887032466 0.0 - - - - - - - 219.0 9 11 MAPKAP1 mitogen-activated protein kinase associated protein 1 285 36 C20140708_OR008_05 C20140708_OR008_05 TB438395.[MT7]-VNYILESR.2y7_1.heavy 569.323 / 894.468 10772.0 31.79615020751953 43 17 10 6 10 3.286415197918226 30.428291611889097 0.03369903564453125 3 0.972872011458382 7.475958100685582 10772.0 51.15250533157307 0.0 - - - - - - - 275.0 21 10 MAPKAP1 mitogen-activated protein kinase associated protein 1 287 37 C20140708_OR008_05 C20140708_OR008_05 TB430019.[MT7]-QFDNFK[MT7].2b3_1.heavy 543.795 / 535.263 13590.0 27.409650325775146 38 12 10 6 10 1.5559071942444074 53.309466922809236 0.03980064392089844 3 0.8919493925218794 3.7201326501052936 13590.0 26.56588887747766 0.0 - - - - - - - 657.2857142857143 27 7 FIBP fibroblast growth factor (acidic) intracellular binding protein 289 37 C20140708_OR008_05 C20140708_OR008_05 TB430019.[MT7]-QFDNFK[MT7].2y5_1.heavy 543.795 / 814.422 4387.0 27.409650325775146 38 12 10 6 10 1.5559071942444074 53.309466922809236 0.03980064392089844 3 0.8919493925218794 3.7201326501052936 4387.0 19.68 0.0 - - - - - - - 256.8 8 10 FIBP fibroblast growth factor (acidic) intracellular binding protein 291 37 C20140708_OR008_05 C20140708_OR008_05 TB430019.[MT7]-QFDNFK[MT7].2b4_1.heavy 543.795 / 649.306 1605.0 27.409650325775146 38 12 10 6 10 1.5559071942444074 53.309466922809236 0.03980064392089844 3 0.8919493925218794 3.7201326501052936 1605.0 0.3571428571428572 2.0 - - - - - - - 214.0 28 7 FIBP fibroblast growth factor (acidic) intracellular binding protein 293 37 C20140708_OR008_05 C20140708_OR008_05 TB430019.[MT7]-QFDNFK[MT7].2y3_1.heavy 543.795 / 552.326 6634.0 27.409650325775146 38 12 10 6 10 1.5559071942444074 53.309466922809236 0.03980064392089844 3 0.8919493925218794 3.7201326501052936 6634.0 23.263285714285715 0.0 - - - - - - - 282.09090909090907 13 11 FIBP fibroblast growth factor (acidic) intracellular binding protein 295 38 C20140708_OR008_05 C20140708_OR008_05 TB438397.[MT7]-DLLDLHK[MT7].2y4_1.heavy 571.345 / 656.385 2639.0 30.614349365234375 42 16 10 6 10 3.1712511646335253 31.533295475054608 0.0326995849609375 3 0.9634114685783933 6.432158303032213 2639.0 6.397575757575758 0.0 - - - - - - - 247.5 5 8 FIBP fibroblast growth factor (acidic) intracellular binding protein 297 38 C20140708_OR008_05 C20140708_OR008_05 TB438397.[MT7]-DLLDLHK[MT7].2y5_1.heavy 571.345 / 769.469 989.0 30.614349365234375 42 16 10 6 10 3.1712511646335253 31.533295475054608 0.0326995849609375 3 0.9634114685783933 6.432158303032213 989.0 4.315636363636363 3.0 - - - - - - - 0.0 1 0 FIBP fibroblast growth factor (acidic) intracellular binding protein 299 38 C20140708_OR008_05 C20140708_OR008_05 TB438397.[MT7]-DLLDLHK[MT7].2b4_1.heavy 571.345 / 601.331 4618.0 30.614349365234375 42 16 10 6 10 3.1712511646335253 31.533295475054608 0.0326995849609375 3 0.9634114685783933 6.432158303032213 4618.0 12.692177589852008 0.0 - - - - - - - 311.6666666666667 9 12 FIBP fibroblast growth factor (acidic) intracellular binding protein 301 38 C20140708_OR008_05 C20140708_OR008_05 TB438397.[MT7]-DLLDLHK[MT7].2y3_1.heavy 571.345 / 541.358 3298.0 30.614349365234375 42 16 10 6 10 3.1712511646335253 31.533295475054608 0.0326995849609375 3 0.9634114685783933 6.432158303032213 3298.0 5.396727272727273 1.0 - - - - - - - 701.25 6 8 FIBP fibroblast growth factor (acidic) intracellular binding protein 303 39 C20140708_OR008_05 C20140708_OR008_05 TB448677.[MT7]-ERVSDVQK[MT7].3b6_1.heavy 416.91 / 830.449 75.0 17.10580062866211 37 11 10 10 6 1.6274310395495046 46.13788525673015 0.0 5 0.8536297385555688 3.185594213231976 75.0 0.985 8.0 - - - - - - - 112.5 4 2 PKD2L1 polycystic kidney disease 2-like 1 305 39 C20140708_OR008_05 C20140708_OR008_05 TB448677.[MT7]-ERVSDVQK[MT7].3y3_1.heavy 416.91 / 518.342 3300.0 17.10580062866211 37 11 10 10 6 1.6274310395495046 46.13788525673015 0.0 5 0.8536297385555688 3.185594213231976 3300.0 16.72 0.0 - - - - - - - 225.0 6 7 PKD2L1 polycystic kidney disease 2-like 1 307 39 C20140708_OR008_05 C20140708_OR008_05 TB448677.[MT7]-ERVSDVQK[MT7].3b4_1.heavy 416.91 / 616.354 600.0 17.10580062866211 37 11 10 10 6 1.6274310395495046 46.13788525673015 0.0 5 0.8536297385555688 3.185594213231976 600.0 4.1386666666666665 4.0 - - - - - - - 0.0 1 0 PKD2L1 polycystic kidney disease 2-like 1 309 39 C20140708_OR008_05 C20140708_OR008_05 TB448677.[MT7]-ERVSDVQK[MT7].3b5_1.heavy 416.91 / 731.38 1800.0 17.10580062866211 37 11 10 10 6 1.6274310395495046 46.13788525673015 0.0 5 0.8536297385555688 3.185594213231976 1800.0 12.8 0.0 - - - - - - - 75.0 3 1 PKD2L1 polycystic kidney disease 2-like 1 311 40 C20140708_OR008_05 C20140708_OR008_05 TB438785.[MT7]-FANIVPFDSWDQLMR.3y7_1.heavy 661.669 / 935.44 3073.0 50.1431999206543 43 13 10 10 10 1.124006730967881 55.344385085340434 0.0 3 0.9072697595940348 4.021028021056248 3073.0 39.27678125 0.0 - - - - - - - 176.0 6 8 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 313 40 C20140708_OR008_05 C20140708_OR008_05 TB438785.[MT7]-FANIVPFDSWDQLMR.3b4_1.heavy 661.669 / 590.342 6275.0 50.1431999206543 43 13 10 10 10 1.124006730967881 55.344385085340434 0.0 3 0.9072697595940348 4.021028021056248 6275.0 40.74392361111111 0.0 - - - - - - - 184.88888888888889 12 9 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 315 40 C20140708_OR008_05 C20140708_OR008_05 TB438785.[MT7]-FANIVPFDSWDQLMR.3y4_1.heavy 661.669 / 547.302 5378.0 50.1431999206543 43 13 10 10 10 1.124006730967881 55.344385085340434 0.0 3 0.9072697595940348 4.021028021056248 5378.0 31.911867559523806 0.0 - - - - - - - 181.33333333333334 10 12 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 317 40 C20140708_OR008_05 C20140708_OR008_05 TB438785.[MT7]-FANIVPFDSWDQLMR.3y8_1.heavy 661.669 / 1050.47 7235.0 50.1431999206543 43 13 10 10 10 1.124006730967881 55.344385085340434 0.0 3 0.9072697595940348 4.021028021056248 7235.0 90.24908854166665 0.0 - - - - - - - 149.33333333333334 14 6 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 319 41 C20140708_OR008_05 C20140708_OR008_05 TB429977.[MT7]-DIEEIIR.2y6_1.heavy 516.296 / 772.456 3421.0 33.70557498931885 38 16 10 2 10 3.602559609344156 27.75804173805328 0.08610153198242188 3 0.9684438185607867 6.929013795979725 3421.0 33.10296107055961 0.0 - - - - - - - 215.28571428571428 6 7 CABP1 calcium binding protein 1 321 41 C20140708_OR008_05 C20140708_OR008_05 TB429977.[MT7]-DIEEIIR.2b3_1.heavy 516.296 / 502.263 2053.0 33.70557498931885 38 16 10 2 10 3.602559609344156 27.75804173805328 0.08610153198242188 3 0.9684438185607867 6.929013795979725 2053.0 9.29505824737453 0.0 - - - - - - - 215.28571428571428 4 7 CABP1 calcium binding protein 1 323 41 C20140708_OR008_05 C20140708_OR008_05 TB429977.[MT7]-DIEEIIR.2y5_1.heavy 516.296 / 659.372 2737.0 33.70557498931885 38 16 10 2 10 3.602559609344156 27.75804173805328 0.08610153198242188 3 0.9684438185607867 6.929013795979725 2737.0 3.998864953131158 1.0 - - - - - - - 359.625 5 8 CABP1 calcium binding protein 1 325 41 C20140708_OR008_05 C20140708_OR008_05 TB429977.[MT7]-DIEEIIR.2b4_1.heavy 516.296 / 631.305 6158.0 33.70557498931885 38 16 10 2 10 3.602559609344156 27.75804173805328 0.08610153198242188 3 0.9684438185607867 6.929013795979725 6158.0 25.190286766570143 0.0 - - - - - - - 274.0 12 8 CABP1 calcium binding protein 1 327 42 C20140708_OR008_05 C20140708_OR008_05 TB438787.[MT7]-GSLVDNIQQHFLLSDR.2y9_1.heavy 993.53 / 1143.59 1003.0 41.27090072631836 42 16 6 10 10 3.058423969354127 32.696578696091585 0.0 3 0.9646937036606826 6.54862556184475 1003.0 3.7314676746458026 4.0 - - - - - - - 286.75 8 12 FIBP fibroblast growth factor (acidic) intracellular binding protein 329 42 C20140708_OR008_05 C20140708_OR008_05 TB438787.[MT7]-GSLVDNIQQHFLLSDR.2b4_1.heavy 993.53 / 501.315 1146.0 41.27090072631836 42 16 6 10 10 3.058423969354127 32.696578696091585 0.0 3 0.9646937036606826 6.54862556184475 1146.0 6.125124382140831 0.0 - - - - - - - 258.0 2 5 FIBP fibroblast growth factor (acidic) intracellular binding protein 331 42 C20140708_OR008_05 C20140708_OR008_05 TB438787.[MT7]-GSLVDNIQQHFLLSDR.2b6_1.heavy 993.53 / 730.385 1433.0 41.27090072631836 42 16 6 10 10 3.058423969354127 32.696578696091585 0.0 3 0.9646937036606826 6.54862556184475 1433.0 11.72017329964974 0.0 - - - - - - - 191.0 2 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 333 42 C20140708_OR008_05 C20140708_OR008_05 TB438787.[MT7]-GSLVDNIQQHFLLSDR.2b5_1.heavy 993.53 / 616.342 2722.0 41.27090072631836 42 16 6 10 10 3.058423969354127 32.696578696091585 0.0 3 0.9646937036606826 6.54862556184475 2722.0 15.21911855586274 0.0 - - - - - - - 238.83333333333334 5 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 335 43 C20140708_OR008_05 C20140708_OR008_05 TB430713.[MT7]-LALC[CAM]GTVLDHLVGEETMADYLLYTLNK[MT7].3b10_1.heavy 1114.25 / 1224.65 266.0 54.29625129699707 41 20 6 7 8 6.098097946105364 16.39855589132779 0.023700714111328125 4 0.9900300859147949 12.349665008605642 266.0 3.733333333333334 8.0 - - - - - - - 0.0 1 0 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 337 43 C20140708_OR008_05 C20140708_OR008_05 TB430713.[MT7]-LALC[CAM]GTVLDHLVGEETMADYLLYTLNK[MT7].3y4_1.heavy 1114.25 / 619.39 1066.0 54.29625129699707 41 20 6 7 8 6.098097946105364 16.39855589132779 0.023700714111328125 4 0.9900300859147949 12.349665008605642 1066.0 26.369473684210526 1.0 - - - - - - - 160.28571428571428 3 14 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 339 43 C20140708_OR008_05 C20140708_OR008_05 TB430713.[MT7]-LALC[CAM]GTVLDHLVGEETMADYLLYTLNK[MT7].3b10_2.heavy 1114.25 / 612.83 1332.0 54.29625129699707 41 20 6 7 8 6.098097946105364 16.39855589132779 0.023700714111328125 4 0.9900300859147949 12.349665008605642 1332.0 17.52631578947368 0.0 - - - - - - - 136.86666666666667 2 15 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 341 43 C20140708_OR008_05 C20140708_OR008_05 TB430713.[MT7]-LALC[CAM]GTVLDHLVGEETMADYLLYTLNK[MT7].3y5_1.heavy 1114.25 / 782.453 989.0 54.29625129699707 41 20 6 7 8 6.098097946105364 16.39855589132779 0.023700714111328125 4 0.9900300859147949 12.349665008605642 989.0 8.590050421328911 0.0 - - - - - - - 0.0 1 0 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 343 44 C20140708_OR008_05 C20140708_OR008_05 TB438786.[MT7]-GSLVDNIQQHFLLSDR.3y6_1.heavy 662.689 / 750.414 10193.0 41.27090072631836 47 17 10 10 10 3.2245143494611486 25.00818758704622 0.0 3 0.976853253620168 8.096104530615643 10193.0 35.963951591388636 0.0 - - - - - - - 266.85714285714283 20 7 FIBP fibroblast growth factor (acidic) intracellular binding protein 345 44 C20140708_OR008_05 C20140708_OR008_05 TB438786.[MT7]-GSLVDNIQQHFLLSDR.3b6_1.heavy 662.689 / 730.385 12059.0 41.27090072631836 47 17 10 10 10 3.2245143494611486 25.00818758704622 0.0 3 0.976853253620168 8.096104530615643 12059.0 10.372071504251055 1.0 - - - - - - - 239.33333333333334 36 3 FIBP fibroblast growth factor (acidic) intracellular binding protein 347 44 C20140708_OR008_05 C20140708_OR008_05 TB438786.[MT7]-GSLVDNIQQHFLLSDR.3b5_1.heavy 662.689 / 616.342 14069.0 41.27090072631836 47 17 10 10 10 3.2245143494611486 25.00818758704622 0.0 3 0.976853253620168 8.096104530615643 14069.0 32.305921021632784 0.0 - - - - - - - 266.7142857142857 28 7 FIBP fibroblast growth factor (acidic) intracellular binding protein 349 44 C20140708_OR008_05 C20140708_OR008_05 TB438786.[MT7]-GSLVDNIQQHFLLSDR.3y5_1.heavy 662.689 / 603.346 8183.0 41.27090072631836 47 17 10 10 10 3.2245143494611486 25.00818758704622 0.0 3 0.976853253620168 8.096104530615643 8183.0 24.360744998903396 0.0 - - - - - - - 236.14285714285714 16 14 FIBP fibroblast growth factor (acidic) intracellular binding protein 351 45 C20140708_OR008_05 C20140708_OR008_05 TB438788.[MT7]-ISTITPQIQAFNLQK[MT7].2y6_1.heavy 995.582 / 864.506 N/A 39.61800003051758 38 8 10 10 10 1.7179893899208676 38.80505145013579 0.0 3 0.7792827178219508 2.576984085436607 451.0 3.4877333333333334 10.0 - - - - - - - 300.6666666666667 2 6 CDC27 cell division cycle 27 homolog (S. cerevisiae) 353 45 C20140708_OR008_05 C20140708_OR008_05 TB438788.[MT7]-ISTITPQIQAFNLQK[MT7].2y4_1.heavy 995.582 / 646.4 N/A 39.61800003051758 38 8 10 10 10 1.7179893899208676 38.80505145013579 0.0 3 0.7792827178219508 2.576984085436607 301.0 0.5062241623142535 17.0 - - - - - - - 0.0 1 0 CDC27 cell division cycle 27 homolog (S. cerevisiae) 355 45 C20140708_OR008_05 C20140708_OR008_05 TB438788.[MT7]-ISTITPQIQAFNLQK[MT7].2b3_1.heavy 995.582 / 446.273 902.0 39.61800003051758 38 8 10 10 10 1.7179893899208676 38.80505145013579 0.0 3 0.7792827178219508 2.576984085436607 902.0 5.693687707641196 3.0 - - - - - - - 200.33333333333334 2 3 CDC27 cell division cycle 27 homolog (S. cerevisiae) 357 45 C20140708_OR008_05 C20140708_OR008_05 TB438788.[MT7]-ISTITPQIQAFNLQK[MT7].2b5_1.heavy 995.582 / 660.405 2254.0 39.61800003051758 38 8 10 10 10 1.7179893899208676 38.80505145013579 0.0 3 0.7792827178219508 2.576984085436607 2254.0 25.42512 0.0 - - - - - - - 180.2 4 5 CDC27 cell division cycle 27 homolog (S. cerevisiae) 359 46 C20140708_OR008_05 C20140708_OR008_05 TB430456.[MT7]-ILAHLTGTEFMQDPDEEHLK[MT7].3y7_1.heavy 871.447 / 1011.52 13878.0 37.179100036621094 46 16 10 10 10 1.8989537393049198 41.54292687314322 0.0 3 0.9661769815401972 6.6915146105345285 13878.0 103.79220779220779 0.0 - - - - - - - 215.6 27 5 PDLIM7 PDZ and LIM domain 7 (enigma) 361 46 C20140708_OR008_05 C20140708_OR008_05 TB430456.[MT7]-ILAHLTGTEFMQDPDEEHLK[MT7].3y3_1.heavy 871.447 / 541.358 9560.0 37.179100036621094 46 16 10 10 10 1.8989537393049198 41.54292687314322 0.0 3 0.9661769815401972 6.6915146105345285 9560.0 82.312911278786 0.0 - - - - - - - 308.3333333333333 19 3 PDLIM7 PDZ and LIM domain 7 (enigma) 363 46 C20140708_OR008_05 C20140708_OR008_05 TB430456.[MT7]-ILAHLTGTEFMQDPDEEHLK[MT7].3b4_1.heavy 871.447 / 579.373 6476.0 37.179100036621094 46 16 10 10 10 1.8989537393049198 41.54292687314322 0.0 3 0.9661769815401972 6.6915146105345285 6476.0 52.564935064935064 0.0 - - - - - - - 256.8333333333333 12 6 PDLIM7 PDZ and LIM domain 7 (enigma) 365 46 C20140708_OR008_05 C20140708_OR008_05 TB430456.[MT7]-ILAHLTGTEFMQDPDEEHLK[MT7].3b5_1.heavy 871.447 / 692.458 2776.0 37.179100036621094 46 16 10 10 10 1.8989537393049198 41.54292687314322 0.0 3 0.9661769815401972 6.6915146105345285 2776.0 24.695584415584413 0.0 - - - - - - - 264.0 5 7 PDLIM7 PDZ and LIM domain 7 (enigma) 367 47 C20140708_OR008_05 C20140708_OR008_05 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 26601.0 15.94260025024414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 26601.0 100.33181405895692 0.0 - - - - - - - 171.16666666666666 53 6 369 47 C20140708_OR008_05 C20140708_OR008_05 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 39461.0 15.94260025024414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 39461.0 519.005621128844 0.0 - - - - - - - 201.75 78 4 371 47 C20140708_OR008_05 C20140708_OR008_05 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 24470.0 15.94260025024414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 24470.0 351.25087643276487 0.0 - - - - - - - 241.14285714285714 48 7 373 48 C20140708_OR008_05 C20140708_OR008_05 TB430454.[MT7]-DVRDLFVDLVEK[MT7].3y3_1.heavy 579.333 / 519.326 5985.0 45.11847496032715 39 13 10 6 10 3.811180333943704 26.238590472711316 0.03569793701171875 3 0.9244361795498305 4.460997457441186 5985.0 44.61545454545454 0.0 - - - - - - - 201.14285714285714 11 7 FIBP fibroblast growth factor (acidic) intracellular binding protein 375 48 C20140708_OR008_05 C20140708_OR008_05 TB430454.[MT7]-DVRDLFVDLVEK[MT7].3b8_1.heavy 579.333 / 1104.58 2288.0 45.11847496032715 39 13 10 6 10 3.811180333943704 26.238590472711316 0.03569793701171875 3 0.9244361795498305 4.460997457441186 2288.0 39.0 0.0 - - - - - - - 105.6 4 5 FIBP fibroblast growth factor (acidic) intracellular binding protein 377 48 C20140708_OR008_05 C20140708_OR008_05 TB430454.[MT7]-DVRDLFVDLVEK[MT7].3y5_1.heavy 579.333 / 747.437 2992.0 45.11847496032715 39 13 10 6 10 3.811180333943704 26.238590472711316 0.03569793701171875 3 0.9244361795498305 4.460997457441186 2992.0 19.465 0.0 - - - - - - - 242.0 5 8 FIBP fibroblast growth factor (acidic) intracellular binding protein 379 48 C20140708_OR008_05 C20140708_OR008_05 TB430454.[MT7]-DVRDLFVDLVEK[MT7].3b8_2.heavy 579.333 / 552.794 10913.0 45.11847496032715 39 13 10 6 10 3.811180333943704 26.238590472711316 0.03569793701171875 3 0.9244361795498305 4.460997457441186 10913.0 127.55454545454545 0.0 - - - - - - - 138.28571428571428 21 7 FIBP fibroblast growth factor (acidic) intracellular binding protein 381 49 C20140708_OR008_05 C20140708_OR008_05 TB448660.[MT7]-ERQNQIK[MT7].2y5_1.heavy 602.356 / 774.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAP1 mitogen-activated protein kinase associated protein 1 383 49 C20140708_OR008_05 C20140708_OR008_05 TB448660.[MT7]-ERQNQIK[MT7].2b4_1.heavy 602.356 / 672.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAP1 mitogen-activated protein kinase associated protein 1 385 49 C20140708_OR008_05 C20140708_OR008_05 TB448660.[MT7]-ERQNQIK[MT7].2b6_1.heavy 602.356 / 913.497 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAP1 mitogen-activated protein kinase associated protein 1 387 49 C20140708_OR008_05 C20140708_OR008_05 TB448660.[MT7]-ERQNQIK[MT7].2b5_1.heavy 602.356 / 800.413 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAP1 mitogen-activated protein kinase associated protein 1 389 50 C20140708_OR008_05 C20140708_OR008_05 TB438581.[MT7]-GYAIGNAPELAK[MT7].2y8_1.heavy 746.424 / 943.533 6601.0 30.86840057373047 37 11 10 6 10 0.9161150409219977 62.9997530950773 0.03279876708984375 3 0.8745610959417183 3.4474525112105208 6601.0 83.1125909090909 0.0 - - - - - - - 281.1111111111111 13 9 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 391 50 C20140708_OR008_05 C20140708_OR008_05 TB438581.[MT7]-GYAIGNAPELAK[MT7].2y5_1.heavy 746.424 / 701.431 3850.0 30.86840057373047 37 11 10 6 10 0.9161150409219977 62.9997530950773 0.03279876708984375 3 0.8745610959417183 3.4474525112105208 3850.0 52.5 0.0 - - - - - - - 172.85714285714286 7 7 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 393 50 C20140708_OR008_05 C20140708_OR008_05 TB438581.[MT7]-GYAIGNAPELAK[MT7].2b4_1.heavy 746.424 / 549.315 5720.0 30.86840057373047 37 11 10 6 10 0.9161150409219977 62.9997530950773 0.03279876708984375 3 0.8745610959417183 3.4474525112105208 5720.0 58.76 0.0 - - - - - - - 238.33333333333334 11 6 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 395 50 C20140708_OR008_05 C20140708_OR008_05 TB438581.[MT7]-GYAIGNAPELAK[MT7].2b7_1.heavy 746.424 / 791.417 2970.0 30.86840057373047 37 11 10 6 10 0.9161150409219977 62.9997530950773 0.03279876708984375 3 0.8745610959417183 3.4474525112105208 2970.0 14.3775 0.0 - - - - - - - 220.0 5 6 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 397 51 C20140708_OR008_05 C20140708_OR008_05 TB438584.[MT7]-FGFSTLALVEK[MT7].3b6_1.heavy 500.629 / 797.431 1122.0 42.85490036010742 50 20 10 10 10 6.014993549711106 16.625121735135178 0.0 3 0.9901969294614074 12.454488088710917 1122.0 20.035714285714285 0.0 - - - - - - - 280.5 2 2 MAPKAP1 mitogen-activated protein kinase associated protein 1 399 51 C20140708_OR008_05 C20140708_OR008_05 TB438584.[MT7]-FGFSTLALVEK[MT7].3y3_1.heavy 500.629 / 519.326 2805.0 42.85490036010742 50 20 10 10 10 6.014993549711106 16.625121735135178 0.0 3 0.9901969294614074 12.454488088710917 2805.0 15.231899109792284 0.0 - - - - - - - 299.3333333333333 5 3 MAPKAP1 mitogen-activated protein kinase associated protein 1 401 51 C20140708_OR008_05 C20140708_OR008_05 TB438584.[MT7]-FGFSTLALVEK[MT7].3b5_1.heavy 500.629 / 684.347 2469.0 42.85490036010742 50 20 10 10 10 6.014993549711106 16.625121735135178 0.0 3 0.9901969294614074 12.454488088710917 2469.0 7.326409495548962 0.0 - - - - - - - 224.25 4 4 MAPKAP1 mitogen-activated protein kinase associated protein 1 403 51 C20140708_OR008_05 C20140708_OR008_05 TB438584.[MT7]-FGFSTLALVEK[MT7].3b7_1.heavy 500.629 / 868.469 1571.0 42.85490036010742 50 20 10 10 10 6.014993549711106 16.625121735135178 0.0 3 0.9901969294614074 12.454488088710917 1571.0 21.46098214285714 0.0 - - - - - - - 140.0 3 4 MAPKAP1 mitogen-activated protein kinase associated protein 1 405 52 C20140708_OR008_05 C20140708_OR008_05 TB438388.[MT7]-DLTDMDK[MT7].2y4_1.heavy 563.289 / 652.309 1288.0 25.00079917907715 47 17 10 10 10 3.2796293645175636 25.88034306928465 0.0 3 0.9751444240047461 7.811721886811126 1288.0 1.4441212121212121 0.0 - - - - - - - 240.42857142857142 2 7 CDC27 cell division cycle 27 homolog (S. cerevisiae) 407 52 C20140708_OR008_05 C20140708_OR008_05 TB438388.[MT7]-DLTDMDK[MT7].2y5_1.heavy 563.289 / 753.357 1882.0 25.00079917907715 47 17 10 10 10 3.2796293645175636 25.88034306928465 0.0 3 0.9751444240047461 7.811721886811126 1882.0 12.356565656565657 0.0 - - - - - - - 247.5 3 10 CDC27 cell division cycle 27 homolog (S. cerevisiae) 409 52 C20140708_OR008_05 C20140708_OR008_05 TB438388.[MT7]-DLTDMDK[MT7].2b4_1.heavy 563.289 / 589.295 4160.0 25.00079917907715 47 17 10 10 10 3.2796293645175636 25.88034306928465 0.0 3 0.9751444240047461 7.811721886811126 4160.0 42.44040404040404 0.0 - - - - - - - 247.5 8 14 CDC27 cell division cycle 27 homolog (S. cerevisiae) 411 52 C20140708_OR008_05 C20140708_OR008_05 TB438388.[MT7]-DLTDMDK[MT7].2y3_1.heavy 563.289 / 537.282 4061.0 25.00079917907715 47 17 10 10 10 3.2796293645175636 25.88034306928465 0.0 3 0.9751444240047461 7.811721886811126 4061.0 13.741767676767676 0.0 - - - - - - - 268.7142857142857 8 7 CDC27 cell division cycle 27 homolog (S. cerevisiae) 413 53 C20140708_OR008_05 C20140708_OR008_05 TB430453.[MT7]-LTADPDSEIATTSLR.3y7_1.heavy 578.639 / 761.452 5386.0 32.70000076293945 50 20 10 10 10 10.866936712343572 9.202225304801093 0.0 3 0.9974217363387514 24.299948397803327 5386.0 50.745186733556295 0.0 - - - - - - - 249.41666666666666 10 12 PIAS1;PIAS2 protein inhibitor of activated STAT, 1;protein inhibitor of activated STAT, 2 415 53 C20140708_OR008_05 C20140708_OR008_05 TB430453.[MT7]-LTADPDSEIATTSLR.3y6_1.heavy 578.639 / 648.367 25137.0 32.70000076293945 50 20 10 10 10 10.866936712343572 9.202225304801093 0.0 3 0.9974217363387514 24.299948397803327 25137.0 60.72866042022711 0.0 - - - - - - - 273.57142857142856 50 7 PIAS1;PIAS2 protein inhibitor of activated STAT, 1;protein inhibitor of activated STAT, 2 417 53 C20140708_OR008_05 C20140708_OR008_05 TB430453.[MT7]-LTADPDSEIATTSLR.3b4_1.heavy 578.639 / 545.305 42493.0 32.70000076293945 50 20 10 10 10 10.866936712343572 9.202225304801093 0.0 3 0.9974217363387514 24.299948397803327 42493.0 65.49614902901062 0.0 - - - - - - - 332.44444444444446 84 9 PIAS1;PIAS2 protein inhibitor of activated STAT, 1;protein inhibitor of activated STAT, 2 419 53 C20140708_OR008_05 C20140708_OR008_05 TB430453.[MT7]-LTADPDSEIATTSLR.3b8_1.heavy 578.639 / 973.459 10174.0 32.70000076293945 50 20 10 10 10 10.866936712343572 9.202225304801093 0.0 3 0.9974217363387514 24.299948397803327 10174.0 111.13937790157846 0.0 - - - - - - - 279.3333333333333 20 3 PIAS1;PIAS2 protein inhibitor of activated STAT, 1;protein inhibitor of activated STAT, 2 421 54 C20140708_OR008_05 C20140708_OR008_05 TB430049.[MT7]-RSGFGVSQR.2y8_1.heavy 569.316 / 837.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - JPH3;JPH4 junctophilin 3;junctophilin 4 423 54 C20140708_OR008_05 C20140708_OR008_05 TB430049.[MT7]-RSGFGVSQR.2b6_1.heavy 569.316 / 748.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - JPH3;JPH4 junctophilin 3;junctophilin 4 425 54 C20140708_OR008_05 C20140708_OR008_05 TB430049.[MT7]-RSGFGVSQR.2b5_1.heavy 569.316 / 649.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - JPH3;JPH4 junctophilin 3;junctophilin 4 427 54 C20140708_OR008_05 C20140708_OR008_05 TB430049.[MT7]-RSGFGVSQR.2y7_1.heavy 569.316 / 750.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - JPH3;JPH4 junctophilin 3;junctophilin 4 429 55 C20140708_OR008_05 C20140708_OR008_05 TB438779.[MT7]-C[CAM]VEAEIANYEAC[CAM]LK[MT7].3b4_1.heavy 653.325 / 604.288 1880.0 38.89715003967285 40 17 10 5 8 6.981074860139191 14.324441723291613 0.045101165771484375 4 0.9717390471461254 7.323873434223181 1880.0 8.161302926811354 2.0 - - - - - - - 344.6 3 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 431 55 C20140708_OR008_05 C20140708_OR008_05 TB438779.[MT7]-C[CAM]VEAEIANYEAC[CAM]LK[MT7].3b5_1.heavy 653.325 / 733.331 5954.0 38.89715003967285 40 17 10 5 8 6.981074860139191 14.324441723291613 0.045101165771484375 4 0.9717390471461254 7.323873434223181 5954.0 23.980158955883354 0.0 - - - - - - - 282.0 11 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 433 55 C20140708_OR008_05 C20140708_OR008_05 TB438779.[MT7]-C[CAM]VEAEIANYEAC[CAM]LK[MT7].3y4_1.heavy 653.325 / 635.367 2820.0 38.89715003967285 40 17 10 5 8 6.981074860139191 14.324441723291613 0.045101165771484375 4 0.9717390471461254 7.323873434223181 2820.0 2.1999999999999997 2.0 - - - - - - - 828.0 9 7 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 435 55 C20140708_OR008_05 C20140708_OR008_05 TB438779.[MT7]-C[CAM]VEAEIANYEAC[CAM]LK[MT7].3b3_1.heavy 653.325 / 533.251 1410.0 38.89715003967285 40 17 10 5 8 6.981074860139191 14.324441723291613 0.045101165771484375 4 0.9717390471461254 7.323873434223181 1410.0 1.8239234449760768 4.0 - - - - - - - 313.42857142857144 5 7 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 437 56 C20140708_OR008_05 C20140708_OR008_05 TB430720.[MT7]-SLSLNPFLWSPFESLC[CAM]EIGEK[MT7]PDPDQTFK[MT7].4b8_1.heavy 954.241 / 1016.59 2330.0 52.52220153808594 48 18 10 10 10 4.820090108747645 20.746500115945338 0.0 3 0.9844271899500961 9.876740919882188 2330.0 19.2243729903537 0.0 - - - - - - - 160.0909090909091 4 11 CDC27 cell division cycle 27 homolog (S. cerevisiae) 439 56 C20140708_OR008_05 C20140708_OR008_05 TB430720.[MT7]-SLSLNPFLWSPFESLC[CAM]EIGEK[MT7]PDPDQTFK[MT7].4b4_1.heavy 954.241 / 545.341 1812.0 52.52220153808594 48 18 10 10 10 4.820090108747645 20.746500115945338 0.0 3 0.9844271899500961 9.876740919882188 1812.0 10.584865858049138 0.0 - - - - - - - 144.42857142857142 3 14 CDC27 cell division cycle 27 homolog (S. cerevisiae) 441 56 C20140708_OR008_05 C20140708_OR008_05 TB430720.[MT7]-SLSLNPFLWSPFESLC[CAM]EIGEK[MT7]PDPDQTFK[MT7].4b5_1.heavy 954.241 / 659.385 6730.0 52.52220153808594 48 18 10 10 10 4.820090108747645 20.746500115945338 0.0 3 0.9844271899500961 9.876740919882188 6730.0 42.265700483091784 0.0 - - - - - - - 174.27272727272728 13 11 CDC27 cell division cycle 27 homolog (S. cerevisiae) 443 56 C20140708_OR008_05 C20140708_OR008_05 TB430720.[MT7]-SLSLNPFLWSPFESLC[CAM]EIGEK[MT7]PDPDQTFK[MT7].4y6_1.heavy 954.241 / 879.469 3779.0 52.52220153808594 48 18 10 10 10 4.820090108747645 20.746500115945338 0.0 3 0.9844271899500961 9.876740919882188 3779.0 101.0155769230769 0.0 - - - - - - - 140.1 7 10 CDC27 cell division cycle 27 homolog (S. cerevisiae) 445 57 C20140708_OR008_05 C20140708_OR008_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 155905.0 18.903799057006836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 155905.0 619.1390888864573 0.0 - - - - - - - 247.0 311 9 447 57 C20140708_OR008_05 C20140708_OR008_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 82859.0 18.903799057006836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 82859.0 868.8997837837837 0.0 - - - - - - - 195.55555555555554 165 9 449 57 C20140708_OR008_05 C20140708_OR008_05 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 97302.0 18.903799057006836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 97302.0 1357.8397377581805 0.0 - - - - - - - 247.08333333333334 194 12 451 58 C20140708_OR008_05 C20140708_OR008_05 TB438572.[MT7]-VVLEGPAPWGFR.3y6_1.heavy 491.277 / 733.378 1406.0 41.729801177978516 28 5 10 5 8 3.7051225504936576 20.31914750636249 0.0428009033203125 4 0.6590150510115668 2.050222167537232 1406.0 6.042481042074364 0.0 - - - - - - - 128.0 2 2 PDLIM7 PDZ and LIM domain 7 (enigma) 453 58 C20140708_OR008_05 C20140708_OR008_05 TB438572.[MT7]-VVLEGPAPWGFR.3b4_1.heavy 491.277 / 585.373 895.0 41.729801177978516 28 5 10 5 8 3.7051225504936576 20.31914750636249 0.0428009033203125 4 0.6590150510115668 2.050222167537232 895.0 1.926443272444156 1.0 - - - - - - - 320.0 2 2 PDLIM7 PDZ and LIM domain 7 (enigma) 455 58 C20140708_OR008_05 C20140708_OR008_05 TB438572.[MT7]-VVLEGPAPWGFR.3b5_1.heavy 491.277 / 642.394 4091.0 41.729801177978516 28 5 10 5 8 3.7051225504936576 20.31914750636249 0.0428009033203125 4 0.6590150510115668 2.050222167537232 4091.0 47.94140625 0.0 - - - - - - - 384.0 8 1 PDLIM7 PDZ and LIM domain 7 (enigma) 457 58 C20140708_OR008_05 C20140708_OR008_05 TB438572.[MT7]-VVLEGPAPWGFR.3y5_1.heavy 491.277 / 662.341 384.0 41.729801177978516 28 5 10 5 8 3.7051225504936576 20.31914750636249 0.0428009033203125 4 0.6590150510115668 2.050222167537232 384.0 3.2 1.0 - - - - - - - 0.0 0 0 PDLIM7 PDZ and LIM domain 7 (enigma) 459 59 C20140708_OR008_05 C20140708_OR008_05 TB430461.[MT7]-SVLLITC[CAM]K[MT7]TC[CAM]NR.3y7_1.heavy 584.995 / 1083.52 4062.0 29.619075298309326 38 12 10 6 10 2.045302164040355 38.78886835821821 0.03849983215332031 3 0.8802483728571412 3.530118496387873 4062.0 25.06509907125257 0.0 - - - - - - - 249.66666666666666 8 6 C18orf21 chromosome 18 open reading frame 21 461 59 C20140708_OR008_05 C20140708_OR008_05 TB430461.[MT7]-SVLLITC[CAM]K[MT7]TC[CAM]NR.3b4_1.heavy 584.995 / 557.378 5024.0 29.619075298309326 38 12 10 6 10 2.045302164040355 38.78886835821821 0.03849983215332031 3 0.8802483728571412 3.530118496387873 5024.0 6.345583072117462 1.0 - - - - - - - 305.7142857142857 10 7 C18orf21 chromosome 18 open reading frame 21 463 59 C20140708_OR008_05 C20140708_OR008_05 TB430461.[MT7]-SVLLITC[CAM]K[MT7]TC[CAM]NR.3y4_1.heavy 584.995 / 550.24 2459.0 29.619075298309326 38 12 10 6 10 2.045302164040355 38.78886835821821 0.03849983215332031 3 0.8802483728571412 3.530118496387873 2459.0 22.465617164793382 0.0 - - - - - - - 200.625 4 8 C18orf21 chromosome 18 open reading frame 21 465 59 C20140708_OR008_05 C20140708_OR008_05 TB430461.[MT7]-SVLLITC[CAM]K[MT7]TC[CAM]NR.3y8_1.heavy 584.995 / 1196.6 214.0 29.619075298309326 38 12 10 6 10 2.045302164040355 38.78886835821821 0.03849983215332031 3 0.8802483728571412 3.530118496387873 214.0 3.4 9.0 - - - - - - - 0.0 0 0 C18orf21 chromosome 18 open reading frame 21 467 60 C20140708_OR008_05 C20140708_OR008_05 TB448653.[MT7]-DLDDISTK[MT7].2y4_1.heavy 597.826 / 592.379 12086.0 25.869949340820312 43 18 10 5 10 4.794279920181111 20.85818968956288 0.04010009765625 3 0.986248205028239 10.511960535881805 12086.0 28.606703700290517 0.0 - - - - - - - 767.0 24 7 FIBP fibroblast growth factor (acidic) intracellular binding protein 469 60 C20140708_OR008_05 C20140708_OR008_05 TB448653.[MT7]-DLDDISTK[MT7].2y5_1.heavy 597.826 / 707.406 8633.0 25.869949340820312 43 18 10 5 10 4.794279920181111 20.85818968956288 0.04010009765625 3 0.986248205028239 10.511960535881805 8633.0 21.77098116527633 0.0 - - - - - - - 266.6666666666667 17 9 FIBP fibroblast growth factor (acidic) intracellular binding protein 471 60 C20140708_OR008_05 C20140708_OR008_05 TB448653.[MT7]-DLDDISTK[MT7].2b4_1.heavy 597.826 / 603.274 18800.0 25.869949340820312 43 18 10 5 10 4.794279920181111 20.85818968956288 0.04010009765625 3 0.986248205028239 10.511960535881805 18800.0 79.37777777777777 0.0 - - - - - - - 240.0 37 12 FIBP fibroblast growth factor (acidic) intracellular binding protein 473 60 C20140708_OR008_05 C20140708_OR008_05 TB448653.[MT7]-DLDDISTK[MT7].2y6_1.heavy 597.826 / 822.432 4316.0 25.869949340820312 43 18 10 5 10 4.794279920181111 20.85818968956288 0.04010009765625 3 0.986248205028239 10.511960535881805 4316.0 65.59420833333334 0.0 - - - - - - - 156.0 8 8 FIBP fibroblast growth factor (acidic) intracellular binding protein 475 61 C20140708_OR008_05 C20140708_OR008_05 TB449039.[MT7]-NSLMYYPEGVPDEEQLFK[MT7].3b6_1.heavy 816.406 / 916.435 5685.0 41.87969970703125 45 15 10 10 10 2.1881058680984666 40.54642408477503 0.0 3 0.9526465663124771 5.648820551182101 5685.0 0.0 0.0 - - - - - - - 307.5 11 2 DGCR14 DiGeorge syndrome critical region gene 14 477 61 C20140708_OR008_05 C20140708_OR008_05 TB449039.[MT7]-NSLMYYPEGVPDEEQLFK[MT7].3b4_1.heavy 816.406 / 590.309 5993.0 41.87969970703125 45 15 10 10 10 2.1881058680984666 40.54642408477503 0.0 3 0.9526465663124771 5.648820551182101 5993.0 -1.1712703583061916 0.0 - - - - - - - 307.2857142857143 11 7 DGCR14 DiGeorge syndrome critical region gene 14 479 61 C20140708_OR008_05 C20140708_OR008_05 TB449039.[MT7]-NSLMYYPEGVPDEEQLFK[MT7].3b5_1.heavy 816.406 / 753.372 4763.0 41.87969970703125 45 15 10 10 10 2.1881058680984666 40.54642408477503 0.0 3 0.9526465663124771 5.648820551182101 4763.0 -0.15464285714285708 0.0 - - - - - - - 256.3333333333333 9 3 DGCR14 DiGeorge syndrome critical region gene 14 481 61 C20140708_OR008_05 C20140708_OR008_05 TB449039.[MT7]-NSLMYYPEGVPDEEQLFK[MT7].3y8_1.heavy 816.406 / 1149.59 5378.0 41.87969970703125 45 15 10 10 10 2.1881058680984666 40.54642408477503 0.0 3 0.9526465663124771 5.648820551182101 5378.0 -2.333188720173535 0.0 - - - - - - - 345.75 10 4 DGCR14 DiGeorge syndrome critical region gene 14 483 62 C20140708_OR008_05 C20140708_OR008_05 TB438370.[MT7]-NFLSSLK[MT7].2b3_1.heavy 548.834 / 519.305 3440.0 35.826900482177734 43 18 10 5 10 6.706322441747139 14.91130211358401 0.04579925537109375 3 0.9867978614353402 10.729049881641568 3440.0 28.22332293986637 0.0 - - - - - - - 299.2 6 10 C18orf21 chromosome 18 open reading frame 21 485 62 C20140708_OR008_05 C20140708_OR008_05 TB438370.[MT7]-NFLSSLK[MT7].2y4_1.heavy 548.834 / 578.363 9274.0 35.826900482177734 43 18 10 5 10 6.706322441747139 14.91130211358401 0.04579925537109375 3 0.9867978614353402 10.729049881641568 9274.0 73.31112508361204 0.0 - - - - - - - 249.5 18 6 C18orf21 chromosome 18 open reading frame 21 487 62 C20140708_OR008_05 C20140708_OR008_05 TB438370.[MT7]-NFLSSLK[MT7].2y5_1.heavy 548.834 / 691.447 3440.0 35.826900482177734 43 18 10 5 10 6.706322441747139 14.91130211358401 0.04579925537109375 3 0.9867978614353402 10.729049881641568 3440.0 41.968 1.0 - - - - - - - 299.42857142857144 11 7 C18orf21 chromosome 18 open reading frame 21 489 62 C20140708_OR008_05 C20140708_OR008_05 TB438370.[MT7]-NFLSSLK[MT7].2y6_1.heavy 548.834 / 838.516 5684.0 35.826900482177734 43 18 10 5 10 6.706322441747139 14.91130211358401 0.04579925537109375 3 0.9867978614353402 10.729049881641568 5684.0 10.39215161649944 0.0 - - - - - - - 299.0 11 1 C18orf21 chromosome 18 open reading frame 21 491 63 C20140708_OR008_05 C20140708_OR008_05 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 177164.0 37.92509841918945 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 177164.0 131.88724481964695 0.0 - - - - - - - 385.6666666666667 354 3 493 63 C20140708_OR008_05 C20140708_OR008_05 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 123465.0 37.92509841918945 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 123465.0 426.78731833910035 0.0 - - - - - - - 253.25 246 4 495 63 C20140708_OR008_05 C20140708_OR008_05 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 158782.0 37.92509841918945 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 158782.0 103.14794747753973 0.0 - - - - - - - 145.0 317 1 497 64 C20140708_OR008_05 C20140708_OR008_05 TB448969.[MT7]-ISTITPQIQAFNLQK[MT7].4y4_1.heavy 498.295 / 646.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 499 64 C20140708_OR008_05 C20140708_OR008_05 TB448969.[MT7]-ISTITPQIQAFNLQK[MT7].4b4_1.heavy 498.295 / 559.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 501 64 C20140708_OR008_05 C20140708_OR008_05 TB448969.[MT7]-ISTITPQIQAFNLQK[MT7].4b5_1.heavy 498.295 / 660.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 503 64 C20140708_OR008_05 C20140708_OR008_05 TB448969.[MT7]-ISTITPQIQAFNLQK[MT7].4y3_1.heavy 498.295 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 505 65 C20140708_OR008_05 C20140708_OR008_05 TB448507.[MT7]-ESLFVR.2y4_1.heavy 447.762 / 534.34 938.0 30.22937536239624 37 18 10 3 6 6.094088286503747 16.409345467059392 0.07649993896484375 6 0.982518179445015 9.320394930115722 938.0 8.387884615384616 2.0 - - - - - - - 178.42857142857142 2 7 MAPKAP1 mitogen-activated protein kinase associated protein 1 507 65 C20140708_OR008_05 C20140708_OR008_05 TB448507.[MT7]-ESLFVR.2b3_1.heavy 447.762 / 474.268 3336.0 30.22937536239624 37 18 10 3 6 6.094088286503747 16.409345467059392 0.07649993896484375 6 0.982518179445015 9.320394930115722 3336.0 14.434615384615386 0.0 - - - - - - - 227.27272727272728 6 11 MAPKAP1 mitogen-activated protein kinase associated protein 1 509 65 C20140708_OR008_05 C20140708_OR008_05 TB448507.[MT7]-ESLFVR.2y3_1.heavy 447.762 / 421.256 1147.0 30.22937536239624 37 18 10 3 6 6.094088286503747 16.409345467059392 0.07649993896484375 6 0.982518179445015 9.320394930115722 1147.0 0.44030710172744725 7.0 - - - - - - - 185.11111111111111 4 9 MAPKAP1 mitogen-activated protein kinase associated protein 1 511 65 C20140708_OR008_05 C20140708_OR008_05 TB448507.[MT7]-ESLFVR.2b5_1.heavy 447.762 / 720.405 417.0 30.22937536239624 37 18 10 3 6 6.094088286503747 16.409345467059392 0.07649993896484375 6 0.982518179445015 9.320394930115722 417.0 2.0048076923076925 2.0 - - - - - - - 0.0 0 0 MAPKAP1 mitogen-activated protein kinase associated protein 1 513 66 C20140708_OR008_05 C20140708_OR008_05 TB430062.[MT7]-GHVGTTATK[MT7].2y4_1.heavy 580.337 / 564.347 706.0 14.304100036621094 50 20 10 10 10 9.338567422664623 10.708280561031327 0.0 3 0.9943481653551031 16.40827352699337 706.0 19.2025839292207 0.0 - - - - - - - 0.0 1 0 MAPKAP1 mitogen-activated protein kinase associated protein 1 515 66 C20140708_OR008_05 C20140708_OR008_05 TB430062.[MT7]-GHVGTTATK[MT7].2y5_1.heavy 580.337 / 665.395 855.0 14.304100036621094 50 20 10 10 10 9.338567422664623 10.708280561031327 0.0 3 0.9943481653551031 16.40827352699337 855.0 24.86349533389892 0.0 - - - - - - - 0.0 1 0 MAPKAP1 mitogen-activated protein kinase associated protein 1 517 66 C20140708_OR008_05 C20140708_OR008_05 TB430062.[MT7]-GHVGTTATK[MT7].2y6_1.heavy 580.337 / 722.417 3493.0 14.304100036621094 50 20 10 10 10 9.338567422664623 10.708280561031327 0.0 3 0.9943481653551031 16.40827352699337 3493.0 40.90900900900901 0.0 - - - - - - - 74.0 6 5 MAPKAP1 mitogen-activated protein kinase associated protein 1 519 66 C20140708_OR008_05 C20140708_OR008_05 TB430062.[MT7]-GHVGTTATK[MT7].2y7_1.heavy 580.337 / 821.485 1635.0 14.304100036621094 50 20 10 10 10 9.338567422664623 10.708280561031327 0.0 3 0.9943481653551031 16.40827352699337 1635.0 22.22763731473409 0.0 - - - - - - - 126.2 3 10 MAPKAP1 mitogen-activated protein kinase associated protein 1 521 67 C20140708_OR008_05 C20140708_OR008_05 TB429892.[MT7]-SSFLIR.2y4_1.heavy 433.764 / 548.356 1050.0 31.085049629211426 39 13 10 6 10 1.335449915833167 51.03138352405249 0.034999847412109375 3 0.9202312415179121 4.340261069670002 1050.0 0.7204116638078903 3.0 - - - - - - - 233.33333333333334 4 6 ZNF559 zinc finger protein 559 523 67 C20140708_OR008_05 C20140708_OR008_05 TB429892.[MT7]-SSFLIR.2b3_1.heavy 433.764 / 466.242 2100.0 31.085049629211426 39 13 10 6 10 1.335449915833167 51.03138352405249 0.034999847412109375 3 0.9202312415179121 4.340261069670002 2100.0 5.5200000000000005 0.0 - - - - - - - 181.55555555555554 4 9 ZNF559 zinc finger protein 559 525 67 C20140708_OR008_05 C20140708_OR008_05 TB429892.[MT7]-SSFLIR.2y5_1.heavy 433.764 / 635.388 1517.0 31.085049629211426 39 13 10 6 10 1.335449915833167 51.03138352405249 0.034999847412109375 3 0.9202312415179121 4.340261069670002 1517.0 2.6042918454935626 1.0 - - - - - - - 379.25 4 4 ZNF559 zinc finger protein 559 527 67 C20140708_OR008_05 C20140708_OR008_05 TB429892.