Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140709_OR011_01 C20140709_OR011_01 TB447019.[MT7]-LHSHDIK[MT7].2y4_1.heavy 569.335 / 656.385 1397.0 16.832700729370117 44 14 10 10 10 1.6271540626103937 45.25867401399272 0.0 3 0.9369955125653475 4.890684133380372 1397.0 12.975719406041986 0.0 - - - - - - - 219.42857142857142 2 7 SDF2L1 stromal cell-derived factor 2-like 1 3 1 C20140709_OR011_01 C20140709_OR011_01 TB447019.[MT7]-LHSHDIK[MT7].2y5_1.heavy 569.335 / 743.417 2304.0 16.832700729370117 44 14 10 10 10 1.6271540626103937 45.25867401399272 0.0 3 0.9369955125653475 4.890684133380372 2304.0 27.431189907944084 2.0 - - - - - - - 217.22222222222223 4 9 SDF2L1 stromal cell-derived factor 2-like 1 5 1 C20140709_OR011_01 C20140709_OR011_01 TB447019.[MT7]-LHSHDIK[MT7].2y3_1.heavy 569.335 / 519.326 2304.0 16.832700729370117 44 14 10 10 10 1.6271540626103937 45.25867401399272 0.0 3 0.9369955125653475 4.890684133380372 2304.0 7.525959885386818 0.0 - - - - - - - 209.5 4 18 SDF2L1 stromal cell-derived factor 2-like 1 7 1 C20140709_OR011_01 C20140709_OR011_01 TB447019.[MT7]-LHSHDIK[MT7].2b5_1.heavy 569.335 / 734.37 3003.0 16.832700729370117 44 14 10 10 10 1.6271540626103937 45.25867401399272 0.0 3 0.9369955125653475 4.890684133380372 3003.0 21.91793789808917 0.0 - - - - - - - 209.75 6 4 SDF2L1 stromal cell-derived factor 2-like 1 9 2 C20140709_OR011_01 C20140709_OR011_01 TB416447.[MT7]-C[CAM]GQAVR.2b3_1.heavy 417.722 / 490.22 2110.0 13.822199821472168 50 20 10 10 10 5.203658034106888 15.381018519421946 0.0 3 0.9920495654482052 13.831802533786638 2110.0 102.16842105263157 0.0 - - - - - - - 95.83333333333333 4 12 SDF2L1 stromal cell-derived factor 2-like 1 11 2 C20140709_OR011_01 C20140709_OR011_01 TB416447.[MT7]-C[CAM]GQAVR.2y5_1.heavy 417.722 / 530.305 2532.0 13.822199821472168 50 20 10 10 10 5.203658034106888 15.381018519421946 0.0 3 0.9920495654482052 13.831802533786638 2532.0 20.95607843137255 0.0 - - - - - - - 184.0 5 10 SDF2L1 stromal cell-derived factor 2-like 1 13 2 C20140709_OR011_01 C20140709_OR011_01 TB416447.[MT7]-C[CAM]GQAVR.2b4_1.heavy 417.722 / 561.257 2685.0 13.822199821472168 50 20 10 10 10 5.203658034106888 15.381018519421946 0.0 3 0.9920495654482052 13.831802533786638 2685.0 15.17608695652174 0.0 - - - - - - - 139.57142857142858 5 14 SDF2L1 stromal cell-derived factor 2-like 1 15 2 C20140709_OR011_01 C20140709_OR011_01 TB416447.[MT7]-C[CAM]GQAVR.2b5_1.heavy 417.722 / 660.326 844.0 13.822199821472168 50 20 10 10 10 5.203658034106888 15.381018519421946 0.0 3 0.9920495654482052 13.831802533786638 844.0 11.59582608695652 0.0 - - - - - - - 0.0 1 0 SDF2L1 stromal cell-derived factor 2-like 1 17 3 C20140709_OR011_01 C20140709_OR011_01 TB416858.[MT7]-NPLIASSFSLVK[MT7].3y3_1.heavy 521.983 / 503.367 1394.0 41.30229949951172 33 12 10 5 6 0.8988409756566005 56.88923459106334 0.04180145263671875 5 0.88868341894583 3.6641135447341298 1394.0 10.279202414813955 4.0 - - - - - - - 272.0769230769231 2 13 C22orf31 chromosome 22 open reading frame 31 19 3 C20140709_OR011_01 C20140709_OR011_01 TB416858.[MT7]-NPLIASSFSLVK[MT7].3b4_1.heavy 521.983 / 582.373 1179.0 41.30229949951172 33 12 10 5 6 0.8988409756566005 56.88923459106334 0.04180145263671875 5 0.88868341894583 3.6641135447341298 1179.0 5.140533630332671 3.0 - - - - - - - 250.22222222222223 2 9 C22orf31 chromosome 22 open reading frame 31 21 3 C20140709_OR011_01 C20140709_OR011_01 TB416858.[MT7]-NPLIASSFSLVK[MT7].3y4_1.heavy 521.983 / 590.399 2359.0 41.30229949951172 33 12 10 5 6 0.8988409756566005 56.88923459106334 0.04180145263671875 5 0.88868341894583 3.6641135447341298 2359.0 12.268114587566028 0.0 - - - - - - - 235.6 4 10 C22orf31 chromosome 22 open reading frame 31 23 3 C20140709_OR011_01 C20140709_OR011_01 TB416858.[MT7]-NPLIASSFSLVK[MT7].3y5_1.heavy 521.983 / 737.468 214.0 41.30229949951172 33 12 10 5 6 0.8988409756566005 56.88923459106334 0.04180145263671875 5 0.88868341894583 3.6641135447341298 214.0 1.3987577639751554 10.0 - - - - - - - 0.0 1 0 C22orf31 chromosome 22 open reading frame 31 25 4 C20140709_OR011_01 C20140709_OR011_01 TB447159.[MT7]-SNLLWDTGVFRGPVLPK[MT7].3b6_1.heavy 729.756 / 873.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 27 4 C20140709_OR011_01 C20140709_OR011_01 TB447159.[MT7]-SNLLWDTGVFRGPVLPK[MT7].3y11_2.heavy 729.756 / 657.904 N/A N/A - - - - - - - - - 0.0 - - - - - - - APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 29 4 C20140709_OR011_01 C20140709_OR011_01 TB447159.[MT7]-SNLLWDTGVFRGPVLPK[MT7].3b4_1.heavy 729.756 / 572.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 31 4 C20140709_OR011_01 C20140709_OR011_01 TB447159.[MT7]-SNLLWDTGVFRGPVLPK[MT7].3y13_2.heavy 729.756 / 808.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 33 5 C20140709_OR011_01 C20140709_OR011_01 TB416548.[MT7]-GAHAPQELPQAK[MT7].3b6_1.heavy 512.291 / 706.375 389.0 20.939074993133545 44 20 10 6 8 6.938505347179823 14.412325853527706 0.03849983215332031 4 0.998664864509121 33.77157906225138 389.0 4.006298969072165 6.0 - - - - - - - 0.0 1 0 HIC2 hypermethylated in cancer 2 35 5 C20140709_OR011_01 C20140709_OR011_01 TB416548.[MT7]-GAHAPQELPQAK[MT7].3b7_1.heavy 512.291 / 835.418 1363.0 20.939074993133545 44 20 10 6 8 6.938505347179823 14.412325853527706 0.03849983215332031 4 0.998664864509121 33.77157906225138 1363.0 5.591794871794872 0.0 - - - - - - - 170.5 2 4 HIC2 hypermethylated in cancer 2 37 5 C20140709_OR011_01 C20140709_OR011_01 TB416548.[MT7]-GAHAPQELPQAK[MT7].3y5_1.heavy 512.291 / 700.447 1071.0 20.939074993133545 44 20 10 6 8 6.938505347179823 14.412325853527706 0.03849983215332031 4 0.998664864509121 33.77157906225138 1071.0 0.0 1.0 - - - - - - - 279.875 2 8 HIC2 hypermethylated in cancer 2 39 5 C20140709_OR011_01 C20140709_OR011_01 TB416548.[MT7]-GAHAPQELPQAK[MT7].3b3_1.heavy 512.291 / 410.227 9247.0 20.939074993133545 44 20 10 6 8 6.938505347179823 14.412325853527706 0.03849983215332031 4 0.998664864509121 33.77157906225138 9247.0 35.886714579055436 0.0 - - - - - - - 267.75 18 12 HIC2 hypermethylated in cancer 2 41 6 C20140709_OR011_01 C20140709_OR011_01 TB447296.[MT7]-QLTEETEVLAHEIER.3y7_1.heavy 647.673 / 867.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM35 tripartite motif-containing 35 43 6 C20140709_OR011_01 C20140709_OR011_01 TB447296.[MT7]-QLTEETEVLAHEIER.3y6_1.heavy 647.673 / 754.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM35 tripartite motif-containing 35 45 6 C20140709_OR011_01 C20140709_OR011_01 TB447296.[MT7]-QLTEETEVLAHEIER.3y5_1.heavy 647.673 / 683.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM35 tripartite motif-containing 35 47 6 C20140709_OR011_01 C20140709_OR011_01 TB447296.[MT7]-QLTEETEVLAHEIER.3b7_1.heavy 647.673 / 975.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM35 tripartite motif-containing 35 49 7 C20140709_OR011_01 C20140709_OR011_01 TB417017.[MT7]-AITIASQTNC[CAM]PLYVTK[MT7].2y8_1.heavy 1034.57 / 1138.6 2301.0 34.187198638916016 45 15 10 10 10 1.9310337662353692 51.78573350115683 0.0 3 0.9508598516704279 5.544334885508241 2301.0 9.108125 0.0 - - - - - - - 230.4 4 10 DPYSL3 dihydropyrimidinase-like 3 51 7 C20140709_OR011_01 C20140709_OR011_01 TB417017.[MT7]-AITIASQTNC[CAM]PLYVTK[MT7].2y9_1.heavy 1034.57 / 1239.65 1406.0 34.187198638916016 45 15 10 10 10 1.9310337662353692 51.78573350115683 0.0 3 0.9508598516704279 5.544334885508241 1406.0 6.0597135416666665 1.0 - - - - - - - 288.0 2 8 DPYSL3 dihydropyrimidinase-like 3 53 7 C20140709_OR011_01 C20140709_OR011_01 TB417017.[MT7]-AITIASQTNC[CAM]PLYVTK[MT7].2y6_1.heavy 1034.57 / 864.531 3068.0 34.187198638916016 45 15 10 10 10 1.9310337662353692 51.78573350115683 0.0 3 0.9508598516704279 5.544334885508241 3068.0 4.6800665346335695 1.0 - - - - - - - 213.33333333333334 9 6 DPYSL3 dihydropyrimidinase-like 3 55 7 C20140709_OR011_01 C20140709_OR011_01 TB417017.[MT7]-AITIASQTNC[CAM]PLYVTK[MT7].2b5_1.heavy 1034.57 / 614.399 3580.0 34.187198638916016 45 15 10 10 10 1.9310337662353692 51.78573350115683 0.0 3 0.9508598516704279 5.544334885508241 3580.0 55.62984375 0.0 - - - - - - - 128.0 7 5 DPYSL3 dihydropyrimidinase-like 3 57 8 C20140709_OR011_01 C20140709_OR011_01 TB416547.[MT7]-GGSEGGC[CAM]PR.2y8_1.heavy 510.736 / 819.341 231.0 12.929799795150757 38 13 10 5 10 1.5187404100121071 52.428607940903944 0.04040050506591797 3 0.9267364124028082 4.5313794471838245 231.0 10.043478260869565 0.0 - - - - - - - 0.0 0 0 SDF2L1 stromal cell-derived factor 2-like 1 59 8 C20140709_OR011_01 C20140709_OR011_01 TB416547.[MT7]-GGSEGGC[CAM]PR.2b5_1.heavy 510.736 / 532.248 162.0 12.929799795150757 38 13 10 5 10 1.5187404100121071 52.428607940903944 0.04040050506591797 3 0.9267364124028082 4.5313794471838245 162.0 3.754832655614639 4.0 - - - - - - - 0.0 0 0 SDF2L1 stromal cell-derived factor 2-like 1 61 8 C20140709_OR011_01 C20140709_OR011_01 TB416547.[MT7]-GGSEGGC[CAM]PR.2y5_1.heavy 510.736 / 546.245 508.0 12.929799795150757 38 13 10 5 10 1.5187404100121071 52.428607940903944 0.04040050506591797 3 0.9267364124028082 4.5313794471838245 508.0 8.627241379310345 0.0 - - - - - - - 0.0 1 0 SDF2L1 stromal cell-derived factor 2-like 1 63 8 C20140709_OR011_01 C20140709_OR011_01 TB416547.[MT7]-GGSEGGC[CAM]PR.2b6_1.heavy 510.736 / 589.27 485.0 12.929799795150757 38 13 10 5 10 1.5187404100121071 52.428607940903944 0.04040050506591797 3 0.9267364124028082 4.5313794471838245 485.0 17.488115942028983 0.0 - - - - - - - 0.0 0 0 SDF2L1 stromal cell-derived factor 2-like 1 65 9 C20140709_OR011_01 C20140709_OR011_01 TB446912.[MT7]-QVTASVR.2y5_1.heavy 452.77 / 533.304 11080.0 18.23870086669922 46 18 10 10 8 5.316555453302478 18.80917087733621 0.0 4 0.9868391290396193 10.745895008546723 11080.0 169.23881856540083 1.0 - - - - - - - 219.77777777777777 25 9 KLF8 Kruppel-like factor 8 67 9 C20140709_OR011_01 C20140709_OR011_01 TB446912.[MT7]-QVTASVR.2b4_1.heavy 452.77 / 544.321 2453.0 18.23870086669922 46 18 10 10 8 5.316555453302478 18.80917087733621 0.0 4 0.9868391290396193 10.745895008546723 2453.0 15.965984528832628 0.0 - - - - - - - 273.27272727272725 4 11 KLF8 Kruppel-like factor 8 69 9 C20140709_OR011_01 C20140709_OR011_01 TB446912.[MT7]-QVTASVR.2y6_1.heavy 452.77 / 632.373 15275.0 18.23870086669922 46 18 10 10 8 5.316555453302478 18.80917087733621 0.0 4 0.9868391290396193 10.745895008546723 15275.0 24.95952578938524 1.0 - - - - - - - 230.1818181818182 30 11 KLF8 Kruppel-like factor 8 71 9 C20140709_OR011_01 C20140709_OR011_01 TB446912.[MT7]-QVTASVR.2b5_1.heavy 452.77 / 631.353 N/A 18.23870086669922 46 18 10 10 8 5.316555453302478 18.80917087733621 0.0 4 0.9868391290396193 10.745895008546723 18124.0 107.67714197147848 1.0 - - - - - - - 213.6 48 10 KLF8 Kruppel-like factor 8 73 10 C20140709_OR011_01 C20140709_OR011_01 TB417151.[MT7]-QNINAPAPATTSSWEVVRNPLIASSFSLVK[MT7].4y8_1.heavy 872.23 / 982.569 3602.0 45.09429931640625 44 14 10 10 10 2.9609522597533275 24.970957321667054 0.0 3 0.938611508325401 4.955320265878656 3602.0 6.112716590557595 1.0 - - - - - - - 166.16666666666666 9 12 C22orf31 chromosome 22 open reading frame 31 75 10 C20140709_OR011_01 C20140709_OR011_01 TB417151.[MT7]-QNINAPAPATTSSWEVVRNPLIASSFSLVK[MT7].4b7_1.heavy 872.23 / 853.465 14100.0 45.09429931640625 44 14 10 10 10 2.9609522597533275 24.970957321667054 0.0 3 0.938611508325401 4.955320265878656 14100.0 73.14665115223067 0.0 - - - - - - - 268.4 28 10 C22orf31 chromosome 22 open reading frame 31 77 10 C20140709_OR011_01 C20140709_OR011_01 TB417151.[MT7]-QNINAPAPATTSSWEVVRNPLIASSFSLVK[MT7].4b5_1.heavy 872.23 / 685.375 13027.0 45.09429931640625 44 14 10 10 10 2.9609522597533275 24.970957321667054 0.0 3 0.938611508325401 4.955320265878656 13027.0 54.47088489590709 0.0 - - - - - - - 268.1666666666667 26 6 C22orf31 chromosome 22 open reading frame 31 79 10 C20140709_OR011_01 C20140709_OR011_01 TB417151.[MT7]-QNINAPAPATTSSWEVVRNPLIASSFSLVK[MT7].4b3_1.heavy 872.23 / 500.295 3525.0 45.09429931640625 44 14 10 10 10 2.9609522597533275 24.970957321667054 0.0 3 0.938611508325401 4.955320265878656 3525.0 11.628818537859008 0.0 - - - - - - - 230.0909090909091 7 11 C22orf31 chromosome 22 open reading frame 31 81 11 C20140709_OR011_01 C20140709_OR011_01 TB416545.[MT7]-LLIELLR.2y6_1.heavy 507.346 / 756.498 777.0 47.195899963378906 47 17 10 10 10 4.54798720610087 21.987748748689445 0.0 3 0.9796355587798576 8.63348899769975 777.0 30.718604651162785 0.0 - - - - - - - 0.0 1 0 BRD1 bromodomain containing 1 83 11 C20140709_OR011_01 C20140709_OR011_01 TB416545.[MT7]-LLIELLR.2y4_1.heavy 507.346 / 530.33 388.0 47.195899963378906 47 17 10 10 10 4.54798720610087 21.987748748689445 0.0 3 0.9796355587798576 8.63348899769975 388.0 8.12093023255814 0.0 - - - - - - - 0.0 0 0 BRD1 bromodomain containing 1 85 11 C20140709_OR011_01 C20140709_OR011_01 TB416545.[MT7]-LLIELLR.2y5_1.heavy 507.346 / 643.414 647.0 47.195899963378906 47 17 10 10 10 4.54798720610087 21.987748748689445 0.0 3 0.9796355587798576 8.63348899769975 647.0 5.015503875968992 0.0 - - - - - - - 0.0 1 0 BRD1 bromodomain containing 1 87 11 C20140709_OR011_01 C20140709_OR011_01 TB416545.[MT7]-LLIELLR.2b4_1.heavy 507.346 / 613.404 475.0 47.195899963378906 47 17 10 10 10 4.54798720610087 21.987748748689445 0.0 3 0.9796355587798576 8.63348899769975 475.0 22.093023255813954 0.0 - - - - - - - 0.0 0 0 BRD1 bromodomain containing 1 89 12 C20140709_OR011_01 C20140709_OR011_01 TB416851.[MT7]-QLPEPLLASSGHC[CAM].2b4_1.heavy 776.899 / 612.347 3567.0 34.405399322509766 44 14 10 10 10 3.1371518195024906 25.515829525105175 0.0 3 0.9472460029264475 5.349420221188944 3567.0 16.688155454545456 0.0 - - - - - - - 220.0 7 3 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 91 12 C20140709_OR011_01 C20140709_OR011_01 TB416851.[MT7]-QLPEPLLASSGHC[CAM].2y9_1.heavy 776.899 / 941.451 3435.0 34.405399322509766 44 14 10 10 10 3.1371518195024906 25.515829525105175 0.0 3 0.9472460029264475 5.349420221188944 3435.0 2.4022727272727264 1.0 - - - - - - - 226.28571428571428 6 7 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 93 12 C20140709_OR011_01 C20140709_OR011_01 TB416851.[MT7]-QLPEPLLASSGHC[CAM].2b6_1.heavy 776.899 / 822.484 1453.0 34.405399322509766 44 14 10 10 10 3.1371518195024906 25.515829525105175 0.0 3 0.9472460029264475 5.349420221188944 1453.0 12.271448620088938 1.0 - - - - - - - 198.0 2 6 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 95 12 C20140709_OR011_01 C20140709_OR011_01 TB416851.[MT7]-QLPEPLLASSGHC[CAM].2y11_1.heavy 776.899 / 1167.55 5152.0 34.405399322509766 44 14 10 10 10 3.1371518195024906 25.515829525105175 0.0 3 0.9472460029264475 5.349420221188944 5152.0 26.02020202020202 0.0 - - - - - - - 280.5 10 8 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 97 13 C20140709_OR011_01 C20140709_OR011_01 TB416542.[MT7]-EVPDYLDHIK[MT7].3y3_1.heavy 506.28 / 541.358 6209.0 30.41380023956299 28 8 10 6 4 1.067821733558768 74.1657701029174 0.03240013122558594 7 0.7630198202314898 2.483308856880345 6209.0 10.458421985815603 0.0 - - - - - - - 271.2 12 10 BRD1 bromodomain containing 1 99 13 C20140709_OR011_01 C20140709_OR011_01 TB416542.[MT7]-EVPDYLDHIK[MT7].3b4_1.heavy 506.28 / 585.3 2822.0 30.41380023956299 28 8 10 6 4 1.067821733558768 74.1657701029174 0.03240013122558594 7 0.7630198202314898 2.483308856880345 2822.0 0.33337271116361483 2.0 - - - - - - - 316.4 8 5 BRD1 bromodomain containing 1 101 13 C20140709_OR011_01 C20140709_OR011_01 TB416542.[MT7]-EVPDYLDHIK[MT7].3b5_1.heavy 506.28 / 748.363 677.0 30.41380023956299 28 8 10 6 4 1.067821733558768 74.1657701029174 0.03240013122558594 7 0.7630198202314898 2.483308856880345 677.0 9.555884955752212 5.0 - - - - - - - 226.0 2 4 BRD1 bromodomain containing 1 103 13 C20140709_OR011_01 C20140709_OR011_01 TB416542.[MT7]-EVPDYLDHIK[MT7].3y4_1.heavy 506.28 / 656.385 790.0 30.41380023956299 28 8 10 6 4 1.067821733558768 74.1657701029174 0.03240013122558594 7 0.7630198202314898 2.483308856880345 790.0 1.1204433095251556 10.0 - - - - - - - 188.33333333333334 2 9 BRD1 bromodomain containing 1 105 14 C20140709_OR011_01 C20140709_OR011_01 TB416913.[MT7]-LTIFEQENFLGK[MT7].2b3_1.heavy 863.985 / 472.325 17336.0 42.911598205566406 45 15 10 10 10 5.091433948118241 19.640832232923167 0.0 3 0.953709728383887 5.713836417372276 17336.0 46.894570489035814 0.0 - - - - - - - 267.75 34 8 CRYBA4 crystallin, beta A4 107 14 C20140709_OR011_01 C20140709_OR011_01 TB416913.[MT7]-LTIFEQENFLGK[MT7].2y8_1.heavy 863.985 / 1108.58 8278.0 42.911598205566406 45 15 10 10 10 5.091433948118241 19.640832232923167 0.0 3 0.953709728383887 5.713836417372276 8278.0 43.53337121318668 0.0 - - - - - - - 264.35714285714283 16 14 CRYBA4 crystallin, beta A4 109 14 C20140709_OR011_01 C20140709_OR011_01 TB416913.[MT7]-LTIFEQENFLGK[MT7].2y5_1.heavy 863.985 / 722.432 6038.0 42.911598205566406 45 15 10 10 10 5.091433948118241 19.640832232923167 0.0 3 0.953709728383887 5.713836417372276 6038.0 50.85747804706709 0.0 - - - - - - - 158.0 12 8 CRYBA4 crystallin, beta A4 111 14 C20140709_OR011_01 C20140709_OR011_01 TB416913.[MT7]-LTIFEQENFLGK[MT7].2y7_1.heavy 863.985 / 979.533 8083.0 42.911598205566406 45 15 10 10 10 5.091433948118241 19.640832232923167 0.0 3 0.953709728383887 5.713836417372276 8083.0 44.94908886547242 0.0 - - - - - - - 250.57142857142858 16 14 CRYBA4 crystallin, beta A4 113 15 C20140709_OR011_01 C20140709_OR011_01 TB416915.[MT7]-GMTTVDDFFQGTK[MT7].3b6_1.heavy 578.959 / 749.362 27360.0 38.87110137939453 48 18 10 10 10 5.095425562413989 19.625446152651556 0.0 3 0.9866199135963285 10.657307014281574 27360.0 114.5547230686503 0.0 - - - - - - - 228.0 54 7 DPYSL3 dihydropyrimidinase-like 3 115 15 C20140709_OR011_01 C20140709_OR011_01 TB416915.[MT7]-GMTTVDDFFQGTK[MT7].3b4_1.heavy 578.959 / 535.267 33203.0 38.87110137939453 48 18 10 10 10 5.095425562413989 19.625446152651556 0.0 3 0.9866199135963285 10.657307014281574 33203.0 118.805461393597 0.0 - - - - - - - 265.6666666666667 66 6 DPYSL3 dihydropyrimidinase-like 3 117 15 C20140709_OR011_01 C20140709_OR011_01 TB416915.[MT7]-GMTTVDDFFQGTK[MT7].3b8_1.heavy 578.959 / 1011.46 25500.0 38.87110137939453 48 18 10 10 10 5.095425562413989 19.625446152651556 0.0 3 0.9866199135963285 10.657307014281574 25500.0 64.83554216867469 0.0 - - - - - - - 199.5 51 4 DPYSL3 dihydropyrimidinase-like 3 119 15 C20140709_OR011_01 C20140709_OR011_01 TB416915.[MT7]-GMTTVDDFFQGTK[MT7].3b7_1.heavy 578.959 / 864.389 76102.0 38.87110137939453 48 18 10 10 10 5.095425562413989 19.625446152651556 0.0 3 0.9866199135963285 10.657307014281574 76102.0 321.14814978849046 0.0 - - - - - - - 265.6666666666667 152 3 DPYSL3 dihydropyrimidinase-like 3 121 16 C20140709_OR011_01 C20140709_OR011_01 TB416711.[MT7]-VLELTAENER.2y8_1.heavy 659.36 / 961.458 14151.0 30.97640037536621 50 20 10 10 10 33.08841558352834 3.0222057549887866 0.0 3 0.995211729782286 17.827875748819324 14151.0 48.55145690374047 0.0 - - - - - - - 247.9 28 10 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 123 16 C20140709_OR011_01 C20140709_OR011_01 TB416711.[MT7]-VLELTAENER.2y9_1.heavy 659.36 / 1074.54 28198.0 30.97640037536621 50 20 10 10 10 33.08841558352834 3.0222057549887866 0.0 3 0.995211729782286 17.827875748819324 28198.0 60.64086021505377 0.0 - - - - - - - 272.27272727272725 56 11 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 125 16 C20140709_OR011_01 C20140709_OR011_01 TB416711.[MT7]-VLELTAENER.2y6_1.heavy 659.36 / 719.332 11155.0 30.97640037536621 50 20 10 10 10 33.08841558352834 3.0222057549887866 0.0 3 0.995211729782286 17.827875748819324 11155.0 85.37738351254481 0.0 - - - - - - - 206.75 22 8 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 127 16 C20140709_OR011_01 C20140709_OR011_01 TB416711.[MT7]-VLELTAENER.2y7_1.heavy 659.36 / 832.416 10742.0 30.97640037536621 50 20 10 10 10 33.08841558352834 3.0222057549887866 0.0 3 0.995211729782286 17.827875748819324 10742.0 120.65716213357155 0.0 - - - - - - - 206.72727272727272 21 11 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 129 17 C20140709_OR011_01 C20140709_OR011_01 TB416919.[MT7]-MVVWDEDGFQGRR.3y10_2.heavy 580.287 / 633.286 254.0 36.25709915161133 19 9 0 10 0 0.6041667427653356 85.26576642847027 0.0 49 0.8169158720880827 2.839073519422984 254.0 0.16213221052631577 39.0 - - - - - - - 235.57142857142858 17 7 CRYBA4 crystallin, beta A4 131 17 C20140709_OR011_01 C20140709_OR011_01 TB416919.[MT7]-MVVWDEDGFQGRR.3y6_1.heavy 580.287 / 720.39 1522.0 36.25709915161133 19 9 0 10 0 0.6041667427653356 85.26576642847027 0.0 49 0.8169158720880827 2.839073519422984 1522.0 7.494294056438211 5.0 - - - - - - - 185.6153846153846 4 13 CRYBA4 crystallin, beta A4 133 17 C20140709_OR011_01 C20140709_OR011_01 TB416919.[MT7]-MVVWDEDGFQGRR.3b5_1.heavy 580.287 / 775.393 N/A 36.25709915161133 19 9 0 10 0 0.6041667427653356 85.26576642847027 0.0 49 0.8169158720880827 2.839073519422984 507.0 0.5196583442838371 17.0 - - - - - - - 253.66666666666666 3 6 CRYBA4 crystallin, beta A4 135 17 C20140709_OR011_01 C20140709_OR011_01 TB416919.[MT7]-MVVWDEDGFQGRR.3y12_2.heavy 580.287 / 732.355 634.0 36.25709915161133 19 9 0 10 0 0.6041667427653356 85.26576642847027 0.0 49 0.8169158720880827 2.839073519422984 634.0 1.8678947368421053 13.0 - - - - - - - 253.71428571428572 3 7 CRYBA4 crystallin, beta A4 137 18 C20140709_OR011_01 C20140709_OR011_01 TB416729.[MT7]-LNRYSDGLLR.3y7_1.heavy 450.925 / 823.431 294.0 30.11697483062744 35 14 10 3 8 2.847658000264205 35.11657649574563 0.06509971618652344 4 0.9476914471392608 5.3723523248969824 294.0 0.29999999999999993 1.0 - - - - - - - 0.0 0 0 LZTS1 leucine zipper, putative tumor suppressor 1 139 18 C20140709_OR011_01 C20140709_OR011_01 TB416729.