[MT7]-SSFLIR.2b4_1.heavy 433.764 / 579.326 3034.0 31.085049629211426 39 13 10 6 10 1.335449915833167 51.03138352405249 0.034999847412109375 3 0.9202312415179121 4.340261069670002 3034.0 22.991965225550132 0.0 - - - - - - - 200.14285714285714 6 7 ZNF559 zinc finger protein 559 529 68 C20140708_OR008_05 C20140708_OR008_05 TB430435.[MT7]-LLHQLIFQIPPSR.3y7_1.heavy 569.346 / 844.468 8035.0 40.78572463989258 41 20 10 1 10 7.846585645799878 12.744396673160384 0.09110260009765625 3 0.9912737970960039 13.201807562981259 8035.0 32.43602760130103 0.0 - - - - - - - 536.0 16 1 FIBP fibroblast growth factor (acidic) intracellular binding protein 531 68 C20140708_OR008_05 C20140708_OR008_05 TB430435.[MT7]-LLHQLIFQIPPSR.3b4_1.heavy 569.346 / 636.395 5758.0 40.78572463989258 41 20 10 1 10 7.846585645799878 12.744396673160384 0.09110260009765625 3 0.9912737970960039 13.201807562981259 5758.0 42.664529415511346 0.0 - - - - - - - 201.0 11 2 FIBP fibroblast growth factor (acidic) intracellular binding protein 533 68 C20140708_OR008_05 C20140708_OR008_05 TB430435.[MT7]-LLHQLIFQIPPSR.3b5_1.heavy 569.346 / 749.479 3080.0 40.78572463989258 41 20 10 1 10 7.846585645799878 12.744396673160384 0.09110260009765625 3 0.9912737970960039 13.201807562981259 3080.0 27.23731343283582 0.0 - - - - - - - 770.0 6 8 FIBP fibroblast growth factor (acidic) intracellular binding protein 535 68 C20140708_OR008_05 C20140708_OR008_05 TB430435.[MT7]-LLHQLIFQIPPSR.3b3_1.heavy 569.346 / 508.336 6829.0 40.78572463989258 41 20 10 1 10 7.846585645799878 12.744396673160384 0.09110260009765625 3 0.9912737970960039 13.201807562981259 6829.0 12.978751247496646 0.0 - - - - - - - 268.0 13 3 FIBP fibroblast growth factor (acidic) intracellular binding protein 537 69 C20140708_OR008_05 C20140708_OR008_05 TB430061.[MT7]-GSEC[CAM]YQK[MT7].2y4_1.heavy 580.286 / 742.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 539 69 C20140708_OR008_05 C20140708_OR008_05 TB430061.[MT7]-GSEC[CAM]YQK[MT7].2b4_1.heavy 580.286 / 578.236 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 541 69 C20140708_OR008_05 C20140708_OR008_05 TB430061.[MT7]-GSEC[CAM]YQK[MT7].2y3_1.heavy 580.286 / 582.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 543 69 C20140708_OR008_05 C20140708_OR008_05 TB430061.[MT7]-GSEC[CAM]YQK[MT7].2b5_1.heavy 580.286 / 741.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 545 70 C20140708_OR008_05 C20140708_OR008_05 TB430065.[MT7]-ESEEPRK[MT7].2b4_1.heavy 581.819 / 619.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 547 70 C20140708_OR008_05 C20140708_OR008_05 TB430065.[MT7]-ESEEPRK[MT7].2b6_1.heavy 581.819 / 872.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 549 70 C20140708_OR008_05 C20140708_OR008_05 TB430065.[MT7]-ESEEPRK[MT7].2y3_1.heavy 581.819 / 544.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 551 70 C20140708_OR008_05 C20140708_OR008_05 TB430065.[MT7]-ESEEPRK[MT7].2y6_1.heavy 581.819 / 889.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 553 71 C20140708_OR008_05 C20140708_OR008_05 TB430068.[MT7]-SEEEGSLK[MT7].2y4_1.heavy 583.811 / 548.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CA9 carbonic anhydrase IX 555 71 C20140708_OR008_05 C20140708_OR008_05 TB430068.[MT7]-SEEEGSLK[MT7].2b4_1.heavy 583.811 / 619.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - CA9 carbonic anhydrase IX 557 71 C20140708_OR008_05 C20140708_OR008_05 TB430068.[MT7]-SEEEGSLK[MT7].2y6_1.heavy 583.811 / 806.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - CA9 carbonic anhydrase IX 559 71 C20140708_OR008_05 C20140708_OR008_05 TB430068.[MT7]-SEEEGSLK[MT7].2y7_1.heavy 583.811 / 935.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - CA9 carbonic anhydrase IX 561 72 C20140708_OR008_05 C20140708_OR008_05 TB448828.[MT7]-LLPMTVVTMASAR.2y9_1.heavy 767.434 / 935.498 4091.0 44.19309997558594 50 20 10 10 10 8.074929372912798 12.384009244148704 0.0 3 0.9936228180108566 15.446030785705517 4091.0 27.976765839041093 0.0 - - - - - - - 240.0 8 8 MAPKAP1 mitogen-activated protein kinase associated protein 1 563 72 C20140708_OR008_05 C20140708_OR008_05 TB448828.[MT7]-LLPMTVVTMASAR.2y10_1.heavy 767.434 / 1066.54 2429.0 44.19309997558594 50 20 10 10 10 8.074929372912798 12.384009244148704 0.0 3 0.9936228180108566 15.446030785705517 2429.0 22.76238671875 0.0 - - - - - - - 201.14285714285714 4 7 MAPKAP1 mitogen-activated protein kinase associated protein 1 565 72 C20140708_OR008_05 C20140708_OR008_05 TB448828.[MT7]-LLPMTVVTMASAR.2y11_1.heavy 767.434 / 1163.59 20326.0 44.19309997558594 50 20 10 10 10 8.074929372912798 12.384009244148704 0.0 3 0.9936228180108566 15.446030785705517 20326.0 151.651015625 0.0 - - - - - - - 224.0 40 8 MAPKAP1 mitogen-activated protein kinase associated protein 1 567 72 C20140708_OR008_05 C20140708_OR008_05 TB448828.[MT7]-LLPMTVVTMASAR.2y7_1.heavy 767.434 / 735.382 3580.0 44.19309997558594 50 20 10 10 10 8.074929372912798 12.384009244148704 0.0 3 0.9936228180108566 15.446030785705517 3580.0 54.23140625 0.0 - - - - - - - 234.66666666666666 7 6 MAPKAP1 mitogen-activated protein kinase associated protein 1 569 73 C20140708_OR008_05 C20140708_OR008_05 TB448640.[MT7]-EVVEATDSR.2y8_1.heavy 575.297 / 876.442 3301.0 19.31429958343506 39 13 10 6 10 1.079125516075437 56.12535654302715 0.03560066223144531 3 0.9068193140641791 4.01114129716119 3301.0 53.91868614872891 0.0 - - - - - - - 183.0 6 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 571 73 C20140708_OR008_05 C20140708_OR008_05 TB448640.[MT7]-EVVEATDSR.2y5_1.heavy 575.297 / 549.263 1651.0 19.31429958343506 39 13 10 6 10 1.079125516075437 56.12535654302715 0.03560066223144531 3 0.9068193140641791 4.01114129716119 1651.0 6.962125410972471 0.0 - - - - - - - 256.8 3 10 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 573 73 C20140708_OR008_05 C20140708_OR008_05 TB448640.[MT7]-EVVEATDSR.2y6_1.heavy 575.297 / 678.305 1009.0 19.31429958343506 39 13 10 6 10 1.079125516075437 56.12535654302715 0.03560066223144531 3 0.9068193140641791 4.01114129716119 1009.0 1.0233042529989094 2.0 - - - - - - - 305.77777777777777 2 9 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 575 73 C20140708_OR008_05 C20140708_OR008_05 TB448640.[MT7]-EVVEATDSR.2y7_1.heavy 575.297 / 777.374 1192.0 19.31429958343506 39 13 10 6 10 1.079125516075437 56.12535654302715 0.03560066223144531 3 0.9068193140641791 4.01114129716119 1192.0 17.51608458066049 0.0 - - - - - - - 183.0 2 1 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 577 74 C20140708_OR008_05 C20140708_OR008_05 TB438568.[MT7]-MLLSQNESQK[MT7].2b3_1.heavy 733.4 / 502.318 2437.0 26.671800136566162 40 14 10 6 10 6.821788945341976 14.658911438220551 0.03719902038574219 3 0.944999455478073 5.2380297149712955 2437.0 27.588679245283018 0.0 - - - - - - - 265.0 4 6 C18orf21 chromosome 18 open reading frame 21 579 74 C20140708_OR008_05 C20140708_OR008_05 TB438568.[MT7]-MLLSQNESQK[MT7].2y8_1.heavy 733.4 / 1077.57 1802.0 26.671800136566162 40 14 10 6 10 6.821788945341976 14.658911438220551 0.03719902038574219 3 0.944999455478073 5.2380297149712955 1802.0 6.403333333333333 0.0 - - - - - - - 190.8 3 5 C18orf21 chromosome 18 open reading frame 21 581 74 C20140708_OR008_05 C20140708_OR008_05 TB438568.[MT7]-MLLSQNESQK[MT7].2y3_1.heavy 733.4 / 506.306 954.0 26.671800136566162 40 14 10 6 10 6.821788945341976 14.658911438220551 0.03719902038574219 3 0.944999455478073 5.2380297149712955 954.0 4.5 0.0 - - - - - - - 0.0 1 0 C18orf21 chromosome 18 open reading frame 21 583 74 C20140708_OR008_05 C20140708_OR008_05 TB438568.[MT7]-MLLSQNESQK[MT7].2y7_1.heavy 733.4 / 964.482 2861.0 26.671800136566162 40 14 10 6 10 6.821788945341976 14.658911438220551 0.03719902038574219 3 0.944999455478073 5.2380297149712955 2861.0 28.340094339622638 0.0 - - - - - - - 181.71428571428572 5 7 C18orf21 chromosome 18 open reading frame 21 585 75 C20140708_OR008_05 C20140708_OR008_05 TB430235.[MT7]-SYVC[CAM]PNC[CAM]GK[MT7].2y5_1.heavy 686.833 / 719.363 2015.0 20.772899627685547 41 18 10 3 10 4.2159474769150815 23.719460583311776 0.07950019836425781 3 0.9830838058870155 9.475386082566503 2015.0 21.24510869565217 1.0 - - - - - - - 146.8 4 5 ZNF496 zinc finger protein 496 587 75 C20140708_OR008_05 C20140708_OR008_05 TB430235.[MT7]-SYVC[CAM]PNC[CAM]GK[MT7].2b4_1.heavy 686.833 / 654.304 458.0 20.772899627685547 41 18 10 3 10 4.2159474769150815 23.719460583311776 0.07950019836425781 3 0.9830838058870155 9.475386082566503 458.0 5.644442687747036 5.0 - - - - - - - 0.0 1 0 ZNF496 zinc finger protein 496 589 75 C20140708_OR008_05 C20140708_OR008_05 TB430235.[MT7]-SYVC[CAM]PNC[CAM]GK[MT7].2y3_1.heavy 686.833 / 508.267 916.0 20.772899627685547 41 18 10 3 10 4.2159474769150815 23.719460583311776 0.07950019836425781 3 0.9830838058870155 9.475386082566503 916.0 2.5027322404371586 0.0 - - - - - - - 0.0 1 0 ZNF496 zinc finger protein 496 591 75 C20140708_OR008_05 C20140708_OR008_05 TB430235.[MT7]-SYVC[CAM]PNC[CAM]GK[MT7].2y6_1.heavy 686.833 / 879.393 1557.0 20.772899627685547 41 18 10 3 10 4.2159474769150815 23.719460583311776 0.07950019836425781 3 0.9830838058870155 9.475386082566503 1557.0 25.09178189593728 0.0 - - - - - - - 274.6666666666667 3 3 ZNF496 zinc finger protein 496 593 76 C20140708_OR008_05 C20140708_OR008_05 TB430431.[MT7]-RTANPNHDMSGSK[MT7].3y6_1.heavy 568.289 / 768.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - C18orf21 chromosome 18 open reading frame 21 595 76 C20140708_OR008_05 C20140708_OR008_05 TB430431.[MT7]-RTANPNHDMSGSK[MT7].3b6_1.heavy 568.289 / 798.434 N/A N/A - - - - - - - - - 0.0 - - - - - - - C18orf21 chromosome 18 open reading frame 21 597 76 C20140708_OR008_05 C20140708_OR008_05 TB430431.[MT7]-RTANPNHDMSGSK[MT7].3b4_1.heavy 568.289 / 587.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - C18orf21 chromosome 18 open reading frame 21 599 76 C20140708_OR008_05 C20140708_OR008_05 TB430431.[MT7]-RTANPNHDMSGSK[MT7].3y4_1.heavy 568.289 / 522.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - C18orf21 chromosome 18 open reading frame 21 601 77 C20140708_OR008_05 C20140708_OR008_05 TB438564.[MT7]-TPVC[CAM]HQC[CAM]HK[MT7].2y8_1.heavy 727.865 / 1209.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDLIM7 PDZ and LIM domain 7 (enigma) 603 77 C20140708_OR008_05 C20140708_OR008_05 TB438564.[MT7]-TPVC[CAM]HQC[CAM]HK[MT7].2y5_1.heavy 727.865 / 853.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDLIM7 PDZ and LIM domain 7 (enigma) 605 77 C20140708_OR008_05 C20140708_OR008_05 TB438564.[MT7]-TPVC[CAM]HQC[CAM]HK[MT7].2y3_1.heavy 727.865 / 588.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDLIM7 PDZ and LIM domain 7 (enigma) 607 77 C20140708_OR008_05 C20140708_OR008_05 TB438564.[MT7]-TPVC[CAM]HQC[CAM]HK[MT7].2y6_1.heavy 727.865 / 1013.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDLIM7 PDZ and LIM domain 7 (enigma) 609 78 C20140708_OR008_05 C20140708_OR008_05 TB438566.[MT7]-VIELQEIISK[MT7].3b6_1.heavy 487.304 / 856.49 1542.0 40.85415077209473 40 15 10 5 10 10.635368423719218 9.402589173777745 0.045299530029296875 3 0.9564261991012541 5.8906050813162505 1542.0 5.821515945827873 0.0 - - - - - - - 350.0 3 2 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 611 78 C20140708_OR008_05 C20140708_OR008_05 TB438566.[MT7]-VIELQEIISK[MT7].3y3_1.heavy 487.304 / 491.331 3224.0 40.85415077209473 40 15 10 5 10 10.635368423719218 9.402589173777745 0.045299530029296875 3 0.9564261991012541 5.8906050813162505 3224.0 22.08628979194662 1.0 - - - - - - - 140.0 6 1 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 613 78 C20140708_OR008_05 C20140708_OR008_05 TB438566.[MT7]-VIELQEIISK[MT7].3b4_1.heavy 487.304 / 599.388 701.0 40.85415077209473 40 15 10 5 10 10.635368423719218 9.402589173777745 0.045299530029296875 3 0.9564261991012541 5.8906050813162505 701.0 7.01 0.0 - - - - - - - 0.0 1 0 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 615 78 C20140708_OR008_05 C20140708_OR008_05 TB438566.[MT7]-VIELQEIISK[MT7].3b5_1.heavy 487.304 / 727.447 1261.0 40.85415077209473 40 15 10 5 10 10.635368423719218 9.402589173777745 0.045299530029296875 3 0.9564261991012541 5.8906050813162505 1261.0 8.71707142857143 1.0 - - - - - - - 210.0 2 2 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 617 79 C20140708_OR008_05 C20140708_OR008_05 TB448821.[MT7]-STEFNEHELK[MT7].3b6_1.heavy 507.931 / 852.386 4432.0 24.31700038909912 38 12 10 6 10 2.315814693542643 43.18134791995119 0.035999298095703125 3 0.8976112183589976 3.8234817282867235 4432.0 47.19481081081081 1.0 - - - - - - - 184.66666666666666 8 6 VSNL1 visinin-like 1 619 79 C20140708_OR008_05 C20140708_OR008_05 TB448821.[MT7]-STEFNEHELK[MT7].3y3_1.heavy 507.931 / 533.341 19944.0 24.31700038909912 38 12 10 6 10 2.315814693542643 43.18134791995119 0.035999298095703125 3 0.8976112183589976 3.8234817282867235 19944.0 88.31869969040248 0.0 - - - - - - - 241.46153846153845 39 13 VSNL1 visinin-like 1 621 79 C20140708_OR008_05 C20140708_OR008_05 TB448821.[MT7]-STEFNEHELK[MT7].3b4_1.heavy 507.931 / 609.3 7387.0 24.31700038909912 38 12 10 6 10 2.315814693542643 43.18134791995119 0.035999298095703125 3 0.8976112183589976 3.8234817282867235 7387.0 52.26902527075812 0.0 - - - - - - - 175.4 14 10 VSNL1 visinin-like 1 623 79 C20140708_OR008_05 C20140708_OR008_05 TB448821.[MT7]-STEFNEHELK[MT7].3b5_1.heavy 507.931 / 723.343 7848.0 24.31700038909912 38 12 10 6 10 2.315814693542643 43.18134791995119 0.035999298095703125 3 0.8976112183589976 3.8234817282867235 7848.0 13.596972042042466 0.0 - - - - - - - 211.0 15 7 VSNL1 visinin-like 1 625 80 C20140708_OR008_05 C20140708_OR008_05 TB438664.[MT7]-GY[MT7]AIGNAPELAK[MT7].4b7_2.heavy 409.741 / 468.263 631.0 27.369849681854248 22 8 4 6 4 0.7653690919768127 81.87335205607425 0.03980064392089844 9 0.7893593404069176 2.640311507258097 631.0 1.5012698412698413 4.0 - - - - - - - 315.25 2 4 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 627 80 C20140708_OR008_05 C20140708_OR008_05 TB438664.[MT7]-GY[MT7]AIGNAPELAK[MT7].4y3_1.heavy 409.741 / 475.336 1052.0 27.369849681854248 22 8 4 6 4 0.7653690919768127 81.87335205607425 0.03980064392089844 9 0.7893593404069176 2.640311507258097 1052.0 11.74156226671191 3.0 - - - - - - - 285.42857142857144 3 7 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 629 80 C20140708_OR008_05 C20140708_OR008_05 TB438664.[MT7]-GY[MT7]AIGNAPELAK[MT7].4b3_1.heavy 409.741 / 580.333 105.0 27.369849681854248 22 8 4 6 4 0.7653690919768127 81.87335205607425 0.03980064392089844 9 0.7893593404069176 2.640311507258097 105.0 1.0 20.0 - - - - - - - 0.0 0 0 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 631 80 C20140708_OR008_05 C20140708_OR008_05 TB438664.[MT7]-GY[MT7]AIGNAPELAK[MT7].4b6_2.heavy 409.741 / 432.745 526.0 27.369849681854248 22 8 4 6 4 0.7653690919768127 81.87335205607425 0.03980064392089844 9 0.7893593404069176 2.640311507258097 526.0 7.263809523809524 2.0 - - - - - - - 0.0 1 0 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 633 81 C20140708_OR008_05 C20140708_OR008_05 TB448504.[MT7]-VLAGDK[MT7].2b3_1.heavy 445.781 / 428.299 5966.0 26.050500869750977 45 17 10 10 8 3.8868693217269885 25.72764652544806 0.0 4 0.9784044466399747 8.382923815746484 5966.0 28.81356738952031 2.0 - - - - - - - 312.2857142857143 17 7 ACTN4 actinin, alpha 4 635 81 C20140708_OR008_05 C20140708_OR008_05 TB448504.[MT7]-VLAGDK[MT7].2b4_1.heavy 445.781 / 485.32 1293.0 26.050500869750977 45 17 10 10 8 3.8868693217269885 25.72764652544806 0.0 4 0.9784044466399747 8.382923815746484 1293.0 16.686072788183342 0.0 - - - - - - - 269.85714285714283 2 7 ACTN4 actinin, alpha 4 637 81 C20140708_OR008_05 C20140708_OR008_05 TB448504.[MT7]-VLAGDK[MT7].2y3_1.heavy 445.781 / 463.263 11037.0 26.050500869750977 45 17 10 10 8 3.8868693217269885 25.72764652544806 0.0 4 0.9784044466399747 8.382923815746484 11037.0 104.64473130317957 1.0 - - - - - - - 262.57142857142856 29 14 ACTN4 actinin, alpha 4 639 81 C20140708_OR008_05 C20140708_OR008_05 TB448504.[MT7]-VLAGDK[MT7].2b5_1.heavy 445.781 / 600.347 7358.0 26.050500869750977 45 17 10 10 8 3.8868693217269885 25.72764652544806 0.0 4 0.9784044466399747 8.382923815746484 7358.0 46.41959731543624 0.0 - - - - - - - 231.83333333333334 14 12 ACTN4 actinin, alpha 4 641 82 C20140708_OR008_05 C20140708_OR008_05 TB449088.[MT7]-DLGPVISTGLLHLAEDGVLSPLALTEGGK[MT7].4y5_1.heavy 790.948 / 635.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 643 82 C20140708_OR008_05 C20140708_OR008_05 TB449088.[MT7]-DLGPVISTGLLHLAEDGVLSPLALTEGGK[MT7].4b11_1.heavy 790.948 / 1210.72 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 645 82 C20140708_OR008_05 C20140708_OR008_05 TB449088.[MT7]-DLGPVISTGLLHLAEDGVLSPLALTEGGK[MT7].4b5_1.heavy 790.948 / 626.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 647 82 C20140708_OR008_05 C20140708_OR008_05 TB449088.[MT7]-DLGPVISTGLLHLAEDGVLSPLALTEGGK[MT7].4b6_1.heavy 790.948 / 739.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 649 83 C20140708_OR008_05 C20140708_OR008_05 TB438668.[MT7]-GLLGSVMLDLDVLR.2y8_1.heavy 822.977 / 974.534 2483.0 54.567399978637695 32 9 10 7 6 0.623319098153675 92.41552095576421 0.020397186279296875 5 0.800638744750611 2.7167373197888365 2483.0 3.299667774086379 0.0 - - - - - - - 157.76190476190476 4 21 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 651 83 C20140708_OR008_05 C20140708_OR008_05 TB438668.[MT7]-GLLGSVMLDLDVLR.2y5_1.heavy 822.977 / 615.382 1805.0 54.567399978637695 32 9 10 7 6 0.623319098153675 92.41552095576421 0.020397186279296875 5 0.800638744750611 2.7167373197888365 1805.0 4.658530588907947 1.0 - - - - - - - 116.96296296296296 4 27 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 653 83 C20140708_OR008_05 C20140708_OR008_05 TB438668.[MT7]-GLLGSVMLDLDVLR.2b6_1.heavy 822.977 / 671.421 677.0 54.567399978637695 32 9 10 7 6 0.623319098153675 92.41552095576421 0.020397186279296875 5 0.800638744750611 2.7167373197888365 677.0 -0.8763919422559796 2.0 - - - - - - - 0.0 1 0 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 655 83 C20140708_OR008_05 C20140708_OR008_05 TB438668.[MT7]-GLLGSVMLDLDVLR.2y11_1.heavy 822.977 / 1217.66 1467.0 54.567399978637695 32 9 10 7 6 0.623319098153675 92.41552095576421 0.020397186279296875 5 0.800638744750611 2.7167373197888365 1467.0 1.9260869565217391 1.0 - - - - - - - 197.0952380952381 2 21 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 657 84 C20140708_OR008_05 C20140708_OR008_05 TB449089.[MT7]-QSILSVRLEQC[CAM]PLQLNNPFNEYSK[MT7].4y5_1.heavy 792.171 / 784.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAP1 mitogen-activated protein kinase associated protein 1 659 84 C20140708_OR008_05 C20140708_OR008_05 TB449089.[MT7]-QSILSVRLEQC[CAM]PLQLNNPFNEYSK[MT7].4b11_2.heavy 792.171 / 729.896 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAP1 mitogen-activated protein kinase associated protein 1 661 84 C20140708_OR008_05 C20140708_OR008_05 TB449089.[MT7]-QSILSVRLEQC[CAM]PLQLNNPFNEYSK[MT7].4y7_1.heavy 792.171 / 1028.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAP1 mitogen-activated protein kinase associated protein 1 663 84 C20140708_OR008_05 C20140708_OR008_05 TB449089.[MT7]-QSILSVRLEQC[CAM]PLQLNNPFNEYSK[MT7].4y3_1.heavy 792.171 / 541.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAPKAP1 mitogen-activated protein kinase associated protein 1 665 85 C20140708_OR008_05 C20140708_OR008_05 TB438669.[MT7]-GLLGSVMLDLDVLR.3y7_1.heavy 548.987 / 843.493 1180.0 54.567399978637695 36 11 10 7 8 1.4162407555494696 47.072975696707374 0.020397186279296875 4 0.867201045200651 3.348400483063573 1180.0 14.75 0.0 - - - - - - - 100.27272727272727 2 11 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 667 85 C20140708_OR008_05 C20140708_OR008_05 TB438669.[MT7]-GLLGSVMLDLDVLR.3b6_1.heavy 548.987 / 671.421 1560.0 54.567399978637695 36 11 10 7 8 1.4162407555494696 47.072975696707374 0.020397186279296875 4 0.867201045200651 3.348400483063573 1560.0 15.692080668962126 2.0 - - - - - - - 101.33333333333333 3 9 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 669 85 C20140708_OR008_05 C20140708_OR008_05 TB438669.[MT7]-GLLGSVMLDLDVLR.3y6_1.heavy 548.987 / 730.409 761.0 54.567399978637695 36 11 10 7 8 1.4162407555494696 47.072975696707374 0.020397186279296875 4 0.867201045200651 3.348400483063573 761.0 3.8719882016775746 1.0 - - - - - - - 119.5 2 14 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 671 85 C20140708_OR008_05 C20140708_OR008_05 TB438669.[MT7]-GLLGSVMLDLDVLR.3y5_1.heavy 548.987 / 615.382 875.0 54.567399978637695 36 11 10 7 8 1.4162407555494696 47.072975696707374 0.020397186279296875 4 0.867201045200651 3.348400483063573 875.0 7.905970596368329 1.0 - - - - - - - 166.0 2 11 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 673 86 C20140708_OR008_05 C20140708_OR008_05 TB430198.[MT7]-GFAENRQPDR.3b9_2.heavy 445.229 / 580.284 3303.0 17.60284996032715 39 14 10 5 10 3.2850335763609926 30.441089162557468 0.046100616455078125 3 0.9422046562879537 5.1085981075640206 3303.0 25.297689655172412 0.0 - - - - - - - 243.6 6 5 CABP1 calcium binding protein 1 675 86 C20140708_OR008_05 C20140708_OR008_05 TB430198.[MT7]-GFAENRQPDR.3b4_1.heavy 445.229 / 549.279 7562.0 17.60284996032715 39 14 10 5 10 3.2850335763609926 30.441089162557468 0.046100616455078125 3 0.9422046562879537 5.1085981075640206 7562.0 164.45177011494252 0.0 - - - - - - - 174.0 15 4 CABP1 calcium binding protein 1 677 86 C20140708_OR008_05 C20140708_OR008_05 TB430198.[MT7]-GFAENRQPDR.3b5_1.heavy 445.229 / 663.322 782.0 17.60284996032715 39 14 10 5 10 3.2850335763609926 30.441089162557468 0.046100616455078125 3 0.9422046562879537 5.1085981075640206 782.0 9.588505747126437 2.0 - - - - - - - 0.0 1 0 CABP1 calcium binding protein 1 679 86 C20140708_OR008_05 C20140708_OR008_05 TB430198.[MT7]-GFAENRQPDR.3y4_1.heavy 445.229 / 515.257 2260.0 17.60284996032715 39 14 10 5 10 3.2850335763609926 30.441089162557468 0.046100616455078125 3 0.9422046562879537 5.1085981075640206 2260.0 29.09425287356322 1.0 - - - - - - - 206.625 4 8 CABP1 calcium binding protein 1 681 87 C20140708_OR008_05 C20140708_OR008_05 TB430646.[MT7]-MRSPPGENPSPQGELPSPESSR.3y7_1.heavy 827.403 / 759.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 683 87 C20140708_OR008_05 C20140708_OR008_05 TB430646.[MT7]-MRSPPGENPSPQGELPSPESSR.3b8_1.heavy 827.403 / 1013.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 685 87 C20140708_OR008_05 C20140708_OR008_05 TB430646.[MT7]-MRSPPGENPSPQGELPSPESSR.3b8_2.heavy 827.403 / 507.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 687 87 C20140708_OR008_05 C20140708_OR008_05 TB430646.[MT7]-MRSPPGENPSPQGELPSPESSR.3y10_1.heavy 827.403 / 1058.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 689 88 C20140708_OR008_05 C20140708_OR008_05 TB430196.[MT7]-ALSEHSC[CAM]LK[MT7].2y4_1.heavy 666.863 / 651.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF559 zinc finger protein 559 691 88 C20140708_OR008_05 C20140708_OR008_05 TB430196.[MT7]-ALSEHSC[CAM]LK[MT7].2y5_1.heavy 666.863 / 788.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF559 zinc finger protein 559 693 88 C20140708_OR008_05 C20140708_OR008_05 TB430196.[MT7]-ALSEHSC[CAM]LK[MT7].2b4_1.heavy 666.863 / 545.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF559 zinc finger protein 559 695 88 C20140708_OR008_05 C20140708_OR008_05 TB430196.[MT7]-ALSEHSC[CAM]LK[MT7].2y3_1.heavy 666.863 / 564.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF559 zinc finger protein 559 697 89 C20140708_OR008_05 C20140708_OR008_05 TB429983.[MT7]-IEDELK[MT7].2b3_1.heavy 517.802 / 502.263 17799.0 27.04129981994629 47 17 10 10 10 4.633949138825707 21.579865683493686 0.0 3 0.9751820503536872 7.8176660351252245 17799.0 38.403095684803 0.0 - - - - - - - 252.0 35 11 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 699 89 C20140708_OR008_05 C20140708_OR008_05 TB429983.[MT7]-IEDELK[MT7].2y5_1.heavy 517.802 / 777.411 20037.0 27.04129981994629 47 17 10 10 10 4.633949138825707 21.579865683493686 0.0 3 0.9751820503536872 7.8176660351252245 20037.0 114.58659375 0.0 - - - - - - - 275.4166666666667 40 12 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 701 89 C20140708_OR008_05 C20140708_OR008_05 TB429983.[MT7]-IEDELK[MT7].2b4_1.heavy 517.802 / 631.305 8420.0 27.04129981994629 47 17 10 10 10 4.633949138825707 21.579865683493686 0.0 3 0.9751820503536872 7.8176660351252245 8420.0 7.02311615752005 2.0 - - - - - - - 192.1 16 10 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 703 89 C20140708_OR008_05 C20140708_OR008_05 TB429983.[MT7]-IEDELK[MT7].2y3_1.heavy 517.802 / 533.341 15454.0 27.04129981994629 47 17 10 10 10 4.633949138825707 21.579865683493686 0.0 3 0.9751820503536872 7.8176660351252245 15454.0 50.787793427230056 0.0 - - - - - - - 284.22222222222223 30 9 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 705 90 C20140708_OR008_05 C20140708_OR008_05 TB430644.[MT7]-ELFVQSEIFPLETPAFAIK[MT7].3y6_1.heavy 823.129 / 790.494 828.0 50.591800689697266 36 11 10 5 10 0.8015206596601214 71.42496884876147 0.04579925537109375 3 0.872709392934912 3.4217316506043547 828.0 19.857966101694913 0.0 - - - - - - - 0.0 1 0 GMPS guanine monphosphate synthetase 707 90 C20140708_OR008_05 C20140708_OR008_05 TB430644.[MT7]-ELFVQSEIFPLETPAFAIK[MT7].3b4_1.heavy 823.129 / 633.373 710.0 50.591800689697266 36 11 10 5 10 0.8015206596601214 71.42496884876147 0.04579925537109375 3 0.872709392934912 3.4217316506043547 710.0 1.4664165103189493 1.0 - - - - - - - 0.0 1 0 GMPS guanine monphosphate synthetase 709 90 C20140708_OR008_05 C20140708_OR008_05 TB430644.[MT7]-ELFVQSEIFPLETPAFAIK[MT7].3b3_1.heavy 823.129 / 534.304 769.0 50.591800689697266 36 11 10 5 10 0.8015206596601214 71.42496884876147 0.04579925537109375 3 0.872709392934912 3.4217316506043547 769.0 10.376667206246427 0.0 - - - - - - - 0.0 1 0 GMPS guanine monphosphate synthetase 711 90 C20140708_OR008_05 C20140708_OR008_05 TB430644.[MT7]-ELFVQSEIFPLETPAFAIK[MT7].3b7_1.heavy 823.129 / 977.506 1539.0 50.591800689697266 36 11 10 5 10 0.8015206596601214 71.42496884876147 0.04579925537109375 3 0.872709392934912 3.4217316506043547 1539.0 36.41430508474576 0.0 - - - - - - - 135.0 3 7 GMPS guanine monphosphate synthetase 713 91 C20140708_OR008_05 C20140708_OR008_05 TB430642.[MT7]-QRVLDEEEYIEGLQTVIQR.4b8_1.heavy 616.331 / 1143.58 2420.0 41.27090072631836 39 11 10 10 8 0.9752747960211282 61.31470852326108 0.0 4 0.8727591139407468 3.422415007084072 2420.0 9.630209442144686 0.0 - - - - - - - 284.6666666666667 4 6 DGCR14 DiGeorge syndrome critical region gene 14 715 91 C20140708_OR008_05 C20140708_OR008_05 TB430642.[MT7]-QRVLDEEEYIEGLQTVIQR.4b8_2.heavy 616.331 / 572.292 7545.0 41.27090072631836 39 11 10 10 8 0.9752747960211282 61.31470852326108 0.0 4 0.8727591139407468 3.422415007084072 7545.0 17.883724005917667 0.0 - - - - - - - 297.6363636363636 15 11 DGCR14 DiGeorge syndrome critical region gene 14 717 91 C20140708_OR008_05 C20140708_OR008_05 TB430642.[MT7]-QRVLDEEEYIEGLQTVIQR.4y6_1.heavy 616.331 / 744.436 2847.0 41.27090072631836 39 11 10 10 8 0.9752747960211282 61.31470852326108 0.0 4 0.8727591139407468 3.422415007084072 2847.0 12.869023654642223 1.0 - - - - - - - 237.33333333333334 8 3 DGCR14 DiGeorge syndrome critical region gene 14 719 91 C20140708_OR008_05 C20140708_OR008_05 TB430642.[MT7]-QRVLDEEEYIEGLQTVIQR.4b9_2.heavy 616.331 / 653.823 9111.0 41.27090072631836 39 11 10 10 8 0.9752747960211282 61.31470852326108 0.0 4 0.8727591139407468 3.422415007084072 9111.0 16.91811356741578 0.0 - - - - - - - 356.0 18 4 DGCR14 DiGeorge syndrome critical region gene 14 721 92 C20140708_OR008_05 C20140708_OR008_05 TB429981.[MT7]-SSLINSLR.2y5_1.heavy 517.31 / 602.362 1856.0 31.563133239746094 40 20 8 6 6 7.380428352976075 13.549349064499232 0.03380012512207031 5 0.9953054855365298 18.005159895160922 1856.0 4.8 2.0 - - - - - - - 232.0 5 8 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 723 92 C20140708_OR008_05 C20140708_OR008_05 TB429981.[MT7]-SSLINSLR.2y6_1.heavy 517.31 / 715.446 928.0 31.563133239746094 40 20 8 6 6 7.380428352976075 13.549349064499232 0.03380012512207031 5 0.9953054855365298 18.005159895160922 928.0 5.4 2.0 - - - - - - - 0.0 1 0 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 725 92 C20140708_OR008_05 C20140708_OR008_05 TB429981.[MT7]-SSLINSLR.2b5_1.heavy 517.31 / 659.385 N/A 31.563133239746094 40 20 8 6 6 7.380428352976075 13.549349064499232 0.03380012512207031 5 0.9953054855365298 18.005159895160922 0.0 0.0 35.0 - - - - - - - 319.0 3 12 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 727 92 C20140708_OR008_05 C20140708_OR008_05 TB429981.[MT7]-SSLINSLR.2y7_1.heavy 517.31 / 802.478 4525.0 31.563133239746094 40 20 8 6 6 7.380428352976075 13.549349064499232 0.03380012512207031 5 0.9953054855365298 18.005159895160922 4525.0 6.3101404923277755 1.0 - - - - - - - 278.4 11 5 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 729 93 C20140708_OR008_05 C20140708_OR008_05 TB430193.[MT7]-EAFREFDK[MT7].2b6_1.heavy 665.356 / 924.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 731 93 C20140708_OR008_05 C20140708_OR008_05 TB430193.[MT7]-EAFREFDK[MT7].2y3_1.heavy 665.356 / 553.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 733 93 C20140708_OR008_05 C20140708_OR008_05 TB430193.[MT7]-EAFREFDK[MT7].2b7_1.heavy 665.356 / 1039.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 735 93 C20140708_OR008_05 C20140708_OR008_05 TB430193.[MT7]-EAFREFDK[MT7].2y7_2.heavy 665.356 / 528.783 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 737 94 C20140708_OR008_05 C20140708_OR008_05 TB429883.[MT7]-WFPGHMAK[MT7].3y6_1.heavy 421.23 / 784.426 109.0 30.548800468444824 38 14 10 6 8 1.7488017218877436 57.18201140152985 0.03280067443847656 4 0.9402882573848662 5.025131169881498 109.0 0.4 14.0 - - - - - - - 0.0 0 0 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 739 94 C20140708_OR008_05 C20140708_OR008_05 TB429883.[MT7]-WFPGHMAK[MT7].3y3_1.heavy 421.23 / 493.293 7204.0 30.548800468444824 38 14 10 6 8 1.7488017218877436 57.18201140152985 0.03280067443847656 4 0.9402882573848662 5.025131169881498 7204.0 21.065468138251433 0.0 - - - - - - - 204.375 14 8 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 741 94 C20140708_OR008_05 C20140708_OR008_05 TB429883.[MT7]-WFPGHMAK[MT7].3b4_1.heavy 421.23 / 632.331 4148.0 30.548800468444824 38 14 10 6 8 1.7488017218877436 57.18201140152985 0.03280067443847656 4 0.9402882573848662 5.025131169881498 4148.0 1.7539112050739958 1.0 - - - - - - - 236.33333333333334 8 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 743 94 C20140708_OR008_05 C20140708_OR008_05 TB429883.[MT7]-WFPGHMAK[MT7].3b5_2.heavy 421.23 / 385.199 3056.0 30.548800468444824 38 14 10 6 8 1.7488017218877436 57.18201140152985 0.03280067443847656 4 0.9402882573848662 5.025131169881498 3056.0 0.459778830963665 3.0 - - - - - - - 261.8 6 10 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 745 95 C20140708_OR008_05 C20140708_OR008_05 TB448814.[MT7]-QIIPMVTELIGR.2y8_1.heavy 757.448 / 918.508 1890.0 47.63135051727295 44 18 10 6 10 3.1674146774668896 31.571489742534776 0.030200958251953125 3 0.9898112979946955 12.216126110859278 1890.0 3.0692307692307694 0.0 - - - - - - - 225.0 3 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 747 95 C20140708_OR008_05 C20140708_OR008_05 TB448814.[MT7]-QIIPMVTELIGR.2y9_1.heavy 757.448 / 1015.56 54445.0 47.63135051727295 44 18 10 6 10 3.1674146774668896 31.571489742534776 0.030200958251953125 3 0.9898112979946955 12.216126110859278 54445.0 201.44650000000001 1.0 - - - - - - - 198.0 108 10 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 749 95 C20140708_OR008_05 C20140708_OR008_05 TB448814.[MT7]-QIIPMVTELIGR.2y10_1.heavy 757.448 / 1128.64 7019.0 47.63135051727295 44 18 10 6 10 3.1674146774668896 31.571489742534776 0.030200958251953125 3 0.9898112979946955 12.216126110859278 7019.0 0.6894083904557944 1.0 - - - - - - - 205.71428571428572 14 7 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 751 95 C20140708_OR008_05 C20140708_OR008_05 TB448814.[MT7]-QIIPMVTELIGR.2y11_1.heavy 757.448 / 1241.73 2520.0 47.63135051727295 44 18 10 6 10 3.1674146774668896 31.571489742534776 0.030200958251953125 3 0.9898112979946955 12.216126110859278 2520.0 0.84 2.0 - - - - - - - 260.0 5 9 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 753 96 C20140708_OR008_05 C20140708_OR008_05 TB429984.[MT7]-EQSQMK[MT7].2y4_1.heavy 519.778 / 637.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 755 96 C20140708_OR008_05 C20140708_OR008_05 TB429984.[MT7]-EQSQMK[MT7].2y5_1.heavy 519.778 / 765.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 757 96 C20140708_OR008_05 C20140708_OR008_05 TB429984.[MT7]-EQSQMK[MT7].2b4_1.heavy 519.778 / 617.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 759 96 C20140708_OR008_05 C20140708_OR008_05 TB429984.[MT7]-EQSQMK[MT7].2b5_1.heavy 519.778 / 748.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 761 97 C20140708_OR008_05 C20140708_OR008_05 TB448815.[MT7]-SLRPEEIEELR.2b3_1.heavy 757.918 / 501.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 763 97 C20140708_OR008_05 C20140708_OR008_05 TB448815.[MT7]-SLRPEEIEELR.2y8_1.heavy 757.918 / 1014.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 765 97 C20140708_OR008_05 C20140708_OR008_05 TB448815.[MT7]-SLRPEEIEELR.2b6_1.heavy 757.918 / 856.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 767 97 C20140708_OR008_05 C20140708_OR008_05 TB448815.[MT7]-SLRPEEIEELR.2b9_1.heavy 757.918 / 1227.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 769 98 C20140708_OR008_05 C20140708_OR008_05 TB430243.[MT7]-NVIFTNC[CAM]VK[MT7].3y3_1.heavy 461.595 / 550.314 5100.0 30.810999870300293 43 17 10 6 10 3.998507398181945 25.009332243693823 0.03280067443847656 3 0.97963754732958 8.633911992146427 5100.0 14.97244048750034 0.0 - - - - - - - 222.0 10 10 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 771 98 C20140708_OR008_05 C20140708_OR008_05 TB430243.[MT7]-NVIFTNC[CAM]VK[MT7].3b4_1.heavy 461.595 / 618.373 4324.0 30.810999870300293 43 17 10 6 10 3.998507398181945 25.009332243693823 0.03280067443847656 3 0.97963754732958 8.633911992146427 4324.0 23.372972972972974 0.0 - - - - - - - 179.30769230769232 8 13 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 773 98 C20140708_OR008_05 C20140708_OR008_05 TB430243.[MT7]-NVIFTNC[CAM]VK[MT7].3y4_1.heavy 461.595 / 664.357 1885.0 30.810999870300293 43 17 10 6 10 3.998507398181945 25.009332243693823 0.03280067443847656 3 0.97963754732958 8.633911992146427 1885.0 5.094594594594594 2.0 - - - - - - - 281.06666666666666 4 15 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 775 98 C20140708_OR008_05 C20140708_OR008_05 TB430243.[MT7]-NVIFTNC[CAM]VK[MT7].3b3_1.heavy 461.595 / 471.305 10200.0 30.810999870300293 43 17 10 6 10 3.998507398181945 25.009332243693823 0.03280067443847656 3 0.97963754732958 8.633911992146427 10200.0 18.12487983885443 0.0 - - - - - - - 277.1666666666667 20 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 777 99 C20140708_OR008_05 C20140708_OR008_05 TB430449.[MT7]-SPMQEEEDLAAGVGR.2y9_1.heavy 866.918 / 887.458 913.0 34.38629913330078 35 5 10 10 10 1.29520342600095 46.885823341060046 0.0 3 0.6788388853631664 2.1165354220964954 913.0 10.675076923076922 0.0 - - - - - - - 0.0 1 0 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 779 99 C20140708_OR008_05 C20140708_OR008_05 TB430449.[MT7]-SPMQEEEDLAAGVGR.2y10_1.heavy 866.918 / 1016.5 2087.0 34.38629913330078 35 5 10 10 10 1.29520342600095 46.885823341060046 0.0 3 0.6788388853631664 2.1165354220964954 2087.0 1.8679880375542355 1.0 - - - - - - - 208.4 4 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 781 99 C20140708_OR008_05 C20140708_OR008_05 TB430449.[MT7]-SPMQEEEDLAAGVGR.2y11_1.heavy 866.918 / 1145.54 1304.0 34.38629913330078 35 5 10 10 10 1.29520342600095 46.885823341060046 0.0 3 0.6788388853631664 2.1165354220964954 1304.0 3.00153452685422 0.0 - - - - - - - 247.6 2 10 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 783 99 C20140708_OR008_05 C20140708_OR008_05 TB430449.[MT7]-SPMQEEEDLAAGVGR.2y7_1.heavy 866.918 / 643.389 652.0 34.38629913330078 35 5 10 10 10 1.29520342600095 46.885823341060046 0.0 3 0.6788388853631664 2.1165354220964954 652.0 -0.10426988653422659 3.0 - - - - - - - 312.8 4 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 785 100 C20140708_OR008_05 C20140708_OR008_05 TB430055.[MT7]-LHEVGHERDSLQR.3y11_2.heavy 573.972 / 663.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 787 100 C20140708_OR008_05 C20140708_OR008_05 TB430055.[MT7]-LHEVGHERDSLQR.3b3_1.heavy 573.972 / 524.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 789 100 C20140708_OR008_05 C20140708_OR008_05 TB430055.[MT7]-LHEVGHERDSLQR.3y4_1.heavy 573.972 / 503.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 791 100 C20140708_OR008_05 C20140708_OR008_05 TB430055.[MT7]-LHEVGHERDSLQR.3y12_2.heavy 573.972 / 731.861 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 793 101 C20140708_OR008_05 C20140708_OR008_05 TB438557.[MT7]-SALQELEELK[MT7].3y3_1.heavy 483.28 / 533.341 1320.0 40.74039840698242 47 17 10 10 10 4.054880128198147 19.278363155556967 0.0 3 0.9757289466290675 7.905616144820724 1320.0 3.2 1.0 - - - - - - - 293.0 2 1 CDC27 cell division cycle 27 homolog (S. cerevisiae) 795 101 C20140708_OR008_05 C20140708_OR008_05 TB438557.[MT7]-SALQELEELK[MT7].3b4_1.heavy 483.28 / 544.321 2640.0 40.74039840698242 47 17 10 10 10 4.054880128198147 19.278363155556967 0.0 3 0.9757289466290675 7.905616144820724 2640.0 8.656542121341266 1.0 - - - - - - - 293.3333333333333 5 3 CDC27 cell division cycle 27 homolog (S. cerevisiae) 797 101 C20140708_OR008_05 C20140708_OR008_05 TB438557.[MT7]-SALQELEELK[MT7].3b5_1.heavy 483.28 / 673.364 2346.0 40.74039840698242 47 17 10 10 10 4.054880128198147 19.278363155556967 0.0 3 0.9757289466290675 7.905616144820724 2346.0 19.955776518443834 0.0 - - - - - - - 880.0 4 1 CDC27 cell division cycle 27 homolog (S. cerevisiae) 799 101 C20140708_OR008_05 C20140708_OR008_05 TB438557.[MT7]-SALQELEELK[MT7].3y4_1.heavy 483.28 / 662.384 733.0 40.74039840698242 47 17 10 10 10 4.054880128198147 19.278363155556967 0.0 3 0.9757289466290675 7.905616144820724 733.0 9.474149659863947 2.0 - - - - - - - 293.5 5 2 CDC27 cell division cycle 27 homolog (S. cerevisiae) 801 102 C20140708_OR008_05 C20140708_OR008_05 TB438650.[MT7]-GGVSYRPAEVAETGA.2y8_1.heavy 804.411 / 747.352 104.0 26.83120059967041 28 8 4 6 10 1.018275612573097 62.22824788663628 0.03800010681152344 3 0.7795496286863748 2.578606119790617 104.0 0.4 14.0 - - - - - - - 145.8 6 5 CA9 carbonic anhydrase IX 803 102 C20140708_OR008_05 C20140708_OR008_05 TB438650.[MT7]-GGVSYRPAEVAETGA.2b11_2.heavy 804.411 / 616.331 834.0 26.83120059967041 28 8 4 6 10 1.018275612573097 62.22824788663628 0.03800010681152344 3 0.7795496286863748 2.578606119790617 834.0 1.4 1.0 - - - - - - - 0.0 1 0 CA9 carbonic anhydrase IX 805 102 C20140708_OR008_05 C20140708_OR008_05 TB438650.[MT7]-GGVSYRPAEVAETGA.2b9_2.heavy 804.411 / 531.278 521.0 26.83120059967041 28 8 4 6 10 1.018275612573097 62.22824788663628 0.03800010681152344 3 0.7795496286863748 2.578606119790617 521.0 4.158942307692308 3.0 - - - - - - - 0.0 1 0 CA9 carbonic anhydrase IX 807 102 C20140708_OR008_05 C20140708_OR008_05 TB438650.[MT7]-GGVSYRPAEVAETGA.2b9_1.heavy 804.411 / 1061.55 1773.0 26.83120059967041 28 8 4 6 10 1.018275612573097 62.22824788663628 0.03800010681152344 3 0.7795496286863748 2.578606119790617 1773.0 13.827703349282295 0.0 - - - - - - - 223.57142857142858 3 7 CA9 carbonic anhydrase IX 809 103 C20140708_OR008_05 C20140708_OR008_05 TB430249.[MT7]-SLVC[CAM]TALRGK[MT7].3y7_1.heavy 464.946 / 949.537 211.0 28.421900431315105 26 3 10 5 8 0.3057023529273613 145.99684682404245 0.045299530029296875 4 0.519363866990208 1.7032754678060735 211.0 3.0095238095238095 3.0 - - - - - - - 0.0 0 0 FIBP fibroblast growth factor (acidic) intracellular binding protein 811 103 C20140708_OR008_05 C20140708_OR008_05 TB430249.[MT7]-SLVC[CAM]TALRGK[MT7].3y8_1.heavy 464.946 / 1048.61 N/A 28.421900431315105 26 3 10 5 8 0.3057023529273613 145.99684682404245 0.045299530029296875 4 0.519363866990208 1.7032754678060735 0.0 0.0 7.0 - - - - - - - 0.0 0 0 FIBP fibroblast growth factor (acidic) intracellular binding protein 813 103 C20140708_OR008_05 C20140708_OR008_05 TB430249.[MT7]-SLVC[CAM]TALRGK[MT7].3y8_2.heavy 464.946 / 524.806 4000.0 28.421900431315105 26 3 10 5 8 0.3057023529273613 145.99684682404245 0.045299530029296875 4 0.519363866990208 1.7032754678060735 4000.0 52.869329722410285 0.0 - - - - - - - 228.16666666666666 8 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 815 103 C20140708_OR008_05 C20140708_OR008_05 TB430249.[MT7]-SLVC[CAM]TALRGK[MT7].3y9_2.heavy 464.946 / 581.348 1368.0 28.421900431315105 26 3 10 5 8 0.3057023529273613 145.99684682404245 0.045299530029296875 4 0.519363866990208 1.7032754678060735 1368.0 25.014857142857146 1.0 - - - - - - - 131.5 2 8 FIBP fibroblast growth factor (acidic) intracellular binding protein 817 104 C20140708_OR008_05 C20140708_OR008_05 TB438809.[MT7]-VVLEGPAPWGFRLQGGK[MT7].3y10_2.heavy 700.405 / 645.365 6240.0 40.2859992980957 47 17 10 10 10 3.2539945370694063 25.089005690642736 0.0 3 0.9785895027442275 8.41920455671651 6240.0 10.234336017733936 1.0 - - - - - - - 223.25 12 4 PDLIM7 PDZ and LIM domain 7 (enigma) 819 104 C20140708_OR008_05 C20140708_OR008_05 TB438809.[MT7]-VVLEGPAPWGFRLQGGK[MT7].3y14_2.heavy 700.405 / 822.442 3269.0 40.2859992980957 47 17 10 10 10 3.2539945370694063 25.089005690642736 0.0 3 0.9785895027442275 8.41920455671651 3269.0 0.42865384615384605 1.0 - - - - - - - 248.0 6 3 PDLIM7 PDZ and LIM domain 7 (enigma) 821 104 C20140708_OR008_05 C20140708_OR008_05 TB438809.[MT7]-VVLEGPAPWGFRLQGGK[MT7].3y12_2.heavy 700.405 / 729.41 1486.0 40.2859992980957 47 17 10 10 10 3.2539945370694063 25.089005690642736 0.0 3 0.9785895027442275 8.41920455671651 1486.0 5.146251618751619 1.0 - - - - - - - 149.0 4 1 PDLIM7 PDZ and LIM domain 7 (enigma) 823 104 C20140708_OR008_05 C20140708_OR008_05 TB438809.[MT7]-VVLEGPAPWGFRLQGGK[MT7].3y13_2.heavy 700.405 / 757.921 4309.0 40.2859992980957 47 17 10 10 10 3.2539945370694063 25.089005690642736 0.0 3 0.9785895027442275 8.41920455671651 4309.0 13.007274703064743 0.0 - - - - - - - 416.2 8 5 PDLIM7 PDZ and LIM domain 7 (enigma) 825 105 C20140708_OR008_05 C20140708_OR008_05 TB430640.[MT7]-ASAPAADPPRYTFAPSVSLNK[MT7].4y4_1.heavy 612.834 / 605.374 31909.0 33.10919952392578 50 20 10 10 10 13.427389367085174 7.447464080034201 0.0 3 0.9972644142365027 23.590554461355993 31909.0 64.5303997070676 0.0 - - - - - - - 283.22222222222223 63 9 PDLIM7 PDZ and LIM domain 7 (enigma) 827 105 C20140708_OR008_05 C20140708_OR008_05 TB430640.[MT7]-ASAPAADPPRYTFAPSVSLNK[MT7].4b7_1.heavy 612.834 / 728.37 35064.0 33.10919952392578 50 20 10 10 10 13.427389367085174 7.447464080034201 0.0 3 0.9972644142365027 23.590554461355993 35064.0 97.26664993038051 0.0 - - - - - - - 363.8333333333333 70 6 PDLIM7 PDZ and LIM domain 7 (enigma) 829 105 C20140708_OR008_05 C20140708_OR008_05 TB430640.[MT7]-ASAPAADPPRYTFAPSVSLNK[MT7].4b5_1.heavy 612.834 / 542.305 8614.0 33.10919952392578 50 20 10 10 10 13.427389367085174 7.447464080034201 0.0 3 0.9972644142365027 23.590554461355993 8614.0 9.491859025805654 0.0 - - - - - - - 267.0 17 5 PDLIM7 PDZ and LIM domain 7 (enigma) 831 105 C20140708_OR008_05 C20140708_OR008_05 TB430640.[MT7]-ASAPAADPPRYTFAPSVSLNK[MT7].4y3_1.heavy 612.834 / 518.342 14317.0 33.10919952392578 50 20 10 10 10 13.427389367085174 7.447464080034201 0.0 3 0.9972644142365027 23.590554461355993 14317.0 13.298816626566827 1.0 - - - - - - - 333.625 29 8 PDLIM7 PDZ and LIM domain 7 (enigma) 833 106 C20140708_OR008_05 C20140708_OR008_05 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1708020.0 34.84410095214844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1708020.0 1230.7907663024178 0.0 - - - - - - - 295.2857142857143 3416 7 835 106 C20140708_OR008_05 C20140708_OR008_05 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 302569.0 34.84410095214844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 302569.0 692.1206913073238 0.0 - - - - - - - 258.5 605 4 837 106 C20140708_OR008_05 C20140708_OR008_05 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 539726.0 34.84410095214844 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 539726.0 509.5910028700007 0.0 - - - - - - - 239.875 1079 8 839 107 C20140708_OR008_05 C20140708_OR008_05 TB438909.[MT7]-YLVALGHAYHPEEFVC[CAM]SQC[CAM]GK[MT7].4b4_1.heavy 689.091 / 591.362 4442.0 36.010000228881836 36 11 10 5 10 0.8329082246016277 60.968949600568905 0.045803070068359375 3 0.8718942843738025 3.410585286524771 4442.0 6.288190358867154 0.0 - - - - - - - 246.66666666666666 8 6 PDLIM7 PDZ and LIM domain 7 (enigma) 841 107 C20140708_OR008_05 C20140708_OR008_05 TB438909.[MT7]-YLVALGHAYHPEEFVC[CAM]SQC[CAM]GK[MT7].4y3_1.heavy 689.091 / 508.267 4886.0 36.010000228881836 36 11 10 5 10 0.8329082246016277 60.968949600568905 0.045803070068359375 3 0.8718942843738025 3.410585286524771 4886.0 15.901509009009008 0.0 - - - - - - - 263.1111111111111 9 9 PDLIM7 PDZ and LIM domain 7 (enigma) 843 107 C20140708_OR008_05 C20140708_OR008_05 TB438909.[MT7]-YLVALGHAYHPEEFVC[CAM]SQC[CAM]GK[MT7].4b6_1.heavy 689.091 / 761.468 888.0 36.010000228881836 36 11 10 5 10 0.8329082246016277 60.968949600568905 0.045803070068359375 3 0.8718942843738025 3.410585286524771 888.0 0.64 7.0 - - - - - - - 325.6 2 5 PDLIM7 PDZ and LIM domain 7 (enigma) 845 107 C20140708_OR008_05 C20140708_OR008_05 TB438909.[MT7]-YLVALGHAYHPEEFVC[CAM]SQC[CAM]GK[MT7].4b3_1.heavy 689.091 / 520.325 1629.0 36.010000228881836 36 11 10 5 10 0.8329082246016277 60.968949600568905 0.045803070068359375 3 0.8718942843738025 3.410585286524771 1629.0 5.173175675675675 0.0 - - - - - - - 296.0 3 8 PDLIM7 PDZ and LIM domain 7 (enigma) 847 108 C20140708_OR008_05 C20140708_OR008_05 TB438550.[MT7]-DQLVLNIEALR.2b3_1.heavy 714.421 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 849 108 C20140708_OR008_05 C20140708_OR008_05 TB438550.[MT7]-DQLVLNIEALR.2y8_1.heavy 714.421 / 927.562 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 851 108 C20140708_OR008_05 C20140708_OR008_05 TB438550.[MT7]-DQLVLNIEALR.2b4_1.heavy 714.421 / 600.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 853 108 C20140708_OR008_05 C20140708_OR008_05 TB438550.[MT7]-DQLVLNIEALR.2y7_1.heavy 714.421 / 828.494 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 855 109 C20140708_OR008_05 C20140708_OR008_05 TB448954.[MT7]-QLNTALPQEFAALTK[MT7].3b6_1.heavy 645.038 / 785.464 17028.0 41.81544876098633 42 17 10 5 10 3.5234727221757485 28.38109101019232 0.04290008544921875 3 0.9716207162157156 7.308515760717177 17028.0 34.96652173913043 1.0 - - - - - - - 275.8 34 5 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 857 109 C20140708_OR008_05 C20140708_OR008_05 TB448954.[MT7]-QLNTALPQEFAALTK[MT7].3b4_1.heavy 645.038 / 601.343 4142.0 41.81544876098633 42 17 10 5 10 3.5234727221757485 28.38109101019232 0.04290008544921875 3 0.9716207162157156 7.308515760717177 4142.0 0.7004347826086955 2.0 - - - - - - - 358.0 15 6 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 859 109 C20140708_OR008_05 C20140708_OR008_05 TB448954.[MT7]-QLNTALPQEFAALTK[MT7].3b5_1.heavy 645.038 / 672.38 19329.0 41.81544876098633 42 17 10 5 10 3.5234727221757485 28.38109101019232 0.04290008544921875 3 0.9716207162157156 7.308515760717177 19329.0 63.943697947962136 0.0 - - - - - - - 306.75 38 4 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 861 109 C20140708_OR008_05 C20140708_OR008_05 TB448954.[MT7]-QLNTALPQEFAALTK[MT7].3y4_1.heavy 645.038 / 576.384 14113.0 41.81544876098633 42 17 10 5 10 3.5234727221757485 28.38109101019232 0.04290008544921875 3 0.9716207162157156 7.308515760717177 14113.0 16.454520757970457 0.0 - - - - - - - 268.25 28 4 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 863 110 C20140708_OR008_05 C20140708_OR008_05 TB449095.[MT7]-AAYESLILDGLFMEILNDC[CAM]SDVDEIK[MT7].4y4_1.heavy 816.159 / 648.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIAS2 protein inhibitor of activated STAT, 2 865 110 C20140708_OR008_05 C20140708_OR008_05 TB449095.[MT7]-AAYESLILDGLFMEILNDC[CAM]SDVDEIK[MT7].4b7_1.heavy 816.159 / 892.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIAS2 protein inhibitor of activated STAT, 2 867 110 C20140708_OR008_05 C20140708_OR008_05 TB449095.[MT7]-AAYESLILDGLFMEILNDC[CAM]SDVDEIK[MT7].4b5_1.heavy 816.159 / 666.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIAS2 protein inhibitor of activated STAT, 2 869 110 C20140708_OR008_05 C20140708_OR008_05 TB449095.[MT7]-AAYESLILDGLFMEILNDC[CAM]SDVDEIK[MT7].4b6_1.heavy 816.159 / 779.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIAS2 protein inhibitor of activated STAT, 2 871 111 C20140708_OR008_05 C20140708_OR008_05 TB429874.[MT7]-SSQVPR.2b3_1.heavy 409.236 / 447.232 3393.0 15.047800064086914 45 20 10 5 10 7.238524019415719 13.814971081365815 0.041599273681640625 3 0.9909008428635672 12.928017372054148 3393.0 29.028885514728213 0.0 - - - - - - - 162.6153846153846 6 13 PDLIM7 PDZ and LIM domain 7 (enigma) 873 111 C20140708_OR008_05 C20140708_OR008_05 TB429874.[MT7]-SSQVPR.2y5_1.heavy 409.236 / 586.331 3727.0 15.047800064086914 45 20 10 5 10 7.238524019415719 13.814971081365815 0.041599273681640625 3 0.9909008428635672 12.928017372054148 3727.0 64.43345045045045 0.0 - - - - - - - 94.7 7 10 PDLIM7 PDZ and LIM domain 7 (enigma) 875 111 C20140708_OR008_05 C20140708_OR008_05 TB429874.[MT7]-SSQVPR.2b4_1.heavy 409.236 / 546.3 1613.0 15.047800064086914 45 20 10 5 10 7.238524019415719 13.814971081365815 0.041599273681640625 3 0.9909008428635672 12.928017372054148 1613.0 23.23591891891892 0.0 - - - - - - - 176.33333333333334 3 6 PDLIM7 PDZ and LIM domain 7 (enigma) 877 111 C20140708_OR008_05 C20140708_OR008_05 TB429874.[MT7]-SSQVPR.2b5_1.heavy 409.236 / 643.353 334.0 15.047800064086914 45 20 10 5 10 7.238524019415719 13.814971081365815 0.041599273681640625 3 0.9909008428635672 12.928017372054148 334.0 3.6108108108108103 6.0 - - - - - - - 180.875 5 8 PDLIM7 PDZ and LIM domain 7 (enigma) 879 112 C20140708_OR008_05 C20140708_OR008_05 TB430080.[MT7]-C[CAM]SLLEEELGATHK[MT7].3b6_1.heavy 592.313 / 876.425 5264.0 33.64099884033203 44 14 10 10 10 2.13978319350303 37.31337222124755 0.0 3 0.9392838291274166 4.982965881553642 5264.0 44.3945015576324 0.0 - - - - - - - 192.4 10 10 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 881 112 C20140708_OR008_05 C20140708_OR008_05 TB430080.[MT7]-C[CAM]SLLEEELGATHK[MT7].3b4_1.heavy 592.313 / 618.34 5264.0 33.64099884033203 44 14 10 10 10 2.13978319350303 37.31337222124755 0.0 3 0.9392838291274166 4.982965881553642 5264.0 14.217932596998017 0.0 - - - - - - - 256.6666666666667 10 6 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 883 112 C20140708_OR008_05 C20140708_OR008_05 TB430080.[MT7]-C[CAM]SLLEEELGATHK[MT7].3b5_1.heavy 592.313 / 747.383 5393.0 33.64099884033203 44 14 10 10 10 2.13978319350303 37.31337222124755 0.0 3 0.9392838291274166 4.982965881553642 5393.0 39.02197601140108 1.0 - - - - - - - 233.36363636363637 13 11 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 885 112 C20140708_OR008_05 C20140708_OR008_05 TB430080.[MT7]-C[CAM]SLLEEELGATHK[MT7].3y5_1.heavy 592.313 / 657.38 9886.0 33.64099884033203 44 14 10 10 10 2.13978319350303 37.31337222124755 0.0 3 0.9392838291274166 4.982965881553642 9886.0 24.965679380689515 0.0 - - - - - - - 256.6363636363636 19 11 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 887 113 C20140708_OR008_05 C20140708_OR008_05 TB438284.[MT7]-LQLNFR.2b3_1.heavy 467.783 / 499.336 1171.0 34.66674995422363 33 18 4 5 6 2.9146561286871826 25.84273207860959 0.04219818115234375 5 0.98306678798006 9.470609981303197 1171.0 12.191232876712329 3.0 - - - - - - - 243.83333333333334 11 6 CA9 carbonic anhydrase IX 889 113 C20140708_OR008_05 C20140708_OR008_05 TB438284.[MT7]-LQLNFR.2y4_1.heavy 467.783 / 549.314 585.0 34.66674995422363 33 18 4 5 6 2.9146561286871826 25.84273207860959 0.04219818115234375 5 0.98306678798006 9.470609981303197 585.0 1.7965870307167235 7.0 - - - - - - - 0.0 1 0 CA9 carbonic anhydrase IX 891 113 C20140708_OR008_05 C20140708_OR008_05 TB438284.[MT7]-LQLNFR.2y5_1.heavy 467.783 / 677.373 3219.0 34.66674995422363 33 18 4 5 6 2.9146561286871826 25.84273207860959 0.04219818115234375 5 0.98306678798006 9.470609981303197 3219.0 32.152375520127165 0.0 - - - - - - - 243.66666666666666 6 3 CA9 carbonic anhydrase IX 893 113 C20140708_OR008_05 C20140708_OR008_05 TB438284.[MT7]-LQLNFR.2b4_1.heavy 467.783 / 613.379 1024.0 34.66674995422363 33 18 4 5 6 2.9146561286871826 25.84273207860959 0.04219818115234375 5 0.98306678798006 9.470609981303197 1024.0 0.07978142076502731 4.0 - - - - - - - 293.0 2 1 CA9 carbonic anhydrase IX 895 114 C20140708_OR008_05 C20140708_OR008_05 TB449070.[MT7]-GWLELESDPGLFTLLVEDFGVK[MT7].3b6_1.heavy 918.161 / 872.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 897 114 C20140708_OR008_05 C20140708_OR008_05 TB449070.[MT7]-GWLELESDPGLFTLLVEDFGVK[MT7].3b4_1.heavy 918.161 / 630.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 899 114 C20140708_OR008_05 C20140708_OR008_05 TB449070.[MT7]-GWLELESDPGLFTLLVEDFGVK[MT7].3y4_1.heavy 918.161 / 594.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 901 114 C20140708_OR008_05 C20140708_OR008_05 TB449070.[MT7]-GWLELESDPGLFTLLVEDFGVK[MT7].3b8_1.heavy 918.161 / 1074.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 903 115 C20140708_OR008_05 C20140708_OR008_05 TB430553.[MT7]-SDPSIVLLLQC[CAM]DIQK[MT7].3b4_1.heavy 673.046 / 531.253 3332.0 44.58637523651123 40 14 10 6 10 1.2004654882263468 53.17341449165832 0.037899017333984375 3 0.9417240479266813 5.08728070619945 3332.0 17.090834143496014 0.0 - - - - - - - 222.3 6 10 VSNL1 visinin-like 1 905 115 C20140708_OR008_05 C20140708_OR008_05 TB430553.[MT7]-SDPSIVLLLQC[CAM]DIQK[MT7].3b5_1.heavy 673.046 / 644.337 5461.0 44.58637523651123 40 14 10 6 10 1.2004654882263468 53.17341449165832 0.037899017333984375 3 0.9417240479266813 5.08728070619945 5461.0 61.208436479490246 0.0 - - - - - - - 235.0 10 13 VSNL1 visinin-like 1 907 115 C20140708_OR008_05 C20140708_OR008_05 TB430553.[MT7]-SDPSIVLLLQC[CAM]DIQK[MT7].3y5_1.heavy 673.046 / 807.415 5554.0 44.58637523651123 40 14 10 6 10 1.2004654882263468 53.17341449165832 0.037899017333984375 3 0.9417240479266813 5.08728070619945 5554.0 85.55516535890729 0.0 - - - - - - - 176.8181818181818 11 11 VSNL1 visinin-like 1 909 115 C20140708_OR008_05 C20140708_OR008_05 TB430553.[MT7]-SDPSIVLLLQC[CAM]DIQK[MT7].3b7_1.heavy 673.046 / 856.49 5646.0 44.58637523651123 40 14 10 6 10 1.2004654882263468 53.17341449165832 0.037899017333984375 3 0.9417240479266813 5.08728070619945 5646.0 17.802702702702703 0.0 - - - - - - - 240.8 11 10 VSNL1 visinin-like 1 911 116 C20140708_OR008_05 C20140708_OR008_05 TB430554.[MT7]-SLRPEEIEELREAFR.4y4_1.heavy 505.275 / 522.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 913 116 C20140708_OR008_05 C20140708_OR008_05 TB430554.[MT7]-SLRPEEIEELREAFR.4b8_2.heavy 505.275 / 549.799 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 915 116 C20140708_OR008_05 C20140708_OR008_05 TB430554.[MT7]-SLRPEEIEELREAFR.4b9_2.heavy 505.275 / 614.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 917 116 C20140708_OR008_05 C20140708_OR008_05 TB430554.[MT7]-SLRPEEIEELREAFR.4b6_1.heavy 505.275 / 856.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 919 117 C20140708_OR008_05 C20140708_OR008_05 TB438282.[MT7]-VLVADK[MT7].2y4_1.heavy 466.805 / 576.347 10403.0 24.555999755859375 50 20 10 10 10 16.096783979187496 6.212421073010363 0.0 3 0.9980381022095693 27.858206399882143 10403.0 57.38988333333333 0.0 - - - - - - - 216.66666666666666 20 12 WDR4;FIBP WD repeat domain 4;fibroblast growth factor (acidic) intracellular binding protein 921 117 C20140708_OR008_05 C20140708_OR008_05 TB438282.[MT7]-VLVADK[MT7].2y5_1.heavy 466.805 / 689.431 9803.0 24.555999755859375 50 20 10 10 10 16.096783979187496 6.212421073010363 0.0 3 0.9980381022095693 27.858206399882143 9803.0 63.13132 0.0 - - - - - - - 200.0 19 7 WDR4;FIBP WD repeat domain 4;fibroblast growth factor (acidic) intracellular binding protein 923 117 C20140708_OR008_05 C20140708_OR008_05 TB438282.[MT7]-VLVADK[MT7].2y3_1.heavy 466.805 / 477.279 13504.0 24.555999755859375 50 20 10 10 10 16.096783979187496 6.212421073010363 0.0 3 0.9980381022095693 27.858206399882143 13504.0 69.23050666666667 0.0 - - - - - - - 212.5 27 8 WDR4;FIBP WD repeat domain 4;fibroblast growth factor (acidic) intracellular binding protein 925 117 C20140708_OR008_05 C20140708_OR008_05 TB438282.[MT7]-VLVADK[MT7].2b5_1.heavy 466.805 / 642.394 3401.0 24.555999755859375 50 20 10 10 10 16.096783979187496 6.212421073010363 0.0 3 0.9980381022095693 27.858206399882143 3401.0 6.524281183086856 1.0 - - - - - - - 216.66666666666666 9 6 WDR4;FIBP WD repeat domain 4;fibroblast growth factor (acidic) intracellular binding protein 927 118 C20140708_OR008_05 C20140708_OR008_05 TB430353.[MT7]-EVVEATDSREK[MT7].3y10_2.heavy 517.614 / 639.344 1467.0 18.774749755859375 34 11 10 3 10 1.0321399702926863 58.94819052718462 0.07970046997070312 3 0.8781752314617102 3.4993200906107145 1467.0 20.76489878831076 0.0 - - - - - - - 211.0 2 10 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 929 118 C20140708_OR008_05 C20140708_OR008_05 TB430353.[MT7]-EVVEATDSREK[MT7].3b4_1.heavy 517.614 / 601.331 825.0 18.774749755859375 34 11 10 3 10 1.0321399702926863 58.94819052718462 0.07970046997070312 3 0.8781752314617102 3.4993200906107145 825.0 3.5305676855895194 0.0 - - - - - - - 0.0 1 0 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 931 118 C20140708_OR008_05 C20140708_OR008_05 TB430353.[MT7]-EVVEATDSREK[MT7].3y4_1.heavy 517.614 / 663.391 2292.0 18.774749755859375 34 11 10 3 10 1.0321399702926863 58.94819052718462 0.07970046997070312 3 0.8781752314617102 3.4993200906107145 2292.0 7.006113537117904 0.0 - - - - - - - 224.11111111111111 4 9 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 933 118 C20140708_OR008_05 C20140708_OR008_05 TB430353.[MT7]-EVVEATDSREK[MT7].3b7_1.heavy 517.614 / 888.443 458.0 18.774749755859375 34 11 10 3 10 1.0321399702926863 58.94819052718462 0.07970046997070312 3 0.8781752314617102 3.4993200906107145 458.0 7.280774530767404 3.0 - - - - - - - 0.0 1 0 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 935 119 C20140708_OR008_05 C20140708_OR008_05 TB430557.[MT7]-LLGHQVGHRDIEEIIR.3y15_2.heavy 677.052 / 886.482 5491.0 30.42930030822754 38 16 4 10 8 2.8585524968370604 34.98274042916766 0.0 4 0.9680748616978392 6.888644044665146 5491.0 4.159848484848485 2.0 - - - - - - - 271.7142857142857 19 7 CABP1 calcium binding protein 1 937 119 C20140708_OR008_05 C20140708_OR008_05 TB430557.[MT7]-LLGHQVGHRDIEEIIR.3y6_1.heavy 677.052 / 772.456 1478.0 30.42930030822754 38 16 4 10 8 2.8585524968370604 34.98274042916766 0.0 4 0.9680748616978392 6.888644044665146 1478.0 8.366037735849057 0.0 - - - - - - - 158.58333333333334 2 12 CABP1 calcium binding protein 1 939 119 C20140708_OR008_05 C20140708_OR008_05 TB430557.[MT7]-LLGHQVGHRDIEEIIR.3b4_1.heavy 677.052 / 565.358 1056.0 30.42930030822754 38 16 4 10 8 2.8585524968370604 34.98274042916766 0.0 4 0.9680748616978392 6.888644044665146 1056.0 4.754502369668247 2.0 - - - - - - - 246.33333333333334 2 15 CABP1 calcium binding protein 1 941 119 C20140708_OR008_05 C20140708_OR008_05 TB430557.[MT7]-LLGHQVGHRDIEEIIR.3y14_2.heavy 677.052 / 829.94 3274.0 30.42930030822754 38 16 4 10 8 2.8585524968370604 34.98274042916766 0.0 4 0.9680748616978392 6.888644044665146 3274.0 35.76174162252247 0.0 - - - - - - - 106.0 6 2 CABP1 calcium binding protein 1 943 120 C20140708_OR008_05 C20140708_OR008_05 TB430188.[MT7]-TFRVLQSVAR.3y7_1.heavy 440.934 / 772.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 945 120 C20140708_OR008_05 C20140708_OR008_05 TB430188.[MT7]-TFRVLQSVAR.3y6_1.heavy 440.934 / 673.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 947 120 C20140708_OR008_05 C20140708_OR008_05 TB430188.[MT7]-TFRVLQSVAR.3y5_1.heavy 440.934 / 560.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 949 120 C20140708_OR008_05 C20140708_OR008_05 TB430188.[MT7]-TFRVLQSVAR.3b7_2.heavy 440.934 / 488.789 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 951 121 C20140708_OR008_05 C20140708_OR008_05 TB430352.[MT7]-LLAETADMIGVK[MT7].3b4_1.heavy 516.969 / 571.357 13033.0 41.44419860839844 35 5 10 10 10 1.8176844386642492 43.07018500712218 0.0 3 0.648785080278793 2.0181661041113146 13033.0 197.37096212121213 0.0 - - - - - - - 132.0 26 2 CABP1 calcium binding protein 1 953 121 C20140708_OR008_05 C20140708_OR008_05 TB430352.[MT7]-LLAETADMIGVK[MT7].3b5_1.heavy 516.969 / 672.405 7372.0 41.44419860839844 35 5 10 10 10 1.8176844386642492 43.07018500712218 0.0 3 0.648785080278793 2.0181661041113146 7372.0 109.74227272727273 0.0 - - - - - - - 210.8 14 5 CABP1 calcium binding protein 1 955 121 C20140708_OR008_05 C20140708_OR008_05 TB430352.[MT7]-LLAETADMIGVK[MT7].3y4_1.heavy 516.969 / 560.389 21459.0 41.44419860839844 35 5 10 10 10 1.8176844386642492 43.07018500712218 0.0 3 0.648785080278793 2.0181661041113146 21459.0 88.64457762405131 0.0 - - - - - - - 175.66666666666666 42 3 CABP1 calcium binding protein 1 957 121 C20140708_OR008_05 C20140708_OR008_05 TB430352.[MT7]-LLAETADMIGVK[MT7].3b7_1.heavy 516.969 / 858.469 5924.0 41.44419860839844 35 5 10 10 10 1.8176844386642492 43.07018500712218 0.0 3 0.648785080278793 2.0181661041113146 5924.0 44.37368821292775 0.0 - - - - - - - 263.0 11 1 CABP1 calcium binding protein 1 959 122 C20140708_OR008_05 C20140708_OR008_05 TB430211.[MT7]-ALC[CAM]SAAQAAWR.2y8_1.heavy 674.849 / 860.437 1215.0 31.12012529373169 40 14 10 6 10 2.3473996963052475 42.60032927387597 0.03510093688964844 3 0.9491571183921093 5.449916269791976 1215.0 16.10187371452077 1.0 - - - - - - - 220.875 2 8 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 961 122 C20140708_OR008_05 C20140708_OR008_05 TB430211.[MT7]-ALC[CAM]SAAQAAWR.2y9_1.heavy 674.849 / 1020.47 3315.0 31.12012529373169 40 14 10 6 10 2.3473996963052475 42.60032927387597 0.03510093688964844 3 0.9491571183921093 5.449916269791976 3315.0 12.11682648101931 0.0 - - - - - - - 206.75 6 8 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 963 122 C20140708_OR008_05 C20140708_OR008_05 TB430211.[MT7]-ALC[CAM]SAAQAAWR.2y10_1.heavy 674.849 / 1133.55 3536.0 31.12012529373169 40 14 10 6 10 2.3473996963052475 42.60032927387597 0.03510093688964844 3 0.9491571183921093 5.449916269791976 3536.0 20.27794561933535 1.0 - - - - - - - 171.55555555555554 7 9 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 965 122 C20140708_OR008_05 C20140708_OR008_05 TB430211.[MT7]-ALC[CAM]SAAQAAWR.2y7_1.heavy 674.849 / 773.405 331.0 31.12012529373169 40 14 10 6 10 2.3473996963052475 42.60032927387597 0.03510093688964844 3 0.9491571183921093 5.449916269791976 331.0 -0.20045248868778281 14.0 - - - - - - - 0.0 1 0 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 967 123 C20140708_OR008_05 C20140708_OR008_05 TB430619.[MT7]-ALC[CAM]SAAQAAWRENFPLC[CAM]GR.3y18_2.heavy 774.717 / 1054 4545.0 38.54174995422363 37 12 10 5 10 1.2301815287969131 54.19254403198933 0.046298980712890625 3 0.8824579950750776 3.563830792888431 4545.0 31.880944628721434 0.0 - - - - - - - 274.0 9 4 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 969 123 C20140708_OR008_05 C20140708_OR008_05 TB430619.[MT7]-ALC[CAM]SAAQAAWRENFPLC[CAM]GR.3y17_2.heavy 774.717 / 997.46 3918.0 38.54174995422363 37 12 10 5 10 1.2301815287969131 54.19254403198933 0.046298980712890625 3 0.8824579950750776 3.563830792888431 3918.0 25.789031034015448 0.0 - - - - - - - 235.0 7 2 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 971 123 C20140708_OR008_05 C20140708_OR008_05 TB430619.[MT7]-ALC[CAM]SAAQAAWRENFPLC[CAM]GR.3b7_1.heavy 774.717 / 846.426 627.0 38.54174995422363 37 12 10 5 10 1.2301815287969131 54.19254403198933 0.046298980712890625 3 0.8824579950750776 3.563830792888431 627.0 1.468725443545646 5.0 - - - - - - - 282.0 2 5 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 973 123 C20140708_OR008_05 C20140708_OR008_05 TB430619.[MT7]-ALC[CAM]SAAQAAWRENFPLC[CAM]GR.3y5_1.heavy 774.717 / 602.308 2351.0 38.54174995422363 37 12 10 5 10 1.2301815287969131 54.19254403198933 0.046298980712890625 3 0.8824579950750776 3.563830792888431 2351.0 14.121022364217254 0.0 - - - - - - - 213.72727272727272 4 11 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 975 124 C20140708_OR008_05 C20140708_OR008_05 TB430415.[MT7]-LGVFSEMEANFK[MT7].3b6_1.heavy 553.96 / 777.426 7345.0 43.992401123046875 43 13 10 10 10 1.3480633448071506 58.870591198815106 0.0 3 0.926622337239771 4.5278115302864 7345.0 92.52648042134189 0.0 - - - - - - - 223.375 14 8 FIBP fibroblast growth factor (acidic) intracellular binding protein 977 124 C20140708_OR008_05 C20140708_OR008_05 TB430415.[MT7]-LGVFSEMEANFK[MT7].3b4_1.heavy 553.96 / 561.352 3573.0 43.992401123046875 43 13 10 10 10 1.3480633448071506 58.870591198815106 0.0 3 0.926622337239771 4.5278115302864 3573.0 62.43727272727273 0.0 - - - - - - - 148.83333333333334 7 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 979 124 C20140708_OR008_05 C20140708_OR008_05 TB430415.[MT7]-LGVFSEMEANFK[MT7].3b5_1.heavy 553.96 / 648.384 2382.0 43.992401123046875 43 13 10 10 10 1.3480633448071506 58.870591198815106 0.0 3 0.926622337239771 4.5278115302864 2382.0 15.97858389261745 0.0 - - - - - - - 173.75 4 4 FIBP fibroblast growth factor (acidic) intracellular binding protein 981 124 C20140708_OR008_05 C20140708_OR008_05 TB430415.[MT7]-LGVFSEMEANFK[MT7].3y4_1.heavy 553.96 / 623.363 7047.0 43.992401123046875 43 13 10 10 10 1.3480633448071506 58.870591198815106 0.0 3 0.926622337239771 4.5278115302864 7047.0 89.38812080536913 0.0 - - - - - - - 212.71428571428572 14 7 FIBP fibroblast growth factor (acidic) intracellular binding protein 983 125 C20140708_OR008_05 C20140708_OR008_05 TB430085.[MT7]-VSSQPC[CAM]TK[MT7].2y4_1.heavy 597.823 / 649.346 2092.0 16.44339942932129 46 16 10 10 10 1.3293968611336422 48.69960085564437 0.0 3 0.9614807027855774 6.267858478146422 2092.0 36.95368571428571 0.0 - - - - - - - 75.0 4 1 PIAS2 protein inhibitor of activated STAT, 2 985 125 C20140708_OR008_05 C20140708_OR008_05 TB430085.[MT7]-VSSQPC[CAM]TK[MT7].2y5_1.heavy 597.823 / 777.404 N/A 16.44339942932129 46 16 10 10 10 1.3293968611336422 48.69960085564437 0.0 3 0.9614807027855774 6.267858478146422 0.0 0.0 12.0 - - - - - - - 0.0 0 0 PIAS2 protein inhibitor of activated STAT, 2 987 125 C20140708_OR008_05 C20140708_OR008_05 TB430085.[MT7]-VSSQPC[CAM]TK[MT7].2b4_1.heavy 597.823 / 546.3 971.0 16.44339942932129 46 16 10 10 10 1.3293968611336422 48.69960085564437 0.0 3 0.9614807027855774 6.267858478146422 971.0 12.968389261744967 0.0 - - - - - - - 0.0 1 0 PIAS2 protein inhibitor of activated STAT, 2 989 125 C20140708_OR008_05 C20140708_OR008_05 TB430085.[MT7]-VSSQPC[CAM]TK[MT7].2y7_1.heavy 597.823 / 951.469 897.0 16.44339942932129 46 16 10 10 10 1.3293968611336422 48.69960085564437 0.0 3 0.9614807027855774 6.267858478146422 897.0 22.9632 0.0 - - - - - - - 0.0 1 0 PIAS2 protein inhibitor of activated STAT, 2 991 126 C20140708_OR008_05 C20140708_OR008_05 TB448841.[MT7]-HSQPATPTPLQSR.3y7_1.heavy 521.95 / 798.447 8499.0 20.77287530899048 46 20 10 6 10 14.369955144282534 6.958963963070382 0.03970146179199219 3 0.9987006835887106 34.2340178484944 8499.0 139.83822734642408 0.0 - - - - - - - 213.33333333333334 16 3 PDLIM7 PDZ and LIM domain 7 (enigma) 993 126 C20140708_OR008_05 C20140708_OR008_05 TB448841.[MT7]-HSQPATPTPLQSR.3b5_1.heavy 521.95 / 665.349 2468.0 20.77287530899048 46 20 10 6 10 14.369955144282534 6.958963963070382 0.03970146179199219 3 0.9987006835887106 34.2340178484944 2468.0 4.733202098628794 0.0 - - - - - - - 221.71428571428572 4 7 PDLIM7 PDZ and LIM domain 7 (enigma) 995 126 C20140708_OR008_05 C20140708_OR008_05 TB448841.[MT7]-HSQPATPTPLQSR.3y4_1.heavy 521.95 / 503.294 2285.0 20.77287530899048 46 20 10 6 10 14.369955144282534 6.958963963070382 0.03970146179199219 3 0.9987006835887106 34.2340178484944 2285.0 6.0558743169398905 1.0 - - - - - - - 284.44444444444446 5 9 PDLIM7 PDZ and LIM domain 7 (enigma) 997 126 C20140708_OR008_05 C20140708_OR008_05 TB448841.[MT7]-HSQPATPTPLQSR.3y5_1.heavy 521.95 / 600.346 11881.0 20.77287530899048 46 20 10 6 10 14.369955144282534 6.958963963070382 0.03970146179199219 3 0.9987006835887106 34.2340178484944 11881.0 107.9379206254238 0.0 - - - - - - - 256.0 23 5 PDLIM7 PDZ and LIM domain 7 (enigma) 999 127 C20140708_OR008_05 C20140708_OR008_05 TB438549.[MT7]-YYAFDEAFVR.2b3_1.heavy 712.852 / 542.273 11738.0 40.10070037841797 44 14 10 10 10 5.734988710197716 17.436825956114646 0.0 3 0.9362151778909262 4.86035248248939 11738.0 87.48394820690123 0.0 - - - - - - - 330.44444444444446 23 9 FIBP fibroblast growth factor (acidic) intracellular binding protein 1001 127 C20140708_OR008_05 C20140708_OR008_05 TB438549.[MT7]-YYAFDEAFVR.2y8_1.heavy 712.852 / 954.468 11886.0 40.10070037841797 44 14 10 10 10 5.734988710197716 17.436825956114646 0.0 3 0.9362151778909262 4.86035248248939 11886.0 109.0134187512711 0.0 - - - - - - - 186.0 23 4 FIBP fibroblast growth factor (acidic) intracellular binding protein 1003 127 C20140708_OR008_05 C20140708_OR008_05 TB438549.[MT7]-YYAFDEAFVR.2y5_1.heavy 712.852 / 621.336 9212.0 40.10070037841797 44 14 10 10 10 5.734988710197716 17.436825956114646 0.0 3 0.9362151778909262 4.86035248248939 9212.0 30.237519974967555 1.0 - - - - - - - 223.0 23 4 FIBP fibroblast growth factor (acidic) intracellular binding protein 1005 127 C20140708_OR008_05 C20140708_OR008_05 TB438549.[MT7]-YYAFDEAFVR.2y9_1.heavy 712.852 / 1117.53 18127.0 40.10070037841797 44 14 10 10 10 5.734988710197716 17.436825956114646 0.0 3 0.9362151778909262 4.86035248248939 18127.0 85.7523063973064 0.0 - - - - - - - 272.5 36 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 1007 128 C20140708_OR008_05 C20140708_OR008_05 TB448520.[MT7]-TSTVLTR.2y5_1.heavy 461.278 / 589.367 2379.0 20.841449737548828 38 12 10 6 10 2.0530233950324472 48.70865097882606 0.037700653076171875 3 0.8828342298255041 3.5696651517980085 2379.0 4.029999999999999 0.0 - - - - - - - 194.875 4 8 PDLIM7 PDZ and LIM domain 7 (enigma) 1009 128 C20140708_OR008_05 C20140708_OR008_05 TB448520.[MT7]-TSTVLTR.2b4_1.heavy 461.278 / 533.305 1922.0 20.841449737548828 38 12 10 6 10 2.0530233950324472 48.70865097882606 0.037700653076171875 3 0.8828342298255041 3.5696651517980085 1922.0 14.237393752833656 0.0 - - - - - - - 201.7 3 10 PDLIM7 PDZ and LIM domain 7 (enigma) 1011 128 C20140708_OR008_05 C20140708_OR008_05 TB448520.[MT7]-TSTVLTR.2y6_1.heavy 461.278 / 676.399 3386.0 20.841449737548828 38 12 10 6 10 2.0530233950324472 48.70865097882606 0.037700653076171875 3 0.8828342298255041 3.5696651517980085 3386.0 44.57474940711462 0.0 - - - - - - - 183.42857142857142 6 7 PDLIM7 PDZ and LIM domain 7 (enigma) 1013 128 C20140708_OR008_05 C20140708_OR008_05 TB448520.[MT7]-TSTVLTR.2b5_1.heavy 461.278 / 646.389 2379.0 20.841449737548828 38 12 10 6 10 2.0530233950324472 48.70865097882606 0.037700653076171875 3 0.8828342298255041 3.5696651517980085 2379.0 29.49923865578128 0.0 - - - - - - - 183.25 4 8 PDLIM7 PDZ and LIM domain 7 (enigma) 1015 129 C20140708_OR008_05 C20140708_OR008_05 TB448522.[MT7]-NQELQR.2y4_1.heavy 466.258 / 545.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA2;PPFIA1;PPFIA3 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 2;protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1;protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3 1017 129 C20140708_OR008_05 C20140708_OR008_05 TB448522.[MT7]-NQELQR.2b3_1.heavy 466.258 / 516.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA2;PPFIA1;PPFIA3 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 2;protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1;protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3 1019 129 C20140708_OR008_05 C20140708_OR008_05 TB448522.[MT7]-NQELQR.2y5_1.heavy 466.258 / 673.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA2;PPFIA1;PPFIA3 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 2;protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1;protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3 1021 129 C20140708_OR008_05 C20140708_OR008_05 TB448522.[MT7]-NQELQR.2b4_1.heavy 466.258 / 629.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA2;PPFIA1;PPFIA3 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 2;protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1;protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3 1023 130 C20140708_OR008_05 C20140708_OR008_05 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 14410.0 22.613399505615234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 14410.0 174.26823513366065 0.0 - - - - - - - 265.3333333333333 28 6 1025 130 C20140708_OR008_05 C20140708_OR008_05 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 17779.0 22.613399505615234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 17779.0 222.41450108089657 0.0 - - - - - - - 249.33333333333334 35 3 1027 130 C20140708_OR008_05 C20140708_OR008_05 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 56986.0 22.613399505615234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 56986.0 659.4919864784251 0.0 - - - - - - - 358.6666666666667 113 6 1029 131 C20140708_OR008_05 C20140708_OR008_05 TB448941.[MT7]-LAEGEQILSGGVFNK[MT7].2y8_1.heavy 925.517 / 965.554 5210.0 39.28580093383789 40 10 10 10 10 0.720580704087914 79.61354108985597 0.0 3 0.8253896979504278 2.909346561472395 5210.0 20.994587751676658 0.0 - - - - - - - 229.5 10 2 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1031 131 C20140708_OR008_05 C20140708_OR008_05 TB448941.[MT7]-LAEGEQILSGGVFNK[MT7].2y3_1.heavy 925.517 / 552.326 3984.0 39.28580093383789 40 10 10 10 10 0.720580704087914 79.61354108985597 0.0 3 0.8253896979504278 2.909346561472395 3984.0 51.87011764705882 0.0 - - - - - - - 153.0 7 2 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1033 131 C20140708_OR008_05 C20140708_OR008_05 TB448941.[MT7]-LAEGEQILSGGVFNK[MT7].2b6_1.heavy 925.517 / 772.396 2298.0 39.28580093383789 40 10 10 10 10 0.720580704087914 79.61354108985597 0.0 3 0.8253896979504278 2.909346561472395 2298.0 8.630761603173081 0.0 - - - - - - - 306.0 4 2 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1035 131 C20140708_OR008_05 C20140708_OR008_05 TB448941.[MT7]-LAEGEQILSGGVFNK[MT7].2b5_1.heavy 925.517 / 644.337 1685.0 39.28580093383789 40 10 10 10 10 0.720580704087914 79.61354108985597 0.0 3 0.8253896979504278 2.909346561472395 1685.0 16.134150326797386 0.0 - - - - - - - 204.0 3 3 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1037 132 C20140708_OR008_05 C20140708_OR008_05 TB430071.[MT7]-C[CAM]C[CAM]VDLSK[MT7].2b3_1.heavy 585.298 / 564.239 1227.0 23.458200454711914 38 18 0 10 10 4.174938898370147 19.035508583192545 0.0 3 0.9879812721948308 11.245976873657565 1227.0 6.54150635971828 9.0 - - - - - - - 224.92307692307693 20 13 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1039 132 C20140708_OR008_05 C20140708_OR008_05 TB430071.[MT7]-C[CAM]C[CAM]VDLSK[MT7].2y4_1.heavy 585.298 / 606.358 1510.0 23.458200454711914 38 18 0 10 10 4.174938898370147 19.035508583192545 0.0 3 0.9879812721948308 11.245976873657565 1510.0 14.86031746031746 0.0 - - - - - - - 220.33333333333334 3 6 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1041 132 C20140708_OR008_05 C20140708_OR008_05 TB430071.[MT7]-C[CAM]C[CAM]VDLSK[MT7].2b4_1.heavy 585.298 / 679.266 2453.0 23.458200454711914 38 18 0 10 10 4.174938898370147 19.035508583192545 0.0 3 0.9879812721948308 11.245976873657565 2453.0 41.7531914893617 0.0 - - - - - - - 202.14285714285714 4 7 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1043 132 C20140708_OR008_05 C20140708_OR008_05 TB430071.[MT7]-C[CAM]C[CAM]VDLSK[MT7].2y6_1.heavy 585.298 / 865.457 1982.0 23.458200454711914 38 18 0 10 10 4.174938898370147 19.035508583192545 0.0 3 0.9879812721948308 11.245976873657565 1982.0 20.916425531914893 0.0 - - - - - - - 220.0 3 6 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1045 133 C20140708_OR008_05 C20140708_OR008_05 TB438271.[MT7]-VVEEMR.2y4_1.heavy 453.745 / 564.245 3491.0 22.951650619506836 44 18 10 6 10 4.688876820519424 21.327069110107743 0.035400390625 3 0.98553214015774 10.247908040287678 3491.0 42.05945041726186 0.0 - - - - - - - 188.57142857142858 6 7 FIBP fibroblast growth factor (acidic) intracellular binding protein 1047 133 C20140708_OR008_05 C20140708_OR008_05 TB438271.[MT7]-VVEEMR.2b3_1.heavy 453.745 / 472.289 4624.0 22.951650619506836 44 18 10 6 10 4.688876820519424 21.327069110107743 0.035400390625 3 0.98553214015774 10.247908040287678 4624.0 11.763727914400036 0.0 - - - - - - - 226.3 9 10 FIBP fibroblast growth factor (acidic) intracellular binding protein 1049 133 C20140708_OR008_05 C20140708_OR008_05 TB438271.[MT7]-VVEEMR.2y5_1.heavy 453.745 / 663.313 11323.0 22.951650619506836 44 18 10 6 10 4.688876820519424 21.327069110107743 0.035400390625 3 0.98553214015774 10.247908040287678 11323.0 224.05085106382978 0.0 - - - - - - - 109.83333333333333 22 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 1051 133 C20140708_OR008_05 C20140708_OR008_05 TB438271.[MT7]-VVEEMR.2b4_1.heavy 453.745 / 601.331 6322.0 22.951650619506836 44 18 10 6 10 4.688876820519424 21.327069110107743 0.035400390625 3 0.98553214015774 10.247908040287678 6322.0 73.95032671323268 0.0 - - - - - - - 207.2 12 5 FIBP fibroblast growth factor (acidic) intracellular binding protein 1053 134 C20140708_OR008_05 C20140708_OR008_05 TB430171.[MT7]-QLTSAMLLQR.3b4_1.heavy 435.587 / 574.332 1767.0 34.572248458862305 35 13 9 5 8 1.4307133620381258 56.81051041570223 0.041500091552734375 4 0.9130706240850212 4.155101471465483 1767.0 15.297465139902114 0.0 - - - - - - - 257.5 3 4 PIAS2 protein inhibitor of activated STAT, 2 1055 134 C20140708_OR008_05 C20140708_OR008_05 TB430171.[MT7]-QLTSAMLLQR.3b5_1.heavy 435.587 / 645.369 1031.0 34.572248458862305 35 13 9 5 8 1.4307133620381258 56.81051041570223 0.041500091552734375 4 0.9130706240850212 4.155101471465483 1031.0 12.624489795918368 0.0 - - - - - - - 220.5 2 2 PIAS2 protein inhibitor of activated STAT, 2 1057 134 C20140708_OR008_05 C20140708_OR008_05 TB430171.[MT7]-QLTSAMLLQR.3y4_1.heavy 435.587 / 529.346 1914.0 34.572248458862305 35 13 9 5 8 1.4307133620381258 56.81051041570223 0.041500091552734375 4 0.9130706240850212 4.155101471465483 1914.0 13.180757320319433 1.0 - - - - - - - 294.3333333333333 4 3 PIAS2 protein inhibitor of activated STAT, 2 1059 134 C20140708_OR008_05 C20140708_OR008_05 TB430171.[MT7]-QLTSAMLLQR.3y5_1.heavy 435.587 / 660.386 589.0 34.572248458862305 35 13 9 5 8 1.4307133620381258 56.81051041570223 0.041500091552734375 4 0.9130706240850212 4.155101471465483 589.0 3.846312851227448 1.0 - - - - - - - 0.0 1 0 PIAS2 protein inhibitor of activated STAT, 2 1061 135 C20140708_OR008_05 C20140708_OR008_05 TB438920.[MT7]-LEDLPTVEAPGDPQEPQNNAHRDK[MT7].4y12_2.heavy 740.375 / 789.399 4086.0 30.18155002593994 41 15 10 6 10 2.1289550936868618 40.13756054778716 0.03830146789550781 3 0.9556354919457968 5.837484069772398 4086.0 11.711464968152868 1.0 - - - - - - - 209.625 8 8 CA9 carbonic anhydrase IX 1063 135 C20140708_OR008_05 C20140708_OR008_05 TB438920.