[MT7]-LNRYSDGLLR.3y6_1.heavy 450.925 / 660.367 979.0 30.11697483062744 35 14 10 3 8 2.847658000264205 35.11657649574563 0.06509971618652344 4 0.9476914471392608 5.3723523248969824 979.0 7.642193877551021 0.0 - - - - - - - 0.0 1 0 LZTS1 leucine zipper, putative tumor suppressor 1 141 18 C20140709_OR011_01 C20140709_OR011_01 TB416729.[MT7]-LNRYSDGLLR.3b7_1.heavy 450.925 / 950.481 196.0 30.11697483062744 35 14 10 3 8 2.847658000264205 35.11657649574563 0.06509971618652344 4 0.9476914471392608 5.3723523248969824 196.0 0.8975 3.0 - - - - - - - 0.0 0 0 LZTS1 leucine zipper, putative tumor suppressor 1 143 18 C20140709_OR011_01 C20140709_OR011_01 TB416729.[MT7]-LNRYSDGLLR.3y4_1.heavy 450.925 / 458.309 3720.0 30.11697483062744 35 14 10 3 8 2.847658000264205 35.11657649574563 0.06509971618652344 4 0.9476914471392608 5.3723523248969824 3720.0 25.053061224489795 0.0 - - - - - - - 241.23076923076923 7 13 LZTS1 leucine zipper, putative tumor suppressor 1 145 19 C20140709_OR011_01 C20140709_OR011_01 TB416639.[MT7]-LSTASVIQAR.2y5_1.heavy 595.355 / 586.367 16292.0 28.985300064086914 50 20 10 10 10 9.497006636650957 10.529633580972646 0.0 3 0.995563914639423 18.522591317176616 16292.0 23.277193881652202 1.0 - - - - - - - 439.0 32 2 HIC2 hypermethylated in cancer 2 147 19 C20140709_OR011_01 C20140709_OR011_01 TB416639.[MT7]-LSTASVIQAR.2y9_1.heavy 595.355 / 932.516 55219.0 28.985300064086914 50 20 10 10 10 9.497006636650957 10.529633580972646 0.0 3 0.995563914639423 18.522591317176616 55219.0 248.89705317814537 0.0 - - - - - - - 195.4 110 10 HIC2 hypermethylated in cancer 2 149 19 C20140709_OR011_01 C20140709_OR011_01 TB416639.[MT7]-LSTASVIQAR.2y6_1.heavy 595.355 / 673.399 9561.0 28.985300064086914 50 20 10 10 10 9.497006636650957 10.529633580972646 0.0 3 0.995563914639423 18.522591317176616 9561.0 41.778889945728196 0.0 - - - - - - - 253.9 19 10 HIC2 hypermethylated in cancer 2 151 19 C20140709_OR011_01 C20140709_OR011_01 TB416639.[MT7]-LSTASVIQAR.2y7_1.heavy 595.355 / 744.436 9561.0 28.985300064086914 50 20 10 10 10 9.497006636650957 10.529633580972646 0.0 3 0.995563914639423 18.522591317176616 9561.0 24.84225641025641 0.0 - - - - - - - 186.54545454545453 19 11 HIC2 hypermethylated in cancer 2 153 20 C20140709_OR011_01 C20140709_OR011_01 TB447002.[MT7]-QSILLNTR.2y5_1.heavy 544.831 / 616.378 12377.0 28.587149620056152 46 20 10 6 10 13.258176208148601 7.542515533813697 0.03429985046386719 3 0.9969694562335032 22.41260563768521 12377.0 17.10348713979519 0.0 - - - - - - - 232.2 24 10 C22orf31 chromosome 22 open reading frame 31 155 20 C20140709_OR011_01 C20140709_OR011_01 TB447002.[MT7]-QSILLNTR.2b4_1.heavy 544.831 / 586.368 13040.0 28.587149620056152 46 20 10 6 10 13.258176208148601 7.542515533813697 0.03429985046386719 3 0.9969694562335032 22.41260563768521 13040.0 18.824455423409127 0.0 - - - - - - - 258.0 26 9 C22orf31 chromosome 22 open reading frame 31 157 20 C20140709_OR011_01 C20140709_OR011_01 TB447002.[MT7]-QSILLNTR.2y6_1.heavy 544.831 / 729.462 6631.0 28.587149620056152 46 20 10 6 10 13.258176208148601 7.542515533813697 0.03429985046386719 3 0.9969694562335032 22.41260563768521 6631.0 33.20500754147813 0.0 - - - - - - - 221.375 13 8 C22orf31 chromosome 22 open reading frame 31 159 20 C20140709_OR011_01 C20140709_OR011_01 TB447002.[MT7]-QSILLNTR.2y7_1.heavy 544.831 / 816.494 34701.0 28.587149620056152 46 20 10 6 10 13.258176208148601 7.542515533813697 0.03429985046386719 3 0.9969694562335032 22.41260563768521 34701.0 304.5462969166349 1.0 - - - - - - - 111.0 69 2 C22orf31 chromosome 22 open reading frame 31 161 21 C20140709_OR011_01 C20140709_OR011_01 TB416921.[MT7]-VILYELENFQGK[MT7].2b3_1.heavy 870.992 / 470.346 22925.0 43.95199966430664 48 18 10 10 10 6.382654428541579 15.66746267083267 0.0 3 0.9899653900418423 12.30972319001249 22925.0 81.03922495274102 0.0 - - - - - - - 352.85714285714283 45 7 CRYBB3 crystallin, beta B3 163 21 C20140709_OR011_01 C20140709_OR011_01 TB416921.[MT7]-VILYELENFQGK[MT7].2y6_1.heavy 870.992 / 866.449 6966.0 43.95199966430664 48 18 10 10 10 6.382654428541579 15.66746267083267 0.0 3 0.9899653900418423 12.30972319001249 6966.0 48.263103196425504 0.0 - - - - - - - 211.6 13 10 CRYBB3 crystallin, beta B3 165 21 C20140709_OR011_01 C20140709_OR011_01 TB416921.[MT7]-VILYELENFQGK[MT7].2b5_1.heavy 870.992 / 762.452 7407.0 43.95199966430664 48 18 10 10 10 6.382654428541579 15.66746267083267 0.0 3 0.9899653900418423 12.30972319001249 7407.0 29.985953088229618 0.0 - - - - - - - 291.2 14 10 CRYBB3 crystallin, beta B3 167 21 C20140709_OR011_01 C20140709_OR011_01 TB416921.[MT7]-VILYELENFQGK[MT7].2y7_1.heavy 870.992 / 979.533 8994.0 43.95199966430664 48 18 10 10 10 6.382654428541579 15.66746267083267 0.0 3 0.9899653900418423 12.30972319001249 8994.0 26.177513727608243 0.0 - - - - - - - 256.72727272727275 17 11 CRYBB3 crystallin, beta B3 169 22 C20140709_OR011_01 C20140709_OR011_01 TB447147.[MT7]-NRDPPEIEYR.3y7_1.heavy 478.248 / 903.457 7519.0 22.876800060272217 37 11 10 6 10 1.1349003326835325 57.56601458256597 0.03999900817871094 3 0.8749574867720787 3.4530320686273406 7519.0 44.81020202020201 0.0 - - - - - - - 226.28571428571428 15 7 KLF8 Kruppel-like factor 8 171 22 C20140709_OR011_01 C20140709_OR011_01 TB447147.[MT7]-NRDPPEIEYR.3y6_1.heavy 478.248 / 806.404 2968.0 22.876800060272217 37 11 10 6 10 1.1349003326835325 57.56601458256597 0.03999900817871094 3 0.8749574867720787 3.4530320686273406 2968.0 26.98560829534281 0.0 - - - - - - - 247.5 5 6 KLF8 Kruppel-like factor 8 173 22 C20140709_OR011_01 C20140709_OR011_01 TB447147.[MT7]-NRDPPEIEYR.3y4_1.heavy 478.248 / 580.309 5243.0 22.876800060272217 37 11 10 6 10 1.1349003326835325 57.56601458256597 0.03999900817871094 3 0.8749574867720787 3.4530320686273406 5243.0 73.87863636363636 0.0 - - - - - - - 162.0 10 11 KLF8 Kruppel-like factor 8 175 22 C20140709_OR011_01 C20140709_OR011_01 TB447147.[MT7]-NRDPPEIEYR.3b3_1.heavy 478.248 / 530.28 10091.0 22.876800060272217 37 11 10 6 10 1.1349003326835325 57.56601458256597 0.03999900817871094 3 0.8749574867720787 3.4530320686273406 10091.0 117.01482828282828 0.0 - - - - - - - 254.57142857142858 20 7 KLF8 Kruppel-like factor 8 177 23 C20140709_OR011_01 C20140709_OR011_01 TB447146.[MT7]-RDPSIPIYGLR.3y6_1.heavy 477.613 / 718.425 16602.0 32.805198669433594 48 18 10 10 10 4.811710953693571 20.78262825060967 0.0 3 0.9814964311548271 9.058633097188093 16602.0 232.70271965890055 0.0 - - - - - - - 198.625 33 8 C22orf31 chromosome 22 open reading frame 31 179 23 C20140709_OR011_01 C20140709_OR011_01 TB447146.[MT7]-RDPSIPIYGLR.3b4_1.heavy 477.613 / 600.322 9544.0 32.805198669433594 48 18 10 10 10 4.811710953693571 20.78262825060967 0.0 3 0.9814964311548271 9.058633097188093 9544.0 91.69913567839197 0.0 - - - - - - - 248.5 19 8 C22orf31 chromosome 22 open reading frame 31 181 23 C20140709_OR011_01 C20140709_OR011_01 TB447146.[MT7]-RDPSIPIYGLR.3b5_1.heavy 477.613 / 713.406 6959.0 32.805198669433594 48 18 10 10 10 4.811710953693571 20.78262825060967 0.0 3 0.9814964311548271 9.058633097188093 6959.0 37.7703684390098 0.0 - - - - - - - 198.66666666666666 13 3 C22orf31 chromosome 22 open reading frame 31 183 23 C20140709_OR011_01 C20140709_OR011_01 TB447146.[MT7]-RDPSIPIYGLR.3y5_1.heavy 477.613 / 621.372 12128.0 32.805198669433594 48 18 10 10 10 4.811710953693571 20.78262825060967 0.0 3 0.9814964311548271 9.058633097188093 12128.0 38.649985280812395 0.0 - - - - - - - 215.16666666666666 24 6 C22orf31 chromosome 22 open reading frame 31 185 24 C20140709_OR011_01 C20140709_OR011_01 TB446920.[MT7]-DLVMFR.2y4_1.heavy 462.758 / 552.296 3769.0 35.389801025390625 46 16 10 10 10 2.3729648312055245 42.14137465711936 0.0 3 0.9647858256917298 6.557236731182476 3769.0 13.77137291828219 1.0 - - - - - - - 273.5 8 4 ZFP30 zinc finger protein 30 homolog (mouse) 187 24 C20140709_OR011_01 C20140709_OR011_01 TB446920.[MT7]-DLVMFR.2b3_1.heavy 462.758 / 472.289 6200.0 35.389801025390625 46 16 10 10 10 2.3729648312055245 42.14137465711936 0.0 3 0.9647858256917298 6.557236731182476 6200.0 32.273972602739725 0.0 - - - - - - - 365.0 12 2 ZFP30 zinc finger protein 30 homolog (mouse) 189 24 C20140709_OR011_01 C20140709_OR011_01 TB446920.[MT7]-DLVMFR.2y5_1.heavy 462.758 / 665.38 7781.0 35.389801025390625 46 16 10 10 10 2.3729648312055245 42.14137465711936 0.0 3 0.9647858256917298 6.557236731182476 7781.0 95.76724408014573 0.0 - - - - - - - 267.6 15 5 ZFP30 zinc finger protein 30 homolog (mouse) 191 24 C20140709_OR011_01 C20140709_OR011_01 TB446920.[MT7]-DLVMFR.2b4_1.heavy 462.758 / 603.329 4741.0 35.389801025390625 46 16 10 10 10 2.3729648312055245 42.14137465711936 0.0 3 0.9647858256917298 6.557236731182476 4741.0 77.21612295081968 0.0 - - - - - - - 146.2 9 5 ZFP30 zinc finger protein 30 homolog (mouse) 193 25 C20140709_OR011_01 C20140709_OR011_01 TB446924.[MT7]-RPGGAGK[MT7].2y4_1.heavy 465.79 / 476.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCF25 transcription factor 25 (basic helix-loop-helix) 195 25 C20140709_OR011_01 C20140709_OR011_01 TB446924.[MT7]-RPGGAGK[MT7].2y5_1.heavy 465.79 / 533.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCF25 transcription factor 25 (basic helix-loop-helix) 197 25 C20140709_OR011_01 C20140709_OR011_01 TB446924.[MT7]-RPGGAGK[MT7].2y3_1.heavy 465.79 / 419.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCF25 transcription factor 25 (basic helix-loop-helix) 199 25 C20140709_OR011_01 C20140709_OR011_01 TB446924.[MT7]-RPGGAGK[MT7].2y6_1.heavy 465.79 / 630.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCF25 transcription factor 25 (basic helix-loop-helix) 201 26 C20140709_OR011_01 C20140709_OR011_01 TB416868.[MT7]-GQLSLFC[CAM]LEDK[MT7].3y3_1.heavy 533.288 / 535.284 11385.0 39.968299865722656 46 16 10 10 10 2.1568140683571997 31.291995434716434 0.0 3 0.9663486043909554 6.708653494519254 11385.0 73.3909090909091 0.0 - - - - - - - 268.8888888888889 22 9 TRIM35 tripartite motif-containing 35 203 26 C20140709_OR011_01 C20140709_OR011_01 TB416868.[MT7]-GQLSLFC[CAM]LEDK[MT7].3b4_1.heavy 533.288 / 530.305 7388.0 39.968299865722656 46 16 10 10 10 2.1568140683571997 31.291995434716434 0.0 3 0.9663486043909554 6.708653494519254 7388.0 22.384144362726513 0.0 - - - - - - - 302.5 14 10 TRIM35 tripartite motif-containing 35 205 26 C20140709_OR011_01 C20140709_OR011_01 TB416868.[MT7]-GQLSLFC[CAM]LEDK[MT7].3b5_1.heavy 533.288 / 643.39 5571.0 39.968299865722656 46 16 10 10 10 2.1568140683571997 31.291995434716434 0.0 3 0.9663486043909554 6.708653494519254 5571.0 68.57854958677686 0.0 - - - - - - - 211.75 11 4 TRIM35 tripartite motif-containing 35 207 26 C20140709_OR011_01 C20140709_OR011_01 TB416868.[MT7]-GQLSLFC[CAM]LEDK[MT7].3y4_1.heavy 533.288 / 648.369 8599.0 39.968299865722656 46 16 10 10 10 2.1568140683571997 31.291995434716434 0.0 3 0.9663486043909554 6.708653494519254 8599.0 52.09146280991736 0.0 - - - - - - - 226.875 17 8 TRIM35 tripartite motif-containing 35 209 27 C20140709_OR011_01 C20140709_OR011_01 TB417004.[MT7]-VGSIQVESGPWLAFESR.2y9_1.heavy 1003.53 / 1062.54 1769.0 43.852500915527344 37 16 8 5 8 3.0957420364468646 32.302433091219356 0.04019927978515625 4 0.9605404202958557 6.19223753213548 1769.0 3.3015985543196438 2.0 - - - - - - - 282.9 7 10 CRYBB3 crystallin, beta B3 211 27 C20140709_OR011_01 C20140709_OR011_01 TB417004.[MT7]-VGSIQVESGPWLAFESR.2y6_1.heavy 1003.53 / 722.383 442.0 43.852500915527344 37 16 8 5 8 3.0957420364468646 32.302433091219356 0.04019927978515625 4 0.9605404202958557 6.19223753213548 442.0 9.990204545454546 5.0 - - - - - - - 0.0 1 0 CRYBB3 crystallin, beta B3 213 27 C20140709_OR011_01 C20140709_OR011_01 TB417004.[MT7]-VGSIQVESGPWLAFESR.2y10_1.heavy 1003.53 / 1149.57 2035.0 43.852500915527344 37 16 8 5 8 3.0957420364468646 32.302433091219356 0.04019927978515625 4 0.9605404202958557 6.19223753213548 2035.0 12.200021319688734 0.0 - - - - - - - 217.93333333333334 4 15 CRYBB3 crystallin, beta B3 215 27 C20140709_OR011_01 C20140709_OR011_01 TB417004.[MT7]-VGSIQVESGPWLAFESR.2b5_1.heavy 1003.53 / 629.374 2566.0 43.852500915527344 37 16 8 5 8 3.0957420364468646 32.302433091219356 0.04019927978515625 4 0.9605404202958557 6.19223753213548 2566.0 9.784484544359694 0.0 - - - - - - - 184.8181818181818 5 11 CRYBB3 crystallin, beta B3 217 28 C20140709_OR011_01 C20140709_OR011_01 TB447286.[MT7]-LMPFSNQLEMGSEK[MT7].2y4_1.heavy 949.983 / 564.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - LZTS1 leucine zipper, putative tumor suppressor 1 219 28 C20140709_OR011_01 C20140709_OR011_01 TB447286.[MT7]-LMPFSNQLEMGSEK[MT7].2y5_1.heavy 949.983 / 695.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - LZTS1 leucine zipper, putative tumor suppressor 1 221 28 C20140709_OR011_01 C20140709_OR011_01 TB447286.[MT7]-LMPFSNQLEMGSEK[MT7].2y6_1.heavy 949.983 / 824.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - LZTS1 leucine zipper, putative tumor suppressor 1 223 28 C20140709_OR011_01 C20140709_OR011_01 TB447286.[MT7]-LMPFSNQLEMGSEK[MT7].2b7_1.heavy 949.983 / 962.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - LZTS1 leucine zipper, putative tumor suppressor 1 225 29 C20140709_OR011_01 C20140709_OR011_01 TB417005.[MT7]-VGSIQVESGPWLAFESR.3y6_1.heavy 669.354 / 722.383 5059.0 43.832401275634766 50 20 10 10 10 8.08960620448859 12.361541151967831 0.0 3 0.9966481465478403 21.310737339880774 5059.0 8.79451851172647 1.0 - - - - - - - 238.92307692307693 14 13 CRYBB3 crystallin, beta B3 227 29 C20140709_OR011_01 C20140709_OR011_01 TB417005.[MT7]-VGSIQVESGPWLAFESR.3b5_1.heavy 669.354 / 629.374 13312.0 43.832401275634766 50 20 10 10 10 8.08960620448859 12.361541151967831 0.0 3 0.9966481465478403 21.310737339880774 13312.0 47.79308270676691 0.0 - - - - - - - 225.23076923076923 26 13 CRYBB3 crystallin, beta B3 229 29 C20140709_OR011_01 C20140709_OR011_01 TB417005.[MT7]-VGSIQVESGPWLAFESR.3y5_1.heavy 669.354 / 609.299 9230.0 43.832401275634766 50 20 10 10 10 8.08960620448859 12.361541151967831 0.0 3 0.9966481465478403 21.310737339880774 9230.0 30.145619806289393 0.0 - - - - - - - 266.14285714285717 18 14 CRYBB3 crystallin, beta B3 231 29 C20140709_OR011_01 C20140709_OR011_01 TB417005.[MT7]-VGSIQVESGPWLAFESR.3y10_1.heavy 669.354 / 1149.57 4082.0 43.832401275634766 50 20 10 10 10 8.08960620448859 12.361541151967831 0.0 3 0.9966481465478403 21.310737339880774 4082.0 19.3809243697479 0.0 - - - - - - - 133.2 8 10 CRYBB3 crystallin, beta B3 233 30 C20140709_OR011_01 C20140709_OR011_01 TB417144.[MT7]-EQEPIMDNNISLVPFERPAVIEK[MT7].4y10_2.heavy 739.898 / 665.386 7822.0 41.069400787353516 43 13 10 10 10 1.1659997335483132 50.94454159146824 0.0 3 0.9202091361023247 4.339651574855371 7822.0 42.170782608695646 0.0 - - - - - - - 172.5 15 6 IKZF2 IKAROS family zinc finger 2 (Helios) 235 30 C20140709_OR011_01 C20140709_OR011_01 TB417144.[MT7]-EQEPIMDNNISLVPFERPAVIEK[MT7].4y13_2.heavy 739.898 / 814.978 6441.0 41.069400787353516 43 13 10 10 10 1.1659997335483132 50.94454159146824 0.0 3 0.9202091361023247 4.339651574855371 6441.0 20.72321739130435 0.0 - - - - - - - 287.5 12 6 IKZF2 IKAROS family zinc finger 2 (Helios) 237 30 C20140709_OR011_01 C20140709_OR011_01 TB417144.[MT7]-EQEPIMDNNISLVPFERPAVIEK[MT7].4b5_1.heavy 739.898 / 741.39 3681.0 41.069400787353516 43 13 10 10 10 1.1659997335483132 50.94454159146824 0.0 3 0.9202091361023247 4.339651574855371 3681.0 12.376695652173913 0.0 - - - - - - - 238.21428571428572 7 14 IKZF2 IKAROS family zinc finger 2 (Helios) 239 30 C20140709_OR011_01 C20140709_OR011_01 TB417144.[MT7]-EQEPIMDNNISLVPFERPAVIEK[MT7].4b3_1.heavy 739.898 / 531.253 5981.0 41.069400787353516 43 13 10 10 10 1.1659997335483132 50.94454159146824 0.0 3 0.9202091361023247 4.339651574855371 5981.0 27.308032463768114 0.0 - - - - - - - 184.0 11 5 IKZF2 IKAROS family zinc finger 2 (Helios) 241 31 C20140709_OR011_01 C20140709_OR011_01 TB416863.[MT7]-MVVWDEDGFQGR.3y6_1.heavy 528.253 / 679.316 7478.0 37.75699996948242 48 18 10 10 10 7.072298661271986 14.13967435334731 0.0 3 0.9893931227217614 11.97247595105662 7478.0 8.921941172929175 1.0 - - - - - - - 181.33333333333334 15 3 CRYBA4 crystallin, beta A4 243 31 C20140709_OR011_01 C20140709_OR011_01 TB416863.[MT7]-MVVWDEDGFQGR.3b5_1.heavy 528.253 / 775.393 4487.0 37.75699996948242 48 18 10 10 10 7.072298661271986 14.13967435334731 0.0 3 0.9893931227217614 11.97247595105662 4487.0 43.22036764705882 0.0 - - - - - - - 272.0 8 5 CRYBA4 crystallin, beta A4 245 31 C20140709_OR011_01 C20140709_OR011_01 TB416863.[MT7]-MVVWDEDGFQGR.3y4_1.heavy 528.253 / 507.267 4215.0 37.75699996948242 48 18 10 10 10 7.072298661271986 14.13967435334731 0.0 3 0.9893931227217614 11.97247595105662 4215.0 14.463235294117647 0.0 - - - - - - - 299.2 8 10 CRYBA4 crystallin, beta A4 247 31 C20140709_OR011_01 C20140709_OR011_01 TB416863.[MT7]-MVVWDEDGFQGR.3y5_1.heavy 528.253 / 564.289 10333.0 37.75699996948242 48 18 10 10 10 7.072298661271986 14.13967435334731 0.0 3 0.9893931227217614 11.97247595105662 10333.0 47.35958333333333 0.0 - - - - - - - 226.66666666666666 20 6 CRYBA4 crystallin, beta A4 249 32 C20140709_OR011_01 C20140709_OR011_01 TB416861.[MT7]-AQLMQYLSLPK[MT7].3y3_1.heavy 527.309 / 501.352 5555.0 41.83300018310547 44 14 10 10 10 1.9266311468793575 51.90407108385747 0.0 3 0.9493684542813194 5.461376400110924 5555.0 30.12288144492282 0.0 - - - - - - - 240.375 11 8 C22orf42 chromosome 22 open reading frame 42 251 32 C20140709_OR011_01 C20140709_OR011_01 TB416861.[MT7]-AQLMQYLSLPK[MT7].3b6_1.heavy 527.309 / 879.451 5555.0 41.83300018310547 44 14 10 10 10 1.9266311468793575 51.90407108385747 0.0 3 0.9493684542813194 5.461376400110924 5555.0 50.73311553618321 1.0 - - - - - - - 107.0 15 2 C22orf42 chromosome 22 open reading frame 42 253 32 C20140709_OR011_01 C20140709_OR011_01 TB416861.[MT7]-AQLMQYLSLPK[MT7].3b5_1.heavy 527.309 / 716.388 12071.0 41.83300018310547 44 14 10 10 10 1.9266311468793575 51.90407108385747 0.0 3 0.9493684542813194 5.461376400110924 12071.0 135.42854078662262 0.0 - - - - - - - 293.75 24 4 C22orf42 chromosome 22 open reading frame 42 255 32 C20140709_OR011_01 C20140709_OR011_01 TB416861.[MT7]-AQLMQYLSLPK[MT7].3y5_1.heavy 527.309 / 701.468 1602.0 41.83300018310547 44 14 10 10 10 1.9266311468793575 51.90407108385747 0.0 3 0.9493684542813194 5.461376400110924 1602.0 0.17473684210526313 1.0 - - - - - - - 200.25 3 8 C22orf42 chromosome 22 open reading frame 42 257 33 C20140709_OR011_01 C20140709_OR011_01 TB417009.[MT7]-LWEALC[CAM]SQGAISEGAQR.2b3_1.heavy 1010.51 / 573.315 5050.0 39.171074867248535 36 14 10 2 10 1.254625699327411 49.29752565510685 0.08589935302734375 3 0.9412888843973278 5.0682044854340855 5050.0 26.010826732476218 0.0 - - - - - - - 215.44444444444446 10 9 C22orf31 chromosome 22 open reading frame 31 259 33 C20140709_OR011_01 C20140709_OR011_01 TB417009.[MT7]-LWEALC[CAM]SQGAISEGAQR.2y11_1.heavy 1010.51 / 1103.54 2072.0 39.171074867248535 36 14 10 2 10 1.254625699327411 49.29752565510685 0.08589935302734375 3 0.9412888843973278 5.0682044854340855 2072.0 7.473539518900344 0.0 - - - - - - - 226.25 4 4 C22orf31 chromosome 22 open reading frame 31 261 33 C20140709_OR011_01 C20140709_OR011_01 TB417009.[MT7]-LWEALC[CAM]SQGAISEGAQR.2b4_1.heavy 1010.51 / 644.352 4791.0 39.171074867248535 36 14 10 2 10 1.254625699327411 49.29752565510685 0.08589935302734375 3 0.9412888843973278 5.0682044854340855 4791.0 46.275094701510426 0.0 - - - - - - - 295.7142857142857 9 7 C22orf31 chromosome 22 open reading frame 31 263 33 C20140709_OR011_01 C20140709_OR011_01 TB417009.[MT7]-LWEALC[CAM]SQGAISEGAQR.2y9_1.heavy 1010.51 / 888.453 1813.0 39.171074867248535 36 14 10 2 10 1.254625699327411 49.29752565510685 0.08589935302734375 3 0.9412888843973278 5.0682044854340855 1813.0 10.64 0.0 - - - - - - - 194.0 3 8 C22orf31 chromosome 22 open reading frame 31 265 34 C20140709_OR011_01 C20140709_OR011_01 TB417140.[MT7]-SNMTSPTLLDANPMENPALFNDIK[MT7].3b5_1.heavy 974.492 / 665.305 13592.0 44.65959930419922 43 13 10 10 10 2.056543400499223 38.06913890485406 0.0 3 0.9241069973679954 4.451186658470954 13592.0 38.458296321546996 0.0 - - - - - - - 309.3 27 10 KLF8 Kruppel-like factor 8 267 34 C20140709_OR011_01 C20140709_OR011_01 TB417140.[MT7]-SNMTSPTLLDANPMENPALFNDIK[MT7].3y8_1.heavy 974.492 / 1061.61 27916.0 44.65959930419922 43 13 10 10 10 2.056543400499223 38.06913890485406 0.0 3 0.9241069973679954 4.451186658470954 27916.0 130.8676113371195 0.0 - - - - - - - 723.3333333333334 55 9 KLF8 Kruppel-like factor 8 269 34 C20140709_OR011_01 C20140709_OR011_01 TB417140.[MT7]-SNMTSPTLLDANPMENPALFNDIK[MT7].3y5_1.heavy 974.492 / 780.437 8546.0 44.65959930419922 43 13 10 10 10 2.056543400499223 38.06913890485406 0.0 3 0.9241069973679954 4.451186658470954 8546.0 66.19647540983607 0.0 - - - - - - - 197.57142857142858 17 14 KLF8 Kruppel-like factor 8 271 34 C20140709_OR011_01 C20140709_OR011_01 TB417140.[MT7]-SNMTSPTLLDANPMENPALFNDIK[MT7].3b7_1.heavy 974.492 / 863.405 6918.0 44.65959930419922 43 13 10 10 10 2.056543400499223 38.06913890485406 0.0 3 0.9241069973679954 4.451186658470954 6918.0 37.49100966986477 0.0 - - - - - - - 244.1818181818182 13 11 KLF8 Kruppel-like factor 8 273 35 C20140709_OR011_01 C20140709_OR011_01 TB416860.[MT7]-AQLMQYLSLPK[MT7].2y3_1.heavy 790.46 / 501.352 1810.0 41.791500091552734 44 17 9 10 8 3.837063003916373 26.06159969172595 0.0 4 0.9783868589314239 8.379499937015606 1810.0 5.298591549295774 2.0 - - - - - - - 193.36363636363637 4 11 C22orf42 chromosome 22 open reading frame 42 275 35 C20140709_OR011_01 C20140709_OR011_01 TB416860.