[MT7]-LEDLPTVEAPGDPQEPQNNAHRDK[MT7].4y9_1.heavy 740.375 / 1223.64 1781.0 30.18155002593994 41 15 10 6 10 2.1289550936868618 40.13756054778716 0.03830146789550781 3 0.9556354919457968 5.837484069772398 1781.0 23.66185714285714 0.0 - - - - - - - 167.8 3 10 CA9 carbonic anhydrase IX 1065 135 C20140708_OR008_05 C20140708_OR008_05 TB438920.[MT7]-LEDLPTVEAPGDPQEPQNNAHRDK[MT7].4b4_1.heavy 740.375 / 615.347 7334.0 30.18155002593994 41 15 10 6 10 2.1289550936868618 40.13756054778716 0.03830146789550781 3 0.9556354919457968 5.837484069772398 7334.0 36.62970525599261 0.0 - - - - - - - 251.6 14 5 CA9 carbonic anhydrase IX 1067 135 C20140708_OR008_05 C20140708_OR008_05 TB438920.[MT7]-LEDLPTVEAPGDPQEPQNNAHRDK[MT7].4b3_1.heavy 740.375 / 502.263 5553.0 30.18155002593994 41 15 10 6 10 2.1289550936868618 40.13756054778716 0.03830146789550781 3 0.9556354919457968 5.837484069772398 5553.0 17.07543307332618 0.0 - - - - - - - 251.4 11 10 CA9 carbonic anhydrase IX 1069 136 C20140708_OR008_05 C20140708_OR008_05 TB430362.[MT7]-TLEGLSDLSTIK[MT7].2y4_1.heavy 782.955 / 592.379 1251.0 40.37770080566406 39 11 10 10 8 1.6473756660534447 60.70260843391368 0.0 4 0.8767939128510759 3.479229103649313 1251.0 15.477115384615384 2.0 - - - - - - - 312.6666666666667 2 9 PIAS2 protein inhibitor of activated STAT, 2 1071 136 C20140708_OR008_05 C20140708_OR008_05 TB430362.[MT7]-TLEGLSDLSTIK[MT7].2b4_1.heavy 782.955 / 545.305 7347.0 40.37770080566406 39 11 10 10 8 1.6473756660534447 60.70260843391368 0.0 4 0.8767939128510759 3.479229103649313 7347.0 9.22822703313225 1.0 - - - - - - - 312.57142857142856 17 7 PIAS2 protein inhibitor of activated STAT, 2 1073 136 C20140708_OR008_05 C20140708_OR008_05 TB430362.[MT7]-TLEGLSDLSTIK[MT7].2b7_1.heavy 782.955 / 860.448 4220.0 40.37770080566406 39 11 10 10 8 1.6473756660534447 60.70260843391368 0.0 4 0.8767939128510759 3.479229103649313 4220.0 39.37352994183665 0.0 - - - - - - - 223.28571428571428 8 7 PIAS2 protein inhibitor of activated STAT, 2 1075 136 C20140708_OR008_05 C20140708_OR008_05 TB430362.[MT7]-TLEGLSDLSTIK[MT7].2y7_1.heavy 782.955 / 907.522 938.0 40.37770080566406 39 11 10 10 8 1.6473756660534447 60.70260843391368 0.0 4 0.8767939128510759 3.479229103649313 938.0 4.347525111821087 2.0 - - - - - - - 273.75 5 4 PIAS2 protein inhibitor of activated STAT, 2 1077 137 C20140708_OR008_05 C20140708_OR008_05 TB430363.[MT7]-SSTEAGGEVQTSK[MT7].2y4_1.heavy 784.904 / 607.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 1079 137 C20140708_OR008_05 C20140708_OR008_05 TB430363.[MT7]-SSTEAGGEVQTSK[MT7].2y8_1.heavy 784.904 / 949.507 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 1081 137 C20140708_OR008_05 C20140708_OR008_05 TB430363.[MT7]-SSTEAGGEVQTSK[MT7].2y9_1.heavy 784.904 / 1020.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 1083 137 C20140708_OR008_05 C20140708_OR008_05 TB430363.[MT7]-SSTEAGGEVQTSK[MT7].2b4_1.heavy 784.904 / 549.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 1085 138 C20140708_OR008_05 C20140708_OR008_05 TB438922.[MT7]-NLPFYDVLDVLIK[MT7]PTSLVQSSIQR.4y5_1.heavy 759.186 / 590.326 1799.0 54.71039962768555 45 18 10 7 10 4.697573808586349 16.854696398826288 0.0204010009765625 3 0.9824937351612841 9.313866451970123 1799.0 0.0 0.0 - - - - - - - 101.35483870967742 3 31 PIAS2 protein inhibitor of activated STAT, 2 1087 138 C20140708_OR008_05 C20140708_OR008_05 TB438922.[MT7]-NLPFYDVLDVLIK[MT7]PTSLVQSSIQR.4b4_1.heavy 759.186 / 616.357 2290.0 54.71039962768555 45 18 10 7 10 4.697573808586349 16.854696398826288 0.0204010009765625 3 0.9824937351612841 9.313866451970123 2290.0 6.992366412213741 0.0 - - - - - - - 93.52380952380952 4 21 PIAS2 protein inhibitor of activated STAT, 2 1089 138 C20140708_OR008_05 C20140708_OR008_05 TB438922.[MT7]-NLPFYDVLDVLIK[MT7]PTSLVQSSIQR.4y11_1.heavy 759.186 / 1215.67 3239.0 54.71039962768555 45 18 10 7 10 4.697573808586349 16.854696398826288 0.0204010009765625 3 0.9824937351612841 9.313866451970123 3239.0 65.50111317254175 0.0 - - - - - - - 93.68181818181819 6 22 PIAS2 protein inhibitor of activated STAT, 2 1091 138 C20140708_OR008_05 C20140708_OR008_05 TB438922.[MT7]-NLPFYDVLDVLIK[MT7]PTSLVQSSIQR.4b6_1.heavy 759.186 / 894.448 3501.0 54.71039962768555 45 18 10 7 10 4.697573808586349 16.854696398826288 0.0204010009765625 3 0.9824937351612841 9.313866451970123 3501.0 4.269512195121952 0.0 - - - - - - - 78.34782608695652 7 23 PIAS2 protein inhibitor of activated STAT, 2 1093 139 C20140708_OR008_05 C20140708_OR008_05 TB448619.[MT7]-SAAENAEK[MT7].2y4_1.heavy 554.298 / 605.338 3722.0 14.348350286483765 43 17 10 6 10 5.8541331851937 17.081948229828534 0.035399436950683594 3 0.978869470941062 8.474995280703249 3722.0 155.1214574187884 0.0 - - - - - - - 107.6 7 10 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1095 139 C20140708_OR008_05 C20140708_OR008_05 TB448619.[MT7]-SAAENAEK[MT7].2y5_1.heavy 554.298 / 734.38 1408.0 14.348350286483765 43 17 10 6 10 5.8541331851937 17.081948229828534 0.035399436950683594 3 0.978869470941062 8.474995280703249 1408.0 28.159999999999997 0.0 - - - - - - - 76.36363636363636 2 11 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1097 139 C20140708_OR008_05 C20140708_OR008_05 TB448619.[MT7]-SAAENAEK[MT7].2b5_1.heavy 554.298 / 617.301 1911.0 14.348350286483765 43 17 10 6 10 5.8541331851937 17.081948229828534 0.035399436950683594 3 0.978869470941062 8.474995280703249 1911.0 21.39179104477612 0.0 - - - - - - - 98.94444444444444 3 18 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1099 139 C20140708_OR008_05 C20140708_OR008_05 TB448619.[MT7]-SAAENAEK[MT7].2y7_1.heavy 554.298 / 876.454 3085.0 14.348350286483765 43 17 10 6 10 5.8541331851937 17.081948229828534 0.035399436950683594 3 0.978869470941062 8.474995280703249 3085.0 63.81093372423596 0.0 - - - - - - - 107.4 6 10 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1101 140 C20140708_OR008_05 C20140708_OR008_05 TB430076.[MT7]-LGTSSDTVQQ.2b3_1.heavy 590.302 / 416.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIAS2 protein inhibitor of activated STAT, 2 1103 140 C20140708_OR008_05 C20140708_OR008_05 TB430076.[MT7]-LGTSSDTVQQ.2b4_1.heavy 590.302 / 503.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIAS2 protein inhibitor of activated STAT, 2 1105 140 C20140708_OR008_05 C20140708_OR008_05 TB430076.[MT7]-LGTSSDTVQQ.2b6_1.heavy 590.302 / 705.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIAS2 protein inhibitor of activated STAT, 2 1107 140 C20140708_OR008_05 C20140708_OR008_05 TB430076.[MT7]-LGTSSDTVQQ.2b7_1.heavy 590.302 / 806.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIAS2 protein inhibitor of activated STAT, 2 1109 141 C20140708_OR008_05 C20140708_OR008_05 TB448838.[MT7]-QTVLEALQQLIR.3b6_1.heavy 519.314 / 786.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1111 141 C20140708_OR008_05 C20140708_OR008_05 TB448838.[MT7]-QTVLEALQQLIR.3b4_1.heavy 519.314 / 586.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1113 141 C20140708_OR008_05 C20140708_OR008_05 TB448838.[MT7]-QTVLEALQQLIR.3b5_1.heavy 519.314 / 715.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1115 141 C20140708_OR008_05 C20140708_OR008_05 TB448838.[MT7]-QTVLEALQQLIR.3y5_1.heavy 519.314 / 657.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1117 142 C20140708_OR008_05 C20140708_OR008_05 TB430424.[MT7]-GLEDGEAGEEEEK[MT7].3b6_1.heavy 560.6 / 745.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGCR14 DiGeorge syndrome critical region gene 14 1119 142 C20140708_OR008_05 C20140708_OR008_05 TB430424.[MT7]-GLEDGEAGEEEEK[MT7].3b4_1.heavy 560.6 / 559.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGCR14 DiGeorge syndrome critical region gene 14 1121 142 C20140708_OR008_05 C20140708_OR008_05 TB430424.[MT7]-GLEDGEAGEEEEK[MT7].3b5_1.heavy 560.6 / 616.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGCR14 DiGeorge syndrome critical region gene 14 1123 142 C20140708_OR008_05 C20140708_OR008_05 TB430424.[MT7]-GLEDGEAGEEEEK[MT7].3b8_1.heavy 560.6 / 873.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGCR14 DiGeorge syndrome critical region gene 14 1125 143 C20140708_OR008_05 C20140708_OR008_05 TB438538.[MT7]-ITGEIMHALK[MT7].3y3_1.heavy 467.611 / 475.336 19605.0 35.84980010986328 48 18 10 10 10 2.972822200486365 28.684101490468237 0.0 3 0.9805239217128804 8.828851676569704 19605.0 129.37979797979798 0.0 - - - - - - - 208.2 39 5 PDLIM7 PDZ and LIM domain 7 (enigma) 1127 143 C20140708_OR008_05 C20140708_OR008_05 TB438538.[MT7]-ITGEIMHALK[MT7].3b4_1.heavy 467.611 / 545.305 19159.0 35.84980010986328 48 18 10 10 10 2.972822200486365 28.684101490468237 0.0 3 0.9805239217128804 8.828851676569704 19159.0 159.22539093394798 0.0 - - - - - - - 297.25 38 4 PDLIM7 PDZ and LIM domain 7 (enigma) 1129 143 C20140708_OR008_05 C20140708_OR008_05 TB438538.[MT7]-ITGEIMHALK[MT7].3b5_1.heavy 467.611 / 658.389 8466.0 35.84980010986328 48 18 10 10 10 2.972822200486365 28.684101490468237 0.0 3 0.9805239217128804 8.828851676569704 8466.0 69.96711902970476 0.0 - - - - - - - 347.0 16 3 PDLIM7 PDZ and LIM domain 7 (enigma) 1131 143 C20140708_OR008_05 C20140708_OR008_05 TB438538.[MT7]-ITGEIMHALK[MT7].3y4_1.heavy 467.611 / 612.395 5050.0 35.84980010986328 48 18 10 10 10 2.972822200486365 28.684101490468237 0.0 3 0.9805239217128804 8.828851676569704 5050.0 44.09463765168463 0.0 - - - - - - - 247.66666666666666 10 3 PDLIM7 PDZ and LIM domain 7 (enigma) 1133 144 C20140708_OR008_05 C20140708_OR008_05 TB430224.[MT7]-DLFVDLVEK[MT7].2b3_1.heavy 683.397 / 520.289 7482.0 42.972450256347656 42 20 9 5 8 4.312727596520411 18.430111184318626 0.0478973388671875 4 0.9937668098053963 15.623608056807969 7482.0 25.555218216318785 1.0 - - - - - - - 210.6 17 5 FIBP fibroblast growth factor (acidic) intracellular binding protein 1135 144 C20140708_OR008_05 C20140708_OR008_05 TB430224.[MT7]-DLFVDLVEK[MT7].2y5_1.heavy 683.397 / 747.437 4637.0 42.972450256347656 42 20 9 5 8 4.312727596520411 18.430111184318626 0.0478973388671875 4 0.9937668098053963 15.623608056807969 4637.0 17.808311824959308 0.0 - - - - - - - 298.5 9 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 1137 144 C20140708_OR008_05 C20140708_OR008_05 TB430224.[MT7]-DLFVDLVEK[MT7].2y6_1.heavy 683.397 / 846.505 5058.0 42.972450256347656 42 20 9 5 8 4.312727596520411 18.430111184318626 0.0478973388671875 4 0.9937668098053963 15.623608056807969 5058.0 34.986497630331755 0.0 - - - - - - - 281.1111111111111 10 9 FIBP fibroblast growth factor (acidic) intracellular binding protein 1139 144 C20140708_OR008_05 C20140708_OR008_05 TB430224.[MT7]-DLFVDLVEK[MT7].2b5_1.heavy 683.397 / 734.384 4742.0 42.972450256347656 42 20 9 5 8 4.312727596520411 18.430111184318626 0.0478973388671875 4 0.9937668098053963 15.623608056807969 4742.0 23.618627875601064 0.0 - - - - - - - 333.8333333333333 9 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 1141 145 C20140708_OR008_05 C20140708_OR008_05 TB438401.[MT7]-LLGHQVGHR.2y8_1.heavy 580.842 / 903.491 1466.0 19.45015001296997 36 18 4 6 8 6.590445223288203 15.173481701454234 0.03660011291503906 4 0.9866584719741678 10.672730718224834 1466.0 26.770434782608696 0.0 - - - - - - - 183.4 2 5 CABP1 calcium binding protein 1 1143 145 C20140708_OR008_05 C20140708_OR008_05 TB438401.[MT7]-LLGHQVGHR.2y5_1.heavy 580.842 / 596.326 641.0 19.45015001296997 36 18 4 6 8 6.590445223288203 15.173481701454234 0.03660011291503906 4 0.9866584719741678 10.672730718224834 641.0 2.097818181818182 6.0 - - - - - - - 0.0 1 0 CABP1 calcium binding protein 1 1145 145 C20140708_OR008_05 C20140708_OR008_05 TB438401.[MT7]-LLGHQVGHR.2y6_1.heavy 580.842 / 733.385 641.0 19.45015001296997 36 18 4 6 8 6.590445223288203 15.173481701454234 0.03660011291503906 4 0.9866584719741678 10.672730718224834 641.0 3.257540983606557 1.0 - - - - - - - 183.28571428571428 4 7 CABP1 calcium binding protein 1 1147 145 C20140708_OR008_05 C20140708_OR008_05 TB438401.[MT7]-LLGHQVGHR.2y7_1.heavy 580.842 / 790.407 1466.0 19.45015001296997 36 18 4 6 8 6.590445223288203 15.173481701454234 0.03660011291503906 4 0.9866584719741678 10.672730718224834 1466.0 11.342018877297566 1.0 - - - - - - - 206.25 4 8 CABP1 calcium binding protein 1 1149 146 C20140708_OR008_05 C20140708_OR008_05 TB430226.[MT7]-DLFVDLVEK[MT7].3y3_1.heavy 455.934 / 519.326 4963.0 42.94850158691406 41 11 10 10 10 0.8207073992973307 72.75010681359225 0.0 3 0.8603578567039287 3.2633653436820915 4963.0 42.338388625592415 0.0 - - - - - - - 237.5 9 4 FIBP fibroblast growth factor (acidic) intracellular binding protein 1151 146 C20140708_OR008_05 C20140708_OR008_05 TB430226.[MT7]-DLFVDLVEK[MT7].3b4_1.heavy 455.934 / 619.357 2217.0 42.94850158691406 41 11 10 10 10 0.8207073992973307 72.75010681359225 0.0 3 0.8603578567039287 3.2633653436820915 2217.0 21.01421800947867 0.0 - - - - - - - 528.0 4 2 FIBP fibroblast growth factor (acidic) intracellular binding protein 1153 146 C20140708_OR008_05 C20140708_OR008_05 TB430226.[MT7]-DLFVDLVEK[MT7].3b5_1.heavy 455.934 / 734.384 3801.0 42.94850158691406 41 11 10 10 10 0.8207073992973307 72.75010681359225 0.0 3 0.8603578567039287 3.2633653436820915 3801.0 12.709968454258673 0.0 - - - - - - - 317.0 7 2 FIBP fibroblast growth factor (acidic) intracellular binding protein 1155 146 C20140708_OR008_05 C20140708_OR008_05 TB430226.[MT7]-DLFVDLVEK[MT7].3b3_1.heavy 455.934 / 520.289 6969.0 42.94850158691406 41 11 10 10 10 0.8207073992973307 72.75010681359225 0.0 3 0.8603578567039287 3.2633653436820915 6969.0 50.50224991403412 0.0 - - - - - - - 316.6666666666667 13 3 FIBP fibroblast growth factor (acidic) intracellular binding protein 1157 147 C20140708_OR008_05 C20140708_OR008_05 TB430367.[MT7]-VLQGGEQEIQFEDFTNTLR.3y6_1.heavy 790.068 / 751.41 4078.0 42.69409942626953 41 16 10 5 10 3.687870204830582 27.11592177756536 0.0449981689453125 3 0.9669094694393435 6.765588603168399 4078.0 43.73620428658377 0.0 - - - - - - - 288.6666666666667 8 3 PKD2L1 polycystic kidney disease 2-like 1 1159 147 C20140708_OR008_05 C20140708_OR008_05 TB430367.[MT7]-VLQGGEQEIQFEDFTNTLR.3b6_1.heavy 790.068 / 728.406 3460.0 42.69409942626953 41 16 10 5 10 3.687870204830582 27.11592177756536 0.0449981689453125 3 0.9669094694393435 6.765588603168399 3460.0 12.840755735492577 0.0 - - - - - - - 206.0 6 6 PKD2L1 polycystic kidney disease 2-like 1 1161 147 C20140708_OR008_05 C20140708_OR008_05 TB430367.[MT7]-VLQGGEQEIQFEDFTNTLR.3b8_1.heavy 790.068 / 985.507 6673.0 42.69409942626953 41 16 10 5 10 3.687870204830582 27.11592177756536 0.0449981689453125 3 0.9669094694393435 6.765588603168399 6673.0 41.60493927125506 0.0 - - - - - - - 185.6 13 10 PKD2L1 polycystic kidney disease 2-like 1 1163 147 C20140708_OR008_05 C20140708_OR008_05 TB430367.[MT7]-VLQGGEQEIQFEDFTNTLR.3y9_1.heavy 790.068 / 1142.55 6673.0 42.69409942626953 41 16 10 5 10 3.687870204830582 27.11592177756536 0.0449981689453125 3 0.9669094694393435 6.765588603168399 6673.0 34.896791989308596 0.0 - - - - - - - 206.11111111111111 13 9 PKD2L1 polycystic kidney disease 2-like 1 1165 148 C20140708_OR008_05 C20140708_OR008_05 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 93104.0 32.198299407958984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 93104.0 422.3836985192856 0.0 - - - - - - - 293.25 186 8 1167 148 C20140708_OR008_05 C20140708_OR008_05 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 110811.0 32.198299407958984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 110811.0 316.2001228435743 0.0 - - - - - - - 234.5 221 10 1169 148 C20140708_OR008_05 C20140708_OR008_05 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 206847.0 32.198299407958984 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 206847.0 595.2590012161751 0.0 - - - - - - - 268.2857142857143 413 7 1171 149 C20140708_OR008_05 C20140708_OR008_05 TB430369.[MT7]-MDLADLTEQQK[MT7].2b3_1.heavy 790.416 / 504.261 2562.0 34.5099983215332 38 18 0 10 10 6.835770024465564 14.628929826792735 0.0 3 0.9892593007234574 11.89752441247467 2562.0 5.498424862940931 1.0 - - - - - - - 213.375 46 8 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1173 149 C20140708_OR008_05 C20140708_OR008_05 TB430369.[MT7]-MDLADLTEQQK[MT7].2b4_1.heavy 790.416 / 575.298 2989.0 34.5099983215332 38 18 0 10 10 6.835770024465564 14.628929826792735 0.0 3 0.9892593007234574 11.89752441247467 2989.0 10.856953313925729 0.0 - - - - - - - 341.8 5 5 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1175 149 C20140708_OR008_05 C20140708_OR008_05 TB430369.[MT7]-MDLADLTEQQK[MT7].2y6_1.heavy 790.416 / 890.506 3131.0 34.5099983215332 38 18 0 10 10 6.835770024465564 14.628929826792735 0.0 3 0.9892593007234574 11.89752441247467 3131.0 33.03526068692859 0.0 - - - - - - - 237.33333333333334 6 3 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1177 149 C20140708_OR008_05 C20140708_OR008_05 TB430369.[MT7]-MDLADLTEQQK[MT7].2b5_1.heavy 790.416 / 690.325 5550.0 34.5099983215332 38 18 0 10 10 6.835770024465564 14.628929826792735 0.0 3 0.9892593007234574 11.89752441247467 5550.0 19.761008877894987 0.0 - - - - - - - 264.2857142857143 11 7 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1179 150 C20140708_OR008_05 C20140708_OR008_05 TB448931.[MT7]-LNLEEFQQLYVK[MT7].3b6_1.heavy 604.676 / 890.474 5114.0 43.42279815673828 42 12 10 10 10 1.0074774484368048 58.551968592360694 0.0 3 0.8920715557338004 3.722276910928514 5114.0 0.0 0.0 - - - - - - - 219.0 10 2 VSNL1 visinin-like 1 1181 150 C20140708_OR008_05 C20140708_OR008_05 TB448931.[MT7]-LNLEEFQQLYVK[MT7].3y3_1.heavy 604.676 / 553.347 29517.0 43.42279815673828 42 12 10 10 10 1.0074774484368048 58.551968592360694 0.0 3 0.8920715557338004 3.722276910928514 29517.0 -8.086849315068491 0.0 - - - - - - - 350.4 59 5 VSNL1 visinin-like 1 1183 150 C20140708_OR008_05 C20140708_OR008_05 TB448931.[MT7]-LNLEEFQQLYVK[MT7].3b4_1.heavy 604.676 / 614.363 9644.0 43.42279815673828 42 12 10 10 10 1.0074774484368048 58.551968592360694 0.0 3 0.8920715557338004 3.722276910928514 9644.0 -1.099971485600228 1.0 - - - - - - - 292.0 21 4 VSNL1 visinin-like 1 1185 150 C20140708_OR008_05 C20140708_OR008_05 TB448931.[MT7]-LNLEEFQQLYVK[MT7].3b5_1.heavy 604.676 / 743.406 19435.0 43.42279815673828 42 12 10 10 10 1.0074774484368048 58.551968592360694 0.0 3 0.8920715557338004 3.722276910928514 19435.0 -0.13311643835615428 0.0 - - - - - - - 219.0 38 2 VSNL1 visinin-like 1 1187 151 C20140708_OR008_05 C20140708_OR008_05 TB448515.[MT7]-SLPASHR.2y4_1.heavy 456.263 / 470.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 1189 151 C20140708_OR008_05 C20140708_OR008_05 TB448515.[MT7]-SLPASHR.2y5_1.heavy 456.263 / 567.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 1191 151 C20140708_OR008_05 C20140708_OR008_05 TB448515.[MT7]-SLPASHR.2b4_1.heavy 456.263 / 513.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 1193 151 C20140708_OR008_05 C20140708_OR008_05 TB448515.[MT7]-SLPASHR.2y6_1.heavy 456.263 / 680.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 1195 152 C20140708_OR008_05 C20140708_OR008_05 TB438621.[MT7]-TLEGLSDLSTIK[MT7].3y3_1.heavy 522.306 / 505.347 7213.0 37.97679901123047 36 14 2 10 10 1.5085251494199758 46.05244459636819 0.0 3 0.9484479302034937 5.411973937591207 7213.0 15.946596810400198 3.0 - - - - - - - 255.0 77 8 PIAS2 protein inhibitor of activated STAT, 2 1197 152 C20140708_OR008_05 C20140708_OR008_05 TB438621.[MT7]-TLEGLSDLSTIK[MT7].3b4_1.heavy 522.306 / 545.305 11290.0 37.97679901123047 36 14 2 10 10 1.5085251494199758 46.05244459636819 0.0 3 0.9484479302034937 5.411973937591207 11290.0 51.80274840256403 0.0 - - - - - - - 313.6666666666667 22 6 PIAS2 protein inhibitor of activated STAT, 2 1199 152 C20140708_OR008_05 C20140708_OR008_05 TB438621.[MT7]-TLEGLSDLSTIK[MT7].3y4_1.heavy 522.306 / 592.379 13171.0 37.97679901123047 36 14 2 10 10 1.5085251494199758 46.05244459636819 0.0 3 0.9484479302034937 5.411973937591207 13171.0 36.53009409888357 0.0 - - - - - - - 336.0 26 7 PIAS2 protein inhibitor of activated STAT, 2 1201 152 C20140708_OR008_05 C20140708_OR008_05 TB438621.[MT7]-TLEGLSDLSTIK[MT7].3b7_1.heavy 522.306 / 860.448 7840.0 37.97679901123047 36 14 2 10 10 1.5085251494199758 46.05244459636819 0.0 3 0.9484479302034937 5.411973937591207 7840.0 28.357446808510637 0.0 - - - - - - - 313.5 15 4 PIAS2 protein inhibitor of activated STAT, 2 1203 153 C20140708_OR008_05 C20140708_OR008_05 TB438939.[MT7]-GTGK[MT7]PGALSGSADGQLSVLQPNTINVLAEK[MT7].4y4_1.heavy 839.47 / 604.379 1867.0 38.8302001953125 41 11 10 10 10 1.3891618385110103 47.99056871453087 0.0 3 0.8661287067417941 3.3346493822615297 1867.0 3.0916559485530546 0.0 - - - - - - - 272.5 3 4 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1205 153 C20140708_OR008_05 C20140708_OR008_05 TB438939.[MT7]-GTGK[MT7]PGALSGSADGQLSVLQPNTINVLAEK[MT7].4y10_1.heavy 839.47 / 1242.72 3267.0 38.8302001953125 41 11 10 10 10 1.3891618385110103 47.99056871453087 0.0 3 0.8661287067417941 3.3346493822615297 3267.0 13.966915937398872 0.0 - - - - - - - 242.22222222222223 6 9 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1207 153 C20140708_OR008_05 C20140708_OR008_05 TB438939.[MT7]-GTGK[MT7]PGALSGSADGQLSVLQPNTINVLAEK[MT7].4b4_1.heavy 839.47 / 632.397 778.0 38.8302001953125 41 11 10 10 10 1.3891618385110103 47.99056871453087 0.0 3 0.8661287067417941 3.3346493822615297 778.0 1.406452809189815 2.0 - - - - - - - 253.0 2 8 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1209 153 C20140708_OR008_05 C20140708_OR008_05 TB438939.[MT7]-GTGK[MT7]PGALSGSADGQLSVLQPNTINVLAEK[MT7].4b13_2.heavy 839.47 / 694.375 2489.0 38.8302001953125 41 11 10 10 10 1.3891618385110103 47.99056871453087 0.0 3 0.8661287067417941 3.3346493822615297 2489.0 10.866370899081659 0.0 - - - - - - - 342.4 4 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1211 154 C20140708_OR008_05 C20140708_OR008_05 TB438316.[MT7]-IGQTGTK[MT7].2y6_1.heavy 496.803 / 735.412 2302.0 17.357799530029297 36 18 2 10 6 4.08537884637127 24.47753409425477 0.0 5 0.98942324856986 11.989544694779031 2302.0 49.40247191011237 1.0 - - - - - - - 111.0 10 4 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1213 154 C20140708_OR008_05 C20140708_OR008_05 TB438316.[MT7]-IGQTGTK[MT7].2y4_1.heavy 496.803 / 550.332 1063.0 17.357799530029297 36 18 2 10 6 4.08537884637127 24.47753409425477 0.0 5 0.98942324856986 11.989544694779031 1063.0 23.875696629213483 0.0 - - - - - - - 164.71428571428572 2 7 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1215 154 C20140708_OR008_05 C20140708_OR008_05 TB438316.[MT7]-IGQTGTK[MT7].2y5_1.heavy 496.803 / 678.39 177.0 17.357799530029297 36 18 2 10 6 4.08537884637127 24.47753409425477 0.0 5 0.98942324856986 11.989544694779031 177.0 2.9091011235955055 13.0 - - - - - - - 0.0 1 0 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1217 154 C20140708_OR008_05 C20140708_OR008_05 TB438316.[MT7]-IGQTGTK[MT7].2b4_1.heavy 496.803 / 544.321 443.0 17.357799530029297 36 18 2 10 6 4.08537884637127 24.47753409425477 0.0 5 0.98942324856986 11.989544694779031 443.0 1.8347776220211547 6.0 - - - - - - - 0.0 1 0 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1219 155 C20140708_OR008_05 C20140708_OR008_05 TB430378.[MT7]-GAIFC[CAM]PPC[CAM]YDVR.3y7_1.heavy 533.591 / 906.414 4006.0 35.24480056762695 42 12 10 10 10 1.2588883283877055 51.73682601339798 0.0 3 0.8837050842597858 3.5832773635778827 4006.0 1.0981084674025694 2.0 - - - - - - - 241.125 8 8 PDLIM7 PDZ and LIM domain 7 (enigma) 1221 155 C20140708_OR008_05 C20140708_OR008_05 TB430378.[MT7]-GAIFC[CAM]PPC[CAM]YDVR.3y6_1.heavy 533.591 / 809.361 3413.0 35.24480056762695 42 12 10 10 10 1.2588883283877055 51.73682601339798 0.0 3 0.8837050842597858 3.5832773635778827 3413.0 12.986456063536355 0.0 - - - - - - - 720.8571428571429 6 7 PDLIM7 PDZ and LIM domain 7 (enigma) 1223 155 C20140708_OR008_05 C20140708_OR008_05 TB430378.[MT7]-GAIFC[CAM]PPC[CAM]YDVR.3y4_1.heavy 533.591 / 552.278 1632.0 35.24480056762695 42 12 10 10 10 1.2588883283877055 51.73682601339798 0.0 3 0.8837050842597858 3.5832773635778827 1632.0 1.5262834257967166 1.0 - - - - - - - 296.75 5 8 PDLIM7 PDZ and LIM domain 7 (enigma) 1225 155 C20140708_OR008_05 C20140708_OR008_05 TB430378.[MT7]-GAIFC[CAM]PPC[CAM]YDVR.3y5_1.heavy 533.591 / 712.308 2226.0 35.24480056762695 42 12 10 10 10 1.2588883283877055 51.73682601339798 0.0 3 0.8837050842597858 3.5832773635778827 2226.0 1.1727941176470587 2.0 - - - - - - - 247.16666666666666 4 6 PDLIM7 PDZ and LIM domain 7 (enigma) 1227 156 C20140708_OR008_05 C20140708_OR008_05 TB438626.[MT7]-VLEEGGFFEEK[MT7].2y4_1.heavy 786.413 / 696.369 2771.0 36.98720169067383 47 17 10 10 10 6.029815342032858 16.584255790209085 0.0 3 0.9773615577349105 8.186841178916275 2771.0 30.58896103896104 0.0 - - - - - - - 154.0 5 3 PDLIM7 PDZ and LIM domain 7 (enigma) 1229 156 C20140708_OR008_05 C20140708_OR008_05 TB438626.[MT7]-VLEEGGFFEEK[MT7].2y8_1.heavy 786.413 / 1086.52 2925.0 36.98720169067383 47 17 10 10 10 6.029815342032858 16.584255790209085 0.0 3 0.9773615577349105 8.186841178916275 2925.0 18.820736263146188 1.0 - - - - - - - 308.0 6 4 PDLIM7 PDZ and LIM domain 7 (enigma) 1231 156 C20140708_OR008_05 C20140708_OR008_05 TB438626.[MT7]-VLEEGGFFEEK[MT7].2y9_1.heavy 786.413 / 1215.56 1385.0 36.98720169067383 47 17 10 10 10 6.029815342032858 16.584255790209085 0.0 3 0.9773615577349105 8.186841178916275 1385.0 14.929220779220781 0.0 - - - - - - - 184.8 2 5 PDLIM7 PDZ and LIM domain 7 (enigma) 1233 156 C20140708_OR008_05 C20140708_OR008_05 TB438626.[MT7]-VLEEGGFFEEK[MT7].2y7_1.heavy 786.413 / 957.48 5541.0 36.98720169067383 47 17 10 10 10 6.029815342032858 16.584255790209085 0.0 3 0.9773615577349105 8.186841178916275 5541.0 61.1309025974026 0.0 - - - - - - - 282.3333333333333 11 6 PDLIM7 PDZ and LIM domain 7 (enigma) 1235 157 C20140708_OR008_05 C20140708_OR008_05 TB438938.[MT7]-LALC[CAM]GTVLDHLVGEETMADYLLYTLNK[MT7].4y4_1.heavy 835.941 / 619.39 7035.0 54.31400108337402 43 16 10 7 10 2.571722624884326 38.884442292643406 0.02359771728515625 3 0.961802294174426 6.294359221452782 7035.0 61.78972487366647 0.0 - - - - - - - 161.0 14 19 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1237 157 C20140708_OR008_05 C20140708_OR008_05 TB438938.[MT7]-LALC[CAM]GTVLDHLVGEETMADYLLYTLNK[MT7].4y5_1.heavy 835.941 / 782.453 6989.0 54.31400108337402 43 16 10 7 10 2.571722624884326 38.884442292643406 0.02359771728515625 3 0.961802294174426 6.294359221452782 6989.0 44.79878854927007 0.0 - - - - - - - 155.72727272727272 13 22 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1239 157 C20140708_OR008_05 C20140708_OR008_05 TB438938.[MT7]-LALC[CAM]GTVLDHLVGEETMADYLLYTLNK[MT7].4b15_2.heavy 835.941 / 876.46 2695.0 54.31400108337402 43 16 10 7 10 2.571722624884326 38.884442292643406 0.02359771728515625 3 0.961802294174426 6.294359221452782 2695.0 40.20529891304348 0.0 - - - - - - - 172.8695652173913 5 23 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1241 157 C20140708_OR008_05 C20140708_OR008_05 TB438938.[MT7]-LALC[CAM]GTVLDHLVGEETMADYLLYTLNK[MT7].4b10_2.heavy 835.941 / 612.83 2786.0 54.31400108337402 43 16 10 7 10 2.571722624884326 38.884442292643406 0.02359771728515625 3 0.961802294174426 6.294359221452782 2786.0 5.863552004586004 1.0 - - - - - - - 130.64285714285714 5 14 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1243 158 C20140708_OR008_05 C20140708_OR008_05 TB438829.[MT7]-FVVVGVLLQVVPSSAATIK[MT7].4b5_1.heavy 554.597 / 646.404 726.0 51.86497497558594 32 10 10 6 6 0.7572474992570183 79.56014203022414 0.038299560546875 5 0.8425208114973107 3.0681694748856008 726.0 3.8892857142857142 1.0 - - - - - - - 0.0 1 0 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1245 158 C20140708_OR008_05 C20140708_OR008_05 TB438829.[MT7]-FVVVGVLLQVVPSSAATIK[MT7].4b7_1.heavy 554.597 / 858.557 447.0 51.86497497558594 32 10 10 6 6 0.7572474992570183 79.56014203022414 0.038299560546875 5 0.8425208114973107 3.0681694748856008 447.0 11.973214285714285 0.0 - - - - - - - 0.0 0 0 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1247 158 C20140708_OR008_05 C20140708_OR008_05 TB438829.[MT7]-FVVVGVLLQVVPSSAATIK[MT7].4y3_1.heavy 554.597 / 505.347 1006.0 51.86497497558594 32 10 10 6 6 0.7572474992570183 79.56014203022414 0.038299560546875 5 0.8425208114973107 3.0681694748856008 1006.0 13.92232142857143 0.0 - - - - - - - 163.08333333333334 2 12 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1249 158 C20140708_OR008_05 C20140708_OR008_05 TB438829.[MT7]-FVVVGVLLQVVPSSAATIK[MT7].4b6_1.heavy 554.597 / 745.473 1229.0 51.86497497558594 32 10 10 6 6 0.7572474992570183 79.56014203022414 0.038299560546875 5 0.8425208114973107 3.0681694748856008 1229.0 10.205089285714285 1.0 - - - - - - - 172.8181818181818 2 11 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1251 159 C20140708_OR008_05 C20140708_OR008_05 TB430278.[MT7]-DQLVLNIEALR.3y6_1.heavy 476.616 / 715.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1253 159 C20140708_OR008_05 C20140708_OR008_05 TB430278.[MT7]-DQLVLNIEALR.3b4_1.heavy 476.616 / 600.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1255 159 C20140708_OR008_05 C20140708_OR008_05 TB430278.[MT7]-DQLVLNIEALR.3y4_1.heavy 476.616 / 488.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1257 159 C20140708_OR008_05 C20140708_OR008_05 TB430278.[MT7]-DQLVLNIEALR.3b3_1.heavy 476.616 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1259 160 C20140708_OR008_05 C20140708_OR008_05 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 247294.0 26.662500381469727 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 247294.0 398.23877502056865 0.0 - - - - - - - 1306.6666666666667 494 3 1261 160 C20140708_OR008_05 C20140708_OR008_05 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 300801.0 26.662500381469727 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 300801.0 585.6151827298997 0.0 - - - - - - - 1483.0 601 1 1263 160 C20140708_OR008_05 C20140708_OR008_05 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 380901.0 26.662500381469727 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 380901.0 57.91857847972314 0.0 - - - - - - - 1483.0 761 1 1265 161 C20140708_OR008_05 C20140708_OR008_05 TB448710.[MT7]-VALNTEIEK[MT7].2y8_1.heavy 652.887 / 1061.6 2891.0 29.112899780273438 44 14 10 10 10 2.0775881270666616 37.862779211771695 0.0 3 0.9479105657995625 5.383740325057437 2891.0 8.683972192356114 1.0 - - - - - - - 237.77777777777777 8 9 PKD2L1 polycystic kidney disease 2-like 1 1267 161 C20140708_OR008_05 C20140708_OR008_05 TB448710.[MT7]-VALNTEIEK[MT7].2y5_1.heavy 652.887 / 763.432 1178.0 29.112899780273438 44 14 10 10 10 2.0775881270666616 37.862779211771695 0.0 3 0.9479105657995625 5.383740325057437 1178.0 8.62398753894081 2.0 - - - - - - - 244.57142857142858 2 7 PKD2L1 polycystic kidney disease 2-like 1 1269 161 C20140708_OR008_05 C20140708_OR008_05 TB448710.[MT7]-VALNTEIEK[MT7].2b4_1.heavy 652.887 / 542.342 1178.0 29.112899780273438 44 14 10 10 10 2.0775881270666616 37.862779211771695 0.0 3 0.9479105657995625 5.383740325057437 1178.0 4.220249221183801 4.0 - - - - - - - 297.22222222222223 2 9 PKD2L1 polycystic kidney disease 2-like 1 1271 161 C20140708_OR008_05 C20140708_OR008_05 TB448710.[MT7]-VALNTEIEK[MT7].2y6_1.heavy 652.887 / 877.475 1713.0 29.112899780273438 44 14 10 10 10 2.0775881270666616 37.862779211771695 0.0 3 0.9479105657995625 5.383740325057437 1713.0 12.807476635514018 0.0 - - - - - - - 202.11111111111111 3 9 PKD2L1 polycystic kidney disease 2-like 1 1273 162 C20140708_OR008_05 C20140708_OR008_05 TB438413.[MT7]-EFLQDLK[MT7].2b3_1.heavy 590.844 / 534.304 7214.0 34.93119812011719 46 16 10 10 10 3.191222147140654 31.335957006189723 0.0 3 0.9661835133789104 6.692164519080515 7214.0 5.740953963712093 1.0 - - - - - - - 319.0 20 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 1275 162 C20140708_OR008_05 C20140708_OR008_05 TB438413.[MT7]-EFLQDLK[MT7].2y3_1.heavy 590.844 / 519.326 6772.0 34.93119812011719 46 16 10 10 10 3.191222147140654 31.335957006189723 0.0 3 0.9661835133789104 6.692164519080515 6772.0 32.23197625399905 0.0 - - - - - - - 257.4166666666667 13 12 FIBP fibroblast growth factor (acidic) intracellular binding protein 1277 162 C20140708_OR008_05 C20140708_OR008_05 TB438413.[MT7]-EFLQDLK[MT7].2y6_1.heavy 590.844 / 907.537 14428.0 34.93119812011719 46 16 10 10 10 3.191222147140654 31.335957006189723 0.0 3 0.9661835133789104 6.692164519080515 14428.0 91.76993197278912 0.0 - - - - - - - 245.0 28 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 1279 162 C20140708_OR008_05 C20140708_OR008_05 TB438413.[MT7]-EFLQDLK[MT7].2b5_1.heavy 590.844 / 777.39 20905.0 34.93119812011719 46 16 10 10 10 3.191222147140654 31.335957006189723 0.0 3 0.9661835133789104 6.692164519080515 20905.0 274.46700680272113 0.0 - - - - - - - 319.0 41 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 1281 163 C20140708_OR008_05 C20140708_OR008_05 TB438417.[MT7]-SSLINSLRR.2b8_1.heavy 595.36 / 1015.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1283 163 C20140708_OR008_05 C20140708_OR008_05 TB438417.[MT7]-SSLINSLRR.2b4_1.heavy 595.36 / 545.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1285 163 C20140708_OR008_05 C20140708_OR008_05 TB438417.[MT7]-SSLINSLRR.2b6_1.heavy 595.36 / 746.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1287 163 C20140708_OR008_05 C20140708_OR008_05 TB438417.[MT7]-SSLINSLRR.2y7_1.heavy 595.36 / 871.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1289 164 C20140708_OR008_05 C20140708_OR008_05 TB438414.[MT7]-TSSVVEMER.2y8_1.heavy 591.301 / 936.445 5072.0 24.227675437927246 44 20 10 6 8 13.610203035243147 7.3474289649503 0.035099029541015625 4 0.9945400497008882 16.694377309430486 5072.0 41.22035135085831 0.0 - - - - - - - 200.9 10 10 ZNF559 zinc finger protein 559 1291 164 C20140708_OR008_05 C20140708_OR008_05 TB438414.[MT7]-TSSVVEMER.2y5_1.heavy 591.301 / 663.313 1435.0 24.227675437927246 44 20 10 6 8 13.610203035243147 7.3474289649503 0.035099029541015625 4 0.9945400497008882 16.694377309430486 1435.0 8.662041884816755 1.0 - - - - - - - 204.85714285714286 2 7 ZNF559 zinc finger protein 559 1293 164 C20140708_OR008_05 C20140708_OR008_05 TB438414.[MT7]-TSSVVEMER.2b4_1.heavy 591.301 / 519.289 2010.0 24.227675437927246 44 20 10 6 8 13.610203035243147 7.3474289649503 0.035099029541015625 4 0.9945400497008882 16.694377309430486 2010.0 1.6820083682008367 2.0 - - - - - - - 314.35714285714283 4 14 ZNF559 zinc finger protein 559 1295 164 C20140708_OR008_05 C20140708_OR008_05 TB438414.[MT7]-TSSVVEMER.2y7_1.heavy 591.301 / 849.414 1723.0 24.227675437927246 44 20 10 6 8 13.610203035243147 7.3474289649503 0.035099029541015625 4 0.9945400497008882 16.694377309430486 1723.0 23.945397502903603 0.0 - - - - - - - 239.0 3 6 ZNF559 zinc finger protein 559 1297 165 C20140708_OR008_05 C20140708_OR008_05 TB430507.[MT7]-AGTAGPGDALYAMLMK[MT7].3b9_1.heavy 618.995 / 842.412 8987.0 45.512474060058594 38 12 10 6 10 1.9211600585381972 35.66973772955393 0.038299560546875 3 0.8979565713318709 3.830060845606996 8987.0 87.98227211672071 0.0 - - - - - - - 230.28571428571428 17 7 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1299 165 C20140708_OR008_05 C20140708_OR008_05 TB430507.[MT7]-AGTAGPGDALYAMLMK[MT7].3b10_1.heavy 618.995 / 955.497 9241.0 45.512474060058594 38 12 10 6 10 1.9211600585381972 35.66973772955393 0.038299560546875 3 0.8979565713318709 3.830060845606996 9241.0 108.71764705882353 0.0 - - - - - - - 226.33333333333334 18 9 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1301 165 C20140708_OR008_05 C20140708_OR008_05 TB430507.[MT7]-AGTAGPGDALYAMLMK[MT7].3b5_1.heavy 618.995 / 502.274 5935.0 45.512474060058594 38 12 10 6 10 1.9211600585381972 35.66973772955393 0.038299560546875 3 0.8979565713318709 3.830060845606996 5935.0 22.86596177097585 0.0 - - - - - - - 657.125 11 8 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1303 165 C20140708_OR008_05 C20140708_OR008_05 TB430507.[MT7]-AGTAGPGDALYAMLMK[MT7].3b8_1.heavy 618.995 / 771.375 4154.0 45.512474060058594 38 12 10 6 10 1.9211600585381972 35.66973772955393 0.038299560546875 3 0.8979565713318709 3.830060845606996 4154.0 1.837149877149877 0.0 - - - - - - - 206.0 8 7 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1305 166 C20140708_OR008_05 C20140708_OR008_05 TB438721.[MT7]-SEQEITALEQNVIR.3y7_1.heavy 591.987 / 871.5 19202.0 38.07809829711914 50 20 10 10 10 9.056860539801951 11.041353630270951 0.0 3 0.9947880897467594 17.0873651241372 19202.0 183.40371794871794 0.0 - - - - - - - 312.0 38 3 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1307 166 C20140708_OR008_05 C20140708_OR008_05 TB438721.[MT7]-SEQEITALEQNVIR.3y6_1.heavy 591.987 / 758.416 30910.0 38.07809829711914 50 20 10 10 10 9.056860539801951 11.041353630270951 0.0 3 0.9947880897467594 17.0873651241372 30910.0 80.04781131133186 0.0 - - - - - - - 280.8 61 5 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1309 166 C20140708_OR008_05 C20140708_OR008_05 TB438721.[MT7]-SEQEITALEQNVIR.3b4_1.heavy 591.987 / 618.285 68065.0 38.07809829711914 50 20 10 10 10 9.056860539801951 11.041353630270951 0.0 3 0.9947880897467594 17.0873651241372 68065.0 503.9427884615385 0.0 - - - - - - - 234.0 136 4 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1311 166 C20140708_OR008_05 C20140708_OR008_05 TB438721.[MT7]-SEQEITALEQNVIR.3y5_1.heavy 591.987 / 629.373 29349.0 38.07809829711914 50 20 10 10 10 9.056860539801951 11.041353630270951 0.0 3 0.9947880897467594 17.0873651241372 29349.0 253.04105769230767 0.0 - - - - - - - 202.8 58 10 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1313 167 C20140708_OR008_05 C20140708_OR008_05 TB438529.[MT7]-IQDLLVDSGK[MT7].3b4_1.heavy 459.273 / 614.363 8495.0 36.313201904296875 42 12 10 10 10 1.0110775700543742 60.83672193659035 0.0 3 0.8938772193564909 3.754398425804381 8495.0 82.80300937988535 0.0 - - - - - - - 182.2 16 5 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1315 167 C20140708_OR008_05 C20140708_OR008_05 TB438529.[MT7]-IQDLLVDSGK[MT7].3b5_1.heavy 459.273 / 727.447 1669.0 36.313201904296875 42 12 10 10 10 1.0110775700543742 60.83672193659035 0.0 3 0.8938772193564909 3.754398425804381 1669.0 14.190843840370155 0.0 - - - - - - - 303.25 3 4 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1317 167 C20140708_OR008_05 C20140708_OR008_05 TB438529.[MT7]-IQDLLVDSGK[MT7].3y4_1.heavy 459.273 / 550.295 11984.0 36.313201904296875 42 12 10 10 10 1.0110775700543742 60.83672193659035 0.0 3 0.8938772193564909 3.754398425804381 11984.0 154.13631578947366 0.0 - - - - - - - 152.0 23 4 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1319 167 C20140708_OR008_05 C20140708_OR008_05 TB438529.[MT7]-IQDLLVDSGK[MT7].3b3_1.heavy 459.273 / 501.279 10012.0 36.313201904296875 42 12 10 10 10 1.0110775700543742 60.83672193659035 0.0 3 0.8938772193564909 3.754398425804381 10012.0 37.618453717616816 0.0 - - - - - - - 303.5 20 2 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1321 168 C20140708_OR008_05 C20140708_OR008_05 TB430277.[MT7]-YYAFDEAFVR.3b5_1.heavy 475.57 / 804.369 880.0 40.10070037841797 47 17 10 10 10 2.9230708362791114 29.19556649092501 0.0 3 0.977850991928131 8.277141024355094 880.0 0.0 0.0 - - - - - - - 0.0 1 0 FIBP fibroblast growth factor (acidic) intracellular binding protein 1323 168 C20140708_OR008_05 C20140708_OR008_05 TB430277.[MT7]-YYAFDEAFVR.3y4_1.heavy 475.57 / 492.293 3079.0 40.10070037841797 47 17 10 10 10 2.9230708362791114 29.19556649092501 0.0 3 0.977850991928131 8.277141024355094 3079.0 16.80648696866274 0.0 - - - - - - - 342.3333333333333 6 3 FIBP fibroblast growth factor (acidic) intracellular binding protein 1325 168 C20140708_OR008_05 C20140708_OR008_05 TB430277.[MT7]-YYAFDEAFVR.3b3_1.heavy 475.57 / 542.273 2933.0 40.10070037841797 47 17 10 10 10 2.9230708362791114 29.19556649092501 0.0 3 0.977850991928131 8.277141024355094 2933.0 39.904761904761905 1.0 - - - - - - - 440.0 5 5 FIBP fibroblast growth factor (acidic) intracellular binding protein 1327 168 C20140708_OR008_05 C20140708_OR008_05 TB430277.[MT7]-YYAFDEAFVR.3y5_1.heavy 475.57 / 621.336 880.0 40.10070037841797 47 17 10 10 10 2.9230708362791114 29.19556649092501 0.0 3 0.977850991928131 8.277141024355094 880.0 11.924897959183674 1.0 - - - - - - - 0.0 1 0 FIBP fibroblast growth factor (acidic) intracellular binding protein 1329 169 C20140708_OR008_05 C20140708_OR008_05 TB430500.[MT7]-NLYRDVMLENYK[MT7].4b7_1.heavy 462.25 / 1036.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF559 zinc finger protein 559 1331 169 C20140708_OR008_05 C20140708_OR008_05 TB430500.[MT7]-NLYRDVMLENYK[MT7].4b7_2.heavy 462.25 / 518.772 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF559 zinc finger protein 559 1333 169 C20140708_OR008_05 C20140708_OR008_05 TB430500.[MT7]-NLYRDVMLENYK[MT7].4b5_1.heavy 462.25 / 806.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF559 zinc finger protein 559 1335 169 C20140708_OR008_05 C20140708_OR008_05 TB430500.[MT7]-NLYRDVMLENYK[MT7].4b6_1.heavy 462.25 / 905.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF559 zinc finger protein 559 1337 170 C20140708_OR008_05 C20140708_OR008_05 TB448484.[MT7]-LTPGGK[MT7].2b3_1.heavy 430.776 / 456.294 552.0 19.637474536895752 33 17 2 6 8 1.2204168937223006 49.2860301921775 0.03750038146972656 4 0.9784236118379341 8.386659551093524 552.0 0.03801652892561983 9.0 - - - - - - - 204.44444444444446 26 9 PDLIM7 PDZ and LIM domain 7 (enigma) 1339 170 C20140708_OR008_05 C20140708_OR008_05 TB448484.[MT7]-LTPGGK[MT7].2y4_1.heavy 430.776 / 502.311 57239.0 19.637474536895752 33 17 2 6 8 1.2204168937223006 49.2860301921775 0.03750038146972656 4 0.9784236118379341 8.386659551093524 57239.0 185.52309420289856 0.0 - - - - - - - 265.77777777777777 114 9 PDLIM7 PDZ and LIM domain 7 (enigma) 1341 170 C20140708_OR008_05 C20140708_OR008_05 TB448484.[MT7]-LTPGGK[MT7].2y5_1.heavy 430.776 / 603.358 20706.0 19.637474536895752 33 17 2 6 8 1.2204168937223006 49.2860301921775 0.03750038146972656 4 0.9784236118379341 8.386659551093524 20706.0 293.7851304347826 1.0 - - - - - - - 195.5 234 8 PDLIM7 PDZ and LIM domain 7 (enigma) 1343 170 C20140708_OR008_05 C20140708_OR008_05 TB448484.[MT7]-LTPGGK[MT7].2y3_1.heavy 430.776 / 405.258 8282.0 19.637474536895752 33 17 2 6 8 1.2204168937223006 49.2860301921775 0.03750038146972656 4 0.9784236118379341 8.386659551093524 8282.0 12.594973069699869 0.0 - - - - - - - 230.0 16 8 PDLIM7 PDZ and LIM domain 7 (enigma) 1345 171 C20140708_OR008_05 C20140708_OR008_05 TB430504.[MT7]-LAEGEQILSGGVFNK[MT7].3y7_1.heavy 617.347 / 852.47 24422.0 39.28580093383789 44 14 10 10 10 2.423245267120625 41.266974233616516 0.0 3 0.9316737512400861 4.694228211972174 24422.0 159.28642658220383 1.0 - - - - - - - 153.0 55 3 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1347 171 C20140708_OR008_05 C20140708_OR008_05 TB430504.[MT7]-LAEGEQILSGGVFNK[MT7].3y3_1.heavy 617.347 / 552.326 43501.0 39.28580093383789 44 14 10 10 10 2.423245267120625 41.266974233616516 0.0 3 0.9316737512400861 4.694228211972174 43501.0 287.9528544587368 0.0 - - - - - - - 220.66666666666666 87 9 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1349 171 C20140708_OR008_05 C20140708_OR008_05 TB430504.[MT7]-LAEGEQILSGGVFNK[MT7].3b6_1.heavy 617.347 / 772.396 43959.0 39.28580093383789 44 14 10 10 10 2.423245267120625 41.266974233616516 0.0 3 0.9316737512400861 4.694228211972174 43959.0 423.3779697846352 0.0 - - - - - - - 229.0 87 4 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1351 171 C20140708_OR008_05 C20140708_OR008_05 TB430504.[MT7]-LAEGEQILSGGVFNK[MT7].3b5_1.heavy 617.347 / 644.337 20453.0 39.28580093383789 44 14 10 10 10 2.423245267120625 41.266974233616516 0.0 3 0.9316737512400861 4.694228211972174 20453.0 70.12293263204886 0.0 - - - - - - - 305.3636363636364 40 11 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1353 172 C20140708_OR008_05 C20140708_OR008_05 TB448483.[MT7]-VGPDGK[MT7].2y4_1.heavy 430.758 / 560.316 706.0 17.05294942855835 27 18 0 5 4 4.401231048646013 22.720915783497396 0.04220008850097656 8 0.9896083845475314 12.096062790465036 706.0 12.286682998530132 4.0 - - - - - - - 219.6 26 5 DGCR14 DiGeorge syndrome critical region gene 14 1355 172 C20140708_OR008_05 C20140708_OR008_05 TB448483.[MT7]-VGPDGK[MT7].2y5_1.heavy 430.758 / 617.338 2745.0 17.05294942855835 27 18 0 5 4 4.401231048646013 22.720915783497396 0.04220008850097656 8 0.9896083845475314 12.096062790465036 2745.0 29.59516168544831 1.0 - - - - - - - 156.8 5 5 DGCR14 DiGeorge syndrome critical region gene 14 1357 172 C20140708_OR008_05 C20140708_OR008_05 TB448483.[MT7]-VGPDGK[MT7].2b4_1.heavy 430.758 / 513.279 1412.0 17.05294942855835 27 18 0 5 4 4.401231048646013 22.720915783497396 0.04220008850097656 8 0.9896083845475314 12.096062790465036 1412.0 14.638592302006936 2.0 - - - - - - - 178.1818181818182 3 11 DGCR14 DiGeorge syndrome critical region gene 14 1359 172 C20140708_OR008_05 C20140708_OR008_05 TB448483.[MT7]-VGPDGK[MT7].2y3_1.heavy 430.758 / 463.263 549.0 17.05294942855835 27 18 0 5 4 4.401231048646013 22.720915783497396 0.04220008850097656 8 0.9896083845475314 12.096062790465036 549.0 3.051195492405683 3.0 - - - - - - - 294.125 2 8 DGCR14 DiGeorge syndrome critical region gene 14 1361 173 C20140708_OR008_05 C20140708_OR008_05 TB438610.[MT7]-AQPVQSK[MT7]PQK[MT7].3y3_1.heavy 514.982 / 516.326 25801.0 16.391199111938477 50 20 10 10 10 56.12244040344145 1.7818184541003668 0.0 3 0.9964806252614179 20.797070348186956 25801.0 364.79298757915706 0.0 - - - - - - - 187.57142857142858 51 7 PDLIM7 PDZ and LIM domain 7 (enigma) 1363 173 C20140708_OR008_05 C20140708_OR008_05 TB438610.[MT7]-AQPVQSK[MT7]PQK[MT7].3y8_2.heavy 514.982 / 600.371 12827.0 16.391199111938477 50 20 10 10 10 56.12244040344145 1.7818184541003668 0.0 3 0.9964806252614179 20.797070348186956 12827.0 50.408975475743766 0.0 - - - - - - - 262.2 25 5 PDLIM7 PDZ and LIM domain 7 (enigma) 1365 173 C20140708_OR008_05 C20140708_OR008_05 TB438610.[MT7]-AQPVQSK[MT7]PQK[MT7].3y5_1.heavy 514.982 / 875.555 1458.0 16.391199111938477 50 20 10 10 10 56.12244040344145 1.7818184541003668 0.0 3 0.9964806252614179 20.797070348186956 1458.0 23.954119147975312 0.0 - - - - - - - 175.0 2 5 PDLIM7 PDZ and LIM domain 7 (enigma) 1367 173 C20140708_OR008_05 C20140708_OR008_05 TB438610.[MT7]-AQPVQSK[MT7]PQK[MT7].3b7_2.heavy 514.982 / 514.311 3280.0 16.391199111938477 50 20 10 10 10 56.12244040344145 1.7818184541003668 0.0 3 0.9964806252614179 20.797070348186956 3280.0 6.137876102670304 3.0 - - - - - - - 265.09090909090907 7 11 PDLIM7 PDZ and LIM domain 7 (enigma) 1369 174 C20140708_OR008_05 C20140708_OR008_05 TB438328.[MT7]-LAPEVMEDLVK[MT7].3y3_1.heavy 511.293 / 503.367 9296.0 41.056800842285156 44 14 10 10 10 2.0465049403412543 41.3607436527119 0.0 3 0.9441057358006569 5.195589289643589 9296.0 94.69882014388489 0.0 - - - - - - - 247.0 18 9 VSNL1 visinin-like 1 1371 174 C20140708_OR008_05 C20140708_OR008_05 TB438328.[MT7]-LAPEVMEDLVK[MT7].3b4_1.heavy 511.293 / 555.326 14014.0 41.056800842285156 44 14 10 10 10 2.0465049403412543 41.3607436527119 0.0 3 0.9441057358006569 5.195589289643589 14014.0 199.82552517985613 0.0 - - - - - - - 166.8 28 5 VSNL1 visinin-like 1 1373 174 C20140708_OR008_05 C20140708_OR008_05 TB438328.[MT7]-LAPEVMEDLVK[MT7].3b5_1.heavy 511.293 / 654.394 15401.0 41.056800842285156 44 14 10 10 10 2.0465049403412543 41.3607436527119 0.0 3 0.9441057358006569 5.195589289643589 15401.0 83.01008237734138 0.0 - - - - - - - 208.5 30 4 VSNL1 visinin-like 1 1375 174 C20140708_OR008_05 C20140708_OR008_05 TB438328.[MT7]-LAPEVMEDLVK[MT7].3y4_1.heavy 511.293 / 618.394 9574.0 41.056800842285156 44 14 10 10 10 2.0465049403412543 41.3607436527119 0.0 3 0.9441057358006569 5.195589289643589 9574.0 54.00938710570006 0.0 - - - - - - - 277.75 19 4 VSNL1 visinin-like 1 1377 175 C20140708_OR008_05 C20140708_OR008_05 TB438612.[MT7]-TANPNHDMSGSK[MT7].3y6_1.heavy 516.256 / 768.368 3366.0 15.533699989318848 47 17 10 10 10 3.250104855560744 24.430272743444533 0.0 3 0.97076988875267 7.200846406216449 3366.0 70.60042372881357 0.0 - - - - - - - 216.33333333333334 6 6 C18orf21 chromosome 18 open reading frame 21 1379 175 C20140708_OR008_05 C20140708_OR008_05 TB438612.[MT7]-TANPNHDMSGSK[MT7].3b5_1.heavy 516.256 / 642.333 2893.0 15.533699989318848 47 17 10 10 10 3.250104855560744 24.430272743444533 0.0 3 0.97076988875267 7.200846406216449 2893.0 38.40988700564972 0.0 - - - - - - - 188.8 5 5 C18orf21 chromosome 18 open reading frame 21 1381 175 C20140708_OR008_05 C20140708_OR008_05 TB438612.[MT7]-TANPNHDMSGSK[MT7].3b3_1.heavy 516.256 / 431.237 5728.0 15.533699989318848 47 17 10 10 10 3.250104855560744 24.430272743444533 0.0 3 0.97076988875267 7.200846406216449 5728.0 44.936368038740916 0.0 - - - - - - - 221.25 11 12 C18orf21 chromosome 18 open reading frame 21 1383 175 C20140708_OR008_05 C20140708_OR008_05 TB438612.[MT7]-TANPNHDMSGSK[MT7].3y4_1.heavy 516.256 / 522.3 6259.0 15.533699989318848 47 17 10 10 10 3.250104855560744 24.430272743444533 0.0 3 0.97076988875267 7.200846406216449 6259.0 48.975790960451974 0.0 - - - - - - - 177.0 12 6 C18orf21 chromosome 18 open reading frame 21 1385 176 C20140708_OR008_05 C20140708_OR008_05 TB438325.[MT7]-DLGNC[CAM]MR.2y5_1.heavy 505.237 / 637.255 1722.0 21.552249908447266 40 18 10 6 6 2.703176776617139 28.68023150276777 0.037700653076171875 5 0.9848685609736277 10.020124164042217 1722.0 12.676087889990251 0.0 - - - - - - - 181.25 3 4 CABP1 calcium binding protein 1 1387 176 C20140708_OR008_05 C20140708_OR008_05 TB438325.[MT7]-DLGNC[CAM]MR.2b4_1.heavy 505.237 / 544.285 1088.0 21.552249908447266 40 18 10 6 6 2.703176776617139 28.68023150276777 0.037700653076171875 5 0.9848685609736277 10.020124164042217 1088.0 2.4044198895027624 3.0 - - - - - - - 173.0909090909091 4 11 CABP1 calcium binding protein 1 1389 176 C20140708_OR008_05 C20140708_OR008_05 TB438325.[MT7]-DLGNC[CAM]MR.2y6_1.heavy 505.237 / 750.339 3354.0 21.552249908447266 40 18 10 6 6 2.703176776617139 28.68023150276777 0.037700653076171875 5 0.9848685609736277 10.020124164042217 3354.0 41.113482880755605 0.0 - - - - - - - 263.0 6 10 CABP1 calcium binding protein 1 1391 176 C20140708_OR008_05 C20140708_OR008_05 TB438325.[MT7]-DLGNC[CAM]MR.2b5_1.heavy 505.237 / 704.315 907.0 21.552249908447266 40 18 10 6 6 2.703176776617139 28.68023150276777 0.037700653076171875 5 0.9848685609736277 10.020124164042217 907.0 19.45564835164835 2.0 - - - - - - - 109.0 6 5 CABP1 calcium binding protein 1 1393 177 C20140708_OR008_05 C20140708_OR008_05 TB438615.[MT7]-SQESQLPEESK[MT7].3y3_1.heavy 517.27 / 507.289 5953.0 20.87909984588623 44 18 10 6 10 3.346058673152972 23.69262688237288 0.03759956359863281 3 0.9886994937240867 11.59854709993572 5953.0 14.138524590163934 1.0 - - - - - - - 251.91666666666666 11 12 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1395 177 C20140708_OR008_05 C20140708_OR008_05 TB438615.[MT7]-SQESQLPEESK[MT7].3b5_1.heavy 517.27 / 704.333 5495.0 20.87909984588623 44 18 10 6 10 3.346058673152972 23.69262688237288 0.03759956359863281 3 0.9886994937240867 11.59854709993572 5495.0 31.99959016393443 0.0 - - - - - - - 183.2 10 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1397 177 C20140708_OR008_05 C20140708_OR008_05 TB438615.[MT7]-SQESQLPEESK[MT7].3y4_1.heavy 517.27 / 636.332 3938.0 20.87909984588623 44 18 10 6 10 3.346058673152972 23.69262688237288 0.03759956359863281 3 0.9886994937240867 11.59854709993572 3938.0 52.81191078641007 0.0 - - - - - - - 274.7 7 10 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1399 177 C20140708_OR008_05 C20140708_OR008_05 TB438615.[MT7]-SQESQLPEESK[MT7].3y5_1.heavy 517.27 / 733.385 8884.0 20.87909984588623 44 18 10 6 10 3.346058673152972 23.69262688237288 0.03759956359863281 3 0.9886994937240867 11.59854709993572 8884.0 97.81674476540721 0.0 - - - - - - - 192.4 17 10 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1401 178 C20140708_OR008_05 C20140708_OR008_05 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 234104.0 37.567501068115234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 234104.0 193.09471116599642 0.0 - - - - - - - 245.14285714285714 468 7 1403 178 C20140708_OR008_05 C20140708_OR008_05 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 506887.0 37.567501068115234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 506887.0 107.62474397274545 0.0 - - - - - - - 260.0 1013 6 1405 178 C20140708_OR008_05 C20140708_OR008_05 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 494566.0 37.567501068115234 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 494566.0 144.1145558143712 0.0 - - - - - - - 249.6 989 10 1407 179 C20140708_OR008_05 C20140708_OR008_05 TB438515.[MT7]-AFAFSPDLAK[MT7].2y5_1.heavy 677.884 / 687.416 4647.0 36.98720169067383 48 18 10 10 10 3.9689940784411215 25.19530088068975 0.0 3 0.9840276199189281 9.752092045891366 4647.0 13.258882220555138 0.0 - - - - - - - 387.5 9 8 ZNF559 zinc finger protein 559 1409 179 C20140708_OR008_05 C20140708_OR008_05 TB438515.[MT7]-AFAFSPDLAK[MT7].2y6_1.heavy 677.884 / 774.448 3717.0 36.98720169067383 48 18 10 10 10 3.9689940784411215 25.19530088068975 0.0 3 0.9840276199189281 9.752092045891366 3717.0 26.301785756449878 0.0 - - - - - - - 271.25 7 4 ZNF559 zinc finger protein 559 1411 179 C20140708_OR008_05 C20140708_OR008_05 TB438515.[MT7]-AFAFSPDLAK[MT7].2b5_1.heavy 677.884 / 668.352 1859.0 36.98720169067383 48 18 10 10 10 3.9689940784411215 25.19530088068975 0.0 3 0.9840276199189281 9.752092045891366 1859.0 1.6163610378587774 4.0 - - - - - - - 310.0 4 6 ZNF559 zinc finger protein 559 1413 179 C20140708_OR008_05 C20140708_OR008_05 TB438515.[MT7]-AFAFSPDLAK[MT7].2y7_1.heavy 677.884 / 921.516 3408.0 36.98720169067383 48 18 10 10 10 3.9689940784411215 25.19530088068975 0.0 3 0.9840276199189281 9.752092045891366 3408.0 5.81102038995226 0.0 - - - - - - - 232.5 6 4 ZNF559 zinc finger protein 559 1415 180 C20140708_OR008_05 C20140708_OR008_05 TB438320.[MT7]-REQAASEDADK[MT7].3b4_1.heavy 503.258 / 629.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 1417 180 C20140708_OR008_05 C20140708_OR008_05 TB438320.[MT7]-REQAASEDADK[MT7].3b5_1.heavy 503.258 / 700.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 1419 180 C20140708_OR008_05 C20140708_OR008_05 TB438320.[MT7]-REQAASEDADK[MT7].3b3_1.heavy 503.258 / 558.312 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 1421 180 C20140708_OR008_05 C20140708_OR008_05 TB438320.[MT7]-REQAASEDADK[MT7].3y4_1.heavy 503.258 / 592.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 1423 181 C20140708_OR008_05 C20140708_OR008_05 TB438516.[MT7]-AFAFSPDLAK[MT7].3y3_1.heavy 452.258 / 475.336 3091.0 36.98720169067383 47 17 10 10 10 2.756001212429688 36.2844542843434 0.0 3 0.9740629140067787 7.646427736969124 3091.0 7.327801724137932 0.0 - - - - - - - 292.22222222222223 6 9 ZNF559 zinc finger protein 559 1425 181 C20140708_OR008_05 C20140708_OR008_05 TB438516.[MT7]-AFAFSPDLAK[MT7].3b4_1.heavy 452.258 / 581.32 927.0 36.98720169067383 47 17 10 10 10 2.756001212429688 36.2844542843434 0.0 3 0.9740629140067787 7.646427736969124 927.0 -0.7997124370956147 1.0 - - - - - - - 309.5 2 2 ZNF559 zinc finger protein 559 1427 181 C20140708_OR008_05 C20140708_OR008_05 TB438516.[MT7]-AFAFSPDLAK[MT7].3b5_1.heavy 452.258 / 668.352 927.0 36.98720169067383 47 17 10 10 10 2.756001212429688 36.2844542843434 0.0 3 0.9740629140067787 7.646427736969124 927.0 3.279568965517241 0.0 - - - - - - - 0.0 1 0 ZNF559 zinc finger protein 559 1429 181 C20140708_OR008_05 C20140708_OR008_05 TB438516.[MT7]-AFAFSPDLAK[MT7].3y4_1.heavy 452.258 / 590.363 3091.0 36.98720169067383 47 17 10 10 10 2.756001212429688 36.2844542843434 0.0 3 0.9740629140067787 7.646427736969124 3091.0 39.086193548387094 0.0 - - - - - - - 309.3333333333333 6 3 ZNF559 zinc finger protein 559 1431 182 C20140708_OR008_05 C20140708_OR008_05 TB438511.[MT7]-MRQDLEEER.2b6_1.heavy 675.334 / 917.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 1433 182 C20140708_OR008_05 C20140708_OR008_05 TB438511.[MT7]-MRQDLEEER.2y6_1.heavy 675.334 / 790.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 1435 182 C20140708_OR008_05 C20140708_OR008_05 TB438511.[MT7]-MRQDLEEER.2b7_1.heavy 675.334 / 1046.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 1437 182 C20140708_OR008_05 C20140708_OR008_05 TB438511.[MT7]-MRQDLEEER.2b5_1.heavy 675.334 / 788.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 1439 183 C20140708_OR008_05 C20140708_OR008_05 TB438512.[MT7]-TSIVQAAAGGVPGGGSNNGK[MT7].3b6_1.heavy 677.367 / 744.437 4319.0 28.918933868408203 29 10 8 5 6 0.6653455246786075 86.32521344245092 0.042400360107421875 5 0.8272800913825094 2.9257168984744455 4319.0 73.21733333333333 0.0 - - - - - - - 210.55555555555554 8 9 PDLIM7 PDZ and LIM domain 7 (enigma) 1441 183 C20140708_OR008_05 C20140708_OR008_05 TB438512.[MT7]-TSIVQAAAGGVPGGGSNNGK[MT7].3b4_1.heavy 677.367 / 545.341 3160.0 28.918933868408203 29 10 8 5 6 0.6653455246786075 86.32521344245092 0.042400360107421875 5 0.8272800913825094 2.9257168984744455 3160.0 5.258530497900657 1.0 - - - - - - - 280.8333333333333 10 6 PDLIM7 PDZ and LIM domain 7 (enigma) 1443 183 C20140708_OR008_05 C20140708_OR008_05 TB438512.[MT7]-TSIVQAAAGGVPGGGSNNGK[MT7].3b5_1.heavy 677.367 / 673.4 N/A 28.918933868408203 29 10 8 5 6 0.6653455246786075 86.32521344245092 0.042400360107421875 5 0.8272800913825094 2.9257168984744455 2001.0 2.4913593189819387 1.0 - - - - - - - 175.5 4 6 PDLIM7 PDZ and LIM domain 7 (enigma) 1445 183 C20140708_OR008_05 C20140708_OR008_05 TB438512.[MT7]-TSIVQAAAGGVPGGGSNNGK[MT7].3y9_1.heavy 677.367 / 931.471 1580.0 28.918933868408203 29 10 8 5 6 0.6653455246786075 86.32521344245092 0.042400360107421875 5 0.8272800913825094 2.9257168984744455 1580.0 9.668431065731557 1.0 - - - - - - - 158.0 6 2 PDLIM7 PDZ and LIM domain 7 (enigma) 1447 184 C20140708_OR008_05 C20140708_OR008_05 TB430284.[MT7]-EFIC[CAM]ALSITSR.2y8_1.heavy 720.885 / 907.467 1492.0 39.38079833984375 41 13 10 10 8 1.1061582543528798 60.2686517994369 0.0 4 0.9075851178910256 4.02799248421178 1492.0 1.0419692503485771 1.0 - - - - - - - 248.5 4 6 VSNL1 visinin-like 1 1449 184 C20140708_OR008_05 C20140708_OR008_05 TB430284.[MT7]-EFIC[CAM]ALSITSR.2y9_1.heavy 720.885 / 1020.55 2537.0 39.38079833984375 41 13 10 10 8 1.1061582543528798 60.2686517994369 0.0 4 0.9075851178910256 4.02799248421178 2537.0 11.718791946308725 2.0 - - - - - - - 238.4 5 5 VSNL1 visinin-like 1 1451 184 C20140708_OR008_05 C20140708_OR008_05 TB430284.[MT7]-EFIC[CAM]ALSITSR.2y10_1.heavy 720.885 / 1167.62 1641.0 39.38079833984375 41 13 10 10 8 1.1061582543528798 60.2686517994369 0.0 4 0.9075851178910256 4.02799248421178 1641.0 5.3945103190168595 2.0 - - - - - - - 298.375 3 8 VSNL1 visinin-like 1 1453 184 C20140708_OR008_05 C20140708_OR008_05 TB430284.[MT7]-EFIC[CAM]ALSITSR.2y7_1.heavy 720.885 / 747.436 895.0 39.38079833984375 41 13 10 10 8 1.1061582543528798 60.2686517994369 0.0 4 0.9075851178910256 4.02799248421178 895.0 2.197544642857143 1.0 - - - - - - - 341.14285714285717 2 7 VSNL1 visinin-like 1 1455 185 C20140708_OR008_05 C20140708_OR008_05 TB438711.[MT7]-SGILEQTGATAAVLQSDTMDHYR.3b6_1.heavy 870.098 / 772.432 1879.0 38.66452598571777 33 8 10 5 10 0.6308319501355766 95.65192010077908 0.04489898681640625 3 0.7593968440939501 2.463724964373151 1879.0 5.797191693290735 1.0 - - - - - - - 313.25 3 4 FIBP fibroblast growth factor (acidic) intracellular binding protein 1457 185 C20140708_OR008_05 C20140708_OR008_05 TB438711.[MT7]-SGILEQTGATAAVLQSDTMDHYR.3b4_1.heavy 870.098 / 515.331 4229.0 38.66452598571777 33 8 10 5 10 0.6308319501355766 95.65192010077908 0.04489898681640625 3 0.7593968440939501 2.463724964373151 4229.0 25.86986195508049 0.0 - - - - - - - 313.2 8 5 FIBP fibroblast growth factor (acidic) intracellular binding protein 1459 185 C20140708_OR008_05 C20140708_OR008_05 TB438711.[MT7]-SGILEQTGATAAVLQSDTMDHYR.3b5_1.heavy 870.098 / 644.374 2193.0 38.66452598571777 33 8 10 5 10 0.6308319501355766 95.65192010077908 0.04489898681640625 3 0.7593968440939501 2.463724964373151 2193.0 27.936305732484076 0.0 - - - - - - - 313.0 4 2 FIBP fibroblast growth factor (acidic) intracellular binding protein 1461 185 C20140708_OR008_05 C20140708_OR008_05 TB438711.[MT7]-SGILEQTGATAAVLQSDTMDHYR.3y8_1.heavy 870.098 / 1024.42 7831.0 38.66452598571777 33 8 10 5 10 0.6308319501355766 95.65192010077908 0.04489898681640625 3 0.7593968440939501 2.463724964373151 7831.0 55.465957379048646 0.0 - - - - - - - 261.1666666666667 15 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 1463 186 C20140708_OR008_05 C20140708_OR008_05 TB438617.[MT7]-QTVLEALQQLIR.2y8_1.heavy 778.468 / 970.568 3663.0 52.62030029296875 43 17 10 6 10 3.9295028802624374 25.448511694008825 0.0355987548828125 3 0.9795331822841757 8.61179523574457 3663.0 20.1596420852425 0.0 - - - - - - - 172.3 7 10 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1465 186 C20140708_OR008_05 C20140708_OR008_05 TB438617.[MT7]-QTVLEALQQLIR.2y9_1.heavy 778.468 / 1083.65 3879.0 52.62030029296875 43 17 10 6 10 3.9295028802624374 25.448511694008825 0.0355987548828125 3 0.9795331822841757 8.61179523574457 3879.0 80.52015503875968 0.0 - - - - - - - 140.1 7 10 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1467 186 C20140708_OR008_05 C20140708_OR008_05 TB438617.[MT7]-QTVLEALQQLIR.2y10_1.heavy 778.468 / 1182.72 1239.0 52.62030029296875 43 17 10 6 10 3.9295028802624374 25.448511694008825 0.0355987548828125 3 0.9795331822841757 8.61179523574457 1239.0 5.5322790697674415 0.0 - - - - - - - 188.5 2 6 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1469 186 C20140708_OR008_05 C20140708_OR008_05 TB438617.[MT7]-QTVLEALQQLIR.2y7_1.heavy 778.468 / 841.525 1832.0 52.62030029296875 43 17 10 6 10 3.9295028802624374 25.448511694008825 0.0355987548828125 3 0.9795331822841757 8.61179523574457 1832.0 27.14074074074074 0.0 - - - - - - - 192.28571428571428 3 7 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1471 187 C20140708_OR008_05 C20140708_OR008_05 TB438619.[MT7]-HSQPATPTPLQSR.2y5_1.heavy 782.422 / 600.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDLIM7 PDZ and LIM domain 7 (enigma) 1473 187 C20140708_OR008_05 C20140708_OR008_05 TB438619.[MT7]-HSQPATPTPLQSR.2y9_1.heavy 782.422 / 970.532 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDLIM7 PDZ and LIM domain 7 (enigma) 1475 187 C20140708_OR008_05 C20140708_OR008_05 TB438619.[MT7]-HSQPATPTPLQSR.2y10_1.heavy 782.422 / 1067.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDLIM7 PDZ and LIM domain 7 (enigma) 1477 187 C20140708_OR008_05 C20140708_OR008_05 TB438619.[MT7]-HSQPATPTPLQSR.2y7_1.heavy 782.422 / 798.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDLIM7 PDZ and LIM domain 7 (enigma) 1479 188 C20140708_OR008_05 C20140708_OR008_05 TB430674.[MT7]-MRSPPGENPSPQGELPSPESSRR.4b8_1.heavy 659.83 / 1013.5 3210.0 24.545674800872803 36 11 10 5 10 1.403899391569772 71.23017546733521 0.04129981994628906 3 0.8677184544974115 3.3550946990262007 3210.0 36.52633880274071 0.0 - - - - - - - 175.28571428571428 6 7 ZNF496 zinc finger protein 496 1481 188 C20140708_OR008_05 C20140708_OR008_05 TB430674.[MT7]-MRSPPGENPSPQGELPSPESSRR.4y8_1.heavy 659.83 / 915.464 661.0 24.545674800872803 36 11 10 5 10 1.403899391569772 71.23017546733521 0.04129981994628906 3 0.8677184544974115 3.3550946990262007 661.0 4.72390020004861 1.0 - - - - - - - 0.0 1 0 ZNF496 zinc finger protein 496 1483 188 C20140708_OR008_05 C20140708_OR008_05 TB430674.[MT7]-MRSPPGENPSPQGELPSPESSRR.4b7_1.heavy 659.83 / 899.453 944.0 24.545674800872803 36 11 10 5 10 1.403899391569772 71.23017546733521 0.04129981994628906 3 0.8677184544974115 3.3550946990262007 944.0 0.16067747261384235 3.0 - - - - - - - 150.8 3 5 ZNF496 zinc finger protein 496 1485 188 C20140708_OR008_05 C20140708_OR008_05 TB430674.[MT7]-MRSPPGENPSPQGELPSPESSRR.4y13_2.heavy 659.83 / 720.365 6704.0 24.545674800872803 36 11 10 5 10 1.403899391569772 71.23017546733521 0.04129981994628906 3 0.8677184544974115 3.3550946990262007 6704.0 41.38139599024296 0.0 - - - - - - - 173.0 13 6 ZNF496 zinc finger protein 496 1487 189 C20140708_OR008_05 C20140708_OR008_05 TB438810.[MT7]-K[MT7]PTWIC[CAM]PVC[CAM]DK[MT7]K[MT7].4y5_1.heavy 527.802 / 937.538 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIAS2 protein inhibitor of activated STAT, 2 1489 189 C20140708_OR008_05 C20140708_OR008_05 TB438810.[MT7]-K[MT7]PTWIC[CAM]PVC[CAM]DK[MT7]K[MT7].4y4_1.heavy 527.802 / 838.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIAS2 protein inhibitor of activated STAT, 2 1491 189 C20140708_OR008_05 C20140708_OR008_05 TB438810.[MT7]-K[MT7]PTWIC[CAM]PVC[CAM]DK[MT7]K[MT7].4y6_2.heavy 527.802 / 517.799 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIAS2 protein inhibitor of activated STAT, 2 1493 189 C20140708_OR008_05 C20140708_OR008_05 TB438810.[MT7]-K[MT7]PTWIC[CAM]PVC[CAM]DK[MT7]K[MT7].4y6_1.heavy 527.802 / 1034.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - PIAS2 protein inhibitor of activated STAT, 2 1495 190 C20140708_OR008_05 C20140708_OR008_05 TB438430.[MT7]-SVFSQSGNSR.2y8_1.heavy 606.808 / 882.406 2132.0 22.09195041656494 36 14 10 6 6 3.0409274235121324 32.884704589399426 0.03289985656738281 5 0.9387573122359225 4.961277135320745 2132.0 16.134054054054054 0.0 - - - - - - - 185.25 4 4 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1497 190 C20140708_OR008_05 C20140708_OR008_05 TB438430.[MT7]-SVFSQSGNSR.2y9_1.heavy 606.808 / 981.475 1761.0 22.09195041656494 36 14 10 6 6 3.0409274235121324 32.884704589399426 0.03289985656738281 5 0.9387573122359225 4.961277135320745 1761.0 0.0 0.0 - - - - - - - 139.0 3 4 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1499 190 C20140708_OR008_05 C20140708_OR008_05 TB438430.[MT7]-SVFSQSGNSR.2b9_1.heavy 606.808 / 1038.5 185.0 22.09195041656494 36 14 10 6 6 3.0409274235121324 32.884704589399426 0.03289985656738281 5 0.9387573122359225 4.961277135320745 185.0 0.1330935251798561 19.0 - - - - - - - 0.0 1 0 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1501 190 C20140708_OR008_05 C20140708_OR008_05 TB438430.[MT7]-SVFSQSGNSR.2y7_1.heavy 606.808 / 735.338 742.0 22.09195041656494 36 14 10 6 6 3.0409274235121324 32.884704589399426 0.03289985656738281 5 0.9387573122359225 4.961277135320745 742.0 1.0676258992805756 3.0 - - - - - - - 154.66666666666666 2 9 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1503 191 C20140708_OR008_05 C20140708_OR008_05 TB438648.[MT7]-GGVSYRPAEVAETGA.3b9_2.heavy 536.61 / 531.278 8552.0 26.82170057296753 42 16 10 6 10 9.028403143377163 11.076155817582823 0.03800010681152344 3 0.9666582125945237 6.739905489498726 8552.0 18.274495961333876 0.0 - - - - - - - 677.75 17 8 CA9 carbonic anhydrase IX 1505 191 C20140708_OR008_05 C20140708_OR008_05 TB438648.[MT7]-GGVSYRPAEVAETGA.3b9_1.heavy 536.61 / 1061.55 521.0 26.82170057296753 42 16 10 6 10 9.028403143377163 11.076155817582823 0.03800010681152344 3 0.9666582125945237 6.739905489498726 521.0 1.5813099041533545 2.0 - - - - - - - 0.0 1 0 CA9 carbonic anhydrase IX 1507 191 C20140708_OR008_05 C20140708_OR008_05 TB438648.[MT7]-GGVSYRPAEVAETGA.3b11_2.heavy 536.61 / 616.331 6466.0 26.82170057296753 42 16 10 6 10 9.028403143377163 11.076155817582823 0.03800010681152344 3 0.9666582125945237 6.739905489498726 6466.0 42.29630614662638 0.0 - - - - - - - 201.66666666666666 12 15 CA9 carbonic anhydrase IX 1509 191 C20140708_OR008_05 C20140708_OR008_05 TB438648.[MT7]-GGVSYRPAEVAETGA.3b10_2.heavy 536.61 / 580.813 5110.0 26.82170057296753 42 16 10 6 10 9.028403143377163 11.076155817582823 0.03800010681152344 3 0.9666582125945237 6.739905489498726 5110.0 18.262045871939684 0.0 - - - - - - - 250.2 10 5 CA9 carbonic anhydrase IX 1511 192 C20140708_OR008_05 C20140708_OR008_05 TB430661.[MT7]-GLLGSVMLDLDVLRGHPPAETLP.4b16_2.heavy 636.855 / 911.012 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1513 192 C20140708_OR008_05 C20140708_OR008_05 TB430661.[MT7]-GLLGSVMLDLDVLRGHPPAETLP.4b7_1.heavy 636.855 / 802.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1515 192 C20140708_OR008_05 C20140708_OR008_05 TB430661.[MT7]-GLLGSVMLDLDVLRGHPPAETLP.4b14_2.heavy 636.855 / 813.972 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1517 192 C20140708_OR008_05 C20140708_OR008_05 TB430661.[MT7]-GLLGSVMLDLDVLRGHPPAETLP.4b6_1.heavy 636.855 / 671.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1519 193 C20140708_OR008_05 C20140708_OR008_05 TB438644.[MT7]-GAIFC[CAM]PPC[CAM]YDVR.2y8_1.heavy 799.882 / 1066.44 3561.0 35.2451753616333 35 14 10 1 10 2.3076912098283824 35.728028390524315 0.09129714965820312 3 0.9428373622794318 5.137069317780678 3561.0 8.401685582522127 0.0 - - - - - - - 321.3333333333333 7 6 PDLIM7 PDZ and LIM domain 7 (enigma) 1521 193 C20140708_OR008_05 C20140708_OR008_05 TB438644.[MT7]-GAIFC[CAM]PPC[CAM]YDVR.2y9_1.heavy 799.882 / 1213.51 1781.0 35.2451753616333 35 14 10 1 10 2.3076912098283824 35.728028390524315 0.09129714965820312 3 0.9428373622794318 5.137069317780678 1781.0 1.5435038011917248 0.0 - - - - - - - 267.0 3 5 PDLIM7 PDZ and LIM domain 7 (enigma) 1523 193 C20140708_OR008_05 C20140708_OR008_05 TB438644.[MT7]-GAIFC[CAM]PPC[CAM]YDVR.2b4_1.heavy 799.882 / 533.32 4451.0 35.2451753616333 35 14 10 1 10 2.3076912098283824 35.728028390524315 0.09129714965820312 3 0.9428373622794318 5.137069317780678 4451.0 4.385122057769934 0.0 - - - - - - - 321.5 8 6 PDLIM7 PDZ and LIM domain 7 (enigma) 1525 193 C20140708_OR008_05 C20140708_OR008_05 TB438644.[MT7]-GAIFC[CAM]PPC[CAM]YDVR.2y7_1.heavy 799.882 / 906.414 6826.0 35.2451753616333 35 14 10 1 10 2.3076912098283824 35.728028390524315 0.09129714965820312 3 0.9428373622794318 5.137069317780678 6826.0 47.40855161360821 0.0 - - - - - - - 296.6666666666667 13 3 PDLIM7 PDZ and LIM domain 7 (enigma) 1527 194 C20140708_OR008_05 C20140708_OR008_05 TB438641.[MT7]-NASIHTLLDALER.3y7_1.heavy 532.966 / 829.478 3371.0 41.78329944610596 38 13 10 5 10 2.4728272588316194 32.184766763216615 0.042797088623046875 3 0.9114807743936311 4.117054849213229 3371.0 36.70644444444444 0.0 - - - - - - - 270.0 6 3 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1529 194 C20140708_OR008_05 C20140708_OR008_05 TB438641.[MT7]-NASIHTLLDALER.3y6_1.heavy 532.966 / 716.394 2967.0 41.78329944610596 38 13 10 5 10 2.4728272588316194 32.184766763216615 0.042797088623046875 3 0.9114807743936311 4.117054849213229 2967.0 21.77777777777778 1.0 - - - - - - - 270.0 5 3 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1531 194 C20140708_OR008_05 C20140708_OR008_05 TB438641.[MT7]-NASIHTLLDALER.3b4_1.heavy 532.966 / 530.305 6877.0 41.78329944610596 38 13 10 5 10 2.4728272588316194 32.184766763216615 0.042797088623046875 3 0.9114807743936311 4.117054849213229 6877.0 37.35654320987655 0.0 - - - - - - - 303.75 13 4 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1533 194 C20140708_OR008_05 C20140708_OR008_05 TB438641.[MT7]-NASIHTLLDALER.3y5_1.heavy 532.966 / 603.31 5798.0 41.78329944610596 38 13 10 5 10 2.4728272588316194 32.184766763216615 0.042797088623046875 3 0.9114807743936311 4.117054849213229 5798.0 31.49530864197531 0.0 - - - - - - - 202.5 11 2 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1535 195 C20140708_OR008_05 C20140708_OR008_05 TB438439.[MT7]-YSSPGLTSK[MT7].3b6_1.heavy 409.899 / 749.395 283.0 23.835124969482422 34 12 10 6 6 0.9162783805195117 66.2534151239017 0.0364990234375 6 0.889125912227353 3.6715590818957713 283.0 3.609580096814139 2.0 - - - - - - - 0.0 0 0 MAPKAP1 mitogen-activated protein kinase associated protein 1 1537 195 C20140708_OR008_05 C20140708_OR008_05 TB438439.[MT7]-YSSPGLTSK[MT7].3y3_1.heavy 409.899 / 479.295 3399.0 23.835124969482422 34 12 10 6 6 0.9162783805195117 66.2534151239017 0.0364990234375 6 0.889125912227353 3.6715590818957713 3399.0 36.14731698521457 0.0 - - - - - - - 242.71428571428572 6 7 MAPKAP1 mitogen-activated protein kinase associated protein 1 1539 195 C20140708_OR008_05 C20140708_OR008_05 TB438439.[MT7]-YSSPGLTSK[MT7].3b5_1.heavy 409.899 / 636.311 1133.0 23.835124969482422 34 12 10 6 6 0.9162783805195117 66.2534151239017 0.0364990234375 6 0.889125912227353 3.6715590818957713 1133.0 11.571063829787233 2.0 - - - - - - - 220.33333333333334 6 6 MAPKAP1 mitogen-activated protein kinase associated protein 1 1541 195 C20140708_OR008_05 C20140708_OR008_05 TB438439.[MT7]-YSSPGLTSK[MT7].3b3_1.heavy 409.899 / 482.237 1983.0 23.835124969482422 34 12 10 6 6 0.9162783805195117 66.2534151239017 0.0364990234375 6 0.889125912227353 3.6715590818957713 1983.0 10.387142857142857 1.0 - - - - - - - 212.5 4 4 MAPKAP1 mitogen-activated protein kinase associated protein 1 1543 196 C20140708_OR008_05 C20140708_OR008_05 TB438501.[MT7]-AFTDSSGLIK[MT7].3y3_1.heavy 442.922 / 517.383 1674.0 31.30620002746582 40 10 10 10 10 0.846854803832448 72.13113833674743 0.0 3 0.8489577242306626 3.1346474706796736 1674.0 3.997611940298508 1.0 - - - - - - - 287.0 3 14 ZNF559 zinc finger protein 559 1545 196 C20140708_OR008_05 C20140708_OR008_05 TB438501.[MT7]-AFTDSSGLIK[MT7].3b4_1.heavy 442.922 / 579.289 1897.0 31.30620002746582 40 10 10 10 10 0.846854803832448 72.13113833674743 0.0 3 0.8489577242306626 3.1346474706796736 1897.0 12.760089686098656 0.0 - - - - - - - 223.25 3 8 ZNF559 zinc finger protein 559 1547 196 C20140708_OR008_05 C20140708_OR008_05 TB438501.[MT7]-AFTDSSGLIK[MT7].3y4_1.heavy 442.922 / 574.404 2343.0 31.30620002746582 40 10 10 10 10 0.846854803832448 72.13113833674743 0.0 3 0.8489577242306626 3.1346474706796736 2343.0 15.349397654584221 0.0 - - - - - - - 269.6666666666667 4 12 ZNF559 zinc finger protein 559 1549 196 C20140708_OR008_05 C20140708_OR008_05 TB438501.[MT7]-AFTDSSGLIK[MT7].3b7_1.heavy 442.922 / 810.375 446.0 31.30620002746582 40 10 10 10 10 0.846854803832448 72.13113833674743 0.0 3 0.8489577242306626 3.1346474706796736 446.0 0.7248358208955223 2.0 - - - - - - - 0.0 0 0 ZNF559 zinc finger protein 559 1551 197 C20140708_OR008_05 C20140708_OR008_05 TB448751.[MT7]-NVIFTNC[CAM]VK[MT7].2y5_1.heavy 691.889 / 765.404 3331.0 30.819200038909912 44 18 10 6 10 2.959423972931352 28.004005730514272 0.03280067443847656 3 0.9809376909465415 8.92446734648375 3331.0 14.118174791600717 0.0 - - - - - - - 225.33333333333334 6 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1553 197 C20140708_OR008_05 C20140708_OR008_05 TB448751.[MT7]-NVIFTNC[CAM]VK[MT7].2y3_1.heavy 691.889 / 550.314 2394.0 30.819200038909912 44 18 10 6 10 2.959423972931352 28.004005730514272 0.03280067443847656 3 0.9809376909465415 8.92446734648375 2394.0 21.982674531351 0.0 - - - - - - - 698.8571428571429 4 7 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1555 197 C20140708_OR008_05 C20140708_OR008_05 TB448751.[MT7]-NVIFTNC[CAM]VK[MT7].2y6_1.heavy 691.889 / 912.473 5516.0 30.819200038909912 44 18 10 6 10 2.959423972931352 28.004005730514272 0.03280067443847656 3 0.9809376909465415 8.92446734648375 5516.0 50.03249568816833 0.0 - - - - - - - 148.57142857142858 11 7 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1557 197 C20140708_OR008_05 C20140708_OR008_05 TB448751.[MT7]-NVIFTNC[CAM]VK[MT7].2y7_1.heavy 691.889 / 1025.56 3955.0 30.819200038909912 44 18 10 6 10 2.959423972931352 28.004005730514272 0.03280067443847656 3 0.9809376909465415 8.92446734648375 3955.0 40.690865384615385 0.0 - - - - - - - 163.42857142857142 7 7 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1559 198 C20140708_OR008_05 C20140708_OR008_05 TB448750.[MT7]-IQDLLVDSGK[MT7].2y4_1.heavy 688.405 / 550.295 4266.0 36.313201904296875 50 20 10 10 10 6.8206796658738025 14.66129548647978 0.0 3 0.9939864013139185 15.90659665783504 4266.0 10.889821699427332 0.0 - - - - - - - 300.0 8 9 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1561 198 C20140708_OR008_05 C20140708_OR008_05 TB448750.[MT7]-IQDLLVDSGK[MT7].2b3_1.heavy 688.405 / 501.279 9385.0 36.313201904296875 50 20 10 10 10 6.8206796658738025 14.66129548647978 0.0 3 0.9939864013139185 15.90659665783504 9385.0 19.139153258441517 0.0 - - - - - - - 189.33333333333334 18 6 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1563 198 C20140708_OR008_05 C20140708_OR008_05 TB448750.[MT7]-IQDLLVDSGK[MT7].2b4_1.heavy 688.405 / 614.363 5119.0 36.313201904296875 50 20 10 10 10 6.8206796658738025 14.66129548647978 0.0 3 0.9939864013139185 15.90659665783504 5119.0 27.552383893525086 0.0 - - - - - - - 331.8888888888889 10 9 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1565 198 C20140708_OR008_05 C20140708_OR008_05 TB448750.[MT7]-IQDLLVDSGK[MT7].2y6_1.heavy 688.405 / 762.448 3413.0 36.313201904296875 50 20 10 10 10 6.8206796658738025 14.66129548647978 0.0 3 0.9939864013139185 15.90659665783504 3413.0 6.26439570435658 0.0 - - - - - - - 284.375 6 8 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1567 199 C20140708_OR008_05 C20140708_OR008_05 TB430256.[MT7]-SFTQNYDLLR.2y8_1.heavy 700.868 / 1022.53 3722.0 35.47639846801758 46 16 10 10 10 1.987081223146951 34.686539619376575 0.0 3 0.9682239520433986 6.904872383036318 3722.0 34.097516778523485 0.0 - - - - - - - 223.5 7 2 ZNF496 zinc finger protein 496 1569 199 C20140708_OR008_05 C20140708_OR008_05 TB430256.[MT7]-SFTQNYDLLR.2y9_1.heavy 700.868 / 1169.59 2531.0 35.47639846801758 46 16 10 10 10 1.987081223146951 34.686539619376575 0.0 3 0.9682239520433986 6.904872383036318 2531.0 25.479865771812083 0.0 - - - - - - - 212.85714285714286 5 7 ZNF496 zinc finger protein 496 1571 199 C20140708_OR008_05 C20140708_OR008_05 TB430256.[MT7]-SFTQNYDLLR.2b7_1.heavy 700.868 / 1000.45 2680.0 35.47639846801758 46 16 10 10 10 1.987081223146951 34.686539619376575 0.0 3 0.9682239520433986 6.904872383036318 2680.0 17.08724832214765 0.0 - - - - - - - 238.4 5 5 ZNF496 zinc finger protein 496 1573 199 C20140708_OR008_05 C20140708_OR008_05 TB430256.[MT7]-SFTQNYDLLR.2b5_1.heavy 700.868 / 722.359 2233.0 35.47639846801758 46 16 10 10 10 1.987081223146951 34.686539619376575 0.0 3 0.9682239520433986 6.904872383036318 2233.0 3.242310111067908 0.0 - - - - - - - 223.5 4 4 ZNF496 zinc finger protein 496 1575 200 C20140708_OR008_05 C20140708_OR008_05 TB438435.[MT7]-DVALSVLSK[MT7].2y5_1.heavy 610.379 / 677.431 1780.0 34.93119812011719 41 11 10 10 10 1.4242684600566529 55.277014588418616 0.0 3 0.8776657260009285 3.4918701390466698 1780.0 2.8416863406408095 1.0 - - - - - - - 313.22222222222223 4 9 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1577 200 C20140708_OR008_05 C20140708_OR008_05 TB438435.[MT7]-DVALSVLSK[MT7].2b4_1.heavy 610.379 / 543.326 3116.0 34.93119812011719 41 11 10 10 10 1.4242684600566529 55.277014588418616 0.0 3 0.8776657260009285 3.4918701390466698 3116.0 7.233496470695165 0.0 - - - - - - - 360.2857142857143 6 7 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1579 200 C20140708_OR008_05 C20140708_OR008_05 TB438435.[MT7]-DVALSVLSK[MT7].2b5_1.heavy 610.379 / 630.358 1484.0 34.93119812011719 41 11 10 10 10 1.4242684600566529 55.277014588418616 0.0 3 0.8776657260009285 3.4918701390466698 1484.0 6.299633547390714 4.0 - - - - - - - 296.6 2 5 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1581 200 C20140708_OR008_05 C20140708_OR008_05 TB438435.