[MT7]-AQLMQYLSLPK[MT7].2b6_1.heavy 790.46 / 879.451 2768.0 41.791500091552734 44 17 9 10 8 3.837063003916373 26.06159969172595 0.0 4 0.9783868589314239 8.379499937015606 2768.0 5.284757433489828 0.0 - - - - - - - 170.0 5 5 C22orf42 chromosome 22 open reading frame 42 277 35 C20140709_OR011_01 C20140709_OR011_01 TB416860.[MT7]-AQLMQYLSLPK[MT7].2y6_1.heavy 790.46 / 864.531 958.0 41.791500091552734 44 17 9 10 8 3.837063003916373 26.06159969172595 0.0 4 0.9783868589314239 8.379499937015606 958.0 3.418215962441314 6.0 - - - - - - - 224.55555555555554 7 9 C22orf42 chromosome 22 open reading frame 42 279 35 C20140709_OR011_01 C20140709_OR011_01 TB416860.[MT7]-AQLMQYLSLPK[MT7].2b5_1.heavy 790.46 / 716.388 3513.0 41.791500091552734 44 17 9 10 8 3.837063003916373 26.06159969172595 0.0 4 0.9783868589314239 8.379499937015606 3513.0 38.73977943130481 0.0 - - - - - - - 252.75 7 8 C22orf42 chromosome 22 open reading frame 42 281 36 C20140709_OR011_01 C20140709_OR011_01 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 84286.0 29.90719985961914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 84286.0 1198.3406223034365 0.0 - - - - - - - 209.66666666666666 168 9 283 36 C20140709_OR011_01 C20140709_OR011_01 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 28493.0 29.90719985961914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 28493.0 222.559821422549 0.0 - - - - - - - 231.77777777777777 56 9 285 36 C20140709_OR011_01 C20140709_OR011_01 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 35839.0 29.90719985961914 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 35839.0 187.94622583351375 0.0 - - - - - - - 242.0 71 16 287 37 C20140709_OR011_01 C20140709_OR011_01 TB416633.[MT7]-AILGEQRPR.2y4_1.heavy 592.355 / 556.331 1654.0 21.480199813842773 34 14 4 10 6 2.3295694088404573 36.65979895187425 0.0 5 0.9418184980715844 5.091449253498057 1654.0 8.223300970873787 5.0 - - - - - - - 753.2857142857143 5 7 TCF25 transcription factor 25 (basic helix-loop-helix) 289 37 C20140709_OR011_01 C20140709_OR011_01 TB416633.[MT7]-AILGEQRPR.2y6_1.heavy 592.355 / 742.396 1654.0 21.480199813842773 34 14 4 10 6 2.3295694088404573 36.65979895187425 0.0 5 0.9418184980715844 5.091449253498057 1654.0 12.307873473222674 0.0 - - - - - - - 227.4 3 10 TCF25 transcription factor 25 (basic helix-loop-helix) 291 37 C20140709_OR011_01 C20140709_OR011_01 TB416633.[MT7]-AILGEQRPR.2b5_1.heavy 592.355 / 628.379 1448.0 21.480199813842773 34 14 4 10 6 2.3295694088404573 36.65979895187425 0.0 5 0.9418184980715844 5.091449253498057 1448.0 16.225396557384737 0.0 - - - - - - - 258.5 2 8 TCF25 transcription factor 25 (basic helix-loop-helix) 293 37 C20140709_OR011_01 C20140709_OR011_01 TB416633.[MT7]-AILGEQRPR.2y7_1.heavy 592.355 / 855.479 827.0 21.480199813842773 34 14 4 10 6 2.3295694088404573 36.65979895187425 0.0 5 0.9418184980715844 5.091449253498057 827.0 13.08747572815534 3.0 - - - - - - - 167.75 2 8 TCF25 transcription factor 25 (basic helix-loop-helix) 295 38 C20140709_OR011_01 C20140709_OR011_01 TB447287.[MT7]-FIPC[CAM]SPFSDYVYK[MT7].2y4_1.heavy 955.984 / 716.41 2281.0 42.35647392272949 33 14 10 5 4 2.246341342507001 44.51683192920104 0.04129791259765625 10 0.9411693750581629 5.0630025214108265 2281.0 -1.8031620553359682 0.0 - - - - - - - 228.0 4 5 DPYSL3 dihydropyrimidinase-like 3 297 38 C20140709_OR011_01 C20140709_OR011_01 TB447287.[MT7]-FIPC[CAM]SPFSDYVYK[MT7].2y8_1.heavy 955.984 / 1162.59 2154.0 42.35647392272949 33 14 10 5 4 2.246341342507001 44.51683192920104 0.04129791259765625 10 0.9411693750581629 5.0630025214108265 2154.0 -3.4055335968379445 0.0 - - - - - - - 253.25 4 4 DPYSL3 dihydropyrimidinase-like 3 299 38 C20140709_OR011_01 C20140709_OR011_01 TB447287.[MT7]-FIPC[CAM]SPFSDYVYK[MT7].2y3_1.heavy 955.984 / 553.347 507.0 42.35647392272949 33 14 10 5 4 2.246341342507001 44.51683192920104 0.04129791259765625 10 0.9411693750581629 5.0630025214108265 507.0 -1.6031620553359685 12.0 - - - - - - - 0.0 1 0 DPYSL3 dihydropyrimidinase-like 3 301 38 C20140709_OR011_01 C20140709_OR011_01 TB447287.[MT7]-FIPC[CAM]SPFSDYVYK[MT7].2y6_1.heavy 955.984 / 918.469 253.0 42.35647392272949 33 14 10 5 4 2.246341342507001 44.51683192920104 0.04129791259765625 10 0.9411693750581629 5.0630025214108265 253.0 1.006578947368421 23.0 - - - - - - - 0.0 1 0 DPYSL3 dihydropyrimidinase-like 3 303 39 C20140709_OR011_01 C20140709_OR011_01 TB417003.[MT7]-GLELEVC[CAM]ENELQRK[MT7].3y6_1.heavy 669.026 / 931.544 4326.0 32.59579849243164 36 14 4 10 8 1.6299206562923951 42.27557204211429 0.0 4 0.9424500233442015 5.1195838476752344 4326.0 38.43330555555556 1.0 - - - - - - - 278.14285714285717 15 7 LZTS1 leucine zipper, putative tumor suppressor 1 305 39 C20140709_OR011_01 C20140709_OR011_01 TB417003.[MT7]-GLELEVC[CAM]ENELQRK[MT7].3b4_1.heavy 669.026 / 557.341 4326.0 32.59579849243164 36 14 4 10 8 1.6299206562923951 42.27557204211429 0.0 4 0.9424500233442015 5.1195838476752344 4326.0 9.13554232856694 0.0 - - - - - - - 274.38461538461536 8 13 LZTS1 leucine zipper, putative tumor suppressor 1 307 39 C20140709_OR011_01 C20140709_OR011_01 TB417003.[MT7]-GLELEVC[CAM]ENELQRK[MT7].3b5_1.heavy 669.026 / 686.384 3569.0 32.59579849243164 36 14 4 10 8 1.6299206562923951 42.27557204211429 0.0 4 0.9424500233442015 5.1195838476752344 3569.0 11.668550476516579 0.0 - - - - - - - 308.7142857142857 7 7 LZTS1 leucine zipper, putative tumor suppressor 1 309 39 C20140709_OR011_01 C20140709_OR011_01 TB417003.[MT7]-GLELEVC[CAM]ENELQRK[MT7].3y8_1.heavy 669.026 / 1220.62 1622.0 32.59579849243164 36 14 4 10 8 1.6299206562923951 42.27557204211429 0.0 4 0.9424500233442015 5.1195838476752344 1622.0 28.234814814814815 0.0 - - - - - - - 151.2 3 5 LZTS1 leucine zipper, putative tumor suppressor 1 311 40 C20140709_OR011_01 C20140709_OR011_01 TB416928.[MT7]-GQEPLGPGALHFDLR.3y8_1.heavy 584.317 / 928.5 2593.0 37.32382392883301 41 16 10 5 10 2.3773664787122253 33.57526521829365 0.04489898681640625 3 0.965255906863855 6.6017087688482 2593.0 3.3243589743589737 0.0 - - - - - - - 272.7142857142857 5 7 TCF25 transcription factor 25 (basic helix-loop-helix) 313 40 C20140709_OR011_01 C20140709_OR011_01 TB416928.[MT7]-GQEPLGPGALHFDLR.3b6_1.heavy 584.317 / 726.39 6004.0 37.32382392883301 41 16 10 5 10 2.3773664787122253 33.57526521829365 0.04489898681640625 3 0.965255906863855 6.6017087688482 6004.0 51.009919786096255 0.0 - - - - - - - 238.5 12 4 TCF25 transcription factor 25 (basic helix-loop-helix) 315 40 C20140709_OR011_01 C20140709_OR011_01 TB416928.[MT7]-GQEPLGPGALHFDLR.3y5_1.heavy 584.317 / 687.357 4367.0 37.32382392883301 41 16 10 5 10 2.3773664787122253 33.57526521829365 0.04489898681640625 3 0.965255906863855 6.6017087688482 4367.0 23.97850915750916 0.0 - - - - - - - 233.57142857142858 8 7 TCF25 transcription factor 25 (basic helix-loop-helix) 317 40 C20140709_OR011_01 C20140709_OR011_01 TB416928.[MT7]-GQEPLGPGALHFDLR.3b5_1.heavy 584.317 / 669.369 3685.0 37.32382392883301 41 16 10 5 10 2.3773664787122253 33.57526521829365 0.04489898681640625 3 0.965255906863855 6.6017087688482 3685.0 15.767114914425427 0.0 - - - - - - - 340.875 7 8 TCF25 transcription factor 25 (basic helix-loop-helix) 319 41 C20140709_OR011_01 C20140709_OR011_01 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 29272.0 16.184099197387695 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 29272.0 105.00511237119687 0.0 - - - - - - - 172.42857142857142 58 7 321 41 C20140709_OR011_01 C20140709_OR011_01 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 40285.0 16.184099197387695 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 40285.0 479.99726635676126 0.0 - - - - - - - 205.11111111111111 80 9 323 41 C20140709_OR011_01 C20140709_OR011_01 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 24938.0 16.184099197387695 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 24938.0 141.90985549661605 0.0 - - - - - - - 213.0 49 8 325 42 C20140709_OR011_01 C20140709_OR011_01 TB446930.[MT7]-ALDTTK[MT7].2b3_1.heavy 468.784 / 444.258 3211.0 18.960500717163086 48 18 10 10 10 18.13011883420332 5.515683648545386 0.0 3 0.9806874866361026 8.866281993623819 3211.0 21.533333333333335 0.0 - - - - - - - 206.33333333333334 6 9 IKZF2 IKAROS family zinc finger 2 (Helios) 327 42 C20140709_OR011_01 C20140709_OR011_01 TB446930.[MT7]-ALDTTK[MT7].2y4_1.heavy 468.784 / 608.337 1098.0 18.960500717163086 48 18 10 10 10 18.13011883420332 5.515683648545386 0.0 3 0.9806874866361026 8.866281993623819 1098.0 9.32325443786982 0.0 - - - - - - - 241.14285714285714 2 7 IKZF2 IKAROS family zinc finger 2 (Helios) 329 42 C20140709_OR011_01 C20140709_OR011_01 TB446930.[MT7]-ALDTTK[MT7].2y5_1.heavy 468.784 / 721.421 2619.0 18.960500717163086 48 18 10 10 10 18.13011883420332 5.515683648545386 0.0 3 0.9806874866361026 8.866281993623819 2619.0 61.73357142857142 0.0 - - - - - - - 196.66666666666666 5 3 IKZF2 IKAROS family zinc finger 2 (Helios) 331 42 C20140709_OR011_01 C20140709_OR011_01 TB446930.[MT7]-ALDTTK[MT7].2y3_1.heavy 468.784 / 493.31 4647.0 18.960500717163086 48 18 10 10 10 18.13011883420332 5.515683648545386 0.0 3 0.9806874866361026 8.866281993623819 4647.0 22.614687596399225 0.0 - - - - - - - 207.1818181818182 9 11 IKZF2 IKAROS family zinc finger 2 (Helios) 333 43 C20140709_OR011_01 C20140709_OR011_01 TB447033.[MT7]-LTPLTVLLR.2y8_1.heavy 585.391 / 912.588 10315.0 46.302249908447266 44 18 10 6 10 6.047337853542019 16.5362019489995 0.0366973876953125 3 0.9830963706810613 9.47891703411996 10315.0 235.94080459770115 0.0 - - - - - - - 104.2 20 5 BRD1 bromodomain containing 1 335 43 C20140709_OR011_01 C20140709_OR011_01 TB447033.[MT7]-LTPLTVLLR.2y5_1.heavy 585.391 / 601.403 1040.0 46.302249908447266 44 18 10 6 10 6.047337853542019 16.5362019489995 0.0366973876953125 3 0.9830963706810613 9.47891703411996 1040.0 0.342668863261944 3.0 - - - - - - - 260.0769230769231 3 13 BRD1 bromodomain containing 1 337 43 C20140709_OR011_01 C20140709_OR011_01 TB447033.[MT7]-LTPLTVLLR.2y6_1.heavy 585.391 / 714.487 1127.0 46.302249908447266 44 18 10 6 10 6.047337853542019 16.5362019489995 0.0366973876953125 3 0.9830963706810613 9.47891703411996 1127.0 4.5601156069364155 1.0 - - - - - - - 173.5 2 10 BRD1 bromodomain containing 1 339 43 C20140709_OR011_01 C20140709_OR011_01 TB447033.[MT7]-LTPLTVLLR.2y7_1.heavy 585.391 / 811.54 14389.0 46.302249908447266 44 18 10 6 10 6.047337853542019 16.5362019489995 0.0366973876953125 3 0.9830963706810613 9.47891703411996 14389.0 114.32732706350372 0.0 - - - - - - - 208.0 28 5 BRD1 bromodomain containing 1 341 44 C20140709_OR011_01 C20140709_OR011_01 TB416522.[MT7]-QYVFER.2y4_1.heavy 493.265 / 550.298 2012.0 27.683624267578125 27 15 0 6 6 1.8627082769981809 44.810901564665734 0.038299560546875 6 0.9521001699085401 5.616249630691471 2012.0 19.93070292103837 2.0 - - - - - - - 211.2 25 10 CRYBB3 crystallin, beta B3 343 44 C20140709_OR011_01 C20140709_OR011_01 TB416522.[MT7]-QYVFER.2b3_1.heavy 493.265 / 535.3 1811.0 27.683624267578125 27 15 0 6 6 1.8627082769981809 44.810901564665734 0.038299560546875 6 0.9521001699085401 5.616249630691471 1811.0 4.423209761013533 2.0 - - - - - - - 201.22222222222223 5 9 CRYBB3 crystallin, beta B3 345 44 C20140709_OR011_01 C20140709_OR011_01 TB416522.[MT7]-QYVFER.2y5_1.heavy 493.265 / 713.362 3219.0 27.683624267578125 27 15 0 6 6 1.8627082769981809 44.810901564665734 0.038299560546875 6 0.9521001699085401 5.616249630691471 3219.0 21.80990099009901 1.0 - - - - - - - 158.28571428571428 6 7 CRYBB3 crystallin, beta B3 347 44 C20140709_OR011_01 C20140709_OR011_01 TB416522.[MT7]-QYVFER.2b4_1.heavy 493.265 / 682.368 905.0 27.683624267578125 27 15 0 6 6 1.8627082769981809 44.810901564665734 0.038299560546875 6 0.9521001699085401 5.616249630691471 905.0 9.547717362795883 0.0 - - - - - - - 0.0 1 0 CRYBB3 crystallin, beta B3 349 45 C20140709_OR011_01 C20140709_OR011_01 TB416662.[MT7]-DFVSC[CAM]WK[MT7].2b3_1.heavy 615.315 / 506.273 5719.0 33.75830078125 44 14 10 10 10 2.338382439560832 42.76460441551248 0.0 3 0.938416165137645 4.9473725153218036 5719.0 13.805365706302155 0.0 - - - - - - - 276.22222222222223 11 9 APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 351 45 C20140709_OR011_01 C20140709_OR011_01 TB416662.[MT7]-DFVSC[CAM]WK[MT7].2y4_1.heavy 615.315 / 724.357 6963.0 33.75830078125 44 14 10 10 10 2.338382439560832 42.76460441551248 0.0 3 0.938416165137645 4.9473725153218036 6963.0 28.755554992151296 0.0 - - - - - - - 316.3636363636364 13 11 APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 353 45 C20140709_OR011_01 C20140709_OR011_01 TB416662.[MT7]-DFVSC[CAM]WK[MT7].2y3_1.heavy 615.315 / 637.325 3854.0 33.75830078125 44 14 10 10 10 2.338382439560832 42.76460441551248 0.0 3 0.938416165137645 4.9473725153218036 3854.0 20.443300445241732 0.0 - - - - - - - 316.45454545454544 7 11 APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 355 45 C20140709_OR011_01 C20140709_OR011_01 TB416662.[MT7]-DFVSC[CAM]WK[MT7].2y6_1.heavy 615.315 / 970.494 4725.0 33.75830078125 44 14 10 10 10 2.338382439560832 42.76460441551248 0.0 3 0.938416165137645 4.9473725153218036 4725.0 37.60997385883772 1.0 - - - - - - - 248.66666666666666 9 9 APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 357 46 C20140709_OR011_01 C20140709_OR011_01 TB446936.[MT7]-TPYDASR.2b3_1.heavy 477.244 / 506.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 359 46 C20140709_OR011_01 C20140709_OR011_01 TB446936.[MT7]-TPYDASR.2y5_1.heavy 477.244 / 611.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 361 46 C20140709_OR011_01 C20140709_OR011_01 TB446936.[MT7]-TPYDASR.2b4_1.heavy 477.244 / 621.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 363 46 C20140709_OR011_01 C20140709_OR011_01 TB446936.[MT7]-TPYDASR.2y6_1.heavy 477.244 / 708.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 365 47 C20140709_OR011_01 C20140709_OR011_01 TB417037.[MT7]-NLHQSGFSLSGTQVDEGVR.3y6_1.heavy 725.702 / 674.347 4811.0 30.45430040359497 42 16 10 6 10 1.7558123187222692 38.34386172779123 0.03240013122558594 3 0.9602792971151385 6.171713860032956 4811.0 27.72440677966102 0.0 - - - - - - - 294.625 9 16 DPYSL3 dihydropyrimidinase-like 3 367 47 C20140709_OR011_01 C20140709_OR011_01 TB417037.[MT7]-NLHQSGFSLSGTQVDEGVR.3b3_1.heavy 725.702 / 509.295 5892.0 30.45430040359497 42 16 10 6 10 1.7558123187222692 38.34386172779123 0.03240013122558594 3 0.9602792971151385 6.171713860032956 5892.0 34.255102040816325 0.0 - - - - - - - 196.16666666666666 11 12 DPYSL3 dihydropyrimidinase-like 3 369 47 C20140709_OR011_01 C20140709_OR011_01 TB417037.[MT7]-NLHQSGFSLSGTQVDEGVR.3y10_1.heavy 725.702 / 1047.51 9328.0 30.45430040359497 42 16 10 6 10 1.7558123187222692 38.34386172779123 0.03240013122558594 3 0.9602792971151385 6.171713860032956 9328.0 47.567616970452306 0.0 - - - - - - - 239.88888888888889 18 9 DPYSL3 dihydropyrimidinase-like 3 371 47 C20140709_OR011_01 C20140709_OR011_01 TB417037.[MT7]-NLHQSGFSLSGTQVDEGVR.3y9_1.heavy 725.702 / 960.474 9525.0 30.45430040359497 42 16 10 6 10 1.7558123187222692 38.34386172779123 0.03240013122558594 3 0.9602792971151385 6.171713860032956 9525.0 39.27224390168064 0.0 - - - - - - - 238.5 19 14 DPYSL3 dihydropyrimidinase-like 3 373 48 C20140709_OR011_01 C20140709_OR011_01 TB417038.[MT7]-SNLLWDTGVFRGPVLPK[MT7].4y10_2.heavy 547.569 / 607.38 15376.0 42.972700119018555 41 16 10 5 10 3.0037703464857697 33.291493178562725 0.040798187255859375 3 0.9625558216737508 6.357782510676546 15376.0 86.71468226463577 0.0 - - - - - - - 228.1 30 10 APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 375 48 C20140709_OR011_01 C20140709_OR011_01 TB417038.[MT7]-SNLLWDTGVFRGPVLPK[MT7].4y12_2.heavy 547.569 / 715.418 9424.0 42.972700119018555 41 16 10 5 10 3.0037703464857697 33.291493178562725 0.040798187255859375 3 0.9625558216737508 6.357782510676546 9424.0 116.67079384448513 0.0 - - - - - - - 184.14285714285714 18 7 APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 377 48 C20140709_OR011_01 C20140709_OR011_01 TB417038.[MT7]-SNLLWDTGVFRGPVLPK[MT7].4y11_2.heavy 547.569 / 657.904 14186.0 42.972700119018555 41 16 10 5 10 3.0037703464857697 33.291493178562725 0.040798187255859375 3 0.9625558216737508 6.357782510676546 14186.0 89.20108732861759 0.0 - - - - - - - 238.0 28 5 APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 379 48 C20140709_OR011_01 C20140709_OR011_01 TB417038.[MT7]-SNLLWDTGVFRGPVLPK[MT7].4b4_1.heavy 547.569 / 572.352 16666.0 42.972700119018555 41 16 10 5 10 3.0037703464857697 33.291493178562725 0.040798187255859375 3 0.9625558216737508 6.357782510676546 16666.0 110.67789932885906 0.0 - - - - - - - 218.3 33 10 APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 381 49 C20140709_OR011_01 C20140709_OR011_01 TB446935.[MT7]-NLDVTSR.2b3_1.heavy 474.765 / 487.263 4869.0 21.171175003051758 43 17 10 6 10 2.2520096494975617 34.72219623645306 0.03730010986328125 3 0.9772994483703451 8.175591120597996 4869.0 64.28650526236086 0.0 - - - - - - - 255.45454545454547 9 11 DENND2C DENN/MADD domain containing 2C 383 49 C20140709_OR011_01 C20140709_OR011_01 TB446935.[MT7]-NLDVTSR.2y5_1.heavy 474.765 / 577.294 2715.0 21.171175003051758 43 17 10 6 10 2.2520096494975617 34.72219623645306 0.03730010986328125 3 0.9772994483703451 8.175591120597996 2715.0 12.989566631016043 0.0 - - - - - - - 206.1 5 10 DENND2C DENN/MADD domain containing 2C 385 49 C20140709_OR011_01 C20140709_OR011_01 TB446935.[MT7]-NLDVTSR.2b4_1.heavy 474.765 / 586.332 1217.0 21.171175003051758 43 17 10 6 10 2.2520096494975617 34.72219623645306 0.03730010986328125 3 0.9772994483703451 8.175591120597996 1217.0 19.025854363408804 0.0 - - - - - - - 160.71428571428572 2 7 DENND2C DENN/MADD domain containing 2C 387 49 C20140709_OR011_01 C20140709_OR011_01 TB446935.[MT7]-NLDVTSR.2y6_1.heavy 474.765 / 690.378 1685.0 21.171175003051758 43 17 10 6 10 2.2520096494975617 34.72219623645306 0.03730010986328125 3 0.9772994483703451 8.175591120597996 1685.0 13.686316059908272 0.0 - - - - - - - 212.8181818181818 3 11 DENND2C DENN/MADD domain containing 2C 389 50 C20140709_OR011_01 C20140709_OR011_01 TB416733.[MT7]-HLNPDTELK[MT7].2y4_1.heavy 677.882 / 634.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCF25 transcription factor 25 (basic helix-loop-helix) 391 50 C20140709_OR011_01 C20140709_OR011_01 TB416733.[MT7]-HLNPDTELK[MT7].2y8_1.heavy 677.882 / 1073.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCF25 transcription factor 25 (basic helix-loop-helix) 393 50 C20140709_OR011_01 C20140709_OR011_01 TB416733.[MT7]-HLNPDTELK[MT7].2y6_1.heavy 677.882 / 846.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCF25 transcription factor 25 (basic helix-loop-helix) 395 50 C20140709_OR011_01 C20140709_OR011_01 TB416733.[MT7]-HLNPDTELK[MT7].2y7_1.heavy 677.882 / 960.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCF25 transcription factor 25 (basic helix-loop-helix) 397 51 C20140709_OR011_01 C20140709_OR011_01 TB416939.[MT7]-LHLFENPAFSGRK[MT7].4y5_1.heavy 451.758 / 738.438 2682.0 33.11210060119629 39 14 10 5 10 2.4733376694024543 40.431195965312526 0.040401458740234375 3 0.9415333701568479 5.0788958598947005 2682.0 34.43380653681083 0.0 - - - - - - - 209.8 5 5 CRYBB3 crystallin, beta B3 399 51 C20140709_OR011_01 C20140709_OR011_01 TB416939.[MT7]-LHLFENPAFSGRK[MT7].4y6_1.heavy 451.758 / 809.475 1283.0 33.11210060119629 39 14 10 5 10 2.4733376694024543 40.431195965312526 0.040401458740234375 3 0.9415333701568479 5.0788958598947005 1283.0 21.931623931623932 0.0 - - - - - - - 466.0 2 1 CRYBB3 crystallin, beta B3 401 51 C20140709_OR011_01 C20140709_OR011_01 TB416939.[MT7]-LHLFENPAFSGRK[MT7].4y7_2.heavy 451.758 / 453.767 20174.0 33.11210060119629 39 14 10 5 10 2.4733376694024543 40.431195965312526 0.040401458740234375 3 0.9415333701568479 5.0788958598947005 20174.0 182.31051025588687 0.0 - - - - - - - 117.0 40 2 CRYBB3 crystallin, beta B3 403 51 C20140709_OR011_01 C20140709_OR011_01 TB416939.[MT7]-LHLFENPAFSGRK[MT7].4b3_1.heavy 451.758 / 508.336 7230.0 33.11210060119629 39 14 10 5 10 2.4733376694024543 40.431195965312526 0.040401458740234375 3 0.9415333701568479 5.0788958598947005 7230.0 35.990591803532126 0.0 - - - - - - - 330.3333333333333 14 6 CRYBB3 crystallin, beta B3 405 52 C20140709_OR011_01 C20140709_OR011_01 TB417034.[MT7]-AALAGGTTMIIDHVVPEPESSLTEAYEK[MT7].3b10_1.heavy 1073.22 / 1031.57 3914.0 41.5802001953125 39 11 10 10 8 2.089882580871097 41.10369196398864 0.0 4 0.8524124680700831 3.172089702582426 3914.0 13.656155720248742 0.0 - - - - - - - 237.875 7 8 DPYSL3 dihydropyrimidinase-like 3 407 52 C20140709_OR011_01 C20140709_OR011_01 TB417034.[MT7]-AALAGGTTMIIDHVVPEPESSLTEAYEK[MT7].3y4_1.heavy 1073.22 / 654.358 2572.0 41.5802001953125 39 11 10 10 8 2.089882580871097 41.10369196398864 0.0 4 0.8524124680700831 3.172089702582426 2572.0 8.766626762436818 0.0 - - - - - - - 196.0 5 4 DPYSL3 dihydropyrimidinase-like 3 409 52 C20140709_OR011_01 C20140709_OR011_01 TB417034.[MT7]-AALAGGTTMIIDHVVPEPESSLTEAYEK[MT7].3y8_1.heavy 1073.22 / 1084.56 783.0 41.5802001953125 39 11 10 10 8 2.089882580871097 41.10369196398864 0.0 4 0.8524124680700831 3.172089702582426 783.0 1.5055814721091427 4.0 - - - - - - - 0.0 1 0 DPYSL3 dihydropyrimidinase-like 3 411 52 C20140709_OR011_01 C20140709_OR011_01 TB417034.[MT7]-AALAGGTTMIIDHVVPEPESSLTEAYEK[MT7].3b8_1.heavy 1073.22 / 787.443 783.0 41.5802001953125 39 11 10 10 8 2.089882580871097 41.10369196398864 0.0 4 0.8524124680700831 3.172089702582426 783.0 1.2427028656547028 3.0 - - - - - - - 223.875 2 8 DPYSL3 dihydropyrimidinase-like 3 413 53 C20140709_OR011_01 C20140709_OR011_01 TB417137.