[MT7]-DVALSVLSK[MT7].2y7_1.heavy 610.379 / 861.553 890.0 34.93119812011719 41 11 10 10 10 1.4242684600566529 55.277014588418616 0.0 3 0.8776657260009285 3.4918701390466698 890.0 4.016835016835016 6.0 - - - - - - - 356.2 2 5 CDC27 cell division cycle 27 homolog (S. cerevisiae) 1583 201 C20140708_OR008_05 C20140708_OR008_05 TB438709.[MT7]-SPMQEEEDLAAGVGR.3y6_1.heavy 578.281 / 530.305 13579.0 34.406700134277344 43 18 10 5 10 10.57915912643558 9.452547107464943 0.040802001953125 3 0.9884499597852687 11.472332451343135 13579.0 4.165370798454611 0.0 - - - - - - - 264.0 27 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1585 201 C20140708_OR008_05 C20140708_OR008_05 TB438709.[MT7]-SPMQEEEDLAAGVGR.3b4_1.heavy 578.281 / 588.293 5142.0 34.406700134277344 43 18 10 5 10 10.57915912643558 9.452547107464943 0.040802001953125 3 0.9884499597852687 11.472332451343135 5142.0 1.1266544979332092 1.0 - - - - - - - 286.0 10 6 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1587 201 C20140708_OR008_05 C20140708_OR008_05 TB438709.[MT7]-SPMQEEEDLAAGVGR.3b5_1.heavy 578.281 / 717.336 5801.0 34.406700134277344 43 18 10 5 10 10.57915912643558 9.452547107464943 0.040802001953125 3 0.9884499597852687 11.472332451343135 5801.0 5.59906945579343 0.0 - - - - - - - 290.4 11 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1589 201 C20140708_OR008_05 C20140708_OR008_05 TB438709.[MT7]-SPMQEEEDLAAGVGR.3b8_1.heavy 578.281 / 1090.45 6592.0 34.406700134277344 43 18 10 5 10 10.57915912643558 9.452547107464943 0.040802001953125 3 0.9884499597852687 11.472332451343135 6592.0 30.805850668505535 0.0 - - - - - - - 308.0 13 3 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1591 202 C20140708_OR008_05 C20140708_OR008_05 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 105662.0 40.37770080566406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 105662.0 460.77615620365793 0.0 - - - - - - - 305.44444444444446 211 9 1593 202 C20140708_OR008_05 C20140708_OR008_05 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 158348.0 40.37770080566406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 158348.0 728.2754753484103 0.0 - - - - - - - 361.5 316 4 1595 202 C20140708_OR008_05 C20140708_OR008_05 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 197428.0 40.37770080566406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 197428.0 1329.2574632486387 0.0 - - - - - - - 241.0 394 3 1597 203 C20140708_OR008_05 C20140708_OR008_05 TB438508.[MT7]-FRYQEAAGPR.3b6_2.heavy 446.906 / 470.244 2749.0 22.79640007019043 46 16 10 10 10 5.928272687465675 16.868319875270412 0.0 3 0.9608525417057335 6.217037850344163 2749.0 48.40630434782609 0.0 - - - - - - - 183.375 5 8 ZNF496 zinc finger protein 496 1599 203 C20140708_OR008_05 C20140708_OR008_05 TB438508.[MT7]-FRYQEAAGPR.3y6_1.heavy 446.906 / 600.31 1924.0 22.79640007019043 46 16 10 10 10 5.928272687465675 16.868319875270412 0.0 3 0.9608525417057335 6.217037850344163 1924.0 14.661944664031621 0.0 - - - - - - - 235.57142857142858 3 7 ZNF496 zinc finger protein 496 1601 203 C20140708_OR008_05 C20140708_OR008_05 TB438508.[MT7]-FRYQEAAGPR.3b3_1.heavy 446.906 / 611.342 1008.0 22.79640007019043 46 16 10 10 10 5.928272687465675 16.868319875270412 0.0 3 0.9608525417057335 6.217037850344163 1008.0 4.382608695652174 0.0 - - - - - - - 168.0 2 6 ZNF496 zinc finger protein 496 1603 203 C20140708_OR008_05 C20140708_OR008_05 TB438508.[MT7]-FRYQEAAGPR.3y5_1.heavy 446.906 / 471.267 4123.0 22.79640007019043 46 16 10 10 10 5.928272687465675 16.868319875270412 0.0 3 0.9608525417057335 6.217037850344163 4123.0 24.413134321235116 0.0 - - - - - - - 197.3846153846154 8 13 ZNF496 zinc finger protein 496 1605 204 C20140708_OR008_05 C20140708_OR008_05 TB448468.[MT7]-SNTAQRLER.3y3_1.heavy 406.894 / 417.246 3899.0 16.187299728393555 45 15 10 10 10 2.0857910248712126 47.94344150856365 0.0 3 0.9545249953003745 5.7652255473021325 3899.0 28.289958040413705 0.0 - - - - - - - 184.75 7 12 MAPKAP1 mitogen-activated protein kinase associated protein 1 1607 204 C20140708_OR008_05 C20140708_OR008_05 TB448468.[MT7]-SNTAQRLER.3b4_1.heavy 406.894 / 518.269 874.0 16.187299728393555 45 15 10 10 10 2.0857910248712126 47.94344150856365 0.0 3 0.9545249953003745 5.7652255473021325 874.0 9.414841140830502 1.0 - - - - - - - 134.33333333333334 5 6 MAPKAP1 mitogen-activated protein kinase associated protein 1 1609 204 C20140708_OR008_05 C20140708_OR008_05 TB448468.[MT7]-SNTAQRLER.3b3_1.heavy 406.894 / 447.232 1882.0 16.187299728393555 45 15 10 10 10 2.0857910248712126 47.94344150856365 0.0 3 0.9545249953003745 5.7652255473021325 1882.0 33.54351994673473 0.0 - - - - - - - 161.2 3 5 MAPKAP1 mitogen-activated protein kinase associated protein 1 1611 204 C20140708_OR008_05 C20140708_OR008_05 TB448468.[MT7]-SNTAQRLER.3b8_2.heavy 406.894 / 522.781 1613.0 16.187299728393555 45 15 10 10 10 2.0857910248712126 47.94344150856365 0.0 3 0.9545249953003745 5.7652255473021325 1613.0 26.467759417199716 0.0 - - - - - - - 134.25 3 4 MAPKAP1 mitogen-activated protein kinase associated protein 1 1613 205 C20140708_OR008_05 C20140708_OR008_05 TB438506.[MT7]-GFAENRQPDR.2b4_1.heavy 667.34 / 549.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 1615 205 C20140708_OR008_05 C20140708_OR008_05 TB438506.[MT7]-GFAENRQPDR.2b9_2.heavy 667.34 / 580.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 1617 205 C20140708_OR008_05 C20140708_OR008_05 TB438506.[MT7]-GFAENRQPDR.2b5_1.heavy 667.34 / 663.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 1619 205 C20140708_OR008_05 C20140708_OR008_05 TB438506.[MT7]-GFAENRQPDR.2b9_1.heavy 667.34 / 1159.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - CABP1 calcium binding protein 1 1621 206 C20140708_OR008_05 C20140708_OR008_05 TB430528.[MT7]-GGGRGALPTSMGQHGPSAR.4y5_1.heavy 485.252 / 487.262 10130.0 21.048675060272217 41 18 10 3 10 7.112437675643703 14.059877156104518 0.07530021667480469 3 0.9801802963309317 8.751729210664688 10130.0 55.94005723744564 0.0 - - - - - - - 182.83333333333334 20 6 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1623 206 C20140708_OR008_05 C20140708_OR008_05 TB430528.[MT7]-GGGRGALPTSMGQHGPSAR.4b7_1.heavy 485.252 / 713.417 1369.0 21.048675060272217 41 18 10 3 10 7.112437675643703 14.059877156104518 0.07530021667480469 3 0.9801802963309317 8.751729210664688 1369.0 14.423604395604395 1.0 - - - - - - - 251.0 2 4 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1625 206 C20140708_OR008_05 C20140708_OR008_05 TB430528.[MT7]-GGGRGALPTSMGQHGPSAR.4y6_1.heavy 485.252 / 624.321 2099.0 21.048675060272217 41 18 10 3 10 7.112437675643703 14.059877156104518 0.07530021667480469 3 0.9801802963309317 8.751729210664688 2099.0 26.28605986119144 0.0 - - - - - - - 167.16666666666666 4 6 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1627 206 C20140708_OR008_05 C20140708_OR008_05 TB430528.[MT7]-GGGRGALPTSMGQHGPSAR.4b10_2.heavy 485.252 / 499.779 3194.0 21.048675060272217 41 18 10 3 10 7.112437675643703 14.059877156104518 0.07530021667480469 3 0.9801802963309317 8.751729210664688 3194.0 17.104480874316938 0.0 - - - - - - - 130.42857142857142 6 7 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1629 207 C20140708_OR008_05 C20140708_OR008_05 TB438952.[MT7]-VLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTK[MT7].4y5_1.heavy 1130.83 / 711.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 1631 207 C20140708_OR008_05 C20140708_OR008_05 TB438952.[MT7]-VLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTK[MT7].4y9_1.heavy 1130.83 / 1155.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 1633 207 C20140708_OR008_05 C20140708_OR008_05 TB438952.[MT7]-VLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTK[MT7].4y6_1.heavy 1130.83 / 812.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 1635 207 C20140708_OR008_05 C20140708_OR008_05 TB438952.[MT7]-VLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTK[MT7].4y3_1.heavy 1130.83 / 539.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 1637 208 C20140708_OR008_05 C20140708_OR008_05 TB438846.[MT7]-EPPTDVTPTFLTTGVLSTLR.3y7_1.heavy 763.753 / 745.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - GMPS guanine monphosphate synthetase 1639 208 C20140708_OR008_05 C20140708_OR008_05 TB438846.[MT7]-EPPTDVTPTFLTTGVLSTLR.3b5_1.heavy 763.753 / 684.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - GMPS guanine monphosphate synthetase 1641 208 C20140708_OR008_05 C20140708_OR008_05 TB438846.[MT7]-EPPTDVTPTFLTTGVLSTLR.3y8_1.heavy 763.753 / 846.504 N/A N/A - - - - - - - - - 0.0 - - - - - - - GMPS guanine monphosphate synthetase 1643 208 C20140708_OR008_05 C20140708_OR008_05 TB438846.[MT7]-EPPTDVTPTFLTTGVLSTLR.3y9_1.heavy 763.753 / 947.552 N/A N/A - - - - - - - - - 0.0 - - - - - - - GMPS guanine monphosphate synthetase 1645 209 C20140708_OR008_05 C20140708_OR008_05 TB430527.[MT7]-QLNTALPQEFAALTK[MT7].4b4_1.heavy 484.03 / 601.343 777.0 41.772600173950195 29 14 2 5 8 1.1655558926741174 51.42110825011965 0.042797088623046875 4 0.9319158125852265 4.702662860506592 777.0 5.298769230769231 1.0 - - - - - - - 0.0 1 0 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1647 209 C20140708_OR008_05 C20140708_OR008_05 TB430527.[MT7]-QLNTALPQEFAALTK[MT7].4b5_1.heavy 484.03 / 672.38 1166.0 41.772600173950195 29 14 2 5 8 1.1655558926741174 51.42110825011965 0.042797088623046875 4 0.9319158125852265 4.702662860506592 1166.0 10.767688352778327 1.0 - - - - - - - 389.0 5 1 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1649 209 C20140708_OR008_05 C20140708_OR008_05 TB430527.[MT7]-QLNTALPQEFAALTK[MT7].4b6_1.heavy 484.03 / 785.464 389.0 41.772600173950195 29 14 2 5 8 1.1655558926741174 51.42110825011965 0.042797088623046875 4 0.9319158125852265 4.702662860506592 389.0 5.939730769230769 0.0 - - - - - - - 0.0 0 0 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1651 209 C20140708_OR008_05 C20140708_OR008_05 TB430527.[MT7]-QLNTALPQEFAALTK[MT7].4b3_1.heavy 484.03 / 500.295 518.0 41.772600173950195 29 14 2 5 8 1.1655558926741174 51.42110825011965 0.042797088623046875 4 0.9319158125852265 4.702662860506592 518.0 1.198286203941731 5.0 - - - - - - - 0.0 1 0 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1653 210 C20140708_OR008_05 C20140708_OR008_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 124906.0 35.52239990234375 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 124906.0 176.13750721186844 0.0 - - - - - - - 235.0 249 2 1655 210 C20140708_OR008_05 C20140708_OR008_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 30247.0 35.52239990234375 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 30247.0 158.54354368839645 1.0 - - - - - - - 290.85714285714283 68 7 1657 210 C20140708_OR008_05 C20140708_OR008_05 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 30404.0 35.52239990234375 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 30404.0 93.15268085106382 0.0 - - - - - - - 344.8 60 5 1659 211 C20140708_OR008_05 C20140708_OR008_05 TB430664.[MT7]-SEQEITALEQNVIRLESQVSR.4y5_1.heavy 644.097 / 576.31 1511.0 46.5537748336792 41 15 10 6 10 3.1010600823917045 32.24703725278184 0.035297393798828125 3 0.9524782598478073 5.6387280509202204 1511.0 16.54904761904762 2.0 - - - - - - - 178.5 9 16 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1661 211 C20140708_OR008_05 C20140708_OR008_05 TB430664.[MT7]-SEQEITALEQNVIRLESQVSR.4b4_1.heavy 644.097 / 618.285 9823.0 46.5537748336792 41 15 10 6 10 3.1010600823917045 32.24703725278184 0.035297393798828125 3 0.9524782598478073 5.6387280509202204 9823.0 71.72349206349206 0.0 - - - - - - - 168.0 19 12 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1663 211 C20140708_OR008_05 C20140708_OR008_05 TB430664.[MT7]-SEQEITALEQNVIRLESQVSR.4y13_2.heavy 644.097 / 779.421 5541.0 46.5537748336792 41 15 10 6 10 3.1010600823917045 32.24703725278184 0.035297393798828125 3 0.9524782598478073 5.6387280509202204 5541.0 28.694464285714282 0.0 - - - - - - - 152.72727272727272 11 11 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1665 211 C20140708_OR008_05 C20140708_OR008_05 TB430664.[MT7]-SEQEITALEQNVIRLESQVSR.4y14_2.heavy 644.097 / 835.963 3610.0 46.5537748336792 41 15 10 6 10 3.1010600823917045 32.24703725278184 0.035297393798828125 3 0.9524782598478073 5.6387280509202204 3610.0 17.620238095238093 0.0 - - - - - - - 243.6 7 10 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1667 212 C20140708_OR008_05 C20140708_OR008_05 TB430663.[MT7]-SEQEITALEQNVIRLESQVSR.3y7_1.heavy 858.46 / 818.437 2678.0 46.52730178833008 50 20 10 10 10 5.601216811870262 17.853263560174476 0.0 3 0.9920342391924974 13.81847211820027 2678.0 47.435802680353575 0.0 - - - - - - - 139.55555555555554 5 9 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1669 212 C20140708_OR008_05 C20140708_OR008_05 TB430663.[MT7]-SEQEITALEQNVIRLESQVSR.3y20_2.heavy 858.46 / 1171.62 4519.0 46.52730178833008 50 20 10 10 10 5.601216811870262 17.853263560174476 0.0 3 0.9920342391924974 13.81847211820027 4519.0 19.13547846889952 0.0 - - - - - - - 237.0 9 12 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1671 212 C20140708_OR008_05 C20140708_OR008_05 TB430663.[MT7]-SEQEITALEQNVIRLESQVSR.3b4_1.heavy 858.46 / 618.285 9874.0 46.52730178833008 50 20 10 10 10 5.601216811870262 17.853263560174476 0.0 3 0.9920342391924974 13.81847211820027 9874.0 105.8455690796498 0.0 - - - - - - - 139.44444444444446 19 9 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1673 212 C20140708_OR008_05 C20140708_OR008_05 TB430663.[MT7]-SEQEITALEQNVIRLESQVSR.3y5_1.heavy 858.46 / 576.31 3682.0 46.52730178833008 50 20 10 10 10 5.601216811870262 17.853263560174476 0.0 3 0.9920342391924974 13.81847211820027 3682.0 37.92239520958084 0.0 - - - - - - - 223.16666666666666 7 12 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 1675 213 C20140708_OR008_05 C20140708_OR008_05 TB438634.[MT7]-LVDC[CAM]IIEVHDAR.3y7_1.heavy 528.616 / 839.437 7055.0 35.19990158081055 48 18 10 10 10 23.976298208353313 4.170785628832399 0.0 3 0.9882724781979805 11.385022587644688 7055.0 63.46300453514739 1.0 - - - - - - - 238.875 14 8 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1677 213 C20140708_OR008_05 C20140708_OR008_05 TB438634.[MT7]-LVDC[CAM]IIEVHDAR.3y6_1.heavy 528.616 / 726.353 20430.0 35.19990158081055 48 18 10 10 10 23.976298208353313 4.170785628832399 0.0 3 0.9882724781979805 11.385022587644688 20430.0 205.3423469387755 0.0 - - - - - - - 294.0 40 5 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1679 213 C20140708_OR008_05 C20140708_OR008_05 TB438634.[MT7]-LVDC[CAM]IIEVHDAR.3b4_1.heavy 528.616 / 632.319 25574.0 35.19990158081055 48 18 10 10 10 23.976298208353313 4.170785628832399 0.0 3 0.9882724781979805 11.385022587644688 25574.0 44.27607482993197 0.0 - - - - - - - 318.5 51 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1681 213 C20140708_OR008_05 C20140708_OR008_05 TB438634.[MT7]-LVDC[CAM]IIEVHDAR.3y5_1.heavy 528.616 / 597.31 12052.0 35.19990158081055 48 18 10 10 10 23.976298208353313 4.170785628832399 0.0 3 0.9882724781979805 11.385022587644688 12052.0 100.84326530612245 0.0 - - - - - - - 273.0 24 7 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1683 214 C20140708_OR008_05 C20140708_OR008_05 TB438635.[MT7]-LFPLPGYAPPPK[MT7].3b6_1.heavy 528.985 / 769.473 3364.0 40.547475814819336 39 20 6 5 8 9.389606377459343 10.650073707036288 0.04489898681640625 4 0.9947503466849987 17.025774753399705 3364.0 25.629205845700692 1.0 - - - - - - - 280.0 6 3 PIAS2 protein inhibitor of activated STAT, 2 1685 214 C20140708_OR008_05 C20140708_OR008_05 TB438635.[MT7]-LFPLPGYAPPPK[MT7].3b4_1.heavy 528.985 / 615.399 4625.0 40.547475814819336 39 20 6 5 8 9.389606377459343 10.650073707036288 0.04489898681640625 4 0.9947503466849987 17.025774753399705 4625.0 49.05803571428571 0.0 - - - - - - - 252.0 9 5 PIAS2 protein inhibitor of activated STAT, 2 1687 214 C20140708_OR008_05 C20140708_OR008_05 TB438635.[MT7]-LFPLPGYAPPPK[MT7].3y4_1.heavy 528.985 / 582.373 3784.0 40.547475814819336 39 20 6 5 8 9.389606377459343 10.650073707036288 0.04489898681640625 4 0.9947503466849987 17.025774753399705 3784.0 -0.06618634760996471 2.0 - - - - - - - 260.0 14 7 PIAS2 protein inhibitor of activated STAT, 2 1689 214 C20140708_OR008_05 C20140708_OR008_05 TB438635.[MT7]-LFPLPGYAPPPK[MT7].3b7_1.heavy 528.985 / 932.536 841.0 40.547475814819336 39 20 6 5 8 9.389606377459343 10.650073707036288 0.04489898681640625 4 0.9947503466849987 17.025774753399705 841.0 9.010714285714286 0.0 - - - - - - - 0.0 1 0 PIAS2 protein inhibitor of activated STAT, 2 1691 215 C20140708_OR008_05 C20140708_OR008_05 TB438303.[MT7]-MQSSLK[MT7].2y5_1.heavy 491.286 / 706.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1693 215 C20140708_OR008_05 C20140708_OR008_05 TB438303.[MT7]-MQSSLK[MT7].2b5_1.heavy 491.286 / 691.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1695 216 C20140708_OR008_05 C20140708_OR008_05 TB438630.[MT7]-MDLADLTEQQK[MT7].3b4_1.heavy 527.279 / 575.298 22833.0 34.5099983215332 46 20 6 10 10 6.287774249943766 15.90387886475001 0.0 3 0.994917900231312 17.304405261114077 22833.0 116.33957142857145 0.0 - - - - - - - 233.33333333333334 45 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1697 216 C20140708_OR008_05 C20140708_OR008_05 TB438630.[MT7]-MDLADLTEQQK[MT7].3b5_1.heavy 527.279 / 690.325 67237.0 34.5099983215332 46 20 6 10 10 6.287774249943766 15.90387886475001 0.0 3 0.994917900231312 17.304405261114077 67237.0 298.38560601427116 0.0 - - - - - - - 280.0 134 4 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1699 216 C20140708_OR008_05 C20140708_OR008_05 TB438630.[MT7]-MDLADLTEQQK[MT7].3y4_1.heavy 527.279 / 676.375 13167.0 34.5099983215332 46 20 6 10 10 6.287774249943766 15.90387886475001 0.0 3 0.994917900231312 17.304405261114077 13167.0 59.64169724770642 0.0 - - - - - - - 140.0 26 1 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1701 216 C20140708_OR008_05 C20140708_OR008_05 TB438630.[MT7]-MDLADLTEQQK[MT7].3b3_1.heavy 527.279 / 504.261 N/A 34.5099983215332 46 20 6 10 10 6.287774249943766 15.90387886475001 0.0 3 0.994917900231312 17.304405261114077 17230.0 7.2408101284607636 3.0 - - - - - - - 308.0 194 5 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1703 217 C20140708_OR008_05 C20140708_OR008_05 TB438631.[MT7]-FLRDPFSQALSR.3y6_1.heavy 527.627 / 661.363 2976.0 38.12900161743164 43 17 10 10 6 4.626963740415495 21.61244513902764 0.0 5 0.9717400460315211 7.324003485114363 2976.0 24.094571946032843 0.0 - - - - - - - 313.2 5 5 DGCR14 DiGeorge syndrome critical region gene 14 1705 217 C20140708_OR008_05 C20140708_OR008_05 TB438631.[MT7]-FLRDPFSQALSR.3y11_2.heavy 527.627 / 645.352 783.0 38.12900161743164 43 17 10 10 6 4.626963740415495 21.61244513902764 0.0 5 0.9717400460315211 7.324003485114363 783.0 3.059666576031541 2.0 - - - - - - - 196.0 2 8 DGCR14 DiGeorge syndrome critical region gene 14 1707 217 C20140708_OR008_05 C20140708_OR008_05 TB438631.[MT7]-FLRDPFSQALSR.3y8_1.heavy 527.627 / 905.484 2976.0 38.12900161743164 43 17 10 10 6 4.626963740415495 21.61244513902764 0.0 5 0.9717400460315211 7.324003485114363 2976.0 7.9167850995853435 0.0 - - - - - - - 940.0 5 1 DGCR14 DiGeorge syndrome critical region gene 14 1709 217 C20140708_OR008_05 C20140708_OR008_05 TB438631.[MT7]-FLRDPFSQALSR.3y5_1.heavy 527.627 / 574.331 1096.0 38.12900161743164 43 17 10 10 6 4.626963740415495 21.61244513902764 0.0 5 0.9717400460315211 7.324003485114363 1096.0 0.10500877077644566 5.0 - - - - - - - 313.5 3 2 DGCR14 DiGeorge syndrome critical region gene 14 1711 218 C20140708_OR008_05 C20140708_OR008_05 TB448863.[MT7]-FFIFALTPQQVR.2b3_1.heavy 805.962 / 552.33 3466.0 48.99832534790039 44 18 10 6 10 20.18872461858084 4.953259895771934 0.03289794921875 3 0.9841552926271206 9.791407966921277 3466.0 -3.4232098765432113 2.0 - - - - - - - 188.0 6 3 PIAS2 protein inhibitor of activated STAT, 2 1713 218 C20140708_OR008_05 C20140708_OR008_05 TB448863.[MT7]-FFIFALTPQQVR.2y8_1.heavy 805.962 / 912.526 2257.0 48.99832534790039 44 18 10 6 10 20.18872461858084 4.953259895771934 0.03289794921875 3 0.9841552926271206 9.791407966921277 2257.0 0.0 0.0 - - - - - - - 241.5 4 4 PIAS2 protein inhibitor of activated STAT, 2 1715 218 C20140708_OR008_05 C20140708_OR008_05 TB448863.[MT7]-FFIFALTPQQVR.2y5_1.heavy 805.962 / 627.357 2741.0 48.99832534790039 44 18 10 6 10 20.18872461858084 4.953259895771934 0.03289794921875 3 0.9841552926271206 9.791407966921277 2741.0 -2.4278122232063772 0.0 - - - - - - - 215.0 5 3 PIAS2 protein inhibitor of activated STAT, 2 1717 218 C20140708_OR008_05 C20140708_OR008_05 TB448863.[MT7]-FFIFALTPQQVR.2y9_1.heavy 805.962 / 1059.59 6368.0 48.99832534790039 44 18 10 6 10 20.18872461858084 4.953259895771934 0.03289794921875 3 0.9841552926271206 9.791407966921277 6368.0 -1.3157024793388459 0.0 - - - - - - - 282.25 12 4 PIAS2 protein inhibitor of activated STAT, 2 1719 219 C20140708_OR008_05 C20140708_OR008_05 TB438632.[MT7]-VTQPELIQTHK[MT7].2y4_1.heavy 791.464 / 657.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1721 219 C20140708_OR008_05 C20140708_OR008_05 TB438632.[MT7]-VTQPELIQTHK[MT7].2y8_1.heavy 791.464 / 1109.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1723 219 C20140708_OR008_05 C20140708_OR008_05 TB438632.[MT7]-VTQPELIQTHK[MT7].2y5_1.heavy 791.464 / 770.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1725 219 C20140708_OR008_05 C20140708_OR008_05 TB438632.[MT7]-VTQPELIQTHK[MT7].2b6_1.heavy 791.464 / 812.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1727 220 C20140708_OR008_05 C20140708_OR008_05 TB438633.[MT7]-VTQPELIQTHK[MT7].3b6_1.heavy 527.978 / 812.463 11337.0 26.25860023498535 44 14 10 10 10 2.3173055082526743 43.153567643052526 0.0 3 0.94495080699289 5.235693043989269 11337.0 106.32565048543688 0.0 - - - - - - - 154.5 22 6 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1729 220 C20140708_OR008_05 C20140708_OR008_05 TB438633.[MT7]-VTQPELIQTHK[MT7].3b5_1.heavy 527.978 / 699.379 14428.0 26.25860023498535 44 14 10 10 10 2.3173055082526743 43.153567643052526 0.0 3 0.94495080699289 5.235693043989269 14428.0 91.47071844660195 0.0 - - - - - - - 194.55555555555554 28 9 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1731 220 C20140708_OR008_05 C20140708_OR008_05 TB438633.[MT7]-VTQPELIQTHK[MT7].3y4_1.heavy 527.978 / 657.38 10203.0 26.25860023498535 44 14 10 10 10 2.3173055082526743 43.153567643052526 0.0 3 0.94495080699289 5.235693043989269 10203.0 131.97861165048545 0.0 - - - - - - - 103.0 20 7 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1733 220 C20140708_OR008_05 C20140708_OR008_05 TB438633.[MT7]-VTQPELIQTHK[MT7].3y5_1.heavy 527.978 / 770.464 3092.0 26.25860023498535 44 14 10 10 10 2.3173055082526743 43.153567643052526 0.0 3 0.94495080699289 5.235693043989269 3092.0 29.231521545861863 1.0 - - - - - - - 257.5 6 4 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1735 221 C20140708_OR008_05 C20140708_OR008_05 TB430266.[MT7]-ITRVEMLEIIEAIYK[MT7].3b11_2.heavy 703.746 / 736.419 2149.0 48.65789985656738 39 13 10 6 10 2.052322719977781 38.66303474343474 0.037601470947265625 3 0.9267206789200627 4.530886859581028 2149.0 45.52200865394641 1.0 - - - - - - - 208.125 4 8 VSNL1 visinin-like 1 1737 221 C20140708_OR008_05 C20140708_OR008_05 TB430266.[MT7]-ITRVEMLEIIEAIYK[MT7].3y4_1.heavy 703.746 / 638.399 7626.0 48.65789985656738 39 13 10 6 10 2.052322719977781 38.66303474343474 0.037601470947265625 3 0.9267206789200627 4.530886859581028 7626.0 74.15459574578604 0.0 - - - - - - - 175.6 15 15 VSNL1 visinin-like 1 1739 221 C20140708_OR008_05 C20140708_OR008_05 TB430266.[MT7]-ITRVEMLEIIEAIYK[MT7].3b8_1.heavy 703.746 / 1116.62 9567.0 48.65789985656738 39 13 10 6 10 2.052322719977781 38.66303474343474 0.037601470947265625 3 0.9267206789200627 4.530886859581028 9567.0 98.74075816270062 0.0 - - - - - - - 207.88888888888889 19 9 VSNL1 visinin-like 1 1741 221 C20140708_OR008_05 C20140708_OR008_05 TB430266.[MT7]-ITRVEMLEIIEAIYK[MT7].3b8_2.heavy 703.746 / 558.814 10538.0 48.65789985656738 39 13 10 6 10 2.052322719977781 38.66303474343474 0.037601470947265625 3 0.9267206789200627 4.530886859581028 10538.0 208.71634657491398 0.0 - - - - - - - 148.57142857142858 21 14 VSNL1 visinin-like 1 1743 222 C20140708_OR008_05 C20140708_OR008_05 TB430519.[MT7]-NK[MT7]DDQITLDEFK[MT7].3y6_1.heavy 633.346 / 896.485 9105.0 31.933249473571777 41 15 10 6 10 4.348532301108021 18.323911948098907 0.03569984436035156 3 0.9586375138433918 6.0471481872309685 9105.0 47.35800791295747 0.0 - - - - - - - 299.8333333333333 18 6 VSNL1 visinin-like 1 1745 222 C20140708_OR008_05 C20140708_OR008_05 TB430519.[MT7]-NK[MT7]DDQITLDEFK[MT7].3b4_1.heavy 633.346 / 761.403 4271.0 31.933249473571777 41 15 10 6 10 4.348532301108021 18.323911948098907 0.03569984436035156 3 0.9586375138433918 6.0471481872309685 4271.0 38.35345326409495 0.0 - - - - - - - 187.16666666666666 8 12 VSNL1 visinin-like 1 1747 222 C20140708_OR008_05 C20140708_OR008_05 TB430519.[MT7]-NK[MT7]DDQITLDEFK[MT7].3b5_1.heavy 633.346 / 889.462 6969.0 31.933249473571777 41 15 10 6 10 4.348532301108021 18.323911948098907 0.03569984436035156 3 0.9586375138433918 6.0471481872309685 6969.0 31.414496538081107 0.0 - - - - - - - 213.4 13 10 VSNL1 visinin-like 1 1749 222 C20140708_OR008_05 C20140708_OR008_05 TB430519.[MT7]-NK[MT7]DDQITLDEFK[MT7].3y4_1.heavy 633.346 / 682.353 10791.0 31.933249473571777 41 15 10 6 10 4.348532301108021 18.323911948098907 0.03569984436035156 3 0.9586375138433918 6.0471481872309685 10791.0 51.808747330960855 0.0 - - - - - - - 268.0769230769231 21 13 VSNL1 visinin-like 1 1751 223 C20140708_OR008_05 C20140708_OR008_05 TB430658.[MT7]-DYAAIVFFANNRFETGK[MT7]K[MT7].4y12_2.heavy 631.598 / 873.98 6405.0 39.49930000305176 45 20 10 5 10 18.580182629904396 5.38207842150336 0.046802520751953125 3 0.9973761680563089 24.08792314664507 6405.0 21.222838427947597 0.0 - - - - - - - 248.125 12 8 FIBP fibroblast growth factor (acidic) intracellular binding protein 1753 223 C20140708_OR008_05 C20140708_OR008_05 TB430658.[MT7]-DYAAIVFFANNRFETGK[MT7]K[MT7].4y11_2.heavy 631.598 / 800.446 6100.0 39.49930000305176 45 20 10 5 10 18.580182629904396 5.38207842150336 0.046802520751953125 3 0.9973761680563089 24.08792314664507 6100.0 25.196330275229357 0.0 - - - - - - - 343.25 12 4 FIBP fibroblast growth factor (acidic) intracellular binding protein 1755 223 C20140708_OR008_05 C20140708_OR008_05 TB430658.[MT7]-DYAAIVFFANNRFETGK[MT7]K[MT7].4b4_1.heavy 631.598 / 565.274 16165.0 39.49930000305176 45 20 10 5 10 18.580182629904396 5.38207842150336 0.046802520751953125 3 0.9973761680563089 24.08792314664507 16165.0 82.17251633986928 0.0 - - - - - - - 322.22222222222223 32 9 FIBP fibroblast growth factor (acidic) intracellular binding protein 1757 223 C20140708_OR008_05 C20140708_OR008_05 TB430658.[MT7]-DYAAIVFFANNRFETGK[MT7]K[MT7].4b5_1.heavy 631.598 / 678.358 5185.0 39.49930000305176 45 20 10 5 10 18.580182629904396 5.38207842150336 0.046802520751953125 3 0.9973761680563089 24.08792314664507 5185.0 9.030056179775281 0.0 - - - - - - - 305.2857142857143 10 7 FIBP fibroblast growth factor (acidic) intracellular binding protein 1759 224 C20140708_OR008_05 C20140708_OR008_05 TB438308.[MT7]-QALLIER.2y4_1.heavy 493.809 / 530.33 4236.0 29.274900436401367 46 16 10 10 10 3.009375446876516 33.22948623901074 0.0 3 0.9670741599943008 6.782581999952349 4236.0 42.364718094941075 0.0 - - - - - - - 227.14285714285714 8 7 FIBP fibroblast growth factor (acidic) intracellular binding protein 1761 224 C20140708_OR008_05 C20140708_OR008_05 TB438308.[MT7]-QALLIER.2y5_1.heavy 493.809 / 643.414 3601.0 29.274900436401367 46 16 10 10 10 3.009375446876516 33.22948623901074 0.0 3 0.9670741599943008 6.782581999952349 3601.0 13.135723270440252 2.0 - - - - - - - 251.75 13 8 FIBP fibroblast growth factor (acidic) intracellular binding protein 1763 224 C20140708_OR008_05 C20140708_OR008_05 TB438308.[MT7]-QALLIER.2b4_1.heavy 493.809 / 570.373 6143.0 29.274900436401367 46 16 10 10 10 3.009375446876516 33.22948623901074 0.0 3 0.9670741599943008 6.782581999952349 6143.0 36.71562769276482 0.0 - - - - - - - 318.0 12 1 FIBP fibroblast growth factor (acidic) intracellular binding protein 1765 224 C20140708_OR008_05 C20140708_OR008_05 TB438308.[MT7]-QALLIER.2y6_1.heavy 493.809 / 714.451 8261.0 29.274900436401367 46 16 10 10 10 3.009375446876516 33.22948623901074 0.0 3 0.9670741599943008 6.782581999952349 8261.0 54.24203773584906 0.0 - - - - - - - 194.33333333333334 16 6 FIBP fibroblast growth factor (acidic) intracellular binding protein 1767 225 C20140708_OR008_05 C20140708_OR008_05 TB438832.[MT7]-ENLEYC[CAM]IMVIGVPNVGK[MT7].3b6_1.heavy 741.73 / 953.416 9136.0 43.82440185546875 43 13 10 10 10 2.0112379562211387 43.971615682180094 0.0 3 0.9071523886387907 4.018444982045394 9136.0 132.19928358208955 0.0 - - - - - - - 133.66666666666666 18 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1769 225 C20140708_OR008_05 C20140708_OR008_05 TB438832.[MT7]-ENLEYC[CAM]IMVIGVPNVGK[MT7].3b4_1.heavy 741.73 / 630.321 9036.0 43.82440185546875 43 13 10 10 10 2.0112379562211387 43.971615682180094 0.0 3 0.9071523886387907 4.018444982045394 9036.0 59.34089552238807 0.0 - - - - - - - 226.0 18 8 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1771 225 C20140708_OR008_05 C20140708_OR008_05 TB438832.[MT7]-ENLEYC[CAM]IMVIGVPNVGK[MT7].3b5_1.heavy 741.73 / 793.385 2209.0 43.82440185546875 43 13 10 10 10 2.0112379562211387 43.971615682180094 0.0 3 0.9071523886387907 4.018444982045394 2209.0 5.7244163986358005 1.0 - - - - - - - 217.5 6 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1773 225 C20140708_OR008_05 C20140708_OR008_05 TB438832.[MT7]-ENLEYC[CAM]IMVIGVPNVGK[MT7].3y5_1.heavy 741.73 / 658.4 23493.0 43.82440185546875 43 13 10 10 10 2.0112379562211387 43.971615682180094 0.0 3 0.9071523886387907 4.018444982045394 23493.0 84.98500818168296 0.0 - - - - - - - 264.72727272727275 46 11 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1775 226 C20140708_OR008_05 C20140708_OR008_05 TB448609.[MT7]-QSAQELK[MT7].2b4_1.heavy 546.319 / 559.296 6835.0 17.45525026321411 37 12 10 5 10 2.5929097359544 38.56671083198811 0.04419898986816406 3 0.8849988070451931 3.6037821037109885 6835.0 99.25575311095747 0.0 - - - - - - - 248.16666666666666 13 6 MAPKAP1 mitogen-activated protein kinase associated protein 1 1777 226 C20140708_OR008_05 C20140708_OR008_05 TB448609.[MT7]-QSAQELK[MT7].2y3_1.heavy 546.319 / 533.341 9990.0 17.45525026321411 37 12 10 5 10 2.5929097359544 38.56671083198811 0.04419898986816406 3 0.8849988070451931 3.6037821037109885 9990.0 17.67220957729686 0.0 - - - - - - - 271.7 19 10 MAPKAP1 mitogen-activated protein kinase associated protein 1 1779 226 C20140708_OR008_05 C20140708_OR008_05 TB448609.[MT7]-QSAQELK[MT7].2y6_1.heavy 546.319 / 819.469 25063.0 17.45525026321411 37 12 10 5 10 2.5929097359544 38.56671083198811 0.04419898986816406 3 0.8849988070451931 3.6037821037109885 25063.0 337.74317221876294 0.0 - - - - - - - 200.42857142857142 50 7 MAPKAP1 mitogen-activated protein kinase associated protein 1 1781 226 C20140708_OR008_05 C20140708_OR008_05 TB448609.[MT7]-QSAQELK[MT7].2b5_1.heavy 546.319 / 688.338 88.0 17.45525026321411 37 12 10 5 10 2.5929097359544 38.56671083198811 0.04419898986816406 3 0.8849988070451931 3.6037821037109885 88.0 0.8207278652906029 21.0 - - - - - - - 292.3333333333333 6 6 MAPKAP1 mitogen-activated protein kinase associated protein 1 1783 227 C20140708_OR008_05 C20140708_OR008_05 TB438831.[MT7]-ENLEYC[CAM]IMVIGVPNVGK[MT7].4y5_1.heavy 556.549 / 658.4 4225.0 43.84584999084473 34 13 10 5 6 0.9100688500542201 57.13762853791745 0.042896270751953125 5 0.919558735239868 4.321830662687936 4225.0 12.604980066554644 0.0 - - - - - - - 281.6 8 5 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1785 227 C20140708_OR008_05 C20140708_OR008_05 TB438831.[MT7]-ENLEYC[CAM]IMVIGVPNVGK[MT7].4b5_1.heavy 556.549 / 793.385 1308.0 43.84584999084473 34 13 10 5 6 0.9100688500542201 57.13762853791745 0.042896270751953125 5 0.919558735239868 4.321830662687936 1308.0 3.578700287382961 1.0 - - - - - - - 234.66666666666666 3 3 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1787 227 C20140708_OR008_05 C20140708_OR008_05 TB438831.[MT7]-ENLEYC[CAM]IMVIGVPNVGK[MT7].4b3_1.heavy 556.549 / 501.279 1811.0 43.84584999084473 34 13 10 5 6 0.9100688500542201 57.13762853791745 0.042896270751953125 5 0.919558735239868 4.321830662687936 1811.0 18.204665149744784 1.0 - - - - - - - 221.4 4 10 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1789 227 C20140708_OR008_05 C20140708_OR008_05 TB438831.[MT7]-ENLEYC[CAM]IMVIGVPNVGK[MT7].4b4_1.heavy 556.549 / 630.321 4125.0 43.84584999084473 34 13 10 5 6 0.9100688500542201 57.13762853791745 0.042896270751953125 5 0.919558735239868 4.321830662687936 4125.0 56.454854440667944 2.0 - - - - - - - 151.0 9 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1791 228 C20140708_OR008_05 C20140708_OR008_05 TB430511.[MT7]-C[CAM]QGPVYGFIFLFK[MT7].2b8_1.heavy 932.507 / 1053.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1793 228 C20140708_OR008_05 C20140708_OR008_05 TB430511.[MT7]-C[CAM]QGPVYGFIFLFK[MT7].2y4_1.heavy 932.507 / 698.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1795 228 C20140708_OR008_05 C20140708_OR008_05 TB430511.[MT7]-C[CAM]QGPVYGFIFLFK[MT7].2b7_1.heavy 932.507 / 906.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1797 228 C20140708_OR008_05 C20140708_OR008_05 TB430511.[MT7]-C[CAM]QGPVYGFIFLFK[MT7].2b5_1.heavy 932.507 / 686.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1799 229 C20140708_OR008_05 C20140708_OR008_05 TB438351.[MT7]-GHPPAETLP.2b6_2.heavy 531.789 / 367.191 4329.0 25.443899154663086 41 15 10 10 6 14.307743179624884 6.989222461191938 0.0 5 0.9537979645823116 5.719332710705371 4329.0 0.5016612257474633 3.0 - - - - - - - 334.75 8 4 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1801 229 C20140708_OR008_05 C20140708_OR008_05 TB438351.[MT7]-GHPPAETLP.2b6_1.heavy 531.789 / 733.375 824.0 25.443899154663086 41 15 10 10 6 14.307743179624884 6.989222461191938 0.0 5 0.9537979645823116 5.719332710705371 824.0 0.0 5.0 - - - - - - - 290.27272727272725 2 11 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1803 229 C20140708_OR008_05 C20140708_OR008_05 TB438351.[MT7]-GHPPAETLP.2b7_1.heavy 531.789 / 834.423 1134.0 25.443899154663086 41 15 10 10 6 14.307743179624884 6.989222461191938 0.0 5 0.9537979645823116 5.719332710705371 1134.0 10.71591866642242 2.0 - - - - - - - 691.7142857142857 3 7 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1805 229 C20140708_OR008_05 C20140708_OR008_05 TB438351.[MT7]-GHPPAETLP.2b5_1.heavy 531.789 / 604.332 1443.0 25.443899154663086 41 15 10 10 6 14.307743179624884 6.989222461191938 0.0 5 0.9537979645823116 5.719332710705371 1443.0 0.48780374091610945 4.0 - - - - - - - 291.8333333333333 3 12 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1807 230 C20140708_OR008_05 C20140708_OR008_05 TB438454.[MT7]-IESVETGLK[MT7].3y3_1.heavy 421.918 / 461.32 12388.0 29.173649787902832 43 18 10 5 10 4.177499514300862 23.937764602406133 0.04049873352050781 3 0.9859060164082852 10.383268572513431 12388.0 132.6151282051282 0.0 - - - - - - - 208.0 24 7 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1809 230 C20140708_OR008_05 C20140708_OR008_05 TB438454.[MT7]-IESVETGLK[MT7].3b4_1.heavy 421.918 / 573.336 4893.0 29.173649787902832 43 18 10 5 10 4.177499514300862 23.937764602406133 0.04049873352050781 3 0.9859060164082852 10.383268572513431 4893.0 27.31925 0.0 - - - - - - - 231.11111111111111 9 9 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1811 230 C20140708_OR008_05 C20140708_OR008_05 TB438454.[MT7]-IESVETGLK[MT7].3y4_1.heavy 421.918 / 562.368 7495.0 29.173649787902832 43 18 10 5 10 4.177499514300862 23.937764602406133 0.04049873352050781 3 0.9859060164082852 10.383268572513431 7495.0 59.09519230769231 0.0 - - - - - - - 187.2 14 5 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1813 230 C20140708_OR008_05 C20140708_OR008_05 TB438454.[MT7]-IESVETGLK[MT7].3b3_1.heavy 421.918 / 474.268 11659.0 29.173649787902832 43 18 10 5 10 4.177499514300862 23.937764602406133 0.04049873352050781 3 0.9859060164082852 10.383268572513431 11659.0 135.27429487179487 0.0 - - - - - - - 208.0 23 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1815 231 C20140708_OR008_05 C20140708_OR008_05 TB449017.[MT7]-LMQITSLHSLNAFLLPIK[MT7].4y4_1.heavy 582.6 / 614.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - GMPS guanine monphosphate synthetase 1817 231 C20140708_OR008_05 C20140708_OR008_05 TB449017.[MT7]-LMQITSLHSLNAFLLPIK[MT7].4y3_1.heavy 582.6 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - GMPS guanine monphosphate synthetase 1819 231 C20140708_OR008_05 C20140708_OR008_05 TB449017.[MT7]-LMQITSLHSLNAFLLPIK[MT7].4b6_1.heavy 582.6 / 818.456 N/A N/A - - - - - - - - - 0.0 - - - - - - - GMPS guanine monphosphate synthetase 1821 231 C20140708_OR008_05 C20140708_OR008_05 TB449017.[MT7]-LMQITSLHSLNAFLLPIK[MT7].4b3_1.heavy 582.6 / 517.292 N/A N/A - - - - - - - - - 0.0 - - - - - - - GMPS guanine monphosphate synthetase 1823 232 C20140708_OR008_05 C20140708_OR008_05 TB448978.[MT7]-RIHLQPDRLQPVEK[MT7].4y4_1.heavy 505.053 / 616.379 3777.0 25.381400108337402 35 10 10 5 10 0.9319882559727413 67.48668126024806 0.04239845275878906 3 0.8496734174769032 3.142298966581023 3777.0 50.852203593714755 0.0 - - - - - - - 240.27272727272728 7 11 ZNF496 zinc finger protein 496 1825 232 C20140708_OR008_05 C20140708_OR008_05 TB448978.[MT7]-RIHLQPDRLQPVEK[MT7].4y9_2.heavy 505.053 / 613.355 7648.0 25.381400108337402 35 10 10 5 10 0.9319882559727413 67.48668126024806 0.04239845275878906 3 0.8496734174769032 3.142298966581023 7648.0 89.96853615520281 0.0 - - - - - - - 215.57142857142858 15 7 ZNF496 zinc finger protein 496 1827 232 C20140708_OR008_05 C20140708_OR008_05 TB448978.[MT7]-RIHLQPDRLQPVEK[MT7].4b4_1.heavy 505.053 / 664.438 850.0 25.381400108337402 35 10 10 5 10 0.9319882559727413 67.48668126024806 0.04239845275878906 3 0.8496734174769032 3.142298966581023 850.0 10.409664623151821 0.0 - - - - - - - 0.0 1 0 ZNF496 zinc finger protein 496 1829 232 C20140708_OR008_05 C20140708_OR008_05 TB448978.[MT7]-RIHLQPDRLQPVEK[MT7].4b3_1.heavy 505.053 / 551.353 4060.0 25.381400108337402 35 10 10 5 10 0.9319882559727413 67.48668126024806 0.04239845275878906 3 0.8496734174769032 3.142298966581023 4060.0 51.738376674546885 0.0 - - - - - - - 188.77777777777777 8 9 ZNF496 zinc finger protein 496 1831 233 C20140708_OR008_05 C20140708_OR008_05 TB448979.[MT7]-SDPSIVLLLQC[CAM]DIQK[MT7].2b4_1.heavy 1009.07 / 531.253 893.0 44.576900482177734 43 13 10 10 10 1.2428476360928589 57.02488450503216 0.0 3 0.9032826936773183 3.9359192787659256 893.0 1.5758823529411765 0.0 - - - - - - - 0.0 1 0 VSNL1 visinin-like 1 1833 233 C20140708_OR008_05 C20140708_OR008_05 TB448979.[MT7]-SDPSIVLLLQC[CAM]DIQK[MT7].2b7_1.heavy 1009.07 / 856.49 1786.0 44.576900482177734 43 13 10 10 10 1.2428476360928589 57.02488450503216 0.0 3 0.9032826936773183 3.9359192787659256 1786.0 10.500396252495777 0.0 - - - - - - - 212.83333333333334 3 6 VSNL1 visinin-like 1 1835 233 C20140708_OR008_05 C20140708_OR008_05 TB448979.[MT7]-SDPSIVLLLQC[CAM]DIQK[MT7].2b5_1.heavy 1009.07 / 644.337 1531.0 44.576900482177734 43 13 10 10 10 1.2428476360928589 57.02488450503216 0.0 3 0.9032826936773183 3.9359192787659256 1531.0 11.9609375 0.0 - - - - - - - 291.85714285714283 3 7 VSNL1 visinin-like 1 1837 233 C20140708_OR008_05 C20140708_OR008_05 TB448979.[MT7]-SDPSIVLLLQC[CAM]DIQK[MT7].2y7_1.heavy 1009.07 / 1048.56 2169.0 44.576900482177734 43 13 10 10 10 1.2428476360928589 57.02488450503216 0.0 3 0.9032826936773183 3.9359192787659256 2169.0 18.988311618338557 0.0 - - - - - - - 219.0 4 7 VSNL1 visinin-like 1 1839 234 C20140708_OR008_05 C20140708_OR008_05 TB438869.[MT7]-VYPIDHGPWGEDEEWTDK[MT7].3y7_1.heavy 821.057 / 1066.48 1043.0 36.32510185241699 38 14 9 5 10 1.5343590111662293 45.64983654435568 0.04759979248046875 3 0.9437685590494683 5.179840281330052 1043.0 3.5933333333333333 5.0 - - - - - - - 248.33333333333334 6 3 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1841 234 C20140708_OR008_05 C20140708_OR008_05 TB438869.[MT7]-VYPIDHGPWGEDEEWTDK[MT7].3y3_1.heavy 821.057 / 507.289 2532.0 36.32510185241699 38 14 9 5 10 1.5343590111662293 45.64983654435568 0.04759979248046875 3 0.9437685590494683 5.179840281330052 2532.0 12.914899328859061 0.0 - - - - - - - 298.0 5 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1843 234 C20140708_OR008_05 C20140708_OR008_05 TB438869.[MT7]-VYPIDHGPWGEDEEWTDK[MT7].3b5_1.heavy 821.057 / 732.405 2085.0 36.32510185241699 38 14 9 5 10 1.5343590111662293 45.64983654435568 0.04759979248046875 3 0.9437685590494683 5.179840281330052 2085.0 13.573489932885908 1.0 - - - - - - - 223.5 4 4 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1845 234 C20140708_OR008_05 C20140708_OR008_05 TB438869.[MT7]-VYPIDHGPWGEDEEWTDK[MT7].3y4_1.heavy 821.057 / 693.369 2830.0 36.32510185241699 38 14 9 5 10 1.5343590111662293 45.64983654435568 0.04759979248046875 3 0.9437685590494683 5.179840281330052 2830.0 4.685011185682326 0.0 - - - - - - - 397.3333333333333 5 3 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1847 235 C20140708_OR008_05 C20140708_OR008_05 TB438358.[MT7]-DFLQTFR.2y4_1.heavy 535.791 / 551.294 2334.0 37.21554946899414 38 15 10 5 8 3.8576140496986087 25.92275917488762 0.0485992431640625 4 0.957313108914144 5.951932293024613 2334.0 17.797495671531042 2.0 - - - - - - - 233.5 7 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1849 235 C20140708_OR008_05 C20140708_OR008_05 TB438358.[MT7]-DFLQTFR.2b3_1.heavy 535.791 / 520.289 2179.0 37.21554946899414 38 15 10 5 8 3.8576140496986087 25.92275917488762 0.0485992431640625 4 0.957313108914144 5.951932293024613 2179.0 2.887281010499003 4.0 - - - - - - - 267.0 4 7 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1851 235 C20140708_OR008_05 C20140708_OR008_05 TB438358.[MT7]-DFLQTFR.2y5_1.heavy 535.791 / 664.378 4669.0 37.21554946899414 38 15 10 5 8 3.8576140496986087 25.92275917488762 0.0485992431640625 4 0.957313108914144 5.951932293024613 4669.0 16.514147909967846 0.0 - - - - - - - 280.0 9 5 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1853 235 C20140708_OR008_05 C20140708_OR008_05 TB438358.[MT7]-DFLQTFR.2y6_1.heavy 535.791 / 811.446 7314.0 37.21554946899414 38 15 10 5 8 3.8576140496986087 25.92275917488762 0.0485992431640625 4 0.957313108914144 5.951932293024613 7314.0 34.48085405234203 0.0 - - - - - - - 337.3333333333333 14 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1855 236 C20140708_OR008_05 C20140708_OR008_05 TB438357.[MT7]-SFVSTLK[MT7].2y4_1.heavy 535.328 / 592.379 7162.0 30.419750213623047 39 17 10 6 6 5.000798587656002 19.996806159488315 0.03820037841796875 5 0.9758414209682149 7.924072676643769 7162.0 82.68854545454545 0.0 - - - - - - - 257.0833333333333 14 12 C18orf21 chromosome 18 open reading frame 21 1857 236 C20140708_OR008_05 C20140708_OR008_05 TB438357.[MT7]-SFVSTLK[MT7].2y5_1.heavy 535.328 / 691.447 1653.0 30.419750213623047 39 17 10 6 6 5.000798587656002 19.996806159488315 0.03820037841796875 5 0.9758414209682149 7.924072676643769 1653.0 9.767727272727274 1.0 - - - - - - - 232.44444444444446 3 9 C18orf21 chromosome 18 open reading frame 21 1859 236 C20140708_OR008_05 C20140708_OR008_05 TB438357.[MT7]-SFVSTLK[MT7].2y3_1.heavy 535.328 / 505.347 2204.0 30.419750213623047 39 17 10 6 6 5.000798587656002 19.996806159488315 0.03820037841796875 5 0.9758414209682149 7.924072676643769 2204.0 2.606674056210462 3.0 - - - - - - - 645.2857142857143 4 7 C18orf21 chromosome 18 open reading frame 21 1861 236 C20140708_OR008_05 C20140708_OR008_05 TB438357.[MT7]-SFVSTLK[MT7].2y6_1.heavy 535.328 / 838.516 1102.0 30.419750213623047 39 17 10 6 6 5.000798587656002 19.996806159488315 0.03820037841796875 5 0.9758414209682149 7.924072676643769 1102.0 0.0 4.0 - - - - - - - 229.58333333333334 2 12 C18orf21 chromosome 18 open reading frame 21 1863 237 C20140708_OR008_05 C20140708_OR008_05 TB438760.[MT7]-NLVAVDWESHINTK[MT7].4y4_1.heavy 479.264 / 619.39 1701.0 35.041799545288086 35 10 10 5 10 1.061955526810639 62.934498176021016 0.044399261474609375 3 0.8272475297578159 2.925432675740026 1701.0 7.669520054033653 2.0 - - - - - - - 283.8333333333333 3 6 ZNF559 zinc finger protein 559 1865 237 C20140708_OR008_05 C20140708_OR008_05 TB438760.[MT7]-NLVAVDWESHINTK[MT7].4b4_1.heavy 479.264 / 542.342 6664.0 35.041799545288086 35 10 10 5 10 1.061955526810639 62.934498176021016 0.044399261474609375 3 0.8272475297578159 2.925432675740026 6664.0 26.727901234567902 0.0 - - - - - - - 283.5 13 2 ZNF559 zinc finger protein 559 1867 237 C20140708_OR008_05 C20140708_OR008_05 TB438760.[MT7]-NLVAVDWESHINTK[MT7].4y6_1.heavy 479.264 / 843.481 567.0 35.041799545288086 35 10 10 5 10 1.061955526810639 62.934498176021016 0.044399261474609375 3 0.8272475297578159 2.925432675740026 567.0 5.889612676056338 1.0 - - - - - - - 0.0 1 0 ZNF559 zinc finger protein 559 1869 237 C20140708_OR008_05 C20140708_OR008_05 TB438760.[MT7]-NLVAVDWESHINTK[MT7].4y3_1.heavy 479.264 / 506.306 2127.0 35.041799545288086 35 10 10 5 10 1.061955526810639 62.934498176021016 0.044399261474609375 3 0.8272475297578159 2.925432675740026 2127.0 10.279436619718311 0.0 - - - - - - - 198.8 4 5 ZNF559 zinc finger protein 559 1871 238 C20140708_OR008_05 C20140708_OR008_05 TB430120.[MT7]-YSSPGLTSK[MT7].2y8_1.heavy 614.345 / 920.517 2739.0 23.835099697113037 38 15 10 3 10 3.298251669618283 30.31909327027592 0.07309913635253906 3 0.9538735790622426 5.724055298084016 2739.0 9.097738515901058 0.0 - - - - - - - 204.41666666666666 5 12 MAPKAP1 mitogen-activated protein kinase associated protein 1 1873 238 C20140708_OR008_05 C20140708_OR008_05 TB430120.[MT7]-YSSPGLTSK[MT7].2y5_1.heavy 614.345 / 649.4 1133.0 23.835099697113037 38 15 10 3 10 3.298251669618283 30.31909327027592 0.07309913635253906 3 0.9538735790622426 5.724055298084016 1133.0 0.9601694915254237 1.0 - - - - - - - 207.6 2 10 MAPKAP1 mitogen-activated protein kinase associated protein 1 1875 238 C20140708_OR008_05 C20140708_OR008_05 TB430120.[MT7]-YSSPGLTSK[MT7].2y6_1.heavy 614.345 / 746.453 4156.0 23.835099697113037 38 15 10 3 10 3.298251669618283 30.31909327027592 0.07309913635253906 3 0.9538735790622426 5.724055298084016 4156.0 51.670453675560054 0.0 - - - - - - - 235.83333333333334 8 6 MAPKAP1 mitogen-activated protein kinase associated protein 1 1877 238 C20140708_OR008_05 C20140708_OR008_05 TB430120.[MT7]-YSSPGLTSK[MT7].2y7_1.heavy 614.345 / 833.485 1889.0 23.835099697113037 38 15 10 3 10 3.298251669618283 30.31909327027592 0.07309913635253906 3 0.9538735790622426 5.724055298084016 1889.0 33.35893617021276 0.0 - - - - - - - 220.11111111111111 3 9 MAPKAP1 mitogen-activated protein kinase associated protein 1 1879 239 C20140708_OR008_05 C20140708_OR008_05 TB438767.[MT7]-QLNTALPQEFAALTK[MT7].2b3_1.heavy 967.053 / 500.295 2771.0 41.772600173950195 38 13 10 5 10 3.195982373242776 31.28928395763831 0.042797088623046875 3 0.9187211207168846 4.299194505182763 2771.0 40.725303030303024 0.0 - - - - - - - 237.6 5 5 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1881 239 C20140708_OR008_05 C20140708_OR008_05 TB438767.[MT7]-QLNTALPQEFAALTK[MT7].2y9_1.heavy 967.053 / 1148.64 7258.0 41.772600173950195 38 13 10 5 10 3.195982373242776 31.28928395763831 0.042797088623046875 3 0.9187211207168846 4.299194505182763 7258.0 44.079520202020205 0.0 - - - - - - - 226.28571428571428 14 7 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1883 239 C20140708_OR008_05 C20140708_OR008_05 TB438767.[MT7]-QLNTALPQEFAALTK[MT7].2b6_1.heavy 967.053 / 785.464 3959.0 41.772600173950195 38 13 10 5 10 3.195982373242776 31.28928395763831 0.042797088623046875 3 0.9187211207168846 4.299194505182763 3959.0 9.397676767676767 1.0 - - - - - - - 231.0 7 4 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1885 239 C20140708_OR008_05 C20140708_OR008_05 TB438767.[MT7]-QLNTALPQEFAALTK[MT7].2b5_1.heavy 967.053 / 672.38 2771.0 41.772600173950195 38 13 10 5 10 3.195982373242776 31.28928395763831 0.042797088623046875 3 0.9187211207168846 4.299194505182763 2771.0 4.373476954578944 1.0 - - - - - - - 264.0 6 6 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1887 240 C20140708_OR008_05 C20140708_OR008_05 TB448974.[MT7]-TMEAFHFVSYVPITGR.3b4_1.heavy 667.012 / 577.277 19527.0 41.12215042114258 37 12 10 5 10 1.095970348157335 60.82889630978971 0.04309844970703125 3 0.8942177634042451 3.7605478788399282 19527.0 -1.7501792573623582 0.0 - - - - - - - 156.0 39 1 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1889 240 C20140708_OR008_05 C20140708_OR008_05 TB448974.[MT7]-TMEAFHFVSYVPITGR.3b5_1.heavy 667.012 / 724.346 15466.0 41.12215042114258 37 12 10 5 10 1.095970348157335 60.82889630978971 0.04309844970703125 3 0.8942177634042451 3.7605478788399282 15466.0 -6.939871794871806 0.0 - - - - - - - 273.25 30 4 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1891 240 C20140708_OR008_05 C20140708_OR008_05 TB448974.[MT7]-TMEAFHFVSYVPITGR.3y8_1.heavy 667.012 / 892.489 24057.0 41.12215042114258 37 12 10 5 10 1.095970348157335 60.82889630978971 0.04309844970703125 3 0.8942177634042451 3.7605478788399282 24057.0 -1.9245599999999996 0.0 - - - - - - - 312.0 48 1 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1893 240 C20140708_OR008_05 C20140708_OR008_05 TB448974.[MT7]-TMEAFHFVSYVPITGR.3y5_1.heavy 667.012 / 543.325 30775.0 41.12215042114258 37 12 10 5 10 1.095970348157335 60.82889630978971 0.04309844970703125 3 0.8942177634042451 3.7605478788399282 30775.0 -1.6422091782283914 0.0 - - - - - - - 390.5 61 4 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1895 241 C20140708_OR008_05 C20140708_OR008_05 TB438466.[MT7]-EAGEAGAATSK[MT7].2b4_1.heavy 640.34 / 531.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGCR14 DiGeorge syndrome critical region gene 14 1897 241 C20140708_OR008_05 C20140708_OR008_05 TB438466.[MT7]-EAGEAGAATSK[MT7].2y6_1.heavy 640.34 / 678.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGCR14 DiGeorge syndrome critical region gene 14 1899 241 C20140708_OR008_05 C20140708_OR008_05 TB438466.[MT7]-EAGEAGAATSK[MT7].2b5_1.heavy 640.34 / 602.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGCR14 DiGeorge syndrome critical region gene 14 1901 241 C20140708_OR008_05 C20140708_OR008_05 TB438466.[MT7]-EAGEAGAATSK[MT7].2y7_1.heavy 640.34 / 749.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - DGCR14 DiGeorge syndrome critical region gene 14 1903 242 C20140708_OR008_05 C20140708_OR008_05 TB448787.[MT7]-FNLMAVVPDRR.3b4_1.heavy 487.942 / 650.345 2499.0 37.37189865112305 45 15 10 10 10 2.040626757942953 49.00455196461536 0.0 3 0.9512357934036187 5.565843102470877 2499.0 21.165 0.0 - - - - - - - 220.5 4 2 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1905 242 C20140708_OR008_05 C20140708_OR008_05 TB448787.[MT7]-FNLMAVVPDRR.3b5_1.heavy 487.942 / 721.382 3968.0 37.37189865112305 45 15 10 10 10 2.040626757942953 49.00455196461536 0.0 3 0.9512357934036187 5.565843102470877 3968.0 34.95619047619048 0.0 - - - - - - - 257.25 7 4 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1907 242 C20140708_OR008_05 C20140708_OR008_05 TB448787.[MT7]-FNLMAVVPDRR.3y4_1.heavy 487.942 / 543.3 3527.0 37.37189865112305 45 15 10 10 10 2.040626757942953 49.00455196461536 0.0 3 0.9512357934036187 5.565843102470877 3527.0 15.715544217687075 1.0 - - - - - - - 367.5 7 2 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1909 242 C20140708_OR008_05 C20140708_OR008_05 TB448787.[MT7]-FNLMAVVPDRR.3b3_1.heavy 487.942 / 519.305 4115.0 37.37189865112305 45 15 10 10 10 2.040626757942953 49.00455196461536 0.0 3 0.9512357934036187 5.565843102470877 4115.0 9.95761127156928 1.0 - - - - - - - 294.0 10 6 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1911 243 C20140708_OR008_05 C20140708_OR008_05 TB438363.[MT7]-ELLALLK[MT7].2b3_1.heavy 544.37 / 500.32 2673.0 42.925100326538086 42 17 10 5 10 6.1914737184501405 16.151243556442353 0.046802520751953125 3 0.9717584727555824 7.326403806545141 2673.0 3.947196261682243 1.0 - - - - - - - 230.46153846153845 5 13 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1913 243 C20140708_OR008_05 C20140708_OR008_05 TB438363.[MT7]-ELLALLK[MT7].2y4_1.heavy 544.37 / 588.42 5132.0 42.925100326538086 42 17 10 5 10 6.1914737184501405 16.151243556442353 0.046802520751953125 3 0.9717584727555824 7.326403806545141 5132.0 53.95794392523364 0.0 - - - - - - - 267.5 10 6 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1915 243 C20140708_OR008_05 C20140708_OR008_05 TB438363.[MT7]-ELLALLK[MT7].2b4_1.heavy 544.37 / 571.357 4277.0 42.925100326538086 42 17 10 5 10 6.1914737184501405 16.151243556442353 0.046802520751953125 3 0.9717584727555824 7.326403806545141 4277.0 52.36327102803738 0.0 - - - - - - - 214.0 8 6 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1917 243 C20140708_OR008_05 C20140708_OR008_05 TB438363.[MT7]-ELLALLK[MT7].2y3_1.heavy 544.37 / 517.383 2994.0 42.925100326538086 42 17 10 5 10 6.1914737184501405 16.151243556442353 0.046802520751953125 3 0.9717584727555824 7.326403806545141 2994.0 3.351578947368421 1.0 - - - - - - - 230.46153846153845 5 13 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 1919 244 C20140708_OR008_05 C20140708_OR008_05 TB448788.[MT7]-MLLSQNESQK[MT7].3b9_2.heavy 489.269 / 588.296 4355.0 23.49642562866211 33 14 8 3 8 1.4134767035528988 43.58182763274047 0.07550048828125 4 0.9479280958519702 5.384654488884933 4355.0 5.604899147704615 0.0 - - - - - - - 202.53846153846155 8 13 C18orf21 chromosome 18 open reading frame 21 1921 244 C20140708_OR008_05 C20140708_OR008_05 TB448788.[MT7]-MLLSQNESQK[MT7].3y3_1.heavy 489.269 / 506.306 4153.0 23.49642562866211 33 14 8 3 8 1.4134767035528988 43.58182763274047 0.07550048828125 4 0.9479280958519702 5.384654488884933 4153.0 38.37593411068649 2.0 - - - - - - - 240.375 12 8 C18orf21 chromosome 18 open reading frame 21 1923 244 C20140708_OR008_05 C20140708_OR008_05 TB448788.[MT7]-MLLSQNESQK[MT7].3b4_1.heavy 489.269 / 589.35 3646.0 23.49642562866211 33 14 8 3 8 1.4134767035528988 43.58182763274047 0.07550048828125 4 0.9479280958519702 5.384654488884933 3646.0 5.512223520189581 0.0 - - - - - - - 258.77777777777777 7 9 C18orf21 chromosome 18 open reading frame 21 1925 244 C20140708_OR008_05 C20140708_OR008_05 TB448788.[MT7]-MLLSQNESQK[MT7].3b3_1.heavy 489.269 / 502.318 3444.0 23.49642562866211 33 14 8 3 8 1.4134767035528988 43.58182763274047 0.07550048828125 4 0.9479280958519702 5.384654488884933 3444.0 0.48575458392101556 3.0 - - - - - - - 270.22222222222223 12 9 C18orf21 chromosome 18 open reading frame 21 1927 245 C20140708_OR008_05 C20140708_OR008_05 TB429904.[MT7]-LSLGLSR.2y5_1.heavy 445.283 / 545.341 5315.0 32.216299057006836 46 20 10 6 10 6.083902381914959 16.436818627672352 0.035999298095703125 3 0.9974573756721565 24.469731680859386 5315.0 12.418860145272685 0.0 - - - - - - - 271.8 10 5 PDLIM7 PDZ and LIM domain 7 (enigma) 1929 245 C20140708_OR008_05 C20140708_OR008_05 TB429904.[MT7]-LSLGLSR.2b4_1.heavy 445.283 / 515.331 6674.0 32.216299057006836 46 20 10 6 10 6.083902381914959 16.436818627672352 0.035999298095703125 3 0.9974573756721565 24.469731680859386 6674.0 63.56294240564189 0.0 - - - - - - - 296.6 13 10 PDLIM7 PDZ and LIM domain 7 (enigma) 1931 245 C20140708_OR008_05 C20140708_OR008_05 TB429904.[MT7]-LSLGLSR.2y6_1.heavy 445.283 / 632.373 24720.0 32.216299057006836 46 20 10 6 10 6.083902381914959 16.436818627672352 0.035999298095703125 3 0.9974573756721565 24.469731680859386 24720.0 114.5699438765694 0.0 - - - - - - - 264.85714285714283 49 7 PDLIM7 PDZ and LIM domain 7 (enigma) 1933 245 C20140708_OR008_05 C20140708_OR008_05 TB429904.[MT7]-LSLGLSR.2b5_1.heavy 445.283 / 628.415 2225.0 32.216299057006836 46 20 10 6 10 6.083902381914959 16.436818627672352 0.035999298095703125 3 0.9974573756721565 24.469731680859386 2225.0 7.177419354838711 1.0 - - - - - - - 124.0 4 4 PDLIM7 PDZ and LIM domain 7 (enigma) 1935 246 C20140708_OR008_05 C20140708_OR008_05 TB438362.[MT7]-YAPSC[CAM]AK[MT7].2y6_1.heavy 542.789 / 777.404 4445.0 19.27697515487671 38 17 10 3 8 5.743084600247883 17.4122456764234 0.07349967956542969 4 0.9707999848874448 7.2045746322077155 4445.0 32.196216216216214 0.0 - - - - - - - 166.8 8 5 PDLIM7 PDZ and LIM domain 7 (enigma) 1937 246 C20140708_OR008_05 C20140708_OR008_05 TB438362.[MT7]-YAPSC[CAM]AK[MT7].2y4_1.heavy 542.789 / 609.315 741.0 19.27697515487671 38 17 10 3 8 5.743084600247883 17.4122456764234 0.07349967956542969 4 0.9707999848874448 7.2045746322077155 741.0 2.6870967741935488 4.0 - - - - - - - 172.14285714285714 2 7 PDLIM7 PDZ and LIM domain 7 (enigma) 1939 246 C20140708_OR008_05 C20140708_OR008_05 TB438362.[MT7]-YAPSC[CAM]AK[MT7].2y5_1.heavy 542.789 / 706.367 6204.0 19.27697515487671 38 17 10 3 8 5.743084600247883 17.4122456764234 0.07349967956542969 4 0.9707999848874448 7.2045746322077155 6204.0 78.30093461203137 0.0 - - - - - - - 198.57142857142858 12 7 PDLIM7 PDZ and LIM domain 7 (enigma) 1941 246 C20140708_OR008_05 C20140708_OR008_05 TB438362.[MT7]-YAPSC[CAM]AK[MT7].2y3_1.heavy 542.789 / 522.283 2222.0 19.27697515487671 38 17 10 3 8 5.743084600247883 17.4122456764234 0.07349967956542969 4 0.9707999848874448 7.2045746322077155 2222.0 11.476643674957616 1.0 - - - - - - - 226.44444444444446 6 18 PDLIM7 PDZ and LIM domain 7 (enigma) 1943 247 C20140708_OR008_05 C20140708_OR008_05 TB438468.[MT7]-EAGEAGAATSK[MT7].3y3_1.heavy 427.229 / 479.295 1284.0 16.08679962158203 44 14 10 10 10 1.752760124227231 40.96941699236541 0.0 3 0.9404806108979868 5.033327165738718 1284.0 18.641777777777776 0.0 - - - - - - - 177.625 2 8 DGCR14 DiGeorge syndrome critical region gene 14 1945 247 C20140708_OR008_05 C20140708_OR008_05 TB438468.[MT7]-EAGEAGAATSK[MT7].3b6_1.heavy 427.229 / 659.312 1081.0 16.08679962158203 44 14 10 10 10 1.752760124227231 40.96941699236541 0.0 3 0.9404806108979868 5.033327165738718 1081.0 18.35288032454361 0.0 - - - - - - - 164.28571428571428 2 7 DGCR14 DiGeorge syndrome critical region gene 14 1947 247 C20140708_OR008_05 C20140708_OR008_05 TB438468.[MT7]-EAGEAGAATSK[MT7].3b4_1.heavy 427.229 / 531.253 1487.0 16.08679962158203 44 14 10 10 10 1.752760124227231 40.96941699236541 0.0 3 0.9404806108979868 5.033327165738718 1487.0 12.9929191321499 0.0 - - - - - - - 202.66666666666666 2 9 DGCR14 DiGeorge syndrome critical region gene 14 1949 247 C20140708_OR008_05 C20140708_OR008_05 TB438468.[MT7]-EAGEAGAATSK[MT7].3b7_1.heavy 427.229 / 730.349 203.0 16.08679962158203 44 14 10 10 10 1.752760124227231 40.96941699236541 0.0 3 0.9404806108979868 5.033327165738718 203.0 4.443886710239651 0.0 - - - - - - - 0.0 0 0 DGCR14 DiGeorge syndrome critical region gene 14 1951 248 C20140708_OR008_05 C20140708_OR008_05 TB448789.[MT7]-VVLEGPAPWGFR.2y8_1.heavy 736.413 / 887.452 29099.0 41.729801177978516 37 12 10 5 10 1.739189643549723 45.136640605894456 0.0428009033203125 3 0.8866672341069661 3.630738652520815 29099.0 190.71770819672133 0.0 - - - - - - - 228.375 58 8 PDLIM7 PDZ and LIM domain 7 (enigma) 1953 248 C20140708_OR008_05 C20140708_OR008_05 TB448789.[MT7]-VVLEGPAPWGFR.2y9_1.heavy 736.413 / 1016.49 19044.0 41.729801177978516 37 12 10 5 10 1.739189643549723 45.136640605894456 0.0428009033203125 3 0.8866672341069661 3.630738652520815 19044.0 69.53720845141156 0.0 - - - - - - - 304.75 38 8 PDLIM7 PDZ and LIM domain 7 (enigma) 1955 248 C20140708_OR008_05 C20140708_OR008_05 TB448789.[MT7]-VVLEGPAPWGFR.2y10_1.heavy 736.413 / 1129.58 8684.0 41.729801177978516 37 12 10 5 10 1.739189643549723 45.136640605894456 0.0428009033203125 3 0.8866672341069661 3.630738652520815 8684.0 83.32406643658325 0.0 - - - - - - - 239.28571428571428 17 7 PDLIM7 PDZ and LIM domain 7 (enigma) 1957 248 C20140708_OR008_05 C20140708_OR008_05 TB448789.[MT7]-VVLEGPAPWGFR.2y11_1.heavy 736.413 / 1228.65 3656.0 41.729801177978516 37 12 10 5 10 1.739189643549723 45.136640605894456 0.0428009033203125 3 0.8866672341069661 3.630738652520815 3656.0 34.8400396893874 0.0 - - - - - - - 279.3333333333333 7 6 PDLIM7 PDZ and LIM domain 7 (enigma) 1959 249 C20140708_OR008_05 C20140708_OR008_05 TB448573.[MT7]-VGGEPGITR.2y8_1.heavy 515.294 / 786.41 13006.0 21.92685079574585 46 20 10 6 10 10.365836120923035 9.647075145067546 0.03660011291503906 3 0.9937076061004839 15.549857969735006 13006.0 116.57758974358975 0.0 - - - - - - - 182.0 26 9 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1961 249 C20140708_OR008_05 C20140708_OR008_05 TB448573.[MT7]-VGGEPGITR.2y5_1.heavy 515.294 / 543.325 12734.0 21.92685079574585 46 20 10 6 10 10.365836120923035 9.647075145067546 0.03660011291503906 3 0.9937076061004839 15.549857969735006 12734.0 53.52478021978021 0.0 - - - - - - - 260.0 25 7 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1963 249 C20140708_OR008_05 C20140708_OR008_05 TB448573.[MT7]-VGGEPGITR.2b6_1.heavy 515.294 / 641.338 3001.0 21.92685079574585 46 20 10 6 10 10.365836120923035 9.647075145067546 0.03660011291503906 3 0.9937076061004839 15.549857969735006 3001.0 12.458363858363859 0.0 - - - - - - - 182.0 6 4 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1965 249 C20140708_OR008_05 C20140708_OR008_05 TB448573.[MT7]-VGGEPGITR.2y7_1.heavy 515.294 / 729.389 910.0 21.92685079574585 46 20 10 6 10 10.365836120923035 9.647075145067546 0.03660011291503906 3 0.9937076061004839 15.549857969735006 910.0 0.4 1.0 - - - - - - - 0.0 1 0 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1967 250 C20140708_OR008_05 C20140708_OR008_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 171489.0 44.03310012817383 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 171489.0 352.89889972630857 0.0 - - - - - - - 286.4 342 10 1969 250 C20140708_OR008_05 C20140708_OR008_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 230922.0 44.03310012817383 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 230922.0 178.9065316642496 1.0 - - - - - - - 310.42857142857144 514 7 1971 250 C20140708_OR008_05 C20140708_OR008_05 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 223715.0 44.03310012817383 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 223715.0 725.5747116025213 0.0 - - - - - - - 818.1428571428571 447 7 1973 251 C20140708_OR008_05 C20140708_OR008_05 TB438759.[MT7]-NLVAVDWESHINTK[MT7].3y3_1.heavy 638.682 / 506.306 18486.0 35.01959991455078 43 13 10 10 10 1.0540021739195722 58.71411958850675 0.0 3 0.9159443376886465 4.226577247662901 18486.0 31.30206118517558 0.0 - - - - - - - 764.25 36 8 ZNF559 zinc finger protein 559 1975 251 C20140708_OR008_05 C20140708_OR008_05 TB438759.[MT7]-NLVAVDWESHINTK[MT7].3b4_1.heavy 638.682 / 542.342 6115.0 35.01959991455078 43 13 10 10 10 1.0540021739195722 58.71411958850675 0.0 3 0.9159443376886465 4.226577247662901 6115.0 4.45102179153262 1.0 - - - - - - - 284.3333333333333 13 12 ZNF559 zinc finger protein 559 1977 251 C20140708_OR008_05 C20140708_OR008_05 TB438759.[MT7]-NLVAVDWESHINTK[MT7].3b5_1.heavy 638.682 / 641.41 4408.0 35.01959991455078 43 13 10 10 10 1.0540021739195722 58.71411958850675 0.0 3 0.9159443376886465 4.226577247662901 4408.0 16.827192752295847 0.0 - - - - - - - 312.8 8 10 ZNF559 zinc finger protein 559 1979 251 C20140708_OR008_05 C20140708_OR008_05 TB438759.[MT7]-NLVAVDWESHINTK[MT7].3y4_1.heavy 638.682 / 619.39 11092.0 35.01959991455078 43 13 10 10 10 1.0540021739195722 58.71411958850675 0.0 3 0.9159443376886465 4.226577247662901 11092.0 45.38634768187332 0.0 - - - - - - - 711.0 22 7 ZNF559 zinc finger protein 559 1981 252 C20140708_OR008_05 C20140708_OR008_05 TB449005.[MT7]-ENLEYC[CAM]IMVIGVPNVGK[MT7].2b8_1.heavy 1112.09 / 1197.54 3737.0 43.856574058532715 42 17 10 5 10 2.9547709705469094 33.84357061741765 0.042896270751953125 3 0.9766509274676575 8.060813640952382 3737.0 8.10433734939759 0.0 - - - - - - - 322.77777777777777 7 9 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1983 252 C20140708_OR008_05 C20140708_OR008_05 TB449005.[MT7]-ENLEYC[CAM]IMVIGVPNVGK[MT7].2b3_1.heavy 1112.09 / 501.279 1799.0 43.856574058532715 42 17 10 5 10 2.9547709705469094 33.84357061741765 0.042896270751953125 3 0.9766509274676575 8.060813640952382 1799.0 -0.5474324838341575 1.0 - - - - - - - 277.0 5 2 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1985 252 C20140708_OR008_05 C20140708_OR008_05 TB449005.[MT7]-ENLEYC[CAM]IMVIGVPNVGK[MT7].2y5_1.heavy 1112.09 / 658.4 10102.0 43.856574058532715 42 17 10 5 10 2.9547709705469094 33.84357061741765 0.042896270751953125 3 0.9766509274676575 8.060813640952382 10102.0 47.4101083032491 0.0 - - - - - - - 276.6666666666667 20 3 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1987 252 C20140708_OR008_05 C20140708_OR008_05 TB449005.[MT7]-ENLEYC[CAM]IMVIGVPNVGK[MT7].2b4_1.heavy 1112.09 / 630.321 4705.0 43.856574058532715 42 17 10 5 10 2.9547709705469094 33.84357061741765 0.042896270751953125 3 0.9766509274676575 8.060813640952382 4705.0 17.496108178043027 0.0 - - - - - - - 311.25 9 4 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 1989 253 C20140708_OR008_05 C20140708_OR008_05 TB449004.[MT7]-FVVVGVLLQVVPSSAATIK[MT7].3b6_1.heavy 739.127 / 745.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1991 253 C20140708_OR008_05 C20140708_OR008_05 TB449004.[MT7]-FVVVGVLLQVVPSSAATIK[MT7].3b5_1.heavy 739.127 / 646.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1993 253 C20140708_OR008_05 C20140708_OR008_05 TB449004.[MT7]-FVVVGVLLQVVPSSAATIK[MT7].3y8_1.heavy 739.127 / 918.538 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1995 253 C20140708_OR008_05 C20140708_OR008_05 TB449004.[MT7]-FVVVGVLLQVVPSSAATIK[MT7].3b7_1.heavy 739.127 / 858.557 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 1997 254 C20140708_OR008_05 C20140708_OR008_05 TB448785.[MT7]-VIELQEIISK[MT7].2y4_1.heavy 730.452 / 604.415 1086.0 40.88825035095215 34 12 9 5 8 1.6875732561993493 59.2566868624204 0.04579925537109375 4 0.8954013483671699 3.7821523152302077 1086.0 5.25483870967742 6.0 - - - - - - - 284.3333333333333 9 6 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 1999 254 C20140708_OR008_05 C20140708_OR008_05 TB448785.[MT7]-VIELQEIISK[MT7].2y9_1.heavy 730.452 / 1216.73 931.0 40.88825035095215 34 12 9 5 8 1.6875732561993493 59.2566868624204 0.04579925537109375 4 0.8954013483671699 3.7821523152302077 931.0 6.607096774193549 0.0 - - - - - - - 0.0 1 0 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 2001 254 C20140708_OR008_05 C20140708_OR008_05 TB448785.[MT7]-VIELQEIISK[MT7].2b4_1.heavy 730.452 / 599.388 4035.0 40.88825035095215 34 12 9 5 8 1.6875732561993493 59.2566868624204 0.04579925537109375 4 0.8954013483671699 3.7821523152302077 4035.0 21.4671809256662 0.0 - - - - - - - 232.5 8 6 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 2003 254 C20140708_OR008_05 C20140708_OR008_05 TB448785.[MT7]-VIELQEIISK[MT7].2b6_1.heavy 730.452 / 856.49 2793.0 40.88825035095215 34 12 9 5 8 1.6875732561993493 59.2566868624204 0.04579925537109375 4 0.8954013483671699 3.7821523152302077 2793.0 18.920322580645163 0.0 - - - - - - - 206.66666666666666 5 3 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 2005 255 C20140708_OR008_05 C20140708_OR008_05 TB448578.[MT7]-YQEAAGPR.2b3_1.heavy 518.271 / 565.274 752.0 18.208324909210205 33 14 10 5 4 9.374842497824206 10.66684587215293 0.04549980163574219 7 0.9466474952096425 5.319060158507496 752.0 8.483809523809525 1.0 - - - - - - - 0.0 1 0 ZNF496 zinc finger protein 496 2007 255 C20140708_OR008_05 C20140708_OR008_05 TB448578.[MT7]-YQEAAGPR.2b4_1.heavy 518.271 / 636.311 585.0 18.208324909210205 33 14 10 5 4 9.374842497824206 10.66684587215293 0.04549980163574219 7 0.9466474952096425 5.319060158507496 585.0 7.164285714285715 7.0 - - - - - - - 223.0 2 6 ZNF496 zinc finger protein 496 2009 255 C20140708_OR008_05 C20140708_OR008_05 TB448578.[MT7]-YQEAAGPR.2y6_1.heavy 518.271 / 600.31 251.0 18.208324909210205 33 14 10 5 4 9.374842497824206 10.66684587215293 0.04549980163574219 7 0.9466474952096425 5.319060158507496 251.0 0.04970059880239519 13.0 - - - - - - - 0.0 1 0 ZNF496 zinc finger protein 496 2011 255 C20140708_OR008_05 C20140708_OR008_05 TB448578.[MT7]-YQEAAGPR.2y7_1.heavy 518.271 / 728.369 1839.0 18.208324909210205 33 14 10 5 4 9.374842497824206 10.66684587215293 0.04549980163574219 7 0.9466474952096425 5.319060158507496 1839.0 32.13399486740804 0.0 - - - - - - - 111.66666666666667 3 3 ZNF496 zinc finger protein 496 2013 256 C20140708_OR008_05 C20140708_OR008_05 TB430117.[MT7]-LFELDGLK[MT7].3y3_1.heavy 408.248 / 461.32 2388.0 40.79699993133545 32 7 10 5 10 3.671242479081308 27.238734725314036 0.046001434326171875 3 0.7106875784196346 2.2366804310409436 2388.0 17.33401242236025 1.0 - - - - - - - 177.0 4 3 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2015 256 C20140708_OR008_05 C20140708_OR008_05 TB430117.[MT7]-LFELDGLK[MT7].3b4_1.heavy 408.248 / 647.388 1327.0 40.79699993133545 32 7 10 5 10 3.671242479081308 27.238734725314036 0.046001434326171875 3 0.7106875784196346 2.2366804310409436 1327.0 14.984990778833877 0.0 - - - - - - - 398.0 2 1 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2017 256 C20140708_OR008_05 C20140708_OR008_05 TB430117.[MT7]-LFELDGLK[MT7].3y4_1.heavy 408.248 / 576.347 1194.0 40.79699993133545 32 7 10 5 10 3.671242479081308 27.238734725314036 0.046001434326171875 3 0.7106875784196346 2.2366804310409436 1194.0 -0.15000000000000036 0.0 - - - - - - - 344.8 2 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2019 256 C20140708_OR008_05 C20140708_OR008_05 TB430117.[MT7]-LFELDGLK[MT7].3b3_1.heavy 408.248 / 534.304 796.0 40.79699993133545 32 7 10 5 10 3.671242479081308 27.238734725314036 0.046001434326171875 3 0.7106875784196346 2.2366804310409436 796.0 5.984962406015038 0.0 - - - - - - - 0.0 1 0 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2021 257 C20140708_OR008_05 C20140708_OR008_05 TB438858.[MT7]-LEQC[CAM]PLQLNNPFNEYSK[MT7].4y5_1.heavy 596.305 / 784.396 3153.0 39.88590049743652 35 12 10 5 8 1.1119848773877756 59.2866188135942 0.048801422119140625 4 0.8907072603314461 3.6985334090600634 3153.0 20.560919128329296 0.0 - - - - - - - 337.5 6 4 MAPKAP1 mitogen-activated protein kinase associated protein 1 2023 257 C20140708_OR008_05 C20140708_OR008_05 TB438858.[MT7]-LEQC[CAM]PLQLNNPFNEYSK[MT7].4b4_1.heavy 596.305 / 675.325 3153.0 39.88590049743652 35 12 10 5 8 1.1119848773877756 59.2866188135942 0.048801422119140625 4 0.8907072603314461 3.6985334090600634 3153.0 6.906 0.0 - - - - - - - 300.0 6 5 MAPKAP1 mitogen-activated protein kinase associated protein 1 2025 257 C20140708_OR008_05 C20140708_OR008_05 TB438858.[MT7]-LEQC[CAM]PLQLNNPFNEYSK[MT7].4y3_1.heavy 596.305 / 541.31 1351.0 39.88590049743652 35 12 10 5 8 1.1119848773877756 59.2866188135942 0.048801422119140625 4 0.8907072603314461 3.6985334090600634 1351.0 1.7992345761207278 5.0 - - - - - - - 350.0 3 3 MAPKAP1 mitogen-activated protein kinase associated protein 1 2027 257 C20140708_OR008_05 C20140708_OR008_05 TB438858.[MT7]-LEQC[CAM]PLQLNNPFNEYSK[MT7].4b3_1.heavy 596.305 / 515.295 1201.0 39.88590049743652 35 12 10 5 8 1.1119848773877756 59.2866188135942 0.048801422119140625 4 0.8907072603314461 3.6985334090600634 1201.0 1.7488352745424294 14.0 - - - - - - - 330.0 4 5 MAPKAP1 mitogen-activated protein kinase associated protein 1 2029 258 C20140708_OR008_05 C20140708_OR008_05 TB449000.[MT7]-VLDEEEYIEGLQTVIQR.3b6_1.heavy 726.719 / 859.417 3496.0 45.39827537536621 41 15 10 6 10 1.8025861843143378 43.941634812293366 0.03710174560546875 3 0.9546939197980504 5.776046106942667 3496.0 0.0 0.0 - - - - - - - 121.0 6 1 DGCR14 DiGeorge syndrome critical region gene 14 2031 258 C20140708_OR008_05 C20140708_OR008_05 TB449000.[MT7]-VLDEEEYIEGLQTVIQR.3b5_1.heavy 726.719 / 730.374 1326.0 45.39827537536621 41 15 10 6 10 1.8025861843143378 43.941634812293366 0.03710174560546875 3 0.9546939197980504 5.776046106942667 1326.0 7.6710743801652885 0.0 - - - - - - - 214.55555555555554 2 9 DGCR14 DiGeorge syndrome critical region gene 14 2033 258 C20140708_OR008_05 C20140708_OR008_05 TB449000.[MT7]-VLDEEEYIEGLQTVIQR.3y8_1.heavy 726.719 / 914.542 1206.0 45.39827537536621 41 15 10 6 10 1.8025861843143378 43.941634812293366 0.03710174560546875 3 0.9546939197980504 5.776046106942667 1206.0 -1.5 1.0 - - - - - - - 241.25 2 4 DGCR14 DiGeorge syndrome critical region gene 14 2035 258 C20140708_OR008_05 C20140708_OR008_05 TB449000.[MT7]-VLDEEEYIEGLQTVIQR.3y9_1.heavy 726.719 / 1043.58 2894.0 45.39827537536621 41 15 10 6 10 1.8025861843143378 43.941634812293366 0.03710174560546875 3 0.9546939197980504 5.776046106942667 2894.0 13.07843057243071 0.0 - - - - - - - 268.0 5 9 DGCR14 DiGeorge syndrome critical region gene 14 2037 259 C20140708_OR008_05 C20140708_OR008_05 TB438460.[MT7]-DLSIPLSIK[MT7].2y4_1.heavy 637.402 / 604.415 1381.0 38.53017520904541 37 20 10 5 2 4.5812828383313615 21.827947221093854 0.046298980712890625 11 0.9954692981947459 18.328018819640118 1381.0 1.1495114006514657 10.0 - - - - - - - 340.8888888888889 4 9 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2039 259 C20140708_OR008_05 C20140708_OR008_05 TB438460.[MT7]-DLSIPLSIK[MT7].2y5_1.heavy 637.402 / 701.468 18418.0 38.53017520904541 37 20 10 5 2 4.5812828383313615 21.827947221093854 0.046298980712890625 11 0.9954692981947459 18.328018819640118 18418.0 77.57157654723127 0.0 - - - - - - - 214.6 36 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2041 259 C20140708_OR008_05 C20140708_OR008_05 TB438460.[MT7]-DLSIPLSIK[MT7].2y6_1.heavy 637.402 / 814.552 1074.0 38.53017520904541 37 20 10 5 2 4.5812828383313615 21.827947221093854 0.046298980712890625 11 0.9954692981947459 18.328018819640118 1074.0 1.6940874594957298 10.0 - - - - - - - 204.16666666666666 5 6 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2043 259 C20140708_OR008_05 C20140708_OR008_05 TB438460.[MT7]-DLSIPLSIK[MT7].2y7_1.heavy 637.402 / 901.584 921.0 38.53017520904541 37 20 10 5 2 4.5812828383313615 21.827947221093854 0.046298980712890625 11 0.9954692981947459 18.328018819640118 921.0 1.0473355791329533 4.0 - - - - - - - 218.85714285714286 2 7 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2045 260 C20140708_OR008_05 C20140708_OR008_05 TB449102.[MT7]-AQEPESGEQAVAAVEALEREPGRPWQWLK[MT7].4b5_1.heavy 888.214 / 699.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 2047 260 C20140708_OR008_05 C20140708_OR008_05 TB449102.[MT7]-AQEPESGEQAVAAVEALEREPGRPWQWLK[MT7].4y6_1.heavy 888.214 / 1001.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 2049 260 C20140708_OR008_05 C20140708_OR008_05 TB449102.[MT7]-AQEPESGEQAVAAVEALEREPGRPWQWLK[MT7].4y19_2.heavy 888.214 / 1190.16 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 2051 260 C20140708_OR008_05 C20140708_OR008_05 TB449102.[MT7]-AQEPESGEQAVAAVEALEREPGRPWQWLK[MT7].4y18_2.heavy 888.214 / 1140.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF496 zinc finger protein 496 2053 261 C20140708_OR008_05 C20140708_OR008_05 TB438461.[MT7]-AAAEGLMSLLR.2y10_1.heavy 638.364 / 1060.58 7421.0 44.395474433898926 42 16 10 6 10 3.12095574231076 32.04146686359604 0.038700103759765625 3 0.9680428014788632 6.885169138751447 7421.0 63.88916959761549 0.0 - - - - - - - 152.83333333333334 14 6 CDC27 cell division cycle 27 homolog (S. cerevisiae) 2055 261 C20140708_OR008_05 C20140708_OR008_05 TB438461.[MT7]-AAAEGLMSLLR.2b5_1.heavy 638.364 / 544.285 1374.0 44.395474433898926 42 16 10 6 10 3.12095574231076 32.04146686359604 0.038700103759765625 3 0.9680428014788632 6.885169138751447 1374.0 1.501639344262295 0.0 - - - - - - - 256.5 2 10 CDC27 cell division cycle 27 homolog (S. cerevisiae) 2057 261 C20140708_OR008_05 C20140708_OR008_05 TB438461.[MT7]-AAAEGLMSLLR.2b6_1.heavy 638.364 / 657.369 1008.0 44.395474433898926 42 16 10 6 10 3.12095574231076 32.04146686359604 0.038700103759765625 3 0.9680428014788632 6.885169138751447 1008.0 5.232786885245901 3.0 - - - - - - - 213.66666666666666 2 6 CDC27 cell division cycle 27 homolog (S. cerevisiae) 2059 261 C20140708_OR008_05 C20140708_OR008_05 TB438461.[MT7]-AAAEGLMSLLR.2y7_1.heavy 638.364 / 789.465 2840.0 44.395474433898926 42 16 10 6 10 3.12095574231076 32.04146686359604 0.038700103759765625 3 0.9680428014788632 6.885169138751447 2840.0 2.3262948858565697 0.0 - - - - - - - 251.75 5 8 CDC27 cell division cycle 27 homolog (S. cerevisiae) 2061 262 C20140708_OR008_05 C20140708_OR008_05 TB430115.[MT7]-SVLLITC[CAM]K[MT7].3y3_1.heavy 407.921 / 552.293 9659.0 33.74814987182617 33 8 10 5 10 0.5797629853409707 89.03311258212534 0.0420989990234375 3 0.7764315847613197 2.5598365552516267 9659.0 71.08980832948065 0.0 - - - - - - - 288.2 19 5 C18orf21 chromosome 18 open reading frame 21 2063 262 C20140708_OR008_05 C20140708_OR008_05 TB430115.[MT7]-SVLLITC[CAM]K[MT7].3b4_1.heavy 407.921 / 557.378 8794.0 33.74814987182617 33 8 10 5 10 0.5797629853409707 89.03311258212534 0.0420989990234375 3 0.7764315847613197 2.5598365552516267 8794.0 45.866255613292275 0.0 - - - - - - - 267.7142857142857 17 7 C18orf21 chromosome 18 open reading frame 21 2065 262 C20140708_OR008_05 C20140708_OR008_05 TB430115.[MT7]-SVLLITC[CAM]K[MT7].3b5_1.heavy 407.921 / 670.462 865.0 33.74814987182617 33 8 10 5 10 0.5797629853409707 89.03311258212534 0.0420989990234375 3 0.7764315847613197 2.5598365552516267 865.0 4.6610004490633825 3.0 - - - - - - - 240.16666666666666 2 6 C18orf21 chromosome 18 open reading frame 21 2067 262 C20140708_OR008_05 C20140708_OR008_05 TB430115.[MT7]-SVLLITC[CAM]K[MT7].3b3_1.heavy 407.921 / 444.294 3748.0 33.74814987182617 33 8 10 5 10 0.5797629853409707 89.03311258212534 0.0420989990234375 3 0.7764315847613197 2.5598365552516267 3748.0 14.313022337762373 0.0 - - - - - - - 201.6 7 5 C18orf21 chromosome 18 open reading frame 21 2069 263 C20140708_OR008_05 C20140708_OR008_05 TB448577.[MT7]-ELMILK[MT7].2y4_1.heavy 517.83 / 648.424 1770.0 35.72270107269287 40 18 9 5 8 4.613489624072493 21.675566252108837 0.046398162841796875 4 0.9885398433006801 11.517320720107088 1770.0 3.4580398574245788 2.0 - - - - - - - 217.6 5 5 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 2071 263 C20140708_OR008_05 C20140708_OR008_05 TB448577.[MT7]-ELMILK[MT7].2y5_1.heavy 517.83 / 761.508 2451.0 35.72270107269287 40 18 9 5 8 4.613489624072493 21.675566252108837 0.046398162841796875 4 0.9885398433006801 11.517320720107088 2451.0 33.52102941176471 0.0 - - - - - - - 204.0 4 8 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 2073 263 C20140708_OR008_05 C20140708_OR008_05 TB448577.[MT7]-ELMILK[MT7].2b4_1.heavy 517.83 / 631.36 1362.0 35.72270107269287 40 18 9 5 8 4.613489624072493 21.675566252108837 0.046398162841796875 4 0.9885398433006801 11.517320720107088 1362.0 3.4270732292917163 1.0 - - - - - - - 241.77777777777777 2 9 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 2075 263 C20140708_OR008_05 C20140708_OR008_05 TB448577.[MT7]-ELMILK[MT7].2b5_1.heavy 517.83 / 744.445 545.0 35.72270107269287 40 18 9 5 8 4.613489624072493 21.675566252108837 0.046398162841796875 4 0.9885398433006801 11.517320720107088 545.0 3.666727941176471 8.0 - - - - - - - 0.0 1 0 PPFIA1 protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 1 2077 264 C20140708_OR008_05 C20140708_OR008_05 TB438368.[MT7]-ASYTPSPAR.2y8_1.heavy 547.292 / 878.437 1381.0 19.367799758911133 42 14 10 10 8 2.0089171866118716 39.24749425121296 0.0 4 0.9356145478856189 4.837381101349031 1381.0 15.961557971014491 0.0 - - - - - - - 173.77777777777777 2 9 DGCR14 DiGeorge syndrome critical region gene 14 2079 264 C20140708_OR008_05 C20140708_OR008_05 TB438368.