[MT7]-AAPAAPPAARPGPRPPAGELGSIGDHER.4y8_1.heavy 715.633 / 870.406 1349.0 25.703674793243408 45 20 10 5 10 5.611078079247237 17.821887093293782 0.04369926452636719 3 0.9942080533205245 16.20840394917563 1349.0 15.566181909707504 0.0 - - - - - - - 240.71428571428572 2 7 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 415 53 C20140709_OR011_01 C20140709_OR011_01 TB417137.[MT7]-AAPAAPPAARPGPRPPAGELGSIGDHER.4y9_1.heavy 715.633 / 983.49 1236.0 25.703674793243408 45 20 10 5 10 5.611078079247237 17.821887093293782 0.04369926452636719 3 0.9942080533205245 16.20840394917563 1236.0 3.6676557863501484 0.0 - - - - - - - 269.8 2 10 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 417 53 C20140709_OR011_01 C20140709_OR011_01 TB417137.[MT7]-AAPAAPPAARPGPRPPAGELGSIGDHER.4b5_1.heavy 715.633 / 526.311 2361.0 25.703674793243408 45 20 10 5 10 5.611078079247237 17.821887093293782 0.04369926452636719 3 0.9942080533205245 16.20840394917563 2361.0 11.209495548961424 0.0 - - - - - - - 240.71428571428572 4 7 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 419 53 C20140709_OR011_01 C20140709_OR011_01 TB417137.[MT7]-AAPAAPPAARPGPRPPAGELGSIGDHER.4y18_2.heavy 715.633 / 921.466 1574.0 25.703674793243408 45 20 10 5 10 5.611078079247237 17.821887093293782 0.04369926452636719 3 0.9942080533205245 16.20840394917563 1574.0 3.7355754682680242 0.0 - - - - - - - 337.25 3 4 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 421 54 C20140709_OR011_01 C20140709_OR011_01 TB417035.[MT7]-NHQSAAEYNIFEGMELR.3y7_1.heavy 718.345 / 881.419 13929.0 39.83980178833008 43 13 10 10 10 2.3031682831080174 43.4184513278616 0.0 3 0.9250218098713735 4.478610061134143 13929.0 35.36340425531914 1.0 - - - - - - - 264.55555555555554 27 9 DPYSL3 dihydropyrimidinase-like 3 423 54 C20140709_OR011_01 C20140709_OR011_01 TB417035.[MT7]-NHQSAAEYNIFEGMELR.3b6_1.heavy 718.345 / 753.376 2886.0 39.83980178833008 43 13 10 10 10 2.3031682831080174 43.4184513278616 0.0 3 0.9250218098713735 4.478610061134143 2886.0 4.4152057374582006 1.0 - - - - - - - 214.85714285714286 6 7 DPYSL3 dihydropyrimidinase-like 3 425 54 C20140709_OR011_01 C20140709_OR011_01 TB417035.[MT7]-NHQSAAEYNIFEGMELR.3y6_1.heavy 718.345 / 734.35 7153.0 39.83980178833008 43 13 10 10 10 2.3031682831080174 43.4184513278616 0.0 3 0.9250218098713735 4.478610061134143 7153.0 30.991583665338645 0.0 - - - - - - - 301.0 14 5 DPYSL3 dihydropyrimidinase-like 3 427 54 C20140709_OR011_01 C20140709_OR011_01 TB417035.[MT7]-NHQSAAEYNIFEGMELR.3y5_1.heavy 718.345 / 605.308 12548.0 39.83980178833008 43 13 10 10 10 2.3031682831080174 43.4184513278616 0.0 3 0.9250218098713735 4.478610061134143 12548.0 18.665090634335602 0.0 - - - - - - - 669.0 25 9 DPYSL3 dihydropyrimidinase-like 3 429 55 C20140709_OR011_01 C20140709_OR011_01 TB416736.[MT7]-MIC[CAM]FNSVAK[MT7].3y3_1.heavy 453.245 / 461.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 431 55 C20140709_OR011_01 C20140709_OR011_01 TB416736.[MT7]-MIC[CAM]FNSVAK[MT7].3b4_1.heavy 453.245 / 696.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 433 55 C20140709_OR011_01 C20140709_OR011_01 TB416736.[MT7]-MIC[CAM]FNSVAK[MT7].3b5_1.heavy 453.245 / 810.376 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 435 55 C20140709_OR011_01 C20140709_OR011_01 TB416736.[MT7]-MIC[CAM]FNSVAK[MT7].3b3_1.heavy 453.245 / 549.265 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 437 56 C20140709_OR011_01 C20140709_OR011_01 TB416945.[MT7]-LSPISHGNTIALFFR.3b4_1.heavy 606.345 / 555.362 3138.0 42.408199310302734 46 18 10 10 8 10.352568491355493 9.65943862950543 0.0 4 0.9875088481841939 11.030825583351303 3138.0 19.556019068573526 1.0 - - - - - - - 213.44444444444446 6 9 TCF25 transcription factor 25 (basic helix-loop-helix) 439 56 C20140709_OR011_01 C20140709_OR011_01 TB416945.[MT7]-LSPISHGNTIALFFR.3y8_1.heavy 606.345 / 981.552 1620.0 42.408199310302734 46 18 10 10 8 10.352568491355493 9.65943862950543 0.0 4 0.9875088481841939 11.030825583351303 1620.0 1.2949007085121247 1.0 - - - - - - - 240.375 3 8 TCF25 transcription factor 25 (basic helix-loop-helix) 441 56 C20140709_OR011_01 C20140709_OR011_01 TB416945.[MT7]-LSPISHGNTIALFFR.3y5_1.heavy 606.345 / 653.377 5973.0 42.408199310302734 46 18 10 10 8 10.352568491355493 9.65943862950543 0.0 4 0.9875088481841939 11.030825583351303 5973.0 11.461372416753541 0.0 - - - - - - - 222.6 11 10 TCF25 transcription factor 25 (basic helix-loop-helix) 443 56 C20140709_OR011_01 C20140709_OR011_01 TB416945.[MT7]-LSPISHGNTIALFFR.3y9_1.heavy 606.345 / 1038.57 5973.0 42.408199310302734 46 18 10 10 8 10.352568491355493 9.65943862950543 0.0 4 0.9875088481841939 11.030825583351303 5973.0 22.251837705967045 0.0 - - - - - - - 202.33333333333334 11 12 TCF25 transcription factor 25 (basic helix-loop-helix) 445 57 C20140709_OR011_01 C20140709_OR011_01 TB589692.[MT7]-K[MT7]VEQLSR.2b3_1.heavy 574.355 / 645.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEBPB CCAAT/enhancer binding protein (C/EBP), beta 447 57 C20140709_OR011_01 C20140709_OR011_01 TB589692.[MT7]-K[MT7]VEQLSR.2y4_1.heavy 574.355 / 503.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEBPB CCAAT/enhancer binding protein (C/EBP), beta 449 57 C20140709_OR011_01 C20140709_OR011_01 TB589692.[MT7]-K[MT7]VEQLSR.2b4_1.heavy 574.355 / 773.476 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEBPB CCAAT/enhancer binding protein (C/EBP), beta 451 57 C20140709_OR011_01 C20140709_OR011_01 TB589692.[MT7]-K[MT7]VEQLSR.2y6_1.heavy 574.355 / 731.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEBPB CCAAT/enhancer binding protein (C/EBP), beta 453 58 C20140709_OR011_01 C20140709_OR011_01 TB589690.[MT7]-TQDLEGALR.2y8_1.heavy 573.815 / 901.474 9115.0 27.910400390625 41 18 10 5 8 4.244239833430023 23.561345240752818 0.04019927978515625 4 0.9854860791071177 10.231594370582078 9115.0 35.949588174870186 0.0 - - - - - - - 271.5 18 10 LZTS1 leucine zipper, putative tumor suppressor 1 455 58 C20140709_OR011_01 C20140709_OR011_01 TB589690.[MT7]-TQDLEGALR.2b6_1.heavy 573.815 / 788.391 8356.0 27.910400390625 41 18 10 5 8 4.244239833430023 23.561345240752818 0.04019927978515625 4 0.9854860791071177 10.231594370582078 8356.0 12.036160631994733 2.0 - - - - - - - 296.1818181818182 17 11 LZTS1 leucine zipper, putative tumor suppressor 1 457 58 C20140709_OR011_01 C20140709_OR011_01 TB589690.[MT7]-TQDLEGALR.2y6_1.heavy 573.815 / 658.388 14866.0 27.910400390625 41 18 10 5 8 4.244239833430023 23.561345240752818 0.04019927978515625 4 0.9854860791071177 10.231594370582078 14866.0 63.603259762308994 0.0 - - - - - - - 248.28571428571428 29 7 LZTS1 leucine zipper, putative tumor suppressor 1 459 58 C20140709_OR011_01 C20140709_OR011_01 TB589690.[MT7]-TQDLEGALR.2y7_1.heavy 573.815 / 773.415 4558.0 27.910400390625 41 18 10 5 8 4.244239833430023 23.561345240752818 0.04019927978515625 4 0.9854860791071177 10.231594370582078 4558.0 27.56629329111419 0.0 - - - - - - - 201.78571428571428 9 14 LZTS1 leucine zipper, putative tumor suppressor 1 461 59 C20140709_OR011_01 C20140709_OR011_01 TB416942.[MT7]-DSELYFLGTDTHK[MT7].3b6_1.heavy 605.312 / 899.427 6849.0 34.36130142211914 44 14 10 10 10 2.2537382157525947 35.76888011561642 0.0 3 0.949310924627986 5.458249656827563 6849.0 1.0219266110795855 1.0 - - - - - - - 193.66666666666666 17 6 HMGXB4 HMG box domain containing 4 463 59 C20140709_OR011_01 C20140709_OR011_01 TB416942.[MT7]-DSELYFLGTDTHK[MT7].3y6_1.heavy 605.312 / 802.417 12147.0 34.36130142211914 44 14 10 10 10 2.2537382157525947 35.76888011561642 0.0 3 0.949310924627986 5.458249656827563 12147.0 112.95345823399758 0.0 - - - - - - - 242.25 24 8 HMGXB4 HMG box domain containing 4 465 59 C20140709_OR011_01 C20140709_OR011_01 TB416942.[MT7]-DSELYFLGTDTHK[MT7].3b4_1.heavy 605.312 / 589.295 19384.0 34.36130142211914 44 14 10 10 10 2.2537382157525947 35.76888011561642 0.0 3 0.949310924627986 5.458249656827563 19384.0 57.198511942037044 0.0 - - - - - - - 284.2 38 10 HMGXB4 HMG box domain containing 4 467 59 C20140709_OR011_01 C20140709_OR011_01 TB416942.[MT7]-DSELYFLGTDTHK[MT7].3b5_1.heavy 605.312 / 752.358 20030.0 34.36130142211914 44 14 10 10 10 2.2537382157525947 35.76888011561642 0.0 3 0.949310924627986 5.458249656827563 20030.0 194.08914728682169 0.0 - - - - - - - 176.0 40 11 HMGXB4 HMG box domain containing 4 469 60 C20140709_OR011_01 C20140709_OR011_01 TB589602.[MT7]-EIALLR.2b3_1.heavy 429.78 / 458.273 103961.0 33.132301330566406 48 18 10 10 10 11.98490676172318 8.343827948614102 0.0 2 0.9894150755468539 11.9849068144881 103961.0 141.73584254426981 0.0 - - - - - - - 294.5 207 8 CDK8;CDK19;BRD1 cyclin-dependent kinase 8;cyclin-dependent kinase 19;bromodomain containing 1 471 60 C20140709_OR011_01 C20140709_OR011_01 TB589602.[MT7]-EIALLR.2y4_1.heavy 429.78 / 472.324 N/A 33.132301330566406 48 18 10 10 10 11.98490676172318 8.343827948614102 0.0 2 0.9894150755468539 11.9849068144881 496.0 3.927585412667946 5.0 - - - - - - - 260.4 10 10 CDK8;CDK19;BRD1 cyclin-dependent kinase 8;cyclin-dependent kinase 19;bromodomain containing 1 473 60 C20140709_OR011_01 C20140709_OR011_01 TB589602.[MT7]-EIALLR.2y5_1.heavy 429.78 / 585.408 N/A 33.132301330566406 48 18 10 10 10 11.98490676172318 8.343827948614102 0.0 2 0.9894150755468539 11.9849068144881 4094.0 8.423693724812896 1.0 - - - - - - - 272.8 8 5 CDK8;CDK19;BRD1 cyclin-dependent kinase 8;cyclin-dependent kinase 19;bromodomain containing 1 475 60 C20140709_OR011_01 C20140709_OR011_01 TB589602.[MT7]-EIALLR.2b4_1.heavy 429.78 / 571.357 51360.0 33.132301330566406 48 18 10 10 10 11.98490676172318 8.343827948614102 0.0 2 0.9894150755468539 11.9849068144881 51360.0 49.04687817518689 0.0 - - - - - - - 372.0 102 1 CDK8;CDK19;BRD1 cyclin-dependent kinase 8;cyclin-dependent kinase 19;bromodomain containing 1 477 61 C20140709_OR011_01 C20140709_OR011_01 TB416748.[MT7]-DASLVYDAVK[MT7].3y3_1.heavy 456.925 / 461.32 7659.0 31.40339994430542 25 8 10 3 4 0.7104279033574695 91.85503853348291 0.07439994812011719 7 0.7825427301694367 2.59699642547632 7659.0 33.3592 0.0 - - - - - - - 150.33333333333334 15 9 MAPK8IP2 mitogen-activated protein kinase 8 interacting protein 2 479 61 C20140709_OR011_01 C20140709_OR011_01 TB416748.[MT7]-DASLVYDAVK[MT7].3b4_1.heavy 456.925 / 531.289 10925.0 31.40339994430542 25 8 10 3 4 0.7104279033574695 91.85503853348291 0.07439994812011719 7 0.7825427301694367 2.59699642547632 10925.0 29.43455462761826 0.0 - - - - - - - 236.7 21 10 MAPK8IP2 mitogen-activated protein kinase 8 interacting protein 2 481 61 C20140709_OR011_01 C20140709_OR011_01 TB416748.[MT7]-DASLVYDAVK[MT7].3y4_1.heavy 456.925 / 576.347 113.0 31.40339994430542 25 8 10 3 4 0.7104279033574695 91.85503853348291 0.07439994812011719 7 0.7825427301694367 2.59699642547632 113.0 -0.36627218934911243 30.0 - - - - - - - 225.22222222222223 2 9 MAPK8IP2 mitogen-activated protein kinase 8 interacting protein 2 483 61 C20140709_OR011_01 C20140709_OR011_01 TB416748.[MT7]-DASLVYDAVK[MT7].3b8_2.heavy 456.925 / 490.246 563.0 31.40339994430542 25 8 10 3 4 0.7104279033574695 91.85503853348291 0.07439994812011719 7 0.7825427301694367 2.59699642547632 563.0 3.0711905011258316 15.0 - - - - - - - 305.85714285714283 8 7 MAPK8IP2 mitogen-activated protein kinase 8 interacting protein 2 485 62 C20140709_OR011_01 C20140709_OR011_01 TB416451.[MT7]-LMLAVR.2b3_1.heavy 423.771 / 502.318 3682.0 35.15959930419922 47 17 10 10 10 3.9044856820135627 25.611567859157702 0.0 3 0.9731502126942305 7.514764925882768 3682.0 43.29057352941176 0.0 - - - - - - - 170.25 7 4 TCF25;CASKIN1 transcription factor 25 (basic helix-loop-helix);CASK interacting protein 1 487 62 C20140709_OR011_01 C20140709_OR011_01 TB416451.[MT7]-LMLAVR.2y4_1.heavy 423.771 / 458.309 3273.0 35.15959930419922 47 17 10 10 10 3.9044856820135627 25.611567859157702 0.0 3 0.9731502126942305 7.514764925882768 3273.0 27.956434227537166 0.0 - - - - - - - 181.66666666666666 6 3 TCF25;CASKIN1 transcription factor 25 (basic helix-loop-helix);CASK interacting protein 1 489 62 C20140709_OR011_01 C20140709_OR011_01 TB416451.[MT7]-LMLAVR.2y5_1.heavy 423.771 / 589.349 6410.0 35.15959930419922 47 17 10 10 10 3.9044856820135627 25.611567859157702 0.0 3 0.9731502126942305 7.514764925882768 6410.0 30.535291114753218 0.0 - - - - - - - 272.6666666666667 12 6 TCF25;CASKIN1 transcription factor 25 (basic helix-loop-helix);CASK interacting protein 1 491 62 C20140709_OR011_01 C20140709_OR011_01 TB416451.[MT7]-LMLAVR.2y3_1.heavy 423.771 / 345.224 818.0 35.15959930419922 47 17 10 10 10 3.9044856820135627 25.611567859157702 0.0 3 0.9731502126942305 7.514764925882768 818.0 -0.321263071009353 3.0 - - - - - - - 340.75 2 4 TCF25;CASKIN1 transcription factor 25 (basic helix-loop-helix);CASK interacting protein 1 493 63 C20140709_OR011_01 C20140709_OR011_01 TB589698.[MT7]-NLETQHK[MT7].2y4_1.heavy 579.329 / 657.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEBPB CCAAT/enhancer binding protein (C/EBP), beta 495 63 C20140709_OR011_01 C20140709_OR011_01 TB589698.[MT7]-NLETQHK[MT7].2b3_1.heavy 579.329 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEBPB CCAAT/enhancer binding protein (C/EBP), beta 497 63 C20140709_OR011_01 C20140709_OR011_01 TB589698.[MT7]-NLETQHK[MT7].2y5_1.heavy 579.329 / 786.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEBPB CCAAT/enhancer binding protein (C/EBP), beta 499 63 C20140709_OR011_01 C20140709_OR011_01 TB589698.[MT7]-NLETQHK[MT7].2y6_1.heavy 579.329 / 899.507 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEBPB CCAAT/enhancer binding protein (C/EBP), beta 501 64 C20140709_OR011_01 C20140709_OR011_01 TB446940.[MT7]-EALSQLR.2y4_1.heavy 480.783 / 503.294 3863.0 25.670900344848633 48 20 10 10 8 3.594132991642859 20.67671933702274 0.0 4 0.9934255903992247 15.212331037115879 3863.0 19.409080091251003 1.0 - - - - - - - 303.375 13 8 SCAND3;ZKSCAN5;ZSCAN21;ZNF232 SCAN domain containing 3;zinc finger with KRAB and SCAN domains 5;zinc finger and SCAN domain containing 21;zinc finger protein 232 503 64 C20140709_OR011_01 C20140709_OR011_01 TB446940.[MT7]-EALSQLR.2y5_1.heavy 480.783 / 616.378 4856.0 25.670900344848633 48 20 10 10 8 3.594132991642859 20.67671933702274 0.0 4 0.9934255903992247 15.212331037115879 4856.0 34.298225861574004 0.0 - - - - - - - 200.63636363636363 9 11 SCAND3;ZKSCAN5;ZSCAN21;ZNF232 SCAN domain containing 3;zinc finger with KRAB and SCAN domains 5;zinc finger and SCAN domain containing 21;zinc finger protein 232 505 64 C20140709_OR011_01 C20140709_OR011_01 TB446940.[MT7]-EALSQLR.2b4_1.heavy 480.783 / 545.305 3200.0 25.670900344848633 48 20 10 10 8 3.594132991642859 20.67671933702274 0.0 4 0.9934255903992247 15.212331037115879 3200.0 18.64894259818731 0.0 - - - - - - - 257.5 6 6 SCAND3;ZKSCAN5;ZSCAN21;ZNF232 SCAN domain containing 3;zinc finger with KRAB and SCAN domains 5;zinc finger and SCAN domain containing 21;zinc finger protein 232 507 64 C20140709_OR011_01 C20140709_OR011_01 TB446940.[MT7]-EALSQLR.2y6_1.heavy 480.783 / 687.415 22072.0 25.670900344848633 48 20 10 10 8 3.594132991642859 20.67671933702274 0.0 4 0.9934255903992247 15.212331037115879 22072.0 257.40074043603454 0.0 - - - - - - - 289.625 44 8 SCAND3;ZKSCAN5;ZSCAN21;ZNF232 SCAN domain containing 3;zinc finger with KRAB and SCAN domains 5;zinc finger and SCAN domain containing 21;zinc finger protein 232 509 65 C20140709_OR011_01 C20140709_OR011_01 TB447123.[MT7]-EDDVSFLMK[MT7].2b3_1.heavy 686.357 / 504.206 9717.0 36.208099365234375 48 20 10 10 8 4.8024668925253975 15.552823090442844 0.0 4 0.9906849092852862 12.777065579711183 9717.0 55.833233090753424 0.0 - - - - - - - 192.0 19 2 TRIM35 tripartite motif-containing 35 511 65 C20140709_OR011_01 C20140709_OR011_01 TB447123.[MT7]-EDDVSFLMK[MT7].2y5_1.heavy 686.357 / 769.44 2046.0 36.208099365234375 48 20 10 10 8 4.8024668925253975 15.552823090442844 0.0 4 0.9906849092852862 12.777065579711183 2046.0 17.37295245273794 0.0 - - - - - - - 256.0 4 4 TRIM35 tripartite motif-containing 35 513 65 C20140709_OR011_01 C20140709_OR011_01 TB447123.[MT7]-EDDVSFLMK[MT7].2b4_1.heavy 686.357 / 603.274 2685.0 36.208099365234375 48 20 10 10 8 4.8024668925253975 15.552823090442844 0.0 4 0.9906849092852862 12.777065579711183 2685.0 1.5252281616688395 1.0 - - - - - - - 256.0 5 5 TRIM35 tripartite motif-containing 35 515 65 C20140709_OR011_01 C20140709_OR011_01 TB447123.[MT7]-EDDVSFLMK[MT7].2b5_1.heavy 686.357 / 690.306 1151.0 36.208099365234375 48 20 10 10 8 4.8024668925253975 15.552823090442844 0.0 4 0.9906849092852862 12.777065579711183 1151.0 4.1876466480446926 2.0 - - - - - - - 298.6666666666667 3 6 TRIM35 tripartite motif-containing 35 517 66 C20140709_OR011_01 C20140709_OR011_01 TB447022.[MT7]-DRASPADLR.2y5_1.heavy 572.813 / 571.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM35 tripartite motif-containing 35 519 66 C20140709_OR011_01 C20140709_OR011_01 TB447022.[MT7]-DRASPADLR.2b6_1.heavy 572.813 / 742.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM35 tripartite motif-containing 35 521 66 C20140709_OR011_01 C20140709_OR011_01 TB447022.[MT7]-DRASPADLR.2b7_1.heavy 572.813 / 857.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM35 tripartite motif-containing 35 523 66 C20140709_OR011_01 C20140709_OR011_01 TB447022.[MT7]-DRASPADLR.2y7_1.heavy 572.813 / 729.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM35 tripartite motif-containing 35 525 67 C20140709_OR011_01 C20140709_OR011_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 146274.0 18.960500717163086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 146274.0 667.9528821777062 0.0 - - - - - - - 169.6 292 10 527 67 C20140709_OR011_01 C20140709_OR011_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 98230.0 18.960500717163086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 98230.0 1216.4901142479464 0.0 - - - - - - - 219.1818181818182 196 11 529 67 C20140709_OR011_01 C20140709_OR011_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 86443.0 18.960500717163086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 86443.0 367.90858538191395 0.0 - - - - - - - 204.14285714285714 172 7 531 68 C20140709_OR011_01 C20140709_OR011_01 TB446949.[MT7]-GLQTNFR.2y4_1.heavy 490.276 / 537.278 5518.0 25.75749969482422 45 15 10 10 10 1.9759429126974786 36.55778581806563 0.0 3 0.9569457703581674 5.926302648484129 5518.0 38.557582261349815 0.0 - - - - - - - 220.8 11 5 APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 533 68 C20140709_OR011_01 C20140709_OR011_01 TB446949.[MT7]-GLQTNFR.2y5_1.heavy 490.276 / 665.337 4856.0 25.75749969482422 45 15 10 10 10 1.9759429126974786 36.55778581806563 0.0 3 0.9569457703581674 5.926302648484129 4856.0 50.966660807470475 0.0 - - - - - - - 165.5 9 4 APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 535 68 C20140709_OR011_01 C20140709_OR011_01 TB446949.[MT7]-GLQTNFR.2y6_1.heavy 490.276 / 778.421 4414.0 25.75749969482422 45 15 10 10 10 1.9759429126974786 36.55778581806563 0.0 3 0.9569457703581674 5.926302648484129 4414.0 47.7223768115942 0.0 - - - - - - - 220.5 8 2 APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 537 68 C20140709_OR011_01 C20140709_OR011_01 TB446949.[MT7]-GLQTNFR.2b5_1.heavy 490.276 / 658.364 2759.0 25.75749969482422 45 15 10 10 10 1.9759429126974786 36.55778581806563 0.0 3 0.9569457703581674 5.926302648484129 2759.0 7.496082137462237 1.0 - - - - - - - 220.6 6 5 APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 539 69 C20140709_OR011_01 C20140709_OR011_01 TB417120.[MT7]-LREFLRVEEQAILDAMAEETR.3b14_2.heavy 888.47 / 929.021 3991.0 50.74600028991699 42 16 10 6 10 2.87224436167153 27.577088011106156 0.033199310302734375 3 0.9688286540397505 6.971880917400643 3991.0 25.345191166321605 0.0 - - - - - - - 118.57894736842105 7 19 TRIM35 tripartite motif-containing 35 541 69 C20140709_OR011_01 C20140709_OR011_01 TB417120.[MT7]-LREFLRVEEQAILDAMAEETR.3y7_1.heavy 888.47 / 807.367 3637.0 50.74600028991699 42 16 10 6 10 2.87224436167153 27.577088011106156 0.033199310302734375 3 0.9688286540397505 6.971880917400643 3637.0 56.74974137931035 0.0 - - - - - - - 146.61111111111111 7 18 TRIM35 tripartite motif-containing 35 543 69 C20140709_OR011_01 C20140709_OR011_01 TB417120.[MT7]-LREFLRVEEQAILDAMAEETR.3y8_1.heavy 888.47 / 922.393 1352.0 50.74600028991699 42 16 10 6 10 2.87224436167153 27.577088011106156 0.033199310302734375 3 0.9688286540397505 6.971880917400643 1352.0 26.33255813953489 0.0 - - - - - - - 126.0 2 12 TRIM35 tripartite motif-containing 35 545 69 C20140709_OR011_01 C20140709_OR011_01 TB417120.[MT7]-LREFLRVEEQAILDAMAEETR.3y9_1.heavy 888.47 / 1035.48 2639.0 50.74600028991699 42 16 10 6 10 2.87224436167153 27.577088011106156 0.033199310302734375 3 0.9688286540397505 6.971880917400643 2639.0 5.218361581920904 0.0 - - - - - - - 188.52380952380952 5 21 TRIM35 tripartite motif-containing 35 547 70 C20140709_OR011_01 C20140709_OR011_01 TB416651.[MT7]-IFTC[CAM]GSDLR.2y8_1.heavy 606.812 / 955.43 27652.0 31.139925479888916 38 12 10 6 10 1.0984063945594285 59.55243161192406 0.03429985046386719 3 0.8979223754171618 3.829407919428052 27652.0 137.66232017574941 0.0 - - - - - - - 690.2857142857143 55 7 ZFP30 zinc finger protein 30 homolog (mouse) 549 70 C20140709_OR011_01 C20140709_OR011_01 TB416651.[MT7]-IFTC[CAM]GSDLR.2y6_1.heavy 606.812 / 707.314 5140.0 31.139925479888916 38 12 10 6 10 1.0984063945594285 59.55243161192406 0.03429985046386719 3 0.8979223754171618 3.829407919428052 5140.0 6.370642978003383 1.0 - - - - - - - 732.375 10 8 ZFP30 zinc finger protein 30 homolog (mouse) 551 70 C20140709_OR011_01 C20140709_OR011_01 TB416651.[MT7]-IFTC[CAM]GSDLR.2b7_1.heavy 606.812 / 925.421 24362.0 31.139925479888916 38 12 10 6 10 1.0984063945594285 59.55243161192406 0.03429985046386719 3 0.8979223754171618 3.829407919428052 24362.0 253.92816478104203 0.0 - - - - - - - 220.42857142857142 48 7 ZFP30 zinc finger protein 30 homolog (mouse) 553 70 C20140709_OR011_01 C20140709_OR011_01 TB416651.[MT7]-IFTC[CAM]GSDLR.2y7_1.heavy 606.812 / 808.362 7504.0 31.139925479888916 38 12 10 6 10 1.0984063945594285 59.55243161192406 0.03429985046386719 3 0.8979223754171618 3.829407919428052 7504.0 26.542433090024332 0.0 - - - - - - - 222.83333333333334 15 12 ZFP30 zinc finger protein 30 homolog (mouse) 555 71 C20140709_OR011_01 C20140709_OR011_01 TB416515.[MT7]-LAPFLK[MT7].2y4_1.heavy 488.825 / 648.42 9931.0 36.41242504119873 43 18 10 5 10 6.018138879615936 16.61643275443683 0.047298431396484375 3 0.9813139703713534 9.014159834215095 9931.0 80.81107843137254 0.0 - - - - - - - 181.33333333333334 19 3 FGD4;FGD2;FGD1;FGD3 FYVE, RhoGEF and PH domain containing 4;FYVE, RhoGEF and PH domain containing 2;FYVE, RhoGEF and PH domain containing 1;FYVE, RhoGEF and PH domain containing 3 557 71 C20140709_OR011_01 C20140709_OR011_01 TB416515.[MT7]-LAPFLK[MT7].2y5_1.heavy 488.825 / 719.457 2993.0 36.41242504119873 43 18 10 5 10 6.018138879615936 16.61643275443683 0.047298431396484375 3 0.9813139703713534 9.014159834215095 2993.0 26.848970588235296 0.0 - - - - - - - 226.66666666666666 5 3 FGD4;FGD2;FGD1;FGD3 FYVE, RhoGEF and PH domain containing 4;FYVE, RhoGEF and PH domain containing 2;FYVE, RhoGEF and PH domain containing 1;FYVE, RhoGEF and PH domain containing 3 559 71 C20140709_OR011_01 C20140709_OR011_01 TB416515.[MT7]-LAPFLK[MT7].2b4_1.heavy 488.825 / 573.352 952.0 36.41242504119873 43 18 10 5 10 6.018138879615936 16.61643275443683 0.047298431396484375 3 0.9813139703713534 9.014159834215095 952.0 10.465 1.0 - - - - - - - 136.0 10 1 FGD4;FGD2;FGD1;FGD3 FYVE, RhoGEF and PH domain containing 4;FYVE, RhoGEF and PH domain containing 2;FYVE, RhoGEF and PH domain containing 1;FYVE, RhoGEF and PH domain containing 3 561 71 C20140709_OR011_01 C20140709_OR011_01 TB416515.[MT7]-LAPFLK[MT7].2y3_1.heavy 488.825 / 551.367 1632.0 36.41242504119873 43 18 10 5 10 6.018138879615936 16.61643275443683 0.047298431396484375 3 0.9813139703713534 9.014159834215095 1632.0 13.44 0.0 - - - - - - - 326.4 3 5 FGD4;FGD2;FGD1;FGD3 FYVE, RhoGEF and PH domain containing 4;FYVE, RhoGEF and PH domain containing 2;FYVE, RhoGEF and PH domain containing 1;FYVE, RhoGEF and PH domain containing 3 563 72 C20140709_OR011_01 C20140709_OR011_01 TB417024.[MT7]-EEAGAPGGGAGMAAGFPYALR.3y7_1.heavy 698.678 / 823.446 7069.0 38.420400619506836 30 14 9 5 2 2.424241029943934 41.2500237248739 0.04199981689453125 12 0.9493508603865506 5.4604196061049795 7069.0 17.547409095920617 0.0 - - - - - - - 266.625 14 8 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 565 72 C20140709_OR011_01 C20140709_OR011_01 TB417024.[MT7]-EEAGAPGGGAGMAAGFPYALR.3y8_1.heavy 698.678 / 894.483 3735.0 38.420400619506836 30 14 9 5 2 2.424241029943934 41.2500237248739 0.04199981689453125 12 0.9493508603865506 5.4604196061049795 3735.0 2.0469865040516546 1.0 - - - - - - - 288.8333333333333 8 6 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 567 72 C20140709_OR011_01 C20140709_OR011_01 TB417024.[MT7]-EEAGAPGGGAGMAAGFPYALR.3b4_1.heavy 698.678 / 531.253 5735.0 38.420400619506836 30 14 9 5 2 2.424241029943934 41.2500237248739 0.04199981689453125 12 0.9493508603865506 5.4604196061049795 5735.0 9.455995717344752 0.0 - - - - - - - 266.61538461538464 11 13 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 569 72 C20140709_OR011_01 C20140709_OR011_01 TB417024.[MT7]-EEAGAPGGGAGMAAGFPYALR.3b5_1.heavy 698.678 / 602.29 9737.0 38.420400619506836 30 14 9 5 2 2.424241029943934 41.2500237248739 0.04199981689453125 12 0.9493508603865506 5.4604196061049795 9737.0 17.86511606480288 1.0 - - - - - - - 266.6666666666667 21 3 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 571 73 C20140709_OR011_01 C20140709_OR011_01 TB417128.[MT7]-NLVSLGFVISNPDLVTC[CAM]LEQIK[MT7].4b8_1.heavy 687.637 / 974.579 1555.0 52.28569984436035 45 18 10 7 10 4.112136224699281 24.31826051854908 0.026798248291015625 3 0.9822932352856082 9.26082850442555 1555.0 23.592156862745096 1.0 - - - - - - - 89.78260869565217 3 23 ZNF595 zinc finger protein 595 573 73 C20140709_OR011_01 C20140709_OR011_01 TB417128.[MT7]-NLVSLGFVISNPDLVTC[CAM]LEQIK[MT7].4b7_1.heavy 687.637 / 875.511 2222.0 52.28569984436035 45 18 10 7 10 4.112136224699281 24.31826051854908 0.026798248291015625 3 0.9822932352856082 9.26082850442555 2222.0 46.30325406758448 0.0 - - - - - - - 91.66666666666667 4 27 ZNF595 zinc finger protein 595 575 73 C20140709_OR011_01 C20140709_OR011_01 TB417128.[MT7]-NLVSLGFVISNPDLVTC[CAM]LEQIK[MT7].4b4_1.heavy 687.637 / 558.337 1435.0 52.28569984436035 45 18 10 7 10 4.112136224699281 24.31826051854908 0.026798248291015625 3 0.9822932352856082 9.26082850442555 1435.0 5.179436113714464 0.0 - - - - - - - 114.09677419354838 2 31 ZNF595 zinc finger protein 595 577 73 C20140709_OR011_01 C20140709_OR011_01 TB417128.[MT7]-NLVSLGFVISNPDLVTC[CAM]LEQIK[MT7].4b6_1.heavy 687.637 / 728.442 3144.0 52.28569984436035 45 18 10 7 10 4.112136224699281 24.31826051854908 0.026798248291015625 3 0.9822932352856082 9.26082850442555 3144.0 54.05634130575307 0.0 - - - - - - - 81.82758620689656 6 29 ZNF595 zinc finger protein 595 579 74 C20140709_OR011_01 C20140709_OR011_01 TB589805.[MT7]-AEPGFEPADC[CAM]K[MT7].2y5_1.heavy 754.868 / 734.362 2002.0 25.133249759674072 35 10 10 5 10 0.9720893415255379 74.22080630042865 0.04459953308105469 3 0.8379262756984303 3.023137551230945 2002.0 14.891879754005503 0.0 - - - - - - - 222.4 4 5 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 581 74 C20140709_OR011_01 C20140709_OR011_01 TB589805.[MT7]-AEPGFEPADC[CAM]K[MT7].2y9_1.heavy 754.868 / 1164.55 2558.0 25.133249759674072 35 10 10 5 10 0.9720893415255379 74.22080630042865 0.04459953308105469 3 0.8379262756984303 3.023137551230945 2558.0 33.41531531531532 0.0 - - - - - - - 200.0 5 5 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 583 74 C20140709_OR011_01 C20140709_OR011_01 TB589805.[MT7]-AEPGFEPADC[CAM]K[MT7].2b6_1.heavy 754.868 / 775.374 1780.0 25.133249759674072 35 10 10 5 10 0.9720893415255379 74.22080630042865 0.04459953308105469 3 0.8379262756984303 3.023137551230945 1780.0 23.244234234234234 0.0 - - - - - - - 222.25 3 4 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 585 74 C20140709_OR011_01 C20140709_OR011_01 TB589805.[MT7]-AEPGFEPADC[CAM]K[MT7].2y3_1.heavy 754.868 / 566.273 556.0 25.133249759674072 35 10 10 5 10 0.9720893415255379 74.22080630042865 0.04459953308105469 3 0.8379262756984303 3.023137551230945 556.0 0.4578779519612459 3.0 - - - - - - - 0.0 1 0 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 587 75 C20140709_OR011_01 C20140709_OR011_01 TB417125.[MT7]-VLSGAWVGFEHAGFQGQQYILER.3b6_1.heavy 912.805 / 758.432 10086.0 43.95199966430664 47 17 10 10 10 8.487393542774647 11.7821801824107 0.0 3 0.9789402903809881 8.48928363887345 10086.0 45.702187499999994 0.0 - - - - - - - 264.0 20 12 CRYBA4 crystallin, beta A4 589 75 C20140709_OR011_01 C20140709_OR011_01 TB417125.[MT7]-VLSGAWVGFEHAGFQGQQYILER.3b4_1.heavy 912.805 / 501.315 4995.0 43.95199966430664 47 17 10 10 10 8.487393542774647 11.7821801824107 0.0 3 0.9789402903809881 8.48928363887345 4995.0 34.080468749999994 0.0 - - - - - - - 234.0 9 16 CRYBA4 crystallin, beta A4 591 75 C20140709_OR011_01 C20140709_OR011_01 TB417125.[MT7]-VLSGAWVGFEHAGFQGQQYILER.3b5_1.heavy 912.805 / 572.352 19499.0 43.95199966430664 47 17 10 10 10 8.487393542774647 11.7821801824107 0.0 3 0.9789402903809881 8.48928363887345 19499.0 74.86223214285715 0.0 - - - - - - - 192.0 38 10 CRYBA4 crystallin, beta A4 593 75 C20140709_OR011_01 C20140709_OR011_01 TB417125.[MT7]-VLSGAWVGFEHAGFQGQQYILER.3y8_1.heavy 912.805 / 1006.53 9029.0 43.95199966430664 47 17 10 10 10 8.487393542774647 11.7821801824107 0.0 3 0.9789402903809881 8.48928363887345 9029.0 44.20447916666666 0.0 - - - - - - - 256.0 18 12 CRYBA4 crystallin, beta A4 595 76 C20140709_OR011_01 C20140709_OR011_01 TB417126.[MT7]-GNVVFGEPITASLGIDGTHYWSK[MT7].4y4_1.heavy 684.861 / 727.39 3810.0 42.85045051574707 40 15 10 5 10 3.0020124646440465 33.31098760506218 0.040699005126953125 3 0.959467995747646 6.109214924936871 3810.0 16.670291262135922 0.0 - - - - - - - 297.55555555555554 7 9 DPYSL3 dihydropyrimidinase-like 3 597 76 C20140709_OR011_01 C20140709_OR011_01 TB417126.[MT7]-GNVVFGEPITASLGIDGTHYWSK[MT7].4b7_1.heavy 684.861 / 847.443 6178.0 42.85045051574707 40 15 10 5 10 3.0020124646440465 33.31098760506218 0.040699005126953125 3 0.959467995747646 6.109214924936871 6178.0 51.58330097087379 0.0 - - - - - - - 248.91666666666666 12 12 DPYSL3 dihydropyrimidinase-like 3 599 76 C20140709_OR011_01 C20140709_OR011_01 TB417126.[MT7]-GNVVFGEPITASLGIDGTHYWSK[MT7].4b4_1.heavy 684.861 / 514.311 12768.0 42.85045051574707 40 15 10 5 10 3.0020124646440465 33.31098760506218 0.040699005126953125 3 0.959467995747646 6.109214924936871 12768.0 51.96452038834951 0.0 - - - - - - - 309.0 25 13 DPYSL3 dihydropyrimidinase-like 3 601 76 C20140709_OR011_01 C20140709_OR011_01 TB417126.[MT7]-GNVVFGEPITASLGIDGTHYWSK[MT7].4y3_1.heavy 684.861 / 564.326 4222.0 42.85045051574707 40 15 10 5 10 3.0020124646440465 33.31098760506218 0.040699005126953125 3 0.959467995747646 6.109214924936871 4222.0 46.07308737864077 0.0 - - - - - - - 183.92857142857142 8 14 DPYSL3 dihydropyrimidinase-like 3 603 77 C20140709_OR011_01 C20140709_OR011_01 TB416742.[MT7]-VSELTERLK[MT7].3b4_1.heavy 454.945 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 605 77 C20140709_OR011_01 C20140709_OR011_01 TB416742.[MT7]-VSELTERLK[MT7].3b3_1.heavy 454.945 / 460.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 607 77 C20140709_OR011_01 C20140709_OR011_01 TB416742.[MT7]-VSELTERLK[MT7].3y8_1.heavy 454.945 / 1119.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 609 77 C20140709_OR011_01 C20140709_OR011_01 TB416742.[MT7]-VSELTERLK[MT7].3y5_1.heavy 454.945 / 790.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 611 78 C20140709_OR011_01 C20140709_OR011_01 TB416654.[MT7]-STVLNEHK[MT7].3y3_1.heavy 405.903 / 557.316 2427.0 19.149599075317383 47 17 10 10 10 11.83822128132803 8.44721496782005 0.0 3 0.9772289412433791 8.1628757036262 2427.0 20.899166666666666 0.0 - - - - - - - 193.84615384615384 4 13 ZNF595 zinc finger protein 595 613 78 C20140709_OR011_01 C20140709_OR011_01 TB416654.[MT7]-STVLNEHK[MT7].3b4_1.heavy 405.903 / 545.341 4315.0 19.149599075317383 47 17 10 10 10 11.83822128132803 8.44721496782005 0.0 3 0.9772289412433791 8.1628757036262 4315.0 62.088055555555556 0.0 - - - - - - - 150.0 8 6 ZNF595 zinc finger protein 595 615 78 C20140709_OR011_01 C20140709_OR011_01 TB416654.[MT7]-STVLNEHK[MT7].3b5_1.heavy 405.903 / 659.385 1888.0 19.149599075317383 47 17 10 10 10 11.83822128132803 8.44721496782005 0.0 3 0.9772289412433791 8.1628757036262 1888.0 39.85777777777778 0.0 - - - - - - - 292.5 3 4 ZNF595 zinc finger protein 595 617 78 C20140709_OR011_01 C20140709_OR011_01 TB416654.[MT7]-STVLNEHK[MT7].3b3_1.heavy 405.903 / 432.258 11687.0 19.149599075317383 47 17 10 10 10 11.83822128132803 8.44721496782005 0.0 3 0.9772289412433791 8.1628757036262 11687.0 40.9045 0.0 - - - - - - - 371.25 23 8 ZNF595 zinc finger protein 595 619 79 C20140709_OR011_01 C20140709_OR011_01 TB416946.[MT7]-VLELTAENERLQK[MT7].3y10_2.heavy 611.022 / 673.381 11157.0 31.25510025024414 39 9 10 10 10 1.2475240776353194 51.958378723782985 0.0 3 0.8171781503579502 2.8411758784818493 11157.0 26.62024811359118 0.0 - - - - - - - 565.75 22 8 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 621 79 C20140709_OR011_01 C20140709_OR011_01 TB416946.[MT7]-VLELTAENERLQK[MT7].3y8_1.heavy 611.022 / 1131.62 4021.0 31.25510025024414 39 9 10 10 10 1.2475240776353194 51.958378723782985 0.0 3 0.8171781503579502 2.8411758784818493 4021.0 40.51715789128582 0.0 - - - - - - - 251.625 8 8 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 623 79 C20140709_OR011_01 C20140709_OR011_01 TB416946.[MT7]-VLELTAENERLQK[MT7].3y12_2.heavy 611.022 / 794.445 15580.0 31.25510025024414 39 9 10 10 10 1.2475240776353194 51.958378723782985 0.0 3 0.8171781503579502 2.8411758784818493 15580.0 54.79754375900484 0.0 - - - - - - - 231.5 31 10 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 625 79 C20140709_OR011_01 C20140709_OR011_01 TB416946.[MT7]-VLELTAENERLQK[MT7].3y9_1.heavy 611.022 / 1232.67 402.0 31.25510025024414 39 9 10 10 10 1.2475240776353194 51.958378723782985 0.0 3 0.8171781503579502 2.8411758784818493 402.0 3.9483564356435643 3.0 - - - - - - - 0.0 0 0 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 627 80 C20140709_OR011_01 C20140709_OR011_01 TB416741.[MT7]-LHSSLIQHQR.3y6_1.heavy 454.929 / 794.463 389.0 20.444000244140625 41 17 10 6 8 2.3624077201332705 33.21413215552596 0.03839874267578125 4 0.9728299828119364 7.470147246136768 389.0 3.598995506212001 1.0 - - - - - - - 0.0 0 0 ZFP30 zinc finger protein 30 homolog (mouse) 629 80 C20140709_OR011_01 C20140709_OR011_01 TB416741.[MT7]-LHSSLIQHQR.3y5_1.heavy 454.929 / 681.379 1071.0 20.444000244140625 41 17 10 6 8 2.3624077201332705 33.21413215552596 0.03839874267578125 4 0.9728299828119364 7.470147246136768 1071.0 12.732790914286923 0.0 - - - - - - - 216.22222222222223 2 9 ZFP30 zinc finger protein 30 homolog (mouse) 631 80 C20140709_OR011_01 C20140709_OR011_01 TB416741.[MT7]-LHSSLIQHQR.3b5_1.heavy 454.929 / 682.4 584.0 20.444000244140625 41 17 10 6 8 2.3624077201332705 33.21413215552596 0.03839874267578125 4 0.9728299828119364 7.470147246136768 584.0 6.678188784690616 2.0 - - - - - - - 259.5 2 6 ZFP30 zinc finger protein 30 homolog (mouse) 633 80 C20140709_OR011_01 C20140709_OR011_01 TB416741.[MT7]-LHSSLIQHQR.3y4_1.heavy 454.929 / 568.295 1947.0 20.444000244140625 41 17 10 6 8 2.3624077201332705 33.21413215552596 0.03839874267578125 4 0.9728299828119364 7.470147246136768 1947.0 23.575763920175973 0.0 - - - - - - - 243.16666666666666 3 6 ZFP30 zinc finger protein 30 homolog (mouse) 635 81 C20140709_OR011_01 C20140709_OR011_01 TB447054.[MT7]-RPPVYYK[MT7].3y3_1.heavy 404.244 / 617.341 5524.0 22.39810085296631 46 20 10 6 10 14.057305991230585 7.113738582796969 0.039600372314453125 3 0.9992649289005157 45.516733665101995 5524.0 8.381191381495563 0.0 - - - - - - - 217.0 11 5 BRD1 bromodomain containing 1 637 81 C20140709_OR011_01 C20140709_OR011_01 TB447054.[MT7]-RPPVYYK[MT7].3b4_1.heavy 404.244 / 594.384 1677.0 22.39810085296631 46 20 10 6 10 14.057305991230585 7.113738582796969 0.039600372314453125 3 0.9992649289005157 45.516733665101995 1677.0 2.6294929006085193 1.0 - - - - - - - 394.5 3 4 BRD1 bromodomain containing 1 639 81 C20140709_OR011_01 C20140709_OR011_01 TB447054.[MT7]-RPPVYYK[MT7].3b5_1.heavy 404.244 / 757.448 986.0 22.39810085296631 46 20 10 6 10 14.057305991230585 7.113738582796969 0.039600372314453125 3 0.9992649289005157 45.516733665101995 986.0 13.146666666666668 0.0 - - - - - - - 0.0 1 0 BRD1 bromodomain containing 1 641 81 C20140709_OR011_01 C20140709_OR011_01 TB447054.[MT7]-RPPVYYK[MT7].3y4_1.heavy 404.244 / 716.41 690.0 22.39810085296631 46 20 10 6 10 14.057305991230585 7.113738582796969 0.039600372314453125 3 0.9992649289005157 45.516733665101995 690.0 4.181818181818182 1.0 - - - - - - - 0.0 1 0 BRD1 bromodomain containing 1 643 82 C20140709_OR011_01 C20140709_OR011_01 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 110556.0 37.97549819946289 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 110556.0 303.55204021220334 0.0 - - - - - - - 353.5 221 4 645 82 C20140709_OR011_01 C20140709_OR011_01 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 90991.0 37.97549819946289 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 90991.0 366.45002137622964 0.0 - - - - - - - 188.8 181 5 647 82 C20140709_OR011_01 C20140709_OR011_01 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 170313.0 37.97549819946289 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 170313.0 774.2064032901295 0.0 - - - - - - - 309.375 340 8 649 83 C20140709_OR011_01 C20140709_OR011_01 TB447058.[MT7]-STTLNEHK[MT7].3b4_1.heavy 406.562 / 547.321 2241.0 16.367950439453125 41 17 10 6 8 2.7278044241911883 29.212380027955255 0.039699554443359375 4 0.9734205095782305 7.553050329161774 2241.0 23.789076923076927 0.0 - - - - - - - 252.5 4 6 ZNF595 zinc finger protein 595 651 83 C20140709_OR011_01 C20140709_OR011_01 TB447058.[MT7]-STTLNEHK[MT7].3b5_1.heavy 406.562 / 661.364 2180.0 16.367950439453125 41 17 10 6 8 2.7278044241911883 29.212380027955255 0.039699554443359375 4 0.9734205095782305 7.553050329161774 2180.0 41.163190624576615 1.0 - - - - - - - 144.0 5 8 ZNF595 zinc finger protein 595 653 83 C20140709_OR011_01 C20140709_OR011_01 TB447058.[MT7]-STTLNEHK[MT7].3y4_1.heavy 406.562 / 671.359 1090.0 16.367950439453125 41 17 10 6 8 2.7278044241911883 29.212380027955255 0.039699554443359375 4 0.9734205095782305 7.553050329161774 1090.0 9.90314485994054 0.0 - - - - - - - 230.2 2 5 ZNF595 zinc finger protein 595 655 83 C20140709_OR011_01 C20140709_OR011_01 TB447058.[MT7]-STTLNEHK[MT7].3b3_1.heavy 406.562 / 434.237 4905.0 16.367950439453125 41 17 10 6 8 2.7278044241911883 29.212380027955255 0.039699554443359375 4 0.9734205095782305 7.553050329161774 4905.0 35.67272727272727 0.0 - - - - - - - 199.8 9 10 ZNF595 zinc finger protein 595 657 84 C20140709_OR011_01 C20140709_OR011_01 TB447059.[MT7]-VEQVAMELR.2b3_1.heavy 609.835 / 501.279 10507.0 32.928199768066406 50 20 10 10 10 11.009130988082795 9.083369078653744 0.0 3 0.9983581136743486 30.453091478115173 10507.0 16.726573426573427 0.0 - - - - - - - 263.6363636363636 21 11 BRD1 bromodomain containing 1 659 84 C20140709_OR011_01 C20140709_OR011_01 TB447059.[MT7]-VEQVAMELR.2y8_1.heavy 609.835 / 975.493 16610.0 32.928199768066406 50 20 10 10 10 11.009130988082795 9.083369078653744 0.0 3 0.9983581136743486 30.453091478115173 16610.0 84.15733333333333 0.0 - - - - - - - 263.6363636363636 33 11 BRD1 bromodomain containing 1 661 84 C20140709_OR011_01 C20140709_OR011_01 TB447059.[MT7]-VEQVAMELR.2y5_1.heavy 609.835 / 619.323 7805.0 32.928199768066406 50 20 10 10 10 11.009130988082795 9.083369078653744 0.0 3 0.9983581136743486 30.453091478115173 7805.0 36.51207456622007 1.0 - - - - - - - 172.72727272727272 18 11 BRD1 bromodomain containing 1 663 84 C20140709_OR011_01 C20140709_OR011_01 TB447059.[MT7]-VEQVAMELR.2y7_1.heavy 609.835 / 846.45 6904.0 32.928199768066406 50 20 10 10 10 11.009130988082795 9.083369078653744 0.0 3 0.9983581136743486 30.453091478115173 6904.0 30.3776 0.0 - - - - - - - 254.54545454545453 13 11 BRD1 bromodomain containing 1 665 85 C20140709_OR011_01 C20140709_OR011_01 TB447391.[MT7]-VLILETMIGLYEPELGSGAGPAGTGTPSLLRGK[MT7].4b4_1.heavy 897.251 / 583.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 667 85 C20140709_OR011_01 C20140709_OR011_01 TB447391.[MT7]-VLILETMIGLYEPELGSGAGPAGTGTPSLLRGK[MT7].4b5_1.heavy 897.251 / 712.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 669 85 C20140709_OR011_01 C20140709_OR011_01 TB447391.[MT7]-VLILETMIGLYEPELGSGAGPAGTGTPSLLRGK[MT7].4y7_1.heavy 897.251 / 914.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 671 85 C20140709_OR011_01 C20140709_OR011_01 TB447391.[MT7]-VLILETMIGLYEPELGSGAGPAGTGTPSLLRGK[MT7].4b6_1.heavy 897.251 / 813.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 673 86 C20140709_OR011_01 C20140709_OR011_01 TB417115.[MT7]-IVNDDQSFYADIYMEDGLIK[MT7].4y4_1.heavy 660.08 / 574.404 1520.0 44.617401123046875 41 13 10 10 8 1.1504713853175126 62.74922537688705 0.0 4 0.9129058196005085 4.1511094547250895 1520.0 6.9395969122638395 0.0 - - - - - - - 219.4 3 10 DPYSL2;DPYSL3 dihydropyrimidinase-like 2;dihydropyrimidinase-like 3 675 86 C20140709_OR011_01 C20140709_OR011_01 TB417115.[MT7]-IVNDDQSFYADIYMEDGLIK[MT7].4b7_1.heavy 660.08 / 916.449 422.0 44.617401123046875 41 13 10 10 8 1.1504713853175126 62.74922537688705 0.0 4 0.9129058196005085 4.1511094547250895 422.0 2.5149981477587877 14.0 - - - - - - - 0.0 1 0 DPYSL2;DPYSL3 dihydropyrimidinase-like 2;dihydropyrimidinase-like 3 677 86 C20140709_OR011_01 C20140709_OR011_01 TB417115.[MT7]-IVNDDQSFYADIYMEDGLIK[MT7].4b4_1.heavy 660.08 / 586.332 1436.0 44.617401123046875 41 13 10 10 8 1.1504713853175126 62.74922537688705 0.0 4 0.9129058196005085 4.1511094547250895 1436.0 5.423944773175542 0.0 - - - - - - - 227.9 2 10 DPYSL2;DPYSL3 dihydropyrimidinase-like 2;dihydropyrimidinase-like 3 679 86 C20140709_OR011_01 C20140709_OR011_01 TB417115.[MT7]-IVNDDQSFYADIYMEDGLIK[MT7].4b5_1.heavy 660.08 / 701.359 845.0 44.617401123046875 41 13 10 10 8 1.1504713853175126 62.74922537688705 0.0 4 0.9129058196005085 4.1511094547250895 845.0 4.675889328063241 1.0 - - - - - - - 0.0 1 0 DPYSL2;DPYSL3 dihydropyrimidinase-like 2;dihydropyrimidinase-like 3 681 87 C20140709_OR011_01 C20140709_OR011_01 TB589817.[MT7]-LHLFENPAFSGR.3b6_1.heavy 511.276 / 898.49 1088.0 36.64500045776367 37 11 10 10 6 0.7314824972452824 78.47918391268225 0.0 5 0.8525934228247397 3.1740867380308453 1088.0 11.92 0.0 - - - - - - - 317.3333333333333 2 3 CRYBB3 crystallin, beta B3 683 87 C20140709_OR011_01 C20140709_OR011_01 TB589817.