[MT7]-ASYTPSPAR.2y5_1.heavy 547.292 / 527.294 2210.0 19.367799758911133 42 14 10 10 8 2.0089171866118716 39.24749425121296 0.0 4 0.9356145478856189 4.837381101349031 2210.0 6.555509134683472 1.0 - - - - - - - 200.72727272727272 4 11 DGCR14 DiGeorge syndrome critical region gene 14 2081 264 C20140708_OR008_05 C20140708_OR008_05 TB438368.[MT7]-ASYTPSPAR.2b4_1.heavy 547.292 / 567.289 1105.0 19.367799758911133 42 14 10 10 8 2.0089171866118716 39.24749425121296 0.0 4 0.9356145478856189 4.837381101349031 1105.0 7.006340579710144 0.0 - - - - - - - 198.15384615384616 2 13 DGCR14 DiGeorge syndrome critical region gene 14 2083 264 C20140708_OR008_05 C20140708_OR008_05 TB438368.[MT7]-ASYTPSPAR.2y7_1.heavy 547.292 / 791.405 552.0 19.367799758911133 42 14 10 10 8 2.0089171866118716 39.24749425121296 0.0 4 0.9356145478856189 4.837381101349031 552.0 1.98 4.0 - - - - - - - 0.0 1 0 DGCR14 DiGeorge syndrome critical region gene 14 2085 265 C20140708_OR008_05 C20140708_OR008_05 TB438854.[MT7]-VLQGGEQEIQFEDFTNTLR.2b6_1.heavy 1184.6 / 728.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 2087 265 C20140708_OR008_05 C20140708_OR008_05 TB438854.[MT7]-VLQGGEQEIQFEDFTNTLR.2y6_1.heavy 1184.6 / 751.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 2089 265 C20140708_OR008_05 C20140708_OR008_05 TB438854.[MT7]-VLQGGEQEIQFEDFTNTLR.2b10_1.heavy 1184.6 / 1226.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 2091 265 C20140708_OR008_05 C20140708_OR008_05 TB438854.[MT7]-VLQGGEQEIQFEDFTNTLR.2y7_1.heavy 1184.6 / 866.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 2093 266 C20140708_OR008_05 C20140708_OR008_05 TB438758.[MT7]-VC[CAM]TISSTGPLQPQPK[MT7].3b4_1.heavy 634.352 / 618.34 1777.0 28.915400505065918 26 13 2 5 6 1.7437207435749462 45.52643435002384 0.042400360107421875 6 0.903754413109346 3.9457136825465713 1777.0 3.117035647315322 2.0 - - - - - - - 303.4 15 10 PKD2L1 polycystic kidney disease 2-like 1 2095 266 C20140708_OR008_05 C20140708_OR008_05 TB438758.[MT7]-VC[CAM]TISSTGPLQPQPK[MT7].3b5_1.heavy 634.352 / 705.372 836.0 28.915400505065918 26 13 2 5 6 1.7437207435749462 45.52643435002384 0.042400360107421875 6 0.903754413109346 3.9457136825465713 836.0 0.4795411089866156 4.0 - - - - - - - 233.94117647058823 2 17 PKD2L1 polycystic kidney disease 2-like 1 2097 266 C20140708_OR008_05 C20140708_OR008_05 TB438758.[MT7]-VC[CAM]TISSTGPLQPQPK[MT7].3y4_1.heavy 634.352 / 613.379 5123.0 28.915400505065918 26 13 2 5 6 1.7437207435749462 45.52643435002384 0.042400360107421875 6 0.903754413109346 3.9457136825465713 5123.0 3.5368024562144407 3.0 - - - - - - - 209.25 31 8 PKD2L1 polycystic kidney disease 2-like 1 2099 266 C20140708_OR008_05 C20140708_OR008_05 TB438758.[MT7]-VC[CAM]TISSTGPLQPQPK[MT7].3b3_1.heavy 634.352 / 505.256 2300.0 28.915400505065918 26 13 2 5 6 1.7437207435749462 45.52643435002384 0.042400360107421875 6 0.903754413109346 3.9457136825465713 2300.0 3.3181644359464633 2.0 - - - - - - - 303.2 9 10 PKD2L1 polycystic kidney disease 2-like 1 2101 267 C20140708_OR008_05 C20140708_OR008_05 TB438752.[MT7]-IHLQPDRLQPVEK[MT7].3y4_1.heavy 621.035 / 616.379 3315.0 28.050049781799316 39 14 10 5 10 15.130043247036442 6.609366435194245 0.04549980163574219 3 0.9411138163398702 5.060589555029864 3315.0 8.24877336448598 0.0 - - - - - - - 237.77777777777777 6 9 ZNF496 zinc finger protein 496 2103 267 C20140708_OR008_05 C20140708_OR008_05 TB438752.[MT7]-IHLQPDRLQPVEK[MT7].3y12_2.heavy 621.035 / 802.456 3101.0 28.050049781799316 39 14 10 5 10 15.130043247036442 6.609366435194245 0.04549980163574219 3 0.9411138163398702 5.060589555029864 3101.0 25.648457943925237 0.0 - - - - - - - 299.6 6 10 ZNF496 zinc finger protein 496 2105 267 C20140708_OR008_05 C20140708_OR008_05 TB438752.[MT7]-IHLQPDRLQPVEK[MT7].3y9_2.heavy 621.035 / 613.355 2781.0 28.050049781799316 39 14 10 5 10 15.130043247036442 6.609366435194245 0.04549980163574219 3 0.9411138163398702 5.060589555029864 2781.0 26.25056074766355 0.0 - - - - - - - 142.66666666666666 5 9 ZNF496 zinc finger protein 496 2107 267 C20140708_OR008_05 C20140708_OR008_05 TB438752.[MT7]-IHLQPDRLQPVEK[MT7].3y9_1.heavy 621.035 / 1225.7 107.0 28.050049781799316 39 14 10 5 10 15.130043247036442 6.609366435194245 0.04549980163574219 3 0.9411138163398702 5.060589555029864 107.0 0.4 35.0 - - - - - - - 0.0 1 0 ZNF496 zinc finger protein 496 2109 268 C20140708_OR008_05 C20140708_OR008_05 TB430494.[MT7]-LWLDGYSVTDAVALR.3y7_1.heavy 608.332 / 745.42 3402.0 45.416826248168945 44 18 10 6 10 2.6278009705237224 30.489315574753757 0.03710174560546875 3 0.980577142178486 8.840978837679728 3402.0 27.516176470588235 0.0 - - - - - - - 170.0 6 13 FIBP fibroblast growth factor (acidic) intracellular binding protein 2111 268 C20140708_OR008_05 C20140708_OR008_05 TB430494.[MT7]-LWLDGYSVTDAVALR.3y6_1.heavy 608.332 / 644.373 3317.0 45.416826248168945 44 18 10 6 10 2.6278009705237224 30.489315574753757 0.03710174560546875 3 0.980577142178486 8.840978837679728 3317.0 21.181104575163396 0.0 - - - - - - - 154.54545454545453 6 11 FIBP fibroblast growth factor (acidic) intracellular binding protein 2113 268 C20140708_OR008_05 C20140708_OR008_05 TB430494.[MT7]-LWLDGYSVTDAVALR.3b4_1.heavy 608.332 / 672.384 2211.0 45.416826248168945 44 18 10 6 10 2.6278009705237224 30.489315574753757 0.03710174560546875 3 0.980577142178486 8.840978837679728 2211.0 8.271741176470588 0.0 - - - - - - - 246.5 4 10 FIBP fibroblast growth factor (acidic) intracellular binding protein 2115 268 C20140708_OR008_05 C20140708_OR008_05 TB430494.[MT7]-LWLDGYSVTDAVALR.3y5_1.heavy 608.332 / 529.346 2977.0 45.416826248168945 44 18 10 6 10 2.6278009705237224 30.489315574753757 0.03710174560546875 3 0.980577142178486 8.840978837679728 2977.0 39.66414705882353 0.0 - - - - - - - 192.66666666666666 5 15 FIBP fibroblast growth factor (acidic) intracellular binding protein 2117 269 C20140708_OR008_05 C20140708_OR008_05 TB438477.[MT7]-DFNVPLSISR.3y6_1.heavy 431.242 / 672.404 3927.0 36.10299873352051 38 13 10 5 10 1.7176330381689517 46.07243258843171 0.047199249267578125 3 0.9299917430109244 4.6368269958611945 3927.0 17.164370860927153 0.0 - - - - - - - 332.2 7 5 PDLIM7 PDZ and LIM domain 7 (enigma) 2119 269 C20140708_OR008_05 C20140708_OR008_05 TB438477.[MT7]-DFNVPLSISR.3y5_1.heavy 431.242 / 575.351 4078.0 36.10299873352051 38 13 10 5 10 1.7176330381689517 46.07243258843171 0.047199249267578125 3 0.9299917430109244 4.6368269958611945 4078.0 17.284238410596025 0.0 - - - - - - - 1157.6666666666667 8 3 PDLIM7 PDZ and LIM domain 7 (enigma) 2121 269 C20140708_OR008_05 C20140708_OR008_05 TB438477.[MT7]-DFNVPLSISR.3b3_1.heavy 431.242 / 521.248 4682.0 36.10299873352051 38 13 10 5 10 1.7176330381689517 46.07243258843171 0.047199249267578125 3 0.9299917430109244 4.6368269958611945 4682.0 46.50993377483444 0.0 - - - - - - - 201.33333333333334 9 3 PDLIM7 PDZ and LIM domain 7 (enigma) 2123 269 C20140708_OR008_05 C20140708_OR008_05 TB438477.[MT7]-DFNVPLSISR.3y4_1.heavy 431.242 / 462.267 6948.0 36.10299873352051 38 13 10 5 10 1.7176330381689517 46.07243258843171 0.047199249267578125 3 0.9299917430109244 4.6368269958611945 6948.0 14.899665116123698 0.0 - - - - - - - 302.0 13 2 PDLIM7 PDZ and LIM domain 7 (enigma) 2125 270 C20140708_OR008_05 C20140708_OR008_05 TB438472.[MT7]-AFINSSSFK[MT7].3y3_1.heavy 430.243 / 525.315 2265.0 31.83880043029785 31 9 10 6 6 1.862688437133037 53.6858435401657 0.03440093994140625 6 0.8080330525953505 2.770405275719201 2265.0 8.53082519226772 0.0 - - - - - - - 213.77777777777777 4 9 ZNF559 zinc finger protein 559 2127 270 C20140708_OR008_05 C20140708_OR008_05 TB438472.[MT7]-AFINSSSFK[MT7].3b4_1.heavy 430.243 / 590.342 113.0 31.83880043029785 31 9 10 6 6 1.862688437133037 53.6858435401657 0.03440093994140625 6 0.8080330525953505 2.770405275719201 113.0 1.0498586572438162 20.0 - - - - - - - 188.44444444444446 2 9 ZNF559 zinc finger protein 559 2129 270 C20140708_OR008_05 C20140708_OR008_05 TB438472.[MT7]-AFINSSSFK[MT7].3y4_1.heavy 430.243 / 612.347 566.0 31.83880043029785 31 9 10 6 6 1.862688437133037 53.6858435401657 0.03440093994140625 6 0.8080330525953505 2.770405275719201 566.0 3.3308849557522127 5.0 - - - - - - - 0.0 1 0 ZNF559 zinc finger protein 559 2131 270 C20140708_OR008_05 C20140708_OR008_05 TB438472.[MT7]-AFINSSSFK[MT7].3b3_1.heavy 430.243 / 476.299 679.0 31.83880043029785 31 9 10 6 6 1.862688437133037 53.6858435401657 0.03440093994140625 6 0.8080330525953505 2.770405275719201 679.0 1.8026548672566372 4.0 - - - - - - - 192.3 2 10 ZNF559 zinc finger protein 559 2133 271 C20140708_OR008_05 C20140708_OR008_05 TB430103.[MT7]-C[CAM]HGC[CAM]DFK[MT7].3y3_1.heavy 404.523 / 553.31 787.0 17.390199184417725 31 8 10 5 8 0.7335289030778486 78.09896662170942 0.04319953918457031 4 0.7955471321907106 2.6814658006912735 787.0 10.855172413793104 0.0 - - - - - - - 0.0 1 0 PDLIM7 PDZ and LIM domain 7 (enigma) 2135 271 C20140708_OR008_05 C20140708_OR008_05 TB430103.[MT7]-C[CAM]HGC[CAM]DFK[MT7].3b3_2.heavy 404.523 / 250.114 1661.0 17.390199184417725 31 8 10 5 8 0.7335289030778486 78.09896662170942 0.04319953918457031 4 0.7955471321907106 2.6814658006912735 1661.0 26.391626272577998 0.0 - - - - - - - 200.9 3 10 PDLIM7 PDZ and LIM domain 7 (enigma) 2137 271 C20140708_OR008_05 C20140708_OR008_05 TB430103.[MT7]-C[CAM]HGC[CAM]DFK[MT7].3b5_2.heavy 404.523 / 387.643 1573.0 17.390199184417725 31 8 10 5 8 0.7335289030778486 78.09896662170942 0.04319953918457031 4 0.7955471321907106 2.6814658006912735 1573.0 6.103353756528726 2.0 - - - - - - - 253.4 3 10 PDLIM7 PDZ and LIM domain 7 (enigma) 2139 271 C20140708_OR008_05 C20140708_OR008_05 TB430103.[MT7]-C[CAM]HGC[CAM]DFK[MT7].3y3_2.heavy 404.523 / 277.159 175.0 17.390199184417725 31 8 10 5 8 0.7335289030778486 78.09896662170942 0.04319953918457031 4 0.7955471321907106 2.6814658006912735 175.0 0.8045977011494252 22.0 - - - - - - - 130.875 2 8 PDLIM7 PDZ and LIM domain 7 (enigma) 2141 272 C20140708_OR008_05 C20140708_OR008_05 TB438470.[MT7]-DFFPDVEK[MT7].3y3_1.heavy 428.895 / 519.326 4318.0 35.51089954376221 36 11 10 5 10 1.2232090106925617 52.79430782455791 0.046001434326171875 3 0.8791018725288089 3.51298898552493 4318.0 22.70089485458613 0.0 - - - - - - - 298.0 8 7 DGCR14 DiGeorge syndrome critical region gene 14 2143 272 C20140708_OR008_05 C20140708_OR008_05 TB438470.[MT7]-DFFPDVEK[MT7].3b5_1.heavy 428.895 / 766.353 893.0 35.51089954376221 36 11 10 5 10 1.2232090106925617 52.79430782455791 0.046001434326171875 3 0.8791018725288089 3.51298898552493 893.0 7.991051454138702 0.0 - - - - - - - 0.0 1 0 DGCR14 DiGeorge syndrome critical region gene 14 2145 272 C20140708_OR008_05 C20140708_OR008_05 TB438470.[MT7]-DFFPDVEK[MT7].3y4_1.heavy 428.895 / 634.353 2084.0 35.51089954376221 36 11 10 5 10 1.2232090106925617 52.79430782455791 0.046001434326171875 3 0.8791018725288089 3.51298898552493 2084.0 20.420402684563758 0.0 - - - - - - - 149.0 4 1 DGCR14 DiGeorge syndrome critical region gene 14 2147 272 C20140708_OR008_05 C20140708_OR008_05 TB438470.[MT7]-DFFPDVEK[MT7].3b3_1.heavy 428.895 / 554.273 3424.0 35.51089954376221 36 11 10 5 10 1.2232090106925617 52.79430782455791 0.046001434326171875 3 0.8791018725288089 3.51298898552493 3424.0 30.639821029082775 0.0 - - - - - - - 223.5 6 2 DGCR14 DiGeorge syndrome critical region gene 14 2149 273 C20140708_OR008_05 C20140708_OR008_05 TB430106.[MT7]-ELIPQESPR.3y6_1.heavy 404.895 / 713.358 535.0 27.081174850463867 35 16 10 3 6 2.326387467030812 34.20590548286815 0.07970046997070312 6 0.9673724373096918 6.813685672137672 535.0 7.1499999999999995 1.0 - - - - - - - 0.0 1 0 DGCR14 DiGeorge syndrome critical region gene 14 2151 273 C20140708_OR008_05 C20140708_OR008_05 TB430106.[MT7]-ELIPQESPR.3y4_1.heavy 404.895 / 488.246 749.0 27.081174850463867 35 16 10 3 6 2.326387467030812 34.20590548286815 0.07970046997070312 6 0.9673724373096918 6.813685672137672 749.0 0.6608333333333334 8.0 - - - - - - - 227.375 2 8 DGCR14 DiGeorge syndrome critical region gene 14 2153 273 C20140708_OR008_05 C20140708_OR008_05 TB430106.[MT7]-ELIPQESPR.3b3_1.heavy 404.895 / 500.32 1820.0 27.081174850463867 35 16 10 3 6 2.326387467030812 34.20590548286815 0.07970046997070312 6 0.9673724373096918 6.813685672137672 1820.0 7.632943925233644 0.0 - - - - - - - 214.0 3 8 DGCR14 DiGeorge syndrome critical region gene 14 2155 273 C20140708_OR008_05 C20140708_OR008_05 TB430106.[MT7]-ELIPQESPR.3y5_1.heavy 404.895 / 616.305 964.0 27.081174850463867 35 16 10 3 6 2.326387467030812 34.20590548286815 0.07970046997070312 6 0.9673724373096918 6.813685672137672 964.0 5.405607476635514 0.0 - - - - - - - 0.0 1 0 DGCR14 DiGeorge syndrome critical region gene 14 2157 274 C20140708_OR008_05 C20140708_OR008_05 TB448893.[MT7]-K[MT7]ITGEIMHALK[MT7].4y4_1.heavy 419.009 / 612.395 1979.0 31.643600463867188 38 8 10 10 10 0.9742802246348797 64.674456012139 0.0 3 0.7916023147890578 2.6550202204669855 1979.0 11.417307692307693 0.0 - - - - - - - 187.2 3 5 PDLIM7 PDZ and LIM domain 7 (enigma) 2159 274 C20140708_OR008_05 C20140708_OR008_05 TB448893.[MT7]-K[MT7]ITGEIMHALK[MT7].4b5_1.heavy 419.009 / 817.502 3229.0 31.643600463867188 38 8 10 10 10 0.9742802246348797 64.674456012139 0.0 3 0.7916023147890578 2.6550202204669855 3229.0 24.83846153846154 0.0 - - - - - - - 138.66666666666666 6 3 PDLIM7 PDZ and LIM domain 7 (enigma) 2161 274 C20140708_OR008_05 C20140708_OR008_05 TB448893.[MT7]-K[MT7]ITGEIMHALK[MT7].4y3_1.heavy 419.009 / 475.336 15311.0 31.643600463867188 38 8 10 10 10 0.9742802246348797 64.674456012139 0.0 3 0.7916023147890578 2.6550202204669855 15311.0 -0.029387715930901948 0.0 - - - - - - - 173.33333333333334 30 6 PDLIM7 PDZ and LIM domain 7 (enigma) 2163 274 C20140708_OR008_05 C20140708_OR008_05 TB448893.[MT7]-K[MT7]ITGEIMHALK[MT7].4b6_1.heavy 419.009 / 930.586 N/A 31.643600463867188 38 8 10 10 10 0.9742802246348797 64.674456012139 0.0 3 0.7916023147890578 2.6550202204669855 0.0 0.0 10.0 - - - - - - - 0.0 0 0 PDLIM7 PDZ and LIM domain 7 (enigma) 2165 275 C20140708_OR008_05 C20140708_OR008_05 TB438889.[MT7]-EVPQVSYLDSPSLQPFQVEER.3b4_1.heavy 864.442 / 598.332 6428.0 41.53409957885742 41 11 10 10 10 1.0916074795948512 57.29954505774864 0.0 3 0.8792920641290465 3.5158138107640715 6428.0 31.21876112571558 0.0 - - - - - - - 228.33333333333334 12 6 ZNF496 zinc finger protein 496 2167 275 C20140708_OR008_05 C20140708_OR008_05 TB438889.[MT7]-EVPQVSYLDSPSLQPFQVEER.3b5_1.heavy 864.442 / 697.4 5745.0 41.53409957885742 41 11 10 10 10 1.0916074795948512 57.29954505774864 0.0 3 0.8792920641290465 3.5158138107640715 5745.0 55.876440715684524 0.0 - - - - - - - 234.71428571428572 11 7 ZNF496 zinc finger protein 496 2169 275 C20140708_OR008_05 C20140708_OR008_05 TB438889.[MT7]-EVPQVSYLDSPSLQPFQVEER.3y8_1.heavy 864.442 / 1032.51 8070.0 41.53409957885742 41 11 10 10 10 1.0916074795948512 57.29954505774864 0.0 3 0.8792920641290465 3.5158138107640715 8070.0 75.69306569343065 0.0 - - - - - - - 213.11111111111111 16 9 ZNF496 zinc finger protein 496 2171 275 C20140708_OR008_05 C20140708_OR008_05 TB438889.[MT7]-EVPQVSYLDSPSLQPFQVEER.3y13_2.heavy 864.442 / 766.373 3009.0 41.53409957885742 41 11 10 10 10 1.0916074795948512 57.29954505774864 0.0 3 0.8792920641290465 3.5158138107640715 3009.0 20.04929542032742 1.0 - - - - - - - 205.25 7 4 ZNF496 zinc finger protein 496 2173 276 C20140708_OR008_05 C20140708_OR008_05 TB430290.[MT7]-DANRQISDLK[MT7].3y4_1.heavy 483.275 / 606.358 3126.0 22.72260093688965 43 13 10 10 10 1.5494089376011688 50.96511786614067 0.0 3 0.9023955472575489 3.917690875575118 3126.0 47.48461956521739 0.0 - - - - - - - 224.88888888888889 6 9 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 2175 276 C20140708_OR008_05 C20140708_OR008_05 TB430290.[MT7]-DANRQISDLK[MT7].3b8_1.heavy 483.275 / 1044.52 N/A 22.72260093688965 43 13 10 10 10 1.5494089376011688 50.96511786614067 0.0 3 0.9023955472575489 3.917690875575118 0.0 -0.0 0.0 - - - - - - - 0.0 0 0 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 2177 276 C20140708_OR008_05 C20140708_OR008_05 TB430290.[MT7]-DANRQISDLK[MT7].3y9_2.heavy 483.275 / 594.844 2298.0 22.72260093688965 43 13 10 10 10 1.5494089376011688 50.96511786614067 0.0 3 0.9023955472575489 3.917690875575118 2298.0 28.075565217391304 0.0 - - - - - - - 214.66666666666666 4 9 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 2179 276 C20140708_OR008_05 C20140708_OR008_05 TB430290.[MT7]-DANRQISDLK[MT7].3b8_2.heavy 483.275 / 522.763 5791.0 22.72260093688965 43 13 10 10 10 1.5494089376011688 50.96511786614067 0.0 3 0.9023955472575489 3.917690875575118 5791.0 44.06195652173913 1.0 - - - - - - - 163.55555555555554 11 9 LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 2181 277 C20140708_OR008_05 C20140708_OR008_05 TB438609.[MT7]-IMQHLEGEGLK[MT7].2b3_1.heavy 771.931 / 517.292 4607.0 30.48305034637451 43 17 10 6 10 16.829684213853277 5.9418821369022154 0.03289985656738281 3 0.9744052947154328 7.697622738371712 4607.0 29.046784767750033 0.0 - - - - - - - 241.0 9 4 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 2183 277 C20140708_OR008_05 C20140708_OR008_05 TB438609.[MT7]-IMQHLEGEGLK[MT7].2y5_1.heavy 771.931 / 647.385 3643.0 30.48305034637451 43 17 10 6 10 16.829684213853277 5.9418821369022154 0.03289985656738281 3 0.9744052947154328 7.697622738371712 3643.0 33.36579439252336 0.0 - - - - - - - 267.5 7 6 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 2185 277 C20140708_OR008_05 C20140708_OR008_05 TB438609.[MT7]-IMQHLEGEGLK[MT7].2y6_1.heavy 771.931 / 776.427 1714.0 30.48305034637451 43 17 10 6 10 16.829684213853277 5.9418821369022154 0.03289985656738281 3 0.9744052947154328 7.697622738371712 1714.0 30.595700934579437 0.0 - - - - - - - 107.0 3 3 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 2187 277 C20140708_OR008_05 C20140708_OR008_05 TB438609.[MT7]-IMQHLEGEGLK[MT7].2y7_1.heavy 771.931 / 889.511 3643.0 30.48305034637451 43 17 10 6 10 16.829684213853277 5.9418821369022154 0.03289985656738281 3 0.9744052947154328 7.697622738371712 3643.0 49.5379906542056 0.0 - - - - - - - 160.5 7 4 MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 2189 278 C20140708_OR008_05 C20140708_OR008_05 TB438885.[MT7]-GLLGSVMLDLDVLRGHPPAETLP.3y7_1.heavy 848.804 / 724.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 2191 278 C20140708_OR008_05 C20140708_OR008_05 TB438885.[MT7]-GLLGSVMLDLDVLRGHPPAETLP.3b16_2.heavy 848.804 / 911.012 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 2193 278 C20140708_OR008_05 C20140708_OR008_05 TB438885.[MT7]-GLLGSVMLDLDVLRGHPPAETLP.3b6_1.heavy 848.804 / 671.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 2195 278 C20140708_OR008_05 C20140708_OR008_05 TB438885.[MT7]-GLLGSVMLDLDVLRGHPPAETLP.3b7_1.heavy 848.804 / 802.461 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 2197 279 C20140708_OR008_05 C20140708_OR008_05 TB438605.[MT7]-LLPMTVVTMASAR.3y7_1.heavy 511.959 / 735.382 2936.0 44.19309997558594 41 11 10 10 10 1.027029647714917 69.98231652999544 0.0 3 0.867097262050336 3.347062412466484 2936.0 14.382608695652173 0.0 - - - - - - - 202.0 5 5 MAPKAP1 mitogen-activated protein kinase associated protein 1 2199 279 C20140708_OR008_05 C20140708_OR008_05 TB438605.[MT7]-LLPMTVVTMASAR.3y6_1.heavy 511.959 / 636.313 2936.0 44.19309997558594 41 11 10 10 10 1.027029647714917 69.98231652999544 0.0 3 0.867097262050336 3.347062412466484 2936.0 62.86869565217391 0.0 - - - - - - - 138.0 5 4 MAPKAP1 mitogen-activated protein kinase associated protein 1 2201 279 C20140708_OR008_05 C20140708_OR008_05 TB438605.[MT7]-LLPMTVVTMASAR.3b4_1.heavy 511.959 / 599.371 1652.0 44.19309997558594 41 11 10 10 10 1.027029647714917 69.98231652999544 0.0 3 0.867097262050336 3.347062412466484 1652.0 11.413818181818181 0.0 - - - - - - - 165.2 3 5 MAPKAP1 mitogen-activated protein kinase associated protein 1 2203 279 C20140708_OR008_05 C20140708_OR008_05 TB438605.[MT7]-LLPMTVVTMASAR.3y5_1.heavy 511.959 / 535.266 5230.0 44.19309997558594 41 11 10 10 10 1.027029647714917 69.98231652999544 0.0 3 0.867097262050336 3.347062412466484 5230.0 53.15271739130435 0.0 - - - - - - - 204.11111111111111 10 9 MAPKAP1 mitogen-activated protein kinase associated protein 1 2205 280 C20140708_OR008_05 C20140708_OR008_05 TB430299.[MT7]-ESLVYFLIGK[MT7].3b6_1.heavy 486.293 / 883.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 2207 280 C20140708_OR008_05 C20140708_OR008_05 TB430299.[MT7]-ESLVYFLIGK[MT7].3b4_1.heavy 486.293 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 2209 280 C20140708_OR008_05 C20140708_OR008_05 TB430299.[MT7]-ESLVYFLIGK[MT7].3b5_1.heavy 486.293 / 736.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 2211 280 C20140708_OR008_05 C20140708_OR008_05 TB430299.[MT7]-ESLVYFLIGK[MT7].3y4_1.heavy 486.293 / 574.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC27 cell division cycle 27 homolog (S. cerevisiae) 2213 281 C20140708_OR008_05 C20140708_OR008_05 TB448592.[MT7]-GLVNVAAK[MT7].2y5_1.heavy 530.342 / 646.4 14374.0 26.614749908447266 44 18 10 6 10 5.499686121357886 18.1828558563829 0.03820037841796875 3 0.9878400502910786 11.180350345028836 14374.0 115.06034953100573 0.0 - - - - - - - 236.11111111111111 28 9 FIBP fibroblast growth factor (acidic) intracellular binding protein 2215 281 C20140708_OR008_05 C20140708_OR008_05 TB448592.[MT7]-GLVNVAAK[MT7].2b4_1.heavy 530.342 / 528.326 16297.0 26.614749908447266 44 18 10 6 10 5.499686121357886 18.1828558563829 0.03820037841796875 3 0.9878400502910786 11.180350345028836 16297.0 90.1417462042582 0.0 - - - - - - - 239.1818181818182 32 11 FIBP fibroblast growth factor (acidic) intracellular binding protein 2217 281 C20140708_OR008_05 C20140708_OR008_05 TB448592.[MT7]-GLVNVAAK[MT7].2y6_1.heavy 530.342 / 745.469 6681.0 26.614749908447266 44 18 10 6 10 5.499686121357886 18.1828558563829 0.03820037841796875 3 0.9878400502910786 11.180350345028836 6681.0 74.07064923883692 0.0 - - - - - - - 202.0 13 4 FIBP fibroblast growth factor (acidic) intracellular binding protein 2219 281 C20140708_OR008_05 C20140708_OR008_05 TB448592.[MT7]-GLVNVAAK[MT7].2b5_1.heavy 530.342 / 627.395 8402.0 26.614749908447266 44 18 10 6 10 5.499686121357886 18.1828558563829 0.03820037841796875 3 0.9878400502910786 11.180350345028836 8402.0 54.81932842626367 0.0 - - - - - - - 183.9090909090909 16 11 FIBP fibroblast growth factor (acidic) intracellular binding protein 2221 282 C20140708_OR008_05 C20140708_OR008_05 TB438487.[MT7]-QLTSAMLLQR.2y8_1.heavy 652.878 / 919.503 1879.0 34.55149841308594 43 13 10 10 10 1.9735871891288685 40.327892077298586 0.0 3 0.9140153054365481 4.1782041086149855 1879.0 14.267934614007876 0.0 - - - - - - - 193.0 3 12 PIAS2 protein inhibitor of activated STAT, 2 2223 282 C20140708_OR008_05 C20140708_OR008_05 TB438487.[MT7]-QLTSAMLLQR.2y9_1.heavy 652.878 / 1032.59 5926.0 34.55149841308594 43 13 10 10 10 1.9735871891288685 40.327892077298586 0.0 3 0.9140153054365481 4.1782041086149855 5926.0 53.20036272521179 0.0 - - - - - - - 289.2857142857143 11 7 PIAS2 protein inhibitor of activated STAT, 2 2225 282 C20140708_OR008_05 C20140708_OR008_05 TB438487.[MT7]-QLTSAMLLQR.2b5_1.heavy 652.878 / 645.369 2168.0 34.55149841308594 43 13 10 10 10 1.9735871891288685 40.327892077298586 0.0 3 0.9140153054365481 4.1782041086149855 2168.0 1.0834551010800846 1.0 - - - - - - - 271.25 4 8 PIAS2 protein inhibitor of activated STAT, 2 2227 282 C20140708_OR008_05 C20140708_OR008_05 TB438487.[MT7]-QLTSAMLLQR.2y7_1.heavy 652.878 / 818.455 289.0 34.55149841308594 43 13 10 10 10 1.9735871891288685 40.327892077298586 0.0 3 0.9140153054365481 4.1782041086149855 289.0 1.502528735632184 24.0 - - - - - - - 217.125 2 8 PIAS2 protein inhibitor of activated STAT, 2 2229 283 C20140708_OR008_05 C20140708_OR008_05 TB438340.[MT7]-GFSPESK[MT7].2y4_1.heavy 520.287 / 604.342 9976.0 21.7347993850708 46 20 10 6 10 10.099575736554904 9.901406020260342 0.03660011291503906 3 0.9902922374363898 12.515575784961971 9976.0 108.5785635359116 0.0 - - - - - - - 203.875 19 8 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2231 283 C20140708_OR008_05 C20140708_OR008_05 TB438340.[MT7]-GFSPESK[MT7].2y5_1.heavy 520.287 / 691.374 3174.0 21.7347993850708 46 20 10 6 10 10.099575736554904 9.901406020260342 0.03660011291503906 3 0.9902922374363898 12.515575784961971 3174.0 16.133038674033152 0.0 - - - - - - - 129.57142857142858 6 7 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2233 283 C20140708_OR008_05 C20140708_OR008_05 TB438340.[MT7]-GFSPESK[MT7].2y3_1.heavy 520.287 / 507.289 726.0 21.7347993850708 46 20 10 6 10 10.099575736554904 9.901406020260342 0.03660011291503906 3 0.9902922374363898 12.515575784961971 726.0 1.5791771392814307 12.0 - - - - - - - 285.0 2 14 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2235 283 C20140708_OR008_05 C20140708_OR008_05 TB438340.[MT7]-GFSPESK[MT7].2y6_1.heavy 520.287 / 838.443 1451.0 21.7347993850708 46 20 10 6 10 10.099575736554904 9.901406020260342 0.03660011291503906 3 0.9902922374363898 12.515575784961971 1451.0 7.5355801104972375 1.0 - - - - - - - 217.4 2 5 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2237 284 C20140708_OR008_05 C20140708_OR008_05 TB448697.[MT7]-DFFPDVEK[MT7].2y4_1.heavy 642.839 / 634.353 2081.0 35.52239990234375 46 16 10 10 10 1.562826529427067 49.366264595545495 0.0 3 0.9661354600630551 6.687387672563101 2081.0 2.7823660100987126 8.0 - - - - - - - 308.75 9 8 DGCR14 DiGeorge syndrome critical region gene 14 2239 284 C20140708_OR008_05 C20140708_OR008_05 TB448697.[MT7]-DFFPDVEK[MT7].2b3_1.heavy 642.839 / 554.273 8325.0 35.52239990234375 46 16 10 10 10 1.562826529427067 49.366264595545495 0.0 3 0.9661354600630551 6.687387672563101 8325.0 15.75170320618426 0.0 - - - - - - - 182.0 16 5 DGCR14 DiGeorge syndrome critical region gene 14 2241 284 C20140708_OR008_05 C20140708_OR008_05 TB448697.[MT7]-DFFPDVEK[MT7].2y5_1.heavy 642.839 / 731.406 16260.0 35.52239990234375 46 16 10 10 10 1.562826529427067 49.366264595545495 0.0 3 0.9661354600630551 6.687387672563101 16260.0 172.60615384615386 0.0 - - - - - - - 202.22222222222223 32 9 DGCR14 DiGeorge syndrome critical region gene 14 2243 284 C20140708_OR008_05 C20140708_OR008_05 TB448697.[MT7]-DFFPDVEK[MT7].2y3_1.heavy 642.839 / 519.326 5463.0 35.52239990234375 46 16 10 10 10 1.562826529427067 49.366264595545495 0.0 3 0.9661354600630551 6.687387672563101 5463.0 21.023227377100508 0.0 - - - - - - - 222.85714285714286 10 7 DGCR14 DiGeorge syndrome critical region gene 14 2245 285 C20140708_OR008_05 C20140708_OR008_05 TB438486.[MT7]-REEEALEER.2y8_1.heavy 652.832 / 1004.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 2247 285 C20140708_OR008_05 C20140708_OR008_05 TB438486.[MT7]-REEEALEER.2b4_1.heavy 652.832 / 688.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 2249 285 C20140708_OR008_05 C20140708_OR008_05 TB438486.[MT7]-REEEALEER.2b7_1.heavy 652.832 / 1001.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 2251 285 C20140708_OR008_05 C20140708_OR008_05 TB438486.[MT7]-REEEALEER.2b5_1.heavy 652.832 / 759.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - PKD2L1 polycystic kidney disease 2-like 1 2253 286 C20140708_OR008_05 C20140708_OR008_05 TB438480.[MT7]-MVGTVIMMK[MT7].3y3_1.heavy 433.248 / 553.296 3078.0 36.576900482177734 38 13 10 5 10 1.1223964590060103 55.043478281588115 0.04740142822265625 3 0.9148705300566672 4.199448134685761 3078.0 20.786493506493507 0.0 - - - - - - - 154.0 6 2 VSNL1 visinin-like 1 2255 286 C20140708_OR008_05 C20140708_OR008_05 TB438480.[MT7]-MVGTVIMMK[MT7].3b4_1.heavy 433.248 / 533.287 2924.0 36.576900482177734 38 13 10 5 10 1.1223964590060103 55.043478281588115 0.04740142822265625 3 0.9148705300566672 4.199448134685761 2924.0 13.860519480519482 0.0 - - - - - - - 308.0 5 4 VSNL1 visinin-like 1 2257 286 C20140708_OR008_05 C20140708_OR008_05 TB438480.[MT7]-MVGTVIMMK[MT7].3b5_1.heavy 433.248 / 632.356 3848.0 36.576900482177734 38 13 10 5 10 1.1223964590060103 55.043478281588115 0.04740142822265625 3 0.9148705300566672 4.199448134685761 3848.0 15.787975123468081 0.0 - - - - - - - 269.5 7 4 VSNL1 visinin-like 1 2259 286 C20140708_OR008_05 C20140708_OR008_05 TB438480.[MT7]-MVGTVIMMK[MT7].3y4_1.heavy 433.248 / 666.38 462.0 36.576900482177734 38 13 10 5 10 1.1223964590060103 55.043478281588115 0.04740142822265625 3 0.9148705300566672 4.199448134685761 462.0 1.0499999999999998 0.0 - - - - - - - 0.0 0 0 VSNL1 visinin-like 1 2261 287 C20140708_OR008_05 C20140708_OR008_05 TB438481.[MT7]-DVMLENYK[MT7].3y3_1.heavy 433.9 / 568.321 2620.0 30.614349365234375 44 18 10 6 10 3.3970827136316717 29.437022418890237 0.0326995849609375 3 0.988993806182788 11.75288963455959 2620.0 35.99495412844037 0.0 - - - - - - - 218.0 5 6 ZNF846;ZNF559 zinc finger protein 846;zinc finger protein 559 2263 287 C20140708_OR008_05 C20140708_OR008_05 TB438481.[MT7]-DVMLENYK[MT7].3b4_1.heavy 433.9 / 603.329 1201.0 30.614349365234375 44 18 10 6 10 3.3970827136316717 29.437022418890237 0.0326995849609375 3 0.988993806182788 11.75288963455959 1201.0 12.340550458715597 0.0 - - - - - - - 208.1818181818182 2 11 ZNF846;ZNF559 zinc finger protein 846;zinc finger protein 559 2265 287 C20140708_OR008_05 C20140708_OR008_05 TB438481.[MT7]-DVMLENYK[MT7].3b5_1.heavy 433.9 / 732.372 655.0 30.614349365234375 44 18 10 6 10 3.3970827136316717 29.437022418890237 0.0326995849609375 3 0.988993806182788 11.75288963455959 655.0 0.6009174311926604 2.0 - - - - - - - 0.0 1 0 ZNF846;ZNF559 zinc finger protein 846;zinc finger protein 559 2267 287 C20140708_OR008_05 C20140708_OR008_05 TB438481.[MT7]-DVMLENYK[MT7].3b3_1.heavy 433.9 / 490.245 10042.0 30.614349365234375 44 18 10 6 10 3.3970827136316717 29.437022418890237 0.0326995849609375 3 0.988993806182788 11.75288963455959 10042.0 69.09633027522936 0.0 - - - - - - - 177.125 20 8 ZNF846;ZNF559 zinc finger protein 846;zinc finger protein 559 2269 288 C20140708_OR008_05 C20140708_OR008_05 TB430698.[MT7]-VHLGAFLAVTPNPGSAASGTEAAAATPSK[MT7].4b8_1.heavy 746.154 / 953.569 4861.0 37.33544921875 32 12 9 5 6 2.5371754588896698 31.39123163898602 0.0485992431640625 5 0.8943502578968228 3.762948407965607 4861.0 15.819357251411201 1.0 - - - - - - - 274.5 11 8 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 2271 288 C20140708_OR008_05 C20140708_OR008_05 TB430698.[MT7]-VHLGAFLAVTPNPGSAASGTEAAAATPSK[MT7].4b7_1.heavy 746.154 / 882.532 2822.0 37.33544921875 32 12 9 5 6 2.5371754588896698 31.39123163898602 0.0485992431640625 5 0.8943502578968228 3.762948407965607 2822.0 7.658488927485887 1.0 - - - - - - - 282.4 7 5 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 2273 288 C20140708_OR008_05 C20140708_OR008_05 TB430698.[MT7]-VHLGAFLAVTPNPGSAASGTEAAAATPSK[MT7].4b5_1.heavy 746.154 / 622.379 1411.0 37.33544921875 32 12 9 5 6 2.5371754588896698 31.39123163898602 0.0485992431640625 5 0.8943502578968228 3.762948407965607 1411.0 -0.26992985823447335 2.0 - - - - - - - 313.57142857142856 4 7 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 2275 288 C20140708_OR008_05 C20140708_OR008_05 TB430698.[MT7]-VHLGAFLAVTPNPGSAASGTEAAAATPSK[MT7].4b6_1.heavy 746.154 / 769.448 3763.0 37.33544921875 32 12 9 5 6 2.5371754588896698 31.39123163898602 0.0485992431640625 5 0.8943502578968228 3.762948407965607 3763.0 8.406276708797794 0.0 - - - - - - - 251.0 7 5 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 2277 289 C20140708_OR008_05 C20140708_OR008_05 TB438873.[MT7]-LLVPANGADPTETLMLFFDK[MT7].3y3_1.heavy 827.45 / 553.31 334.0 53.40785026550293 33 14 9 6 4 2.075160321047391 37.90558280872996 0.034297943115234375 10 0.9317110754650344 4.695525864487734 334.0 1.1032 10.0 - - - - - - - 177.25 2 12 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 2279 289 C20140708_OR008_05 C20140708_OR008_05 TB438873.[MT7]-LLVPANGADPTETLMLFFDK[MT7].3y6_1.heavy 827.45 / 944.503 584.0 53.40785026550293 33 14 9 6 4 2.075160321047391 37.90558280872996 0.034297943115234375 10 0.9317110754650344 4.695525864487734 584.0 5.628915662650602 4.0 - - - - - - - 163.6153846153846 2 13 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 2281 289 C20140708_OR008_05 C20140708_OR008_05 TB438873.[MT7]-LLVPANGADPTETLMLFFDK[MT7].3y5_1.heavy 827.45 / 813.463 417.0 53.40785026550293 33 14 9 6 4 2.075160321047391 37.90558280872996 0.034297943115234375 10 0.9317110754650344 4.695525864487734 417.0 7.033734939759037 4.0 - - - - - - - 0.0 1 0 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 2283 289 C20140708_OR008_05 C20140708_OR008_05 TB438873.[MT7]-LLVPANGADPTETLMLFFDK[MT7].3y4_1.heavy 827.45 / 700.379 1002.0 53.40785026550293 33 14 9 6 4 2.075160321047391 37.90558280872996 0.034297943115234375 10 0.9317110754650344 4.695525864487734 1002.0 25.4207917383821 2.0 - - - - - - - 121.0 2 10 TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 2285 290 C20140708_OR008_05 C20140708_OR008_05 TB438874.[MT7]-LLVPANGADPTETLMLFFDK[MT7].4y4_1.heavy 620.839 / 700.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 2287 290 C20140708_OR008_05 C20140708_OR008_05 TB438874.[MT7]-LLVPANGADPTETLMLFFDK[MT7].4b9_1.heavy 620.839 / 995.564 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 2289 290 C20140708_OR008_05 C20140708_OR008_05 TB438874.[MT7]-LLVPANGADPTETLMLFFDK[MT7].4y6_1.heavy 620.839 / 944.503 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 2291 290 C20140708_OR008_05 C20140708_OR008_05 TB438874.[MT7]-LLVPANGADPTETLMLFFDK[MT7].4y3_1.heavy 620.839 / 553.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF10A tumor necrosis factor receptor superfamily, member 10a 2293 291 C20140708_OR008_05 C20140708_OR008_05 TB438875.[MT7]-IQVSERPLMFLLDTPGVLAPR.2b3_1.heavy 1248.71 / 485.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 2295 291 C20140708_OR008_05 C20140708_OR008_05 TB438875.[MT7]-IQVSERPLMFLLDTPGVLAPR.2y8_1.heavy 1248.71 / 810.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 2297 291 C20140708_OR008_05 C20140708_OR008_05 TB438875.[MT7]-IQVSERPLMFLLDTPGVLAPR.2y16_2.heavy 1248.71 / 898.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 2299 291 C20140708_OR008_05 C20140708_OR008_05 TB438875.[MT7]-IQVSERPLMFLLDTPGVLAPR.2y7_1.heavy 1248.71 / 709.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTG1 mitochondrial GTPase 1 homolog (S. cerevisiae) 2301 292 C20140708_OR008_05 C20140708_OR008_05 TB438870.[MT7]-QRVLDEEEYIEGLQTVIQR.3b5_1.heavy 821.438 / 756.448 2467.0 41.27090072631836 43 13 10 10 10 3.238763608692988 30.87597987441735 0.0 3 0.9212383109093851 4.3682984396753275 2467.0 21.60751724137931 0.0 - - - - - - - 232.0 4 5 DGCR14 DiGeorge syndrome critical region gene 14 2303 292 C20140708_OR008_05 C20140708_OR008_05 TB438870.[MT7]-QRVLDEEEYIEGLQTVIQR.3b8_1.heavy 821.438 / 1143.58 5661.0 41.27090072631836 43 13 10 10 10 3.238763608692988 30.87597987441735 0.0 3 0.9212383109093851 4.3682984396753275 5661.0 13.778567356897632 0.0 - - - - - - - 290.0 11 6 DGCR14 DiGeorge syndrome critical region gene 14 2305 292 C20140708_OR008_05 C20140708_OR008_05 TB438870.[MT7]-QRVLDEEEYIEGLQTVIQR.3y8_1.heavy 821.438 / 914.542 8418.0 41.27090072631836 43 13 10 10 10 3.238763608692988 30.87597987441735 0.0 3 0.9212383109093851 4.3682984396753275 8418.0 74.11710344827586 0.0 - - - - - - - 290.0 16 4 DGCR14 DiGeorge syndrome critical region gene 14 2307 292 C20140708_OR008_05 C20140708_OR008_05 TB438870.[MT7]-QRVLDEEEYIEGLQTVIQR.3y9_1.heavy 821.438 / 1043.58 14079.0 41.27090072631836 43 13 10 10 10 3.238763608692988 30.87597987441735 0.0 3 0.9212383109093851 4.3682984396753275 14079.0 41.97577200205867 0.0 - - - - - - - 290.0 28 9 DGCR14 DiGeorge syndrome critical region gene 14 2309 293 C20140708_OR008_05 C20140708_OR008_05 TB438731.[MT7]-GVQVEEIYDLQSK[MT7].3b6_1.heavy 599.328 / 786.411 29723.0 35.19990158081055 47 17 10 10 10 1.9956277304307373 39.574545037549534 0.0 3 0.9721266966453886 7.374866883473464 29723.0 145.46755377152186 0.0 - - - - - - - 291.3333333333333 59 3 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2311 293 C20140708_OR008_05 C20140708_OR008_05 TB438731.[MT7]-GVQVEEIYDLQSK[MT7].3b4_1.heavy 599.328 / 528.326 21855.0 35.19990158081055 47 17 10 10 10 1.9956277304307373 39.574545037549534 0.0 3 0.9721266966453886 7.374866883473464 21855.0 58.24402836272574 0.0 - - - - - - - 312.14285714285717 43 7 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2313 293 C20140708_OR008_05 C20140708_OR008_05 TB438731.[MT7]-GVQVEEIYDLQSK[MT7].3b5_1.heavy 599.328 / 657.369 12239.0 35.19990158081055 47 17 10 10 10 1.9956277304307373 39.574545037549534 0.0 3 0.9721266966453886 7.374866883473464 12239.0 41.44692879667196 1.0 - - - - - - - 686.7142857142857 25 7 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2315 293 C20140708_OR008_05 C20140708_OR008_05 TB438731.[MT7]-GVQVEEIYDLQSK[MT7].3y5_1.heavy 599.328 / 734.417 11802.0 35.19990158081055 47 17 10 10 10 1.9956277304307373 39.574545037549534 0.0 3 0.9721266966453886 7.374866883473464 11802.0 31.231725046259502 0.0 - - - - - - - 327.75 23 8 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2317 294 C20140708_OR008_05 C20140708_OR008_05 TB438732.[MT7]-GVQVEEIYDLQSK[MT7].2y4_1.heavy 898.488 / 619.39 1468.0 35.22235107421875 37 12 10 5 10 0.7129083694341966 74.75739296996238 0.04489898681640625 3 0.8886710058452745 3.663905313839787 1468.0 14.480272108843536 0.0 - - - - - - - 293.8333333333333 2 6 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2319 294 C20140708_OR008_05 C20140708_OR008_05 TB438732.[MT7]-GVQVEEIYDLQSK[MT7].2y8_1.heavy 898.488 / 1139.61 1321.0 35.22235107421875 37 12 10 5 10 0.7129083694341966 74.75739296996238 0.04489898681640625 3 0.8886710058452745 3.663905313839787 1321.0 8.714503401360544 1.0 - - - - - - - 183.75 2 8 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2321 294 C20140708_OR008_05 C20140708_OR008_05 TB438732.[MT7]-GVQVEEIYDLQSK[MT7].2b4_1.heavy 898.488 / 528.326 4256.0 35.22235107421875 37 12 10 5 10 0.7129083694341966 74.75739296996238 0.04489898681640625 3 0.8886710058452745 3.663905313839787 4256.0 20.086128454651615 0.0 - - - - - - - 330.25 8 4 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2323 294 C20140708_OR008_05 C20140708_OR008_05 TB438732.[MT7]-GVQVEEIYDLQSK[MT7].2y7_1.heavy 898.488 / 1010.56 2495.0 35.22235107421875 37 12 10 5 10 0.7129083694341966 74.75739296996238 0.04489898681640625 3 0.8886710058452745 3.663905313839787 2495.0 7.653664627536008 0.0 - - - - - - - 330.25 4 8 BAP1 BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 2325 295 C20140708_OR008_05 C20140708_OR008_05 TB438735.[MT7]-LNLEEFQQLYVK[MT7].2b4_1.heavy 906.511 / 614.363 2961.0 43.42279815673828 45 15 10 10 10 10.074651575976084 9.925901580403934 0.0 3 0.951812473165415 5.599322367064353 2961.0 16.932328767123288 0.0 - - - - - - - 256.0 5 6 VSNL1 visinin-like 1 2327 295 C20140708_OR008_05 C20140708_OR008_05 TB438735.[MT7]-LNLEEFQQLYVK[MT7].2y3_1.heavy 906.511 / 553.347 2412.0 43.42279815673828 45 15 10 10 10 10.074651575976084 9.925901580403934 0.0 3 0.951812473165415 5.599322367064353 2412.0 14.967582962068533 0.0 - - - - - - - 241.4 4 5 VSNL1 visinin-like 1 2329 295 C20140708_OR008_05 C20140708_OR008_05 TB438735.[MT7]-LNLEEFQQLYVK[MT7].2b7_1.heavy 906.511 / 1018.53 1645.0 43.42279815673828 45 15 10 10 10 10.074651575976084 9.925901580403934 0.0 3 0.951812473165415 5.599322367064353 1645.0 21.56527397260274 0.0 - - - - - - - 170.66666666666666 3 9 VSNL1 visinin-like 1 2331 295 C20140708_OR008_05 C20140708_OR008_05 TB438735.[MT7]-LNLEEFQQLYVK[MT7].2b5_1.heavy 906.511 / 743.406 1316.0 43.42279815673828 45 15 10 10 10 10.074651575976084 9.925901580403934 0.0 3 0.951812473165415 5.599322367064353 1316.0 14.607272727272727 2.0 - - - - - - - 219.5 3 10 VSNL1 visinin-like 1