[MT7]-LHLFENPAFSGR.3y6_1.heavy 511.276 / 634.331 1632.0 36.64500045776367 37 11 10 10 6 0.7314824972452824 78.47918391268225 0.0 5 0.8525934228247397 3.1740867380308453 1632.0 18.0 2.0 - - - - - - - 136.0 5 1 CRYBB3 crystallin, beta B3 685 87 C20140709_OR011_01 C20140709_OR011_01 TB589817.[MT7]-LHLFENPAFSGR.3b3_1.heavy 511.276 / 508.336 4079.0 36.64500045776367 37 11 10 10 6 0.7314824972452824 78.47918391268225 0.0 5 0.8525934228247397 3.1740867380308453 4079.0 12.04704656862745 0.0 - - - - - - - 244.8 8 5 CRYBB3 crystallin, beta B3 687 87 C20140709_OR011_01 C20140709_OR011_01 TB589817.[MT7]-LHLFENPAFSGR.3y5_1.heavy 511.276 / 537.278 2856.0 36.64500045776367 37 11 10 10 6 0.7314824972452824 78.47918391268225 0.0 5 0.8525934228247397 3.1740867380308453 2856.0 14.5 1.0 - - - - - - - 272.0 5 4 CRYBB3 crystallin, beta B3 689 88 C20140709_OR011_01 C20140709_OR011_01 TB447394.[MT7]-LLPSDQPAEPNFSTLLTAASYLQLPELAALC[CAM]R.4y8_1.heavy 911.734 / 929.487 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIC2 hypermethylated in cancer 2 691 88 C20140709_OR011_01 C20140709_OR011_01 TB447394.[MT7]-LLPSDQPAEPNFSTLLTAASYLQLPELAALC[CAM]R.4b5_1.heavy 911.734 / 670.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIC2 hypermethylated in cancer 2 693 88 C20140709_OR011_01 C20140709_OR011_01 TB447394.[MT7]-LLPSDQPAEPNFSTLLTAASYLQLPELAALC[CAM]R.4b9_1.heavy 911.734 / 1095.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIC2 hypermethylated in cancer 2 695 88 C20140709_OR011_01 C20140709_OR011_01 TB447394.[MT7]-LLPSDQPAEPNFSTLLTAASYLQLPELAALC[CAM]R.4b6_1.heavy 911.734 / 798.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIC2 hypermethylated in cancer 2 697 89 C20140709_OR011_01 C20140709_OR011_01 TB589816.[MT7]-LQDC[CAM]YVDSPALTNIWMAR.3y7_1.heavy 766.377 / 891.451 8338.0 44.47500038146973 43 18 10 5 10 5.96407828006329 16.767050213656624 0.041202545166015625 3 0.9832178185923613 9.513250208737599 8338.0 87.37425149700599 0.0 - - - - - - - 138.88888888888889 16 9 C22orf31 chromosome 22 open reading frame 31 699 89 C20140709_OR011_01 C20140709_OR011_01 TB589816.[MT7]-LQDC[CAM]YVDSPALTNIWMAR.3b4_1.heavy 766.377 / 661.31 8588.0 44.47500038146973 43 18 10 5 10 5.96407828006329 16.767050213656624 0.041202545166015625 3 0.9832178185923613 9.513250208737599 8588.0 31.40384 1.0 - - - - - - - 166.63636363636363 17 11 C22orf31 chromosome 22 open reading frame 31 701 89 C20140709_OR011_01 C20140709_OR011_01 TB589816.[MT7]-LQDC[CAM]YVDSPALTNIWMAR.3b5_1.heavy 766.377 / 824.373 8088.0 44.47500038146973 43 18 10 5 10 5.96407828006329 16.767050213656624 0.041202545166015625 3 0.9832178185923613 9.513250208737599 8088.0 43.64614131736526 0.0 - - - - - - - 202.42857142857142 16 7 C22orf31 chromosome 22 open reading frame 31 703 89 C20140709_OR011_01 C20140709_OR011_01 TB589816.[MT7]-LQDC[CAM]YVDSPALTNIWMAR.3b3_1.heavy 766.377 / 501.279 7921.0 44.47500038146973 43 18 10 5 10 5.96407828006329 16.767050213656624 0.041202545166015625 3 0.9832178185923613 9.513250208737599 7921.0 46.38385820359281 0.0 - - - - - - - 175.0 15 10 C22orf31 chromosome 22 open reading frame 31 705 90 C20140709_OR011_01 C20140709_OR011_01 TB417111.[MT7]-SMEVANFYYEADC[CAM]LAAAYGGK[MT7].4y4_1.heavy 655.309 / 568.321 15377.0 46.82210159301758 44 14 10 10 10 1.5585661537298987 44.01820319476488 0.0 3 0.9405576207742604 5.036619589449466 15377.0 46.35721454012737 0.0 - - - - - - - 293.3333333333333 30 12 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 707 90 C20140709_OR011_01 C20140709_OR011_01 TB417111.[MT7]-SMEVANFYYEADC[CAM]LAAAYGGK[MT7].4b4_1.heavy 655.309 / 591.293 10500.0 46.82210159301758 44 14 10 10 10 1.5585661537298987 44.01820319476488 0.0 3 0.9405576207742604 5.036619589449466 10500.0 49.23247232472324 0.0 - - - - - - - 225.73333333333332 21 15 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 709 90 C20140709_OR011_01 C20140709_OR011_01 TB417111.[MT7]-SMEVANFYYEADC[CAM]LAAAYGGK[MT7].4b5_1.heavy 655.309 / 662.33 6774.0 46.82210159301758 44 14 10 10 10 1.5585661537298987 44.01820319476488 0.0 3 0.9405576207742604 5.036619589449466 6774.0 23.364372691429757 0.0 - - - - - - - 256.2857142857143 13 14 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 711 90 C20140709_OR011_01 C20140709_OR011_01 TB417111.[MT7]-SMEVANFYYEADC[CAM]LAAAYGGK[MT7].4b6_1.heavy 655.309 / 776.373 10161.0 46.82210159301758 44 14 10 10 10 1.5585661537298987 44.01820319476488 0.0 3 0.9405576207742604 5.036619589449466 10161.0 89.40536708860759 0.0 - - - - - - - 203.14285714285714 20 14 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 713 91 C20140709_OR011_01 C20140709_OR011_01 TB589719.[MT7]-EQDLLETK[MT7].2y4_1.heavy 632.355 / 634.389 4383.0 27.607025146484375 44 18 10 6 10 4.207381075916016 23.76775438108571 0.038299560546875 3 0.9805870644881467 8.843245307381764 4383.0 30.401964025481952 1.0 - - - - - - - 219.2 15 10 LZTS1 leucine zipper, putative tumor suppressor 1 715 91 C20140709_OR011_01 C20140709_OR011_01 TB589719.[MT7]-EQDLLETK[MT7].2b3_1.heavy 632.355 / 517.237 14246.0 27.607025146484375 44 18 10 6 10 4.207381075916016 23.76775438108571 0.038299560546875 3 0.9805870644881467 8.843245307381764 14246.0 29.894320801671263 0.0 - - - - - - - 754.8888888888889 28 9 LZTS1 leucine zipper, putative tumor suppressor 1 717 91 C20140709_OR011_01 C20140709_OR011_01 TB589719.[MT7]-EQDLLETK[MT7].2b4_1.heavy 632.355 / 630.321 6575.0 27.607025146484375 44 18 10 6 10 4.207381075916016 23.76775438108571 0.038299560546875 3 0.9805870644881467 8.843245307381764 6575.0 48.90710052601629 0.0 - - - - - - - 259.09090909090907 13 11 LZTS1 leucine zipper, putative tumor suppressor 1 719 91 C20140709_OR011_01 C20140709_OR011_01 TB589719.[MT7]-EQDLLETK[MT7].2y3_1.heavy 632.355 / 521.305 7342.0 27.607025146484375 44 18 10 6 10 4.207381075916016 23.76775438108571 0.038299560546875 3 0.9805870644881467 8.843245307381764 7342.0 36.87325463020842 0.0 - - - - - - - 229.36363636363637 14 11 LZTS1 leucine zipper, putative tumor suppressor 1 721 92 C20140709_OR011_01 C20140709_OR011_01 TB447251.[MT7]-DIYEMNLSQWK[MT7].3b6_1.heavy 572.295 / 910.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZFP30 zinc finger protein 30 homolog (mouse) 723 92 C20140709_OR011_01 C20140709_OR011_01 TB447251.[MT7]-DIYEMNLSQWK[MT7].3b4_1.heavy 572.295 / 665.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZFP30 zinc finger protein 30 homolog (mouse) 725 92 C20140709_OR011_01 C20140709_OR011_01 TB447251.[MT7]-DIYEMNLSQWK[MT7].3y4_1.heavy 572.295 / 692.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZFP30 zinc finger protein 30 homolog (mouse) 727 92 C20140709_OR011_01 C20140709_OR011_01 TB447251.[MT7]-DIYEMNLSQWK[MT7].3b3_1.heavy 572.295 / 536.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZFP30 zinc finger protein 30 homolog (mouse) 729 93 C20140709_OR011_01 C20140709_OR011_01 TB416813.[MT7]-SHDQSENENK[MT7].3y3_1.heavy 492.57 / 534.3 386.0 12.261500358581543 48 18 10 10 10 6.387996533729816 15.654360404233362 0.0 3 0.9897515996174548 12.180432991593774 386.0 11.287424633936261 0.0 - - - - - - - 0.0 0 0 DENND2C DENN/MADD domain containing 2C 731 93 C20140709_OR011_01 C20140709_OR011_01 TB416813.[MT7]-SHDQSENENK[MT7].3b4_1.heavy 492.57 / 612.286 279.0 12.261500358581543 48 18 10 10 10 6.387996533729816 15.654360404233362 0.0 3 0.9897515996174548 12.180432991593774 279.0 10.703786337209301 0.0 - - - - - - - 0.0 0 0 DENND2C DENN/MADD domain containing 2C 733 93 C20140709_OR011_01 C20140709_OR011_01 TB416813.[MT7]-SHDQSENENK[MT7].3y4_1.heavy 492.57 / 648.343 536.0 12.261500358581543 48 18 10 10 10 6.387996533729816 15.654360404233362 0.0 3 0.9897515996174548 12.180432991593774 536.0 25.619523809523812 0.0 - - - - - - - 0.0 1 0 DENND2C DENN/MADD domain containing 2C 735 93 C20140709_OR011_01 C20140709_OR011_01 TB416813.[MT7]-SHDQSENENK[MT7].3b3_1.heavy 492.57 / 484.227 1190.0 12.261500358581543 48 18 10 10 10 6.387996533729816 15.654360404233362 0.0 3 0.9897515996174548 12.180432991593774 1190.0 22.21333333333333 0.0 - - - - - - - 49.916666666666664 2 24 DENND2C DENN/MADD domain containing 2C 737 94 C20140709_OR011_01 C20140709_OR011_01 TB417112.[MT7]-SMEVANFYYEADC[CAM]LAAAYGGK[MT7].3b6_1.heavy 873.41 / 776.373 9433.0 46.831050872802734 44 18 10 6 10 3.353652573978622 23.76744485551819 0.035797119140625 3 0.9838279304166702 9.691534348495699 9433.0 38.44554456999372 0.0 - - - - - - - 182.2941176470588 18 17 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 739 94 C20140709_OR011_01 C20140709_OR011_01 TB417112.[MT7]-SMEVANFYYEADC[CAM]LAAAYGGK[MT7].3b4_1.heavy 873.41 / 591.293 8355.0 46.831050872802734 44 18 10 6 10 3.353652573978622 23.76744485551819 0.035797119140625 3 0.9838279304166702 9.691534348495699 8355.0 133.68158518846445 0.0 - - - - - - - 168.41666666666666 16 12 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 741 94 C20140709_OR011_01 C20140709_OR011_01 TB417112.[MT7]-SMEVANFYYEADC[CAM]LAAAYGGK[MT7].3b5_1.heavy 873.41 / 662.33 7209.0 46.831050872802734 44 18 10 6 10 3.353652573978622 23.76744485551819 0.035797119140625 3 0.9838279304166702 9.691534348495699 7209.0 94.40483966307079 0.0 - - - - - - - 171.63636363636363 14 11 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 743 94 C20140709_OR011_01 C20140709_OR011_01 TB417112.[MT7]-SMEVANFYYEADC[CAM]LAAAYGGK[MT7].3b7_1.heavy 873.41 / 923.441 13610.0 46.831050872802734 44 18 10 6 10 3.353652573978622 23.76744485551819 0.035797119140625 3 0.9838279304166702 9.691534348495699 13610.0 239.3373797678275 0.0 - - - - - - - 183.63636363636363 27 11 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 745 95 C20140709_OR011_01 C20140709_OR011_01 TB447397.[MT7]-TIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGK[MT7].3b4_1.heavy 1246.03 / 555.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLF8 Kruppel-like factor 8 747 95 C20140709_OR011_01 C20140709_OR011_01 TB447397.[MT7]-TIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGK[MT7].3b5_1.heavy 1246.03 / 654.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLF8 Kruppel-like factor 8 749 95 C20140709_OR011_01 C20140709_OR011_01 TB447397.[MT7]-TIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGK[MT7].3y8_1.heavy 1246.03 / 900.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLF8 Kruppel-like factor 8 751 95 C20140709_OR011_01 C20140709_OR011_01 TB447397.[MT7]-TIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGK[MT7].3y5_1.heavy 1246.03 / 577.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLF8 Kruppel-like factor 8 753 96 C20140709_OR011_01 C20140709_OR011_01 TB589716.[MT7]-TVVRPTYK[MT7].2y4_1.heavy 626.387 / 652.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 755 96 C20140709_OR011_01 C20140709_OR011_01 TB589716.[MT7]-TVVRPTYK[MT7].2b4_1.heavy 626.387 / 600.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 757 96 C20140709_OR011_01 C20140709_OR011_01 TB589716.[MT7]-TVVRPTYK[MT7].2y3_1.heavy 626.387 / 555.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 759 96 C20140709_OR011_01 C20140709_OR011_01 TB589716.[MT7]-TVVRPTYK[MT7].2y7_1.heavy 626.387 / 1006.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 761 97 C20140709_OR011_01 C20140709_OR011_01 TB416588.[MT7]-FGEALQER.2y5_1.heavy 547.292 / 616.341 3008.0 27.970600128173828 39 13 8 10 8 1.8503980947621057 42.33613738964604 0.0 4 0.9114711923464179 4.116828637336215 3008.0 19.966823688864647 0.0 - - - - - - - 175.375 6 8 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 763 97 C20140709_OR011_01 C20140709_OR011_01 TB416588.[MT7]-FGEALQER.2y6_1.heavy 547.292 / 745.384 401.0 27.970600128173828 39 13 8 10 8 1.8503980947621057 42.33613738964604 0.0 4 0.9114711923464179 4.116828637336215 401.0 3.8754451827242526 15.0 - - - - - - - 0.0 1 0 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 765 97 C20140709_OR011_01 C20140709_OR011_01 TB416588.[MT7]-FGEALQER.2b5_1.heavy 547.292 / 662.363 1103.0 27.970600128173828 39 13 8 10 8 1.8503980947621057 42.33613738964604 0.0 4 0.9114711923464179 4.116828637336215 1103.0 1.3174526172725602 4.0 - - - - - - - 217.5 9 6 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 767 97 C20140709_OR011_01 C20140709_OR011_01 TB416588.[MT7]-FGEALQER.2y7_1.heavy 547.292 / 802.405 2507.0 27.970600128173828 39 13 8 10 8 1.8503980947621057 42.33613738964604 0.0 4 0.9114711923464179 4.116828637336215 2507.0 7.769609468911794 1.0 - - - - - - - 200.5 7 10 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 769 98 C20140709_OR011_01 C20140709_OR011_01 TB416825.[MT7]-NVLAASSIYFK[MT7].3b6_1.heavy 500.96 / 700.411 909.0 38.82979965209961 43 13 10 10 10 1.9760204355067068 39.26343195300087 0.0 3 0.9224207594334007 4.401909525035671 909.0 7.905969230769232 0.0 - - - - - - - 0.0 1 0 HIC2 hypermethylated in cancer 2 771 98 C20140709_OR011_01 C20140709_OR011_01 TB416825.[MT7]-NVLAASSIYFK[MT7].3y3_1.heavy 500.96 / 601.347 11692.0 38.82979965209961 43 13 10 10 10 1.9760204355067068 39.26343195300087 0.0 3 0.9224207594334007 4.401909525035671 11692.0 60.258769230769225 0.0 - - - - - - - 303.3333333333333 23 3 HIC2 hypermethylated in cancer 2 773 98 C20140709_OR011_01 C20140709_OR011_01 TB416825.[MT7]-NVLAASSIYFK[MT7].3b4_1.heavy 500.96 / 542.342 5067.0 38.82979965209961 43 13 10 10 10 1.9760204355067068 39.26343195300087 0.0 3 0.9224207594334007 4.401909525035671 5067.0 38.015966785094605 1.0 - - - - - - - 216.66666666666666 11 3 HIC2 hypermethylated in cancer 2 775 98 C20140709_OR011_01 C20140709_OR011_01 TB416825.[MT7]-NVLAASSIYFK[MT7].3b5_1.heavy 500.96 / 613.379 2858.0 38.82979965209961 43 13 10 10 10 1.9760204355067068 39.26343195300087 0.0 3 0.9224207594334007 4.401909525035671 2858.0 24.163914466278268 0.0 - - - - - - - 260.0 5 5 HIC2 hypermethylated in cancer 2 777 99 C20140709_OR011_01 C20140709_OR011_01 TB447181.[MT7]-AFNQSSSLIIHR.3y7_1.heavy 506.283 / 825.494 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF595 zinc finger protein 595 779 99 C20140709_OR011_01 C20140709_OR011_01 TB447181.[MT7]-AFNQSSSLIIHR.3y6_1.heavy 506.283 / 738.462 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF595 zinc finger protein 595 781 99 C20140709_OR011_01 C20140709_OR011_01 TB447181.[MT7]-AFNQSSSLIIHR.3y4_1.heavy 506.283 / 538.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF595 zinc finger protein 595 783 99 C20140709_OR011_01 C20140709_OR011_01 TB447181.[MT7]-AFNQSSSLIIHR.3y8_1.heavy 506.283 / 912.526 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF595 zinc finger protein 595 785 100 C20140709_OR011_01 C20140709_OR011_01 TB416961.[MT7]-IMLEDGNLHVTQGAGR.3y7_1.heavy 618.992 / 688.374 55099.0 32.020301818847656 47 17 10 10 10 4.426848764439141 22.589432194589435 0.0 3 0.9744340126114123 7.701963444656304 55099.0 362.07914285714287 0.0 - - - - - - - 255.0 110 7 DPYSL3 dihydropyrimidinase-like 3 787 100 C20140709_OR011_01 C20140709_OR011_01 TB416961.[MT7]-IMLEDGNLHVTQGAGR.3y6_1.heavy 618.992 / 589.305 95400.0 32.020301818847656 47 17 10 10 10 4.426848764439141 22.589432194589435 0.0 3 0.9744340126114123 7.701963444656304 95400.0 317.24285714285713 0.0 - - - - - - - 336.0 190 10 DPYSL3 dihydropyrimidinase-like 3 789 100 C20140709_OR011_01 C20140709_OR011_01 TB416961.[MT7]-IMLEDGNLHVTQGAGR.3y8_1.heavy 618.992 / 825.433 26343.0 32.020301818847656 47 17 10 10 10 4.426848764439141 22.589432194589435 0.0 3 0.9744340126114123 7.701963444656304 26343.0 103.11402857142858 0.0 - - - - - - - 682.5 52 8 DPYSL3 dihydropyrimidinase-like 3 791 100 C20140709_OR011_01 C20140709_OR011_01 TB416961.[MT7]-IMLEDGNLHVTQGAGR.3b7_1.heavy 618.992 / 917.452 39461.0 32.020301818847656 47 17 10 10 10 4.426848764439141 22.589432194589435 0.0 3 0.9744340126114123 7.701963444656304 39461.0 184.90297142857145 0.0 - - - - - - - 231.0 78 10 DPYSL3 dihydropyrimidinase-like 3 793 101 C20140709_OR011_01 C20140709_OR011_01 TB589823.[MT7]-HNQVEAAWLEGR.2b3_1.heavy 777.401 / 524.27 1277.0 30.611000061035156 42 16 10 6 10 1.7810337493588908 40.068130003581196 0.033199310302734375 3 0.9649901563865536 6.576457592577071 1277.0 16.491454514008993 0.0 - - - - - - - 176.8 2 5 TRIM35 tripartite motif-containing 35 795 101 C20140709_OR011_01 C20140709_OR011_01 TB589823.[MT7]-HNQVEAAWLEGR.2y8_1.heavy 777.401 / 931.463 1081.0 30.611000061035156 42 16 10 6 10 1.7810337493588908 40.068130003581196 0.033199310302734375 3 0.9649901563865536 6.576457592577071 1081.0 6.429538222068489 0.0 - - - - - - - 171.75 2 8 TRIM35 tripartite motif-containing 35 797 101 C20140709_OR011_01 C20140709_OR011_01 TB589823.[MT7]-HNQVEAAWLEGR.2y9_1.heavy 777.401 / 1030.53 982.0 30.611000061035156 42 16 10 6 10 1.7810337493588908 40.068130003581196 0.033199310302734375 3 0.9649901563865536 6.576457592577071 982.0 13.978469387755101 0.0 - - - - - - - 0.0 1 0 TRIM35 tripartite motif-containing 35 799 101 C20140709_OR011_01 C20140709_OR011_01 TB589823.[MT7]-HNQVEAAWLEGR.2y7_1.heavy 777.401 / 802.421 1081.0 30.611000061035156 42 16 10 6 10 1.7810337493588908 40.068130003581196 0.033199310302734375 3 0.9649901563865536 6.576457592577071 1081.0 10.203316326530611 0.0 - - - - - - - 196.14285714285714 2 7 TRIM35 tripartite motif-containing 35 801 102 C20140709_OR011_01 C20140709_OR011_01 TB417109.[MT7]-SC[CAM]C[CAM]DYALHVDITHWNDSVK[MT7].4b7_1.heavy 652.81 / 1014.41 4821.0 35.34339904785156 46 16 10 10 10 2.801576518290025 27.75925384230837 0.0 3 0.965390224146265 6.614581661557937 4821.0 7.258336240475868 1.0 - - - - - - - 238.83333333333334 13 6 DPYSL3 dihydropyrimidinase-like 3 803 102 C20140709_OR011_01 C20140709_OR011_01 TB417109.[MT7]-SC[CAM]C[CAM]DYALHVDITHWNDSVK[MT7].4b4_1.heavy 652.81 / 667.23 8469.0 35.34339904785156 46 16 10 10 10 2.801576518290025 27.75925384230837 0.0 3 0.965390224146265 6.614581661557937 8469.0 40.287314578005116 0.0 - - - - - - - 228.08333333333334 16 12 DPYSL3 dihydropyrimidinase-like 3 805 102 C20140709_OR011_01 C20140709_OR011_01 TB417109.[MT7]-SC[CAM]C[CAM]DYALHVDITHWNDSVK[MT7].4b5_1.heavy 652.81 / 830.293 4691.0 35.34339904785156 46 16 10 10 10 2.801576518290025 27.75925384230837 0.0 3 0.965390224146265 6.614581661557937 4691.0 19.15747810355858 0.0 - - - - - - - 260.75 9 8 DPYSL3 dihydropyrimidinase-like 3 807 102 C20140709_OR011_01 C20140709_OR011_01 TB417109.[MT7]-SC[CAM]C[CAM]DYALHVDITHWNDSVK[MT7].4b6_1.heavy 652.81 / 901.33 9382.0 35.34339904785156 46 16 10 10 10 2.801576518290025 27.75925384230837 0.0 3 0.965390224146265 6.614581661557937 9382.0 57.47822988505747 0.0 - - - - - - - 221.6 18 10 DPYSL3 dihydropyrimidinase-like 3 809 103 C20140709_OR011_01 C20140709_OR011_01 TB416574.[MT7]-HSDEYK[MT7].2y4_1.heavy 533.774 / 698.348 578.0 14.674974918365479 40 17 10 3 10 2.5244692193026155 31.147578679586395 0.07889938354492188 3 0.9776447934878489 8.238736790091014 578.0 17.099166666666665 0.0 - - - - - - - 0.0 1 0 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 811 103 C20140709_OR011_01 C20140709_OR011_01 TB416574.[MT7]-HSDEYK[MT7].2y5_1.heavy 533.774 / 785.38 1059.0 14.674974918365479 40 17 10 3 10 2.5244692193026155 31.147578679586395 0.07889938354492188 3 0.9776447934878489 8.238736790091014 1059.0 41.698125 0.0 - - - - - - - 96.2 2 5 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 813 103 C20140709_OR011_01 C20140709_OR011_01 TB416574.[MT7]-HSDEYK[MT7].2b4_1.heavy 533.774 / 613.27 241.0 14.674974918365479 40 17 10 3 10 2.5244692193026155 31.147578679586395 0.07889938354492188 3 0.9776447934878489 8.238736790091014 241.0 3.330486111111111 1.0 - - - - - - - 0.0 0 0 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 815 103 C20140709_OR011_01 C20140709_OR011_01 TB416574.[MT7]-HSDEYK[MT7].2y3_1.heavy 533.774 / 583.321 433.0 14.674974918365479 40 17 10 3 10 2.5244692193026155 31.147578679586395 0.07889938354492188 3 0.9776447934878489 8.238736790091014 433.0 5.487673611111111 1.0 - - - - - - - 0.0 0 0 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 817 104 C20140709_OR011_01 C20140709_OR011_01 TB417107.[MT7]-SPPVQESQSERLQAAGADSAGPK[MT7].4y4_1.heavy 650.339 / 516.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCEB3C;TCEB3CL transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 819 104 C20140709_OR011_01 C20140709_OR011_01 TB417107.[MT7]-SPPVQESQSERLQAAGADSAGPK[MT7].4b4_1.heavy 650.339 / 525.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCEB3C;TCEB3CL transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 821 104 C20140709_OR011_01 C20140709_OR011_01 TB417107.[MT7]-SPPVQESQSERLQAAGADSAGPK[MT7].4b13_2.heavy 650.339 / 805.916 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCEB3C;TCEB3CL transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 823 104 C20140709_OR011_01 C20140709_OR011_01 TB417107.[MT7]-SPPVQESQSERLQAAGADSAGPK[MT7].4b22_2.heavy 650.339 / 1154.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - TCEB3C;TCEB3CL transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 825 105 C20140709_OR011_01 C20140709_OR011_01 TB447190.[MT7]-YLSESGVTPYK[MT7].3b6_1.heavy 511.28 / 781.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND2C DENN/MADD domain containing 2C 827 105 C20140709_OR011_01 C20140709_OR011_01 TB447190.[MT7]-YLSESGVTPYK[MT7].3y3_1.heavy 511.28 / 551.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND2C DENN/MADD domain containing 2C 829 105 C20140709_OR011_01 C20140709_OR011_01 TB447190.[MT7]-YLSESGVTPYK[MT7].3b4_1.heavy 511.28 / 637.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND2C DENN/MADD domain containing 2C 831 105 C20140709_OR011_01 C20140709_OR011_01 TB447190.[MT7]-YLSESGVTPYK[MT7].3b5_1.heavy 511.28 / 724.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - DENND2C DENN/MADD domain containing 2C 833 106 C20140709_OR011_01 C20140709_OR011_01 TB589829.[MT7]-QIGDNLIVPGGVK[MT7].3b6_1.heavy 533.322 / 785.427 37741.0 34.49359893798828 42 12 10 10 10 1.0195102751409468 60.12176362273249 0.0 3 0.891905758676685 3.719367645666351 37741.0 276.4312175572519 0.0 - - - - - - - 205.85714285714286 75 7 DPYSL3 dihydropyrimidinase-like 3 835 106 C20140709_OR011_01 C20140709_OR011_01 TB589829.[MT7]-QIGDNLIVPGGVK[MT7].3b5_1.heavy 533.322 / 672.343 40361.0 34.49359893798828 42 12 10 10 10 1.0195102751409468 60.12176362273249 0.0 3 0.891905758676685 3.719367645666351 40361.0 168.7543546148508 0.0 - - - - - - - 218.33333333333334 80 6 DPYSL3 dihydropyrimidinase-like 3 837 106 C20140709_OR011_01 C20140709_OR011_01 TB589829.[MT7]-QIGDNLIVPGGVK[MT7].3y4_1.heavy 533.322 / 504.326 45341.0 34.49359893798828 42 12 10 10 10 1.0195102751409468 60.12176362273249 0.0 3 0.891905758676685 3.719367645666351 45341.0 33.40415497737892 1.0 - - - - - - - 769.625 90 8 DPYSL3 dihydropyrimidinase-like 3 839 106 C20140709_OR011_01 C20140709_OR011_01 TB589829.[MT7]-QIGDNLIVPGGVK[MT7].3y5_1.heavy 533.322 / 601.379 103262.0 34.49359893798828 42 12 10 10 10 1.0195102751409468 60.12176362273249 0.0 3 0.891905758676685 3.719367645666351 103262.0 346.8341984732825 0.0 - - - - - - - 636.2857142857143 206 7 DPYSL3 dihydropyrimidinase-like 3 841 107 C20140709_OR011_01 C20140709_OR011_01 TB447387.[MT7]-AALAGGTTMIIDHVVPEPESSLTEAYEK[MT7].4y4_1.heavy 805.169 / 654.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL3 dihydropyrimidinase-like 3 843 107 C20140709_OR011_01 C20140709_OR011_01 TB447387.[MT7]-AALAGGTTMIIDHVVPEPESSLTEAYEK[MT7].4b15_2.heavy 805.169 / 797.941 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL3 dihydropyrimidinase-like 3 845 107 C20140709_OR011_01 C20140709_OR011_01 TB447387.[MT7]-AALAGGTTMIIDHVVPEPESSLTEAYEK[MT7].4y6_1.heavy 805.169 / 884.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL3 dihydropyrimidinase-like 3 847 107 C20140709_OR011_01 C20140709_OR011_01 TB447387.[MT7]-AALAGGTTMIIDHVVPEPESSLTEAYEK[MT7].4y3_1.heavy 805.169 / 583.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL3 dihydropyrimidinase-like 3 849 108 C20140709_OR011_01 C20140709_OR011_01 TB417101.[MT7]-SQRAQQVLHLQVLQLQQEK[MT7].4b8_1.heavy 641.373 / 1055.61 2444.0 33.929100036621094 40 10 10 10 10 0.6751123536905924 76.91379211432337 0.0 3 0.8326473390546988 2.973681605387462 2444.0 6.211246910665412 1.0 - - - - - - - 244.4 5 5 LZTS1 leucine zipper, putative tumor suppressor 1 851 108 C20140709_OR011_01 C20140709_OR011_01 TB417101.[MT7]-SQRAQQVLHLQVLQLQQEK[MT7].4b8_2.heavy 641.373 / 528.307 9044.0 33.929100036621094 40 10 10 10 10 0.6751123536905924 76.91379211432337 0.0 3 0.8326473390546988 2.973681605387462 9044.0 16.53409317717048 1.0 - - - - - - - 715.7142857142857 18 7 LZTS1 leucine zipper, putative tumor suppressor 1 853 108 C20140709_OR011_01 C20140709_OR011_01 TB417101.[MT7]-SQRAQQVLHLQVLQLQQEK[MT7].4b6_1.heavy 641.373 / 843.455 1100.0 33.929100036621094 40 10 10 10 10 0.6751123536905924 76.91379211432337 0.0 3 0.8326473390546988 2.973681605387462 1100.0 4.956250628582922 2.0 - - - - - - - 217.0 2 9 LZTS1 leucine zipper, putative tumor suppressor 1 855 108 C20140709_OR011_01 C20140709_OR011_01 TB417101.[MT7]-SQRAQQVLHLQVLQLQQEK[MT7].4b9_2.heavy 641.373 / 596.837 6355.0 33.929100036621094 40 10 10 10 10 0.6751123536905924 76.91379211432337 0.0 3 0.8326473390546988 2.973681605387462 6355.0 27.674194228741253 0.0 - - - - - - - 325.8333333333333 12 6 LZTS1 leucine zipper, putative tumor suppressor 1 857 109 C20140709_OR011_01 C20140709_OR011_01 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1018610.0 34.88650131225586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1018610.0 1427.646317680267 0.0 - - - - - - - 314.3636363636364 2037 11 859 109 C20140709_OR011_01 C20140709_OR011_01 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 221811.0 34.88650131225586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 221811.0 326.35705721021475 0.0 - - - - - - - 682.625 443 8 861 109 C20140709_OR011_01 C20140709_OR011_01 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 276798.0 34.88650131225586 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 276798.0 217.73060817561873 0.0 - - - - - - - 666.0 553 7 863 110 C20140709_OR011_01 C20140709_OR011_01 TB447389.[MT7]-VLILETMIGLYEPELGSGAGPAGTGTPSLLR.3b6_1.heavy 1086.26 / 813.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 865 110 C20140709_OR011_01 C20140709_OR011_01 TB447389.[MT7]-VLILETMIGLYEPELGSGAGPAGTGTPSLLR.3b4_1.heavy 1086.26 / 583.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 867 110 C20140709_OR011_01 C20140709_OR011_01 TB447389.[MT7]-VLILETMIGLYEPELGSGAGPAGTGTPSLLR.3b5_1.heavy 1086.26 / 712.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 869 110 C20140709_OR011_01 C20140709_OR011_01 TB447389.[MT7]-VLILETMIGLYEPELGSGAGPAGTGTPSLLR.3y12_1.heavy 1086.26 / 1126.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 871 111 C20140709_OR011_01 C20140709_OR011_01 TB589729.[MT7]-IRGGSEGGC[CAM]PR.2b8_1.heavy 645.329 / 858.455 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDF2L1 stromal cell-derived factor 2-like 1 873 111 C20140709_OR011_01 C20140709_OR011_01 TB589729.[MT7]-IRGGSEGGC[CAM]PR.2y5_1.heavy 645.329 / 546.245 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDF2L1 stromal cell-derived factor 2-like 1 875 111 C20140709_OR011_01 C20140709_OR011_01 TB589729.[MT7]-IRGGSEGGC[CAM]PR.2y9_1.heavy 645.329 / 876.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDF2L1 stromal cell-derived factor 2-like 1 877 111 C20140709_OR011_01 C20140709_OR011_01 TB589729.[MT7]-IRGGSEGGC[CAM]PR.2b5_1.heavy 645.329 / 615.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDF2L1 stromal cell-derived factor 2-like 1 879 112 C20140709_OR011_01 C20140709_OR011_01 TB416671.[MT7]-IDDIFESK[MT7].2y4_1.heavy 627.845 / 654.358 2989.0 35.799150466918945 25 12 0 5 8 1.2164989056347497 55.548698103017074 0.048297882080078125 4 0.894235800304083 3.7608744069946565 2989.0 6.426084533914382 0.0 - - - - - - - 299.2 5 5 DENND2C DENN/MADD domain containing 2C 881 112 C20140709_OR011_01 C20140709_OR011_01 TB416671.[MT7]-IDDIFESK[MT7].2y5_1.heavy 627.845 / 767.442 5570.0 35.799150466918945 25 12 0 5 8 1.2164989056347497 55.548698103017074 0.048297882080078125 4 0.894235800304083 3.7608744069946565 5570.0 15.587995119140427 0.0 - - - - - - - 272.0 11 9 DENND2C DENN/MADD domain containing 2C 883 112 C20140709_OR011_01 C20140709_OR011_01 TB416671.[MT7]-IDDIFESK[MT7].2y3_1.heavy 627.845 / 507.289 1902.0 35.799150466918945 25 12 0 5 8 1.2164989056347497 55.548698103017074 0.048297882080078125 4 0.894235800304083 3.7608744069946565 1902.0 3.921060382916053 5.0 - - - - - - - 226.66666666666666 4 6 DENND2C DENN/MADD domain containing 2C 885 112 C20140709_OR011_01 C20140709_OR011_01 TB416671.[MT7]-IDDIFESK[MT7].2y7_1.heavy 627.845 / 997.496 5434.0 35.799150466918945 25 12 0 5 8 1.2164989056347497 55.548698103017074 0.048297882080078125 4 0.894235800304083 3.7608744069946565 5434.0 41.55831910682254 2.0 - - - - - - - 272.0 41 8 DENND2C DENN/MADD domain containing 2C 887 113 C20140709_OR011_01 C20140709_OR011_01 TB416578.[MT7]-C[CAM]SVC[CAM]EK[MT7].2y4_1.heavy 535.764 / 679.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIC2 hypermethylated in cancer 2 889 113 C20140709_OR011_01 C20140709_OR011_01 TB416578.[MT7]-C[CAM]SVC[CAM]EK[MT7].2y5_1.heavy 535.764 / 766.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIC2 hypermethylated in cancer 2 891 113 C20140709_OR011_01 C20140709_OR011_01 TB416578.[MT7]-C[CAM]SVC[CAM]EK[MT7].2y3_1.heavy 535.764 / 580.288 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIC2 hypermethylated in cancer 2 893 113 C20140709_OR011_01 C20140709_OR011_01 TB416578.[MT7]-C[CAM]SVC[CAM]EK[MT7].2b5_1.heavy 535.764 / 780.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIC2 hypermethylated in cancer 2 895 114 C20140709_OR011_01 C20140709_OR011_01 TB416673.[MT7]-ALSFSDGGSK[MT7].2y8_1.heavy 628.84 / 928.449 4876.0 26.82979965209961 45 15 10 10 10 2.1079881683580792 33.13813482984702 0.0 3 0.9574059778239397 5.958464187072381 4876.0 56.07241452991453 0.0 - - - - - - - 190.16666666666666 9 6 LZTS1 leucine zipper, putative tumor suppressor 1 897 114 C20140709_OR011_01 C20140709_OR011_01 TB416673.[MT7]-ALSFSDGGSK[MT7].2y5_1.heavy 628.84 / 607.317 1556.0 26.82979965209961 45 15 10 10 10 2.1079881683580792 33.13813482984702 0.0 3 0.9574059778239397 5.958464187072381 1556.0 2.356657877195156 10.0 - - - - - - - 666.8571428571429 3 7 LZTS1 leucine zipper, putative tumor suppressor 1 899 114 C20140709_OR011_01 C20140709_OR011_01 TB416673.[MT7]-ALSFSDGGSK[MT7].2y9_1.heavy 628.84 / 1041.53 4980.0 26.82979965209961 45 15 10 10 10 2.1079881683580792 33.13813482984702 0.0 3 0.9574059778239397 5.958464187072381 4980.0 35.150695028444225 0.0 - - - - - - - 155.75 9 4 LZTS1 leucine zipper, putative tumor suppressor 1 901 114 C20140709_OR011_01 C20140709_OR011_01 TB416673.[MT7]-ALSFSDGGSK[MT7].2y6_1.heavy 628.84 / 694.349 3735.0 26.82979965209961 45 15 10 10 10 2.1079881683580792 33.13813482984702 0.0 3 0.9574059778239397 5.958464187072381 3735.0 38.27947733737324 0.0 - - - - - - - 163.0 7 7 LZTS1 leucine zipper, putative tumor suppressor 1 903 115 C20140709_OR011_01 C20140709_OR011_01 TB447077.[MT7]-RYSLELGK[MT7].3y3_1.heavy 418.587 / 461.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - C22orf31 chromosome 22 open reading frame 31 905 115 C20140709_OR011_01 C20140709_OR011_01 TB447077.[MT7]-RYSLELGK[MT7].3b4_1.heavy 418.587 / 664.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - C22orf31 chromosome 22 open reading frame 31 907 115 C20140709_OR011_01 C20140709_OR011_01 TB447077.[MT7]-RYSLELGK[MT7].3b5_1.heavy 418.587 / 793.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - C22orf31 chromosome 22 open reading frame 31 909 115 C20140709_OR011_01 C20140709_OR011_01 TB447077.[MT7]-RYSLELGK[MT7].3b3_1.heavy 418.587 / 551.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - C22orf31 chromosome 22 open reading frame 31 911 116 C20140709_OR011_01 C20140709_OR011_01 TB416975.[MT7]-DMGPPTFPEDVPALQR.3y7_1.heavy 638.656 / 798.447 4167.0 38.27002429962158 39 20 6 5 8 7.295068424488599 13.707890616119922 0.043498992919921875 4 0.9960431759662826 19.613075270682124 4167.0 1.4441827986353917 2.0 - - - - - - - 179.0 13 3 LZTS1 leucine zipper, putative tumor suppressor 1 913 116 C20140709_OR011_01 C20140709_OR011_01 TB416975.[MT7]-DMGPPTFPEDVPALQR.3y6_1.heavy 638.656 / 683.42 5108.0 38.27002429962158 39 20 6 5 8 7.295068424488599 13.707890616119922 0.043498992919921875 4 0.9960431759662826 19.613075270682124 5108.0 3.0509767441860465 1.0 - - - - - - - 653.0 10 7 LZTS1 leucine zipper, putative tumor suppressor 1 915 116 C20140709_OR011_01 C20140709_OR011_01 TB416975.[MT7]-DMGPPTFPEDVPALQR.3y5_1.heavy 638.656 / 584.352 12635.0 38.27002429962158 39 20 6 5 8 7.295068424488599 13.707890616119922 0.043498992919921875 4 0.9960431759662826 19.613075270682124 12635.0 0.3859189876918815 2.0 - - - - - - - 201.5 37 2 LZTS1 leucine zipper, putative tumor suppressor 1 917 116 C20140709_OR011_01 C20140709_OR011_01 TB416975.[MT7]-DMGPPTFPEDVPALQR.3y9_1.heavy 638.656 / 1024.54 7930.0 38.27002429962158 39 20 6 5 8 7.295068424488599 13.707890616119922 0.043498992919921875 4 0.9960431759662826 19.613075270682124 7930.0 0.09496001487818484 1.0 - - - - - - - 268.6666666666667 15 6 LZTS1 leucine zipper, putative tumor suppressor 1 919 117 C20140709_OR011_01 C20140709_OR011_01 TB447079.[MT7]-QEVQNLIK[MT7].2b3_1.heavy 630.382 / 501.279 7194.0 28.434600830078125 34 14 2 10 8 1.1746217162919093 56.75586083758313 0.0 4 0.9341913139267904 4.7842051742392355 7194.0 -3.8402135231316734 1.0 - - - - - - - 196.5 46 4 DPYSL3 dihydropyrimidinase-like 3 921 117 C20140709_OR011_01 C20140709_OR011_01 TB447079.[MT7]-QEVQNLIK[MT7].2b4_1.heavy 630.382 / 629.338 4946.0 28.434600830078125 34 14 2 10 8 1.1746217162919093 56.75586083758313 0.0 4 0.9341913139267904 4.7842051742392355 4946.0 -2.1982222222222205 0.0 - - - - - - - 196.5 9 8 DPYSL3 dihydropyrimidinase-like 3 923 117 C20140709_OR011_01 C20140709_OR011_01 TB447079.[MT7]-QEVQNLIK[MT7].2b6_1.heavy 630.382 / 856.464 7869.0 28.434600830078125 34 14 2 10 8 1.1746217162919093 56.75586083758313 0.0 4 0.9341913139267904 4.7842051742392355 7869.0 -0.349733333333333 0.0 - - - - - - - 168.5 15 2 DPYSL3 dihydropyrimidinase-like 3 925 117 C20140709_OR011_01 C20140709_OR011_01 TB447079.[MT7]-QEVQNLIK[MT7].2b5_1.heavy 630.382 / 743.38 5059.0 28.434600830078125 34 14 2 10 8 1.1746217162919093 56.75586083758313 0.0 4 0.9341913139267904 4.7842051742392355 5059.0 -0.4503560830860547 0.0 - - - - - - - 206.0 10 6 DPYSL3 dihydropyrimidinase-like 3 927 118 C20140709_OR011_01 C20140709_OR011_01 TB416971.[MT7]-LMPFSNQLEMGSEK[MT7].3y6_1.heavy 633.658 / 824.394 22735.0 39.24599838256836 46 16 10 10 10 3.2093058403506642 31.159386164664664 0.0 3 0.9632718903056414 6.419848872829974 22735.0 83.68213917310379 0.0 - - - - - - - 308.8888888888889 45 9 LZTS1 leucine zipper, putative tumor suppressor 1 929 118 C20140709_OR011_01 C20140709_OR011_01 TB416971.[MT7]-LMPFSNQLEMGSEK[MT7].3y4_1.heavy 633.658 / 564.311 58731.0 39.24599838256836 46 16 10 10 10 3.2093058403506642 31.159386164664664 0.0 3 0.9632718903056414 6.419848872829974 58731.0 58.47730237580994 0.0 - - - - - - - 303.4 117 5 LZTS1 leucine zipper, putative tumor suppressor 1 931 118 C20140709_OR011_01 C20140709_OR011_01 TB416971.[MT7]-LMPFSNQLEMGSEK[MT7].3b7_1.heavy 633.658 / 962.489 14146.0 39.24599838256836 46 16 10 10 10 3.2093058403506642 31.159386164664664 0.0 3 0.9632718903056414 6.419848872829974 14146.0 36.865068467987044 0.0 - - - - - - - 224.77777777777777 28 9 LZTS1 leucine zipper, putative tumor suppressor 1 933 118 C20140709_OR011_01 C20140709_OR011_01 TB416971.[MT7]-LMPFSNQLEMGSEK[MT7].3y5_1.heavy 633.658 / 695.351 25261.0 39.24599838256836 46 16 10 10 10 3.2093058403506642 31.159386164664664 0.0 3 0.9632718903056414 6.419848872829974 25261.0 38.92517740786542 0.0 - - - - - - - 306.7142857142857 50 7 LZTS1 leucine zipper, putative tumor suppressor 1 935 119 C20140709_OR011_01 C20140709_OR011_01 TB416972.[MT7]-HSPTRETLTYAQAQR.3y7_1.heavy 635.002 / 837.421 1513.0 20.71677541732788 41 15 10 6 10 3.3583057793476434 29.776919247485907 0.03989982604980469 3 0.9533737427658873 5.6930502699713035 1513.0 23.93160679476469 0.0 - - - - - - - 315.3333333333333 3 3 BRD1 bromodomain containing 1 937 119 C20140709_OR011_01 C20140709_OR011_01 TB416972.[MT7]-HSPTRETLTYAQAQR.3y14_2.heavy 635.002 / 811.418 6146.0 20.71677541732788 41 15 10 6 10 3.3583057793476434 29.776919247485907 0.03989982604980469 3 0.9533737427658873 5.6930502699713035 6146.0 27.23786860856628 0.0 - - - - - - - 331.0 12 4 BRD1 bromodomain containing 1 939 119 C20140709_OR011_01 C20140709_OR011_01 TB416972.[MT7]-HSPTRETLTYAQAQR.3y5_1.heavy 635.002 / 573.31 851.0 20.71677541732788 41 15 10 6 10 3.3583057793476434 29.776919247485907 0.03989982604980469 3 0.9533737427658873 5.6930502699713035 851.0 17.199157894736842 4.0 - - - - - - - 189.4 2 10 BRD1 bromodomain containing 1 941 119 C20140709_OR011_01 C20140709_OR011_01 TB416972.[MT7]-HSPTRETLTYAQAQR.3y13_2.heavy 635.002 / 767.902 2742.0 20.71677541732788 41 15 10 6 10 3.3583057793476434 29.776919247485907 0.03989982604980469 3 0.9533737427658873 5.6930502699713035 2742.0 19.116760563380282 0.0 - - - - - - - 331.0 5 4 BRD1 bromodomain containing 1 943 120 C20140709_OR011_01 C20140709_OR011_01 TB447279.[MT7]-VEEQAILDAMAEETR.3b4_1.heavy 616.976 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM35 tripartite motif-containing 35 945 120 C20140709_OR011_01 C20140709_OR011_01 TB447279.[MT7]-VEEQAILDAMAEETR.3b5_1.heavy 616.976 / 701.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM35 tripartite motif-containing 35 947 120 C20140709_OR011_01 C20140709_OR011_01 TB447279.[MT7]-VEEQAILDAMAEETR.3b3_1.heavy 616.976 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM35 tripartite motif-containing 35 949 120 C20140709_OR011_01 C20140709_OR011_01 TB447279.[MT7]-VEEQAILDAMAEETR.3y8_1.heavy 616.976 / 922.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - TRIM35 tripartite motif-containing 35 951 121 C20140709_OR011_01 C20140709_OR011_01 TB589838.[MT7]-ENVGLDINENTK[MT7].3y3_1.heavy 545.293 / 506.306 9085.0 28.169200897216797 48 18 10 10 10 3.8812856895128234 25.764658414658456 0.0 3 0.9867173775148661 10.696422921686988 9085.0 5.0513363463899115 0.0 - - - - - - - 770.5 18 8 DENND2C DENN/MADD domain containing 2C 953 121 C20140709_OR011_01 C20140709_OR011_01 TB589838.[MT7]-ENVGLDINENTK[MT7].3b6_1.heavy 545.293 / 772.396 15034.0 28.169200897216797 48 18 10 10 10 3.8812856895128234 25.764658414658456 0.0 3 0.9867173775148661 10.696422921686988 15034.0 80.7942975412387 0.0 - - - - - - - 194.5 30 10 DENND2C DENN/MADD domain containing 2C 955 121 C20140709_OR011_01 C20140709_OR011_01 TB589838.[MT7]-ENVGLDINENTK[MT7].3b4_1.heavy 545.293 / 544.285 13736.0 28.169200897216797 48 18 10 10 10 3.8812856895128234 25.764658414658456 0.0 3 0.9867173775148661 10.696422921686988 13736.0 16.289565403977882 0.0 - - - - - - - 1174.5714285714287 27 7 DENND2C DENN/MADD domain containing 2C 957 121 C20140709_OR011_01 C20140709_OR011_01 TB589838.[MT7]-ENVGLDINENTK[MT7].3y5_1.heavy 545.293 / 749.391 2812.0 28.169200897216797 48 18 10 10 10 3.8812856895128234 25.764658414658456 0.0 3 0.9867173775148661 10.696422921686988 2812.0 13.795779420825632 0.0 - - - - - - - 204.11111111111111 5 9 DENND2C DENN/MADD domain containing 2C 959 122 C20140709_OR011_01 C20140709_OR011_01 TB589835.[MT7]-K[MT7]PAEYGYVSLGR.3y7_1.heavy 543.306 / 751.41 18970.0 28.443175792694092 40 14 10 6 10 2.009000979038967 40.52531574565721 0.03429985046386719 3 0.9398453932778702 5.006410314040159 18970.0 238.50913978494626 0.0 - - - - - - - 203.25 37 8 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 961 122 C20140709_OR011_01 C20140709_OR011_01 TB589835.[MT7]-K[MT7]PAEYGYVSLGR.3b4_1.heavy 543.306 / 714.439 6829.0 28.443175792694092 40 14 10 6 10 2.009000979038967 40.52531574565721 0.03429985046386719 3 0.9398453932778702 5.006410314040159 6829.0 22.881144275079762 0.0 - - - - - - - 289.1111111111111 13 9 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 963 122 C20140709_OR011_01 C20140709_OR011_01 TB589835.[MT7]-K[MT7]PAEYGYVSLGR.3y8_1.heavy 543.306 / 914.473 8564.0 28.443175792694092 40 14 10 6 10 2.009000979038967 40.52531574565721 0.03429985046386719 3 0.9398453932778702 5.006410314040159 8564.0 62.93703703703704 1.0 - - - - - - - 206.8181818181818 17 11 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 965 122 C20140709_OR011_01 C20140709_OR011_01 TB589835.[MT7]-K[MT7]PAEYGYVSLGR.3y5_1.heavy 543.306 / 531.325 29268.0 28.443175792694092 40 14 10 6 10 2.009000979038967 40.52531574565721 0.03429985046386719 3 0.9398453932778702 5.006410314040159 29268.0 74.03784694417165 0.0 - - - - - - - 225.83333333333334 58 12 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 967 123 C20140709_OR011_01 C20140709_OR011_01 TB589834.[MT7]-VNLLEQELQELR.3y6_1.heavy 543.309 / 787.431 2758.0 45.7338981628418 42 12 10 10 10 3.791456390790957 26.375089066800115 0.0 3 0.8904908575406506 3.6948078050554343 2758.0 54.90103286384976 0.0 - - - - - - - 131.14285714285714 5 7 LZTS1 leucine zipper, putative tumor suppressor 1 969 123 C20140709_OR011_01 C20140709_OR011_01 TB589834.[MT7]-VNLLEQELQELR.3b4_1.heavy 543.309 / 584.389 6082.0 45.7338981628418 42 12 10 10 10 3.791456390790957 26.375089066800115 0.0 3 0.8904908575406506 3.6948078050554343 6082.0 51.70073428063053 0.0 - - - - - - - 135.58333333333334 12 12 LZTS1 leucine zipper, putative tumor suppressor 1 971 123 C20140709_OR011_01 C20140709_OR011_01 TB589834.[MT7]-VNLLEQELQELR.3y4_1.heavy 543.309 / 545.304 5657.0 45.7338981628418 42 12 10 10 10 3.791456390790957 26.375089066800115 0.0 3 0.8904908575406506 3.6948078050554343 5657.0 44.90668170313009 0.0 - - - - - - - 155.4 11 5 LZTS1 leucine zipper, putative tumor suppressor 1 973 123 C20140709_OR011_01 C20140709_OR011_01 TB589834.[MT7]-VNLLEQELQELR.3y5_1.heavy 543.309 / 658.388 1485.0 45.7338981628418 42 12 10 10 10 3.791456390790957 26.375089066800115 0.0 3 0.8904908575406506 3.6948078050554343 1485.0 16.840531914893617 0.0 - - - - - - - 194.375 2 8 LZTS1 leucine zipper, putative tumor suppressor 1 975 124 C20140709_OR011_01 C20140709_OR011_01 TB416560.[MT7]-GVIFPTLR.2y5_1.heavy 523.828 / 633.372 2219.0 38.00789928436279 36 15 10 5 6 16.026558168677706 6.239642906949287 0.043201446533203125 5 0.9550556385632148 5.799420516058597 2219.0 10.54029231428186 0.0 - - - - - - - 235.2 4 5 ADCY8 adenylate cyclase 8 (brain) 977 124 C20140709_OR011_01 C20140709_OR011_01 TB416560.[MT7]-GVIFPTLR.2b4_1.heavy 523.828 / 561.352 1958.0 38.00789928436279 36 15 10 5 6 16.026558168677706 6.239642906949287 0.043201446533203125 5 0.9550556385632148 5.799420516058597 1958.0 7.726513644658018 1.0 - - - - - - - 261.1666666666667 4 6 ADCY8 adenylate cyclase 8 (brain) 979 124 C20140709_OR011_01 C20140709_OR011_01 TB416560.[MT7]-GVIFPTLR.2y6_1.heavy 523.828 / 746.456 1175.0 38.00789928436279 36 15 10 5 6 16.026558168677706 6.239642906949287 0.043201446533203125 5 0.9550556385632148 5.799420516058597 1175.0 5.079406130268199 1.0 - - - - - - - 304.6666666666667 2 3 ADCY8 adenylate cyclase 8 (brain) 981 124 C20140709_OR011_01 C20140709_OR011_01 TB416560.[MT7]-GVIFPTLR.2y7_1.heavy 523.828 / 845.524 1436.0 38.00789928436279 36 15 10 5 6 16.026558168677706 6.239642906949287 0.043201446533203125 5 0.9550556385632148 5.799420516058597 1436.0 2.3812393368323717 1.0 - - - - - - - 305.0 3 3 ADCY8 adenylate cyclase 8 (brain) 983 125 C20140709_OR011_01 C20140709_OR011_01 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 12890.0 22.532800674438477 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 12890.0 230.34907407407405 0.0 - - - - - - - 198.5 25 6 985 125 C20140709_OR011_01 C20140709_OR011_01 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 16681.0 22.532800674438477 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 16681.0 174.98416524216523 0.0 - - - - - - - 135.25 33 4 987 125 C20140709_OR011_01 C20140709_OR011_01 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 56867.0 22.532800674438477 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 56867.0 757.0862207714628 0.0 - - - - - - - 189.5 113 4 989 126 C20140709_OR011_01 C20140709_OR011_01 TB447377.[MT7]-VLSGAWVGFEHAGFQGQQYILER.4y4_1.heavy 684.856 / 530.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRYBA4 crystallin, beta A4 991 126 C20140709_OR011_01 C20140709_OR011_01 TB447377.[MT7]-VLSGAWVGFEHAGFQGQQYILER.4y5_1.heavy 684.856 / 693.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRYBA4 crystallin, beta A4 993 126 C20140709_OR011_01 C20140709_OR011_01 TB447377.[MT7]-VLSGAWVGFEHAGFQGQQYILER.4b4_1.heavy 684.856 / 501.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRYBA4 crystallin, beta A4 995 126 C20140709_OR011_01 C20140709_OR011_01 TB447377.[MT7]-VLSGAWVGFEHAGFQGQQYILER.4b5_1.heavy 684.856 / 572.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRYBA4 crystallin, beta A4 997 127 C20140709_OR011_01 C20140709_OR011_01 TB416805.[MT7]-IFQC[CAM]NTC[CAM]VK[MT7].2b3_1.heavy 729.378 / 533.32 1382.0 28.255924701690674 22 8 0 6 8 3.18103306918271 31.43632833269872 0.03849983215332031 4 0.7818160431999817 2.5924972326853033 1382.0 17.474296262113523 3.0 - - - - - - - 175.44444444444446 32 9 ZNF595 zinc finger protein 595 999 127 C20140709_OR011_01 C20140709_OR011_01 TB416805.[MT7]-IFQC[CAM]NTC[CAM]VK[MT7].2y8_1.heavy 729.378 / 1200.56 790.0 28.255924701690674 22 8 0 6 8 3.18103306918271 31.43632833269872 0.03849983215332031 4 0.7818160431999817 2.5924972326853033 790.0 10.38263377013377 0.0 - - - - - - - 0.0 1 0 ZNF595 zinc finger protein 595 1001 127 C20140709_OR011_01 C20140709_OR011_01 TB416805.[MT7]-IFQC[CAM]NTC[CAM]VK[MT7].2y3_1.heavy 729.378 / 550.314 1185.0 28.255924701690674 22 8 0 6 8 3.18103306918271 31.43632833269872 0.03849983215332031 4 0.7818160431999817 2.5924972326853033 1185.0 4.283108108108108 0.0 - - - - - - - 175.55555555555554 2 9 ZNF595 zinc finger protein 595 1003 127 C20140709_OR011_01 C20140709_OR011_01 TB416805.[MT7]-IFQC[CAM]NTC[CAM]VK[MT7].2y6_1.heavy 729.378 / 925.435 2370.0 28.255924701690674 22 8 0 6 8 3.18103306918271 31.43632833269872 0.03849983215332031 4 0.7818160431999817 2.5924972326853033 2370.0 35.13136440547608 0.0 - - - - - - - 138.2 4 5 ZNF595 zinc finger protein 595 1005 128 C20140709_OR011_01 C20140709_OR011_01 TB447060.[MT7]-MVEIEIEGR.2b3_1.heavy 610.327 / 504.261 8642.0 33.71590042114258 40 10 10 10 10 0.6549909841175459 79.72336457783197 0.0 3 0.8267293942882268 2.9209206610605443 8642.0 19.60614284244108 0.0 - - - - - - - 737.5714285714286 17 7 BRD1 bromodomain containing 1 1007 128 C20140709_OR011_01 C20140709_OR011_01 TB447060.[MT7]-MVEIEIEGR.2y8_1.heavy 610.327 / 944.505 14122.0 33.71590042114258 40 10 10 10 10 0.6549909841175459 79.72336457783197 0.0 3 0.8267293942882268 2.9209206610605443 14122.0 187.9873726021214 0.0 - - - - - - - 228.25 28 12 BRD1 bromodomain containing 1 1009 128 C20140709_OR011_01 C20140709_OR011_01 TB447060.[MT7]-MVEIEIEGR.2b5_1.heavy 610.327 / 746.388 6745.0 33.71590042114258 40 10 10 10 10 0.6549909841175459 79.72336457783197 0.0 3 0.8267293942882268 2.9209206610605443 6745.0 21.425356574634712 0.0 - - - - - - - 274.06666666666666 13 15 BRD1 bromodomain containing 1 1011 128 C20140709_OR011_01 C20140709_OR011_01 TB447060.[MT7]-MVEIEIEGR.2y7_1.heavy 610.327 / 845.436 5796.0 33.71590042114258 40 10 10 10 10 0.6549909841175459 79.72336457783197 0.0 3 0.8267293942882268 2.9209206610605443 5796.0 6.400427046263345 1.0 - - - - - - - 187.11111111111111 11 9 BRD1 bromodomain containing 1 1013 129 C20140709_OR011_01 C20140709_OR011_01 TB416981.[MT7]-GMYDGPVFDLTTTPK[MT7].4b4_1.heavy 483.252 / 611.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL3 dihydropyrimidinase-like 3 1015 129 C20140709_OR011_01 C20140709_OR011_01 TB416981.[MT7]-GMYDGPVFDLTTTPK[MT7].4b5_1.heavy 483.252 / 668.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL3 dihydropyrimidinase-like 3 1017 129 C20140709_OR011_01 C20140709_OR011_01 TB416981.[MT7]-GMYDGPVFDLTTTPK[MT7].4b9_1.heavy 483.252 / 1126.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL3 dihydropyrimidinase-like 3 1019 129 C20140709_OR011_01 C20140709_OR011_01 TB416981.[MT7]-GMYDGPVFDLTTTPK[MT7].4b3_1.heavy 483.252 / 496.235 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL3 dihydropyrimidinase-like 3 1021 130 C20140709_OR011_01 C20140709_OR011_01 TB447062.[MT7]-IRQEFDK[MT7].3b6_2.heavy 408.571 / 467.249 9630.0 22.67990016937256 26 13 4 5 4 1.5249871658722831 43.55369899954623 0.04120063781738281 10 0.9068290213370398 4.011353607827796 9630.0 25.33405506647633 0.0 - - - - - - - 351.0 19 7 TRIM35 tripartite motif-containing 35 1023 130 C20140709_OR011_01 C20140709_OR011_01 TB447062.[MT7]-IRQEFDK[MT7].3y3_1.heavy 408.571 / 553.31 9139.0 22.67990016937256 26 13 4 5 4 1.5249871658722831 43.55369899954623 0.04120063781738281 10 0.9068290213370398 4.011353607827796 9139.0 73.34788574378388 0.0 - - - - - - - 223.45454545454547 18 11 TRIM35 tripartite motif-containing 35 1025 130 C20140709_OR011_01 C20140709_OR011_01 TB447062.[MT7]-IRQEFDK[MT7].3b4_1.heavy 408.571 / 671.396 2653.0 22.67990016937256 26 13 4 5 4 1.5249871658722831 43.55369899954623 0.04120063781738281 10 0.9068290213370398 4.011353607827796 2653.0 0.4326924372872296 16.0 - - - - - - - 353.7 32 10 TRIM35 tripartite motif-containing 35 1027 130 C20140709_OR011_01 C20140709_OR011_01 TB447062.[MT7]-IRQEFDK[MT7].3b3_1.heavy 408.571 / 542.353 688.0 22.67990016937256 26 13 4 5 4 1.5249871658722831 43.55369899954623 0.04120063781738281 10 0.9068290213370398 4.011353607827796 688.0 0.766754508575186 9.0 - - - - - - - 252.71428571428572 18 7 TRIM35 tripartite motif-containing 35 1029 131 C20140709_OR011_01 C20140709_OR011_01 TB447064.[MT7]-HVILSEIK[MT7].3y3_1.heavy 409.595 / 533.341 4393.0 28.246299743652344 43 13 10 10 10 1.298358162490156 47.577326085373855 0.0 3 0.9263556462278626 4.519502493116611 4393.0 -0.9097928994082842 0.0 - - - - - - - 338.0 8 1 TCF25 transcription factor 25 (basic helix-loop-helix) 1031 131 C20140709_OR011_01 C20140709_OR011_01 TB447064.[MT7]-HVILSEIK[MT7].3b5_1.heavy 409.595 / 694.437 676.0 28.246299743652344 43 13 10 10 10 1.298358162490156 47.577326085373855 0.0 3 0.9263556462278626 4.519502493116611 676.0 -0.14000000000000012 3.0 - - - - - - - 0.0 1 0 TCF25 transcription factor 25 (basic helix-loop-helix) 1033 131 C20140709_OR011_01 C20140709_OR011_01 TB447064.[MT7]-HVILSEIK[MT7].3y4_1.heavy 409.595 / 620.374 8335.0 28.246299743652344 43 13 10 10 10 1.298358162490156 47.577326085373855 0.0 3 0.9263556462278626 4.519502493116611 8335.0 -7.376106194690266 0.0 - - - - - - - 150.33333333333334 16 3 TCF25 transcription factor 25 (basic helix-loop-helix) 1035 131 C20140709_OR011_01 C20140709_OR011_01 TB447064.[MT7]-HVILSEIK[MT7].3b3_1.heavy 409.595 / 494.321 3717.0 28.246299743652344 43 13 10 10 10 1.298358162490156 47.577326085373855 0.0 3 0.9263556462278626 4.519502493116611 3717.0 0.0 0.0 - - - - - - - 338.0 7 1 TCF25 transcription factor 25 (basic helix-loop-helix) 1037 132 C20140709_OR011_01 C20140709_OR011_01 TB447068.[MT7]-ERYEDYLC[CAM]WVK[MT7].3b6_1.heavy 616.978 / 1000.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - C22orf42 chromosome 22 open reading frame 42 1039 132 C20140709_OR011_01 C20140709_OR011_01 TB447068.[MT7]-ERYEDYLC[CAM]WVK[MT7].3y3_1.heavy 616.978 / 576.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - C22orf42 chromosome 22 open reading frame 42 1041 132 C20140709_OR011_01 C20140709_OR011_01 TB447068.[MT7]-ERYEDYLC[CAM]WVK[MT7].3b5_1.heavy 616.978 / 837.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - C22orf42 chromosome 22 open reading frame 42 1043 132 C20140709_OR011_01 C20140709_OR011_01 TB447068.[MT7]-ERYEDYLC[CAM]WVK[MT7].3y4_1.heavy 616.978 / 736.393 N/A N/A - - - - - - - - - 0.0 - - - - - - - C22orf42 chromosome 22 open reading frame 42 1045 133 C20140709_OR011_01 C20140709_OR011_01 TB416709.[MT7]-SHGDLGGSYK[MT7].3b6_2.heavy 436.898 / 356.181 5513.0 18.84119987487793 43 13 10 10 10 1.1345518995432666 58.22519110528198 0.0 3 0.9176228914810977 4.270037556310583 5513.0 11.026 0.0 - - - - - - - 236.5 11 10 CRYBB3 crystallin, beta B3 1047 133 C20140709_OR011_01 C20140709_OR011_01 TB416709.[MT7]-SHGDLGGSYK[MT7].3b6_1.heavy 436.898 / 711.354 613.0 18.84119987487793 43 13 10 10 10 1.1345518995432666 58.22519110528198 0.0 3 0.9176228914810977 4.270037556310583 613.0 3.3277142857142854 7.0 - - - - - - - 0.0 1 0 CRYBB3 crystallin, beta B3 1049 133 C20140709_OR011_01 C20140709_OR011_01 TB416709.[MT7]-SHGDLGGSYK[MT7].3y4_1.heavy 436.898 / 598.332 4288.0 18.84119987487793 43 13 10 10 10 1.1345518995432666 58.22519110528198 0.0 3 0.9176228914810977 4.270037556310583 4288.0 53.6 0.0 - - - - - - - 197.25 8 8 CRYBB3 crystallin, beta B3 1051 133 C20140709_OR011_01 C20140709_OR011_01 TB416709.[MT7]-SHGDLGGSYK[MT7].3y5_1.heavy 436.898 / 655.353 6475.0 18.84119987487793 43 13 10 10 10 1.1345518995432666 58.22519110528198 0.0 3 0.9176228914810977 4.270037556310583 6475.0 61.79 0.0 - - - - - - - 175.125 12 8 CRYBB3 crystallin, beta B3 1053 134 C20140709_OR011_01 C20140709_OR011_01 TB416982.[MT7]-GMYDGPVFDLTTTPK[MT7].3b9_1.heavy 644.001 / 1126.5 10227.0 39.58190155029297 50 20 10 10 10 9.223230153059571 10.842188511020465 0.0 3 0.9973465069279529 23.952856400004865 10227.0 91.9358079144385 0.0 - - - - - - - 263.3333333333333 20 9 DPYSL3 dihydropyrimidinase-like 3 1055 134 C20140709_OR011_01 C20140709_OR011_01 TB416982.[MT7]-GMYDGPVFDLTTTPK[MT7].3b4_1.heavy 644.001 / 611.262 20579.0 39.58190155029297 50 20 10 10 10 9.223230153059571 10.842188511020465 0.0 3 0.9973465069279529 23.952856400004865 20579.0 104.6495826085089 0.0 - - - - - - - 294.72727272727275 41 11 DPYSL3 dihydropyrimidinase-like 3 1057 134 C20140709_OR011_01 C20140709_OR011_01 TB416982.[MT7]-GMYDGPVFDLTTTPK[MT7].3b5_1.heavy 644.001 / 668.283 31928.0 39.58190155029297 50 20 10 10 10 9.223230153059571 10.842188511020465 0.0 3 0.9973465069279529 23.952856400004865 31928.0 84.18967160702867 0.0 - - - - - - - 320.85714285714283 63 7 DPYSL3 dihydropyrimidinase-like 3 1059 134 C20140709_OR011_01 C20140709_OR011_01 TB416982.[MT7]-GMYDGPVFDLTTTPK[MT7].3b7_1.heavy 644.001 / 864.404 14218.0 39.58190155029297 50 20 10 10 10 9.223230153059571 10.842188511020465 0.0 3 0.9973465069279529 23.952856400004865 14218.0 68.65783684566445 0.0 - - - - - - - 286.6 28 10 DPYSL3 dihydropyrimidinase-like 3 1061 135 C20140709_OR011_01 C20140709_OR011_01 TB416983.[MT7]-FIHGHRGGSGSGSGGSGK[MT7].4y4_1.heavy 483.253 / 492.29 3580.0 15.458399772644043 42 14 10 10 8 2.471727336673176 40.45753692824189 0.0 4 0.9398182447198953 5.005269387144289 3580.0 30.765624999999996 2.0 - - - - - - - 214.41176470588235 7 17 ADCY8 adenylate cyclase 8 (brain) 1063 135 C20140709_OR011_01 C20140709_OR011_01 TB416983.[MT7]-FIHGHRGGSGSGSGGSGK[MT7].4b11_2.heavy 483.253 / 619.319 256.0 15.458399772644043 42 14 10 10 8 2.471727336673176 40.45753692824189 0.0 4 0.9398182447198953 5.005269387144289 256.0 5.704 5.0 - - - - - - - 0.0 1 0 ADCY8 adenylate cyclase 8 (brain) 1065 135 C20140709_OR011_01 C20140709_OR011_01 TB416983.[MT7]-FIHGHRGGSGSGSGGSGK[MT7].4b12_2.heavy 483.253 / 647.83 1726.0 15.458399772644043 42 14 10 10 8 2.471727336673176 40.45753692824189 0.0 4 0.9398182447198953 5.005269387144289 1726.0 17.080208333333335 0.0 - - - - - - - 224.0 3 2 ADCY8 adenylate cyclase 8 (brain) 1067 135 C20140709_OR011_01 C20140709_OR011_01 TB416983.[MT7]-FIHGHRGGSGSGSGGSGK[MT7].4b10_2.heavy 483.253 / 575.803 959.0 15.458399772644043 42 14 10 10 8 2.471727336673176 40.45753692824189 0.0 4 0.9398182447198953 5.005269387144289 959.0 13.186250000000001 0.0 - - - - - - - 0.0 1 0 ADCY8 adenylate cyclase 8 (brain) 1069 136 C20140709_OR011_01 C20140709_OR011_01 TB447268.[MT7]-K[MT7]QPGVHEEPVLK[MT7].4y4_1.heavy 449.022 / 600.42 6005.0 21.368200302124023 39 11 10 10 8 2.8857665330259876 34.65283793943682 0.0 4 0.8678093725354182 3.3562750170329196 6005.0 27.366792377248988 2.0 - - - - - - - 173.125 13 8 C22orf31 chromosome 22 open reading frame 31 1071 136 C20140709_OR011_01 C20140709_OR011_01 TB447268.[MT7]-K[MT7]QPGVHEEPVLK[MT7].4b8_2.heavy 449.022 / 597.33 2679.0 21.368200302124023 39 11 10 10 8 2.8857665330259876 34.65283793943682 0.0 4 0.8678093725354182 3.3562750170329196 2679.0 37.24045479516559 0.0 - - - - - - - 184.57142857142858 5 7 C22orf31 chromosome 22 open reading frame 31 1073 136 C20140709_OR011_01 C20140709_OR011_01 TB447268.[MT7]-K[MT7]QPGVHEEPVLK[MT7].4b5_1.heavy 449.022 / 798.508 1109.0 21.368200302124023 39 11 10 10 8 2.8857665330259876 34.65283793943682 0.0 4 0.8678093725354182 3.3562750170329196 1109.0 23.505978260869565 1.0 - - - - - - - 92.0 2 1 C22orf31 chromosome 22 open reading frame 31 1075 136 C20140709_OR011_01 C20140709_OR011_01 TB447268.[MT7]-K[MT7]QPGVHEEPVLK[MT7].4y3_1.heavy 449.022 / 503.367 2864.0 21.368200302124023 39 11 10 10 8 2.8857665330259876 34.65283793943682 0.0 4 0.8678093725354182 3.3562750170329196 2864.0 24.01300107327544 0.0 - - - - - - - 215.55555555555554 5 9 C22orf31 chromosome 22 open reading frame 31 1077 137 C20140709_OR011_01 C20140709_OR011_01 TB416701.[MT7]-RIEHTIDLR.3y4_1.heavy 432.922 / 516.314 658.0 23.16189956665039 35 8 9 10 8 0.68800006468366 83.42173367041144 0.0 4 0.7971700519560802 2.692565968422532 658.0 3.784876179048762 10.0 - - - - - - - 219.42857142857142 5 7 ADCY8 adenylate cyclase 8 (brain) 1079 137 C20140709_OR011_01 C20140709_OR011_01 TB416701.[MT7]-RIEHTIDLR.3b3_1.heavy 432.922 / 543.337 1974.0 23.16189956665039 35 8 9 10 8 0.68800006468366 83.42173367041144 0.0 4 0.7971700519560802 2.692565968422532 1974.0 17.94627397260274 0.0 - - - - - - - 241.0 3 5 ADCY8 adenylate cyclase 8 (brain) 1081 137 C20140709_OR011_01 C20140709_OR011_01 TB416701.[MT7]-RIEHTIDLR.3y5_1.heavy 432.922 / 617.362 2632.0 23.16189956665039 35 8 9 10 8 0.68800006468366 83.42173367041144 0.0 4 0.7971700519560802 2.692565968422532 2632.0 28.322031585932315 1.0 - - - - - - - 219.375 10 8 ADCY8 adenylate cyclase 8 (brain) 1083 137 C20140709_OR011_01 C20140709_OR011_01 TB416701.[MT7]-RIEHTIDLR.3b7_2.heavy 432.922 / 505.281 4386.0 23.16189956665039 35 8 9 10 8 0.68800006468366 83.42173367041144 0.0 4 0.7971700519560802 2.692565968422532 4386.0 30.00829475457921 0.0 - - - - - - - 274.25 8 4 ADCY8 adenylate cyclase 8 (brain) 1085 138 C20140709_OR011_01 C20140709_OR011_01 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 77455.0 32.17959976196289 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 77455.0 661.4167934575885 0.0 - - - - - - - 192.0 154 4 1087 138 C20140709_OR011_01 C20140709_OR011_01 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 86439.0 32.17959976196289 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 86439.0 407.3962371835838 0.0 - - - - - - - 255.66666666666666 172 3 1089 138 C20140709_OR011_01 C20140709_OR011_01 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 165428.0 32.17959976196289 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 165428.0 710.7120411236767 0.0 - - - - - - - 219.2 330 10 1091 139 C20140709_OR011_01 C20140709_OR011_01 TB589704.[MT7]-SAADLISQAR.2y5_1.heavy 588.329 / 574.331 6059.0 29.242149353027344 38 18 4 6 10 4.653685864624516 21.48834341401523 0.0345001220703125 3 0.9831286481616069 9.488005691490144 6059.0 21.236495049504953 1.0 - - - - - - - 639.6666666666666 62 9 DPYSL3 dihydropyrimidinase-like 3 1093 139 C20140709_OR011_01 C20140709_OR011_01 TB589704.[MT7]-SAADLISQAR.2y9_1.heavy 588.329 / 944.516 14541.0 29.242149353027344 38 18 4 6 10 4.653685864624516 21.48834341401523 0.0345001220703125 3 0.9831286481616069 9.488005691490144 14541.0 80.62336633663367 0.0 - - - - - - - 202.0 29 12 DPYSL3 dihydropyrimidinase-like 3 1095 139 C20140709_OR011_01 C20140709_OR011_01 TB589704.[MT7]-SAADLISQAR.2y6_1.heavy 588.329 / 687.415 15652.0 29.242149353027344 38 18 4 6 10 4.653685864624516 21.48834341401523 0.0345001220703125 3 0.9831286481616069 9.488005691490144 15652.0 59.728135313531354 0.0 - - - - - - - 692.5714285714286 31 7 DPYSL3 dihydropyrimidinase-like 3 1097 139 C20140709_OR011_01 C20140709_OR011_01 TB589704.[MT7]-SAADLISQAR.2b5_1.heavy 588.329 / 602.327 8785.0 29.242149353027344 38 18 4 6 10 4.653685864624516 21.48834341401523 0.0345001220703125 3 0.9831286481616069 9.488005691490144 8785.0 53.63778877887788 0.0 - - - - - - - 634.8571428571429 17 7 DPYSL3 dihydropyrimidinase-like 3 1099 140 C20140709_OR011_01 C20140709_OR011_01 TB447365.[MT7]-GFLC[CAM]DVIIMVENSIFRAHK[MT7].4b5_1.heavy 635.096 / 737.341 451.0 51.62880039215088 24 15 0 3 6 2.583600113821529 38.705680288922544 0.053600311279296875 6 0.9502549903206968 5.510241461355836 451.0 7.046875 2.0 - - - - - - - 80.19444444444444 3 36 HIC2 hypermethylated in cancer 2 1101 140 C20140709_OR011_01 C20140709_OR011_01 TB447365.[MT7]-GFLC[CAM]DVIIMVENSIFRAHK[MT7].4b7_1.heavy 635.096 / 949.493 217.0 51.62880039215088 24 15 0 3 6 2.583600113821529 38.705680288922544 0.053600311279296875 6 0.9502549903206968 5.510241461355836 217.0 0.7890148044558037 2.0 - - - - - - - 0.0 0 0 HIC2 hypermethylated in cancer 2 1103 140 C20140709_OR011_01 C20140709_OR011_01 TB447365.[MT7]-GFLC[CAM]DVIIMVENSIFRAHK[MT7].4b6_1.heavy 635.096 / 836.409 330.0 51.62880039215088 24 15 0 3 6 2.583600113821529 38.705680288922544 0.053600311279296875 6 0.9502549903206968 5.510241461355836 330.0 6.668141592920354 1.0 - - - - - - - 0.0 0 0 HIC2 hypermethylated in cancer 2 1105 140 C20140709_OR011_01 C20140709_OR011_01 TB447365.[MT7]-GFLC[CAM]DVIIMVENSIFRAHK[MT7].4b4_1.heavy 635.096 / 622.314 129.0 51.62880039215088 24 15 0 3 6 2.583600113821529 38.705680288922544 0.053600311279296875 6 0.9502549903206968 5.510241461355836 129.0 1.6722222222222223 18.0 - - - - - - - 0.0 0 0 HIC2 hypermethylated in cancer 2 1107 141 C20140709_OR011_01 C20140709_OR011_01 TB416802.[MT7]-FGFSQDSGHGK[MT7].3b6_1.heavy 485.58 / 826.385 675.0 24.875999450683594 43 13 10 10 10 1.7270320779604025 40.151122350394935 0.0 3 0.9011070749147744 3.891651899596729 675.0 0.9669928825622776 8.0 - - - - - - - 224.8181818181818 2 11 LZTS1 leucine zipper, putative tumor suppressor 1 1109 141 C20140709_OR011_01 C20140709_OR011_01 TB416802.[MT7]-FGFSQDSGHGK[MT7].3b4_1.heavy 485.58 / 583.3 1912.0 24.875999450683594 43 13 10 10 10 1.7270320779604025 40.151122350394935 0.0 3 0.9011070749147744 3.891651899596729 1912.0 15.34152380952381 1.0 - - - - - - - 262.3333333333333 3 9 LZTS1 leucine zipper, putative tumor suppressor 1 1111 141 C20140709_OR011_01 C20140709_OR011_01 TB416802.[MT7]-FGFSQDSGHGK[MT7].3b5_1.heavy 485.58 / 711.358 1125.0 24.875999450683594 43 13 10 10 10 1.7270320779604025 40.151122350394935 0.0 3 0.9011070749147744 3.891651899596729 1125.0 5.538130563798219 1.0 - - - - - - - 289.14285714285717 2 7 LZTS1 leucine zipper, putative tumor suppressor 1 1113 141 C20140709_OR011_01 C20140709_OR011_01 TB416802.[MT7]-FGFSQDSGHGK[MT7].3b3_1.heavy 485.58 / 496.268 1687.0 24.875999450683594 43 13 10 10 10 1.7270320779604025 40.151122350394935 0.0 3 0.9011070749147744 3.891651899596729 1687.0 15.357055555555556 0.0 - - - - - - - 202.2 3 5 LZTS1 leucine zipper, putative tumor suppressor 1 1115 142 C20140709_OR011_01 C20140709_OR011_01 TB447367.[MT7]-GLSFFAFEHSEEYQQAQHK[MT7].4b8_1.heavy 643.568 / 1043.53 4198.0 36.447898864746094 48 18 10 10 10 7.282066496535895 13.732365674986674 0.0 3 0.9895135601026553 12.04115328606229 4198.0 -1.049937473947478 1.0 - - - - - - - 280.0 9 6 TCF25 transcription factor 25 (basic helix-loop-helix) 1117 142 C20140709_OR011_01 C20140709_OR011_01 TB447367.[MT7]-GLSFFAFEHSEEYQQAQHK[MT7].4b7_1.heavy 643.568 / 914.489 3478.0 36.447898864746094 48 18 10 10 10 7.282066496535895 13.732365674986674 0.0 3 0.9895135601026553 12.04115328606229 3478.0 -2.8983333333333334 0.0 - - - - - - - 120.0 6 4 TCF25 transcription factor 25 (basic helix-loop-helix) 1119 142 C20140709_OR011_01 C20140709_OR011_01 TB447367.[MT7]-GLSFFAFEHSEEYQQAQHK[MT7].4b4_1.heavy 643.568 / 549.315 7676.0 36.447898864746094 48 18 10 10 10 7.282066496535895 13.732365674986674 0.0 3 0.9895135601026553 12.04115328606229 7676.0 -1.599166666666667 0.0 - - - - - - - 320.0 15 6 TCF25 transcription factor 25 (basic helix-loop-helix) 1121 142 C20140709_OR011_01 C20140709_OR011_01 TB447367.[MT7]-GLSFFAFEHSEEYQQAQHK[MT7].4b6_1.heavy 643.568 / 767.421 7076.0 36.447898864746094 48 18 10 10 10 7.282066496535895 13.732365674986674 0.0 3 0.9895135601026553 12.04115328606229 7076.0 -0.23586666666666645 0.0 - - - - - - - 360.0 14 3 TCF25 transcription factor 25 (basic helix-loop-helix) 1123 143 C20140709_OR011_01 C20140709_OR011_01 TB416690.[MT7]-LLIELLRK[MT7].3y6_1.heavy 429.298 / 915.611 N/A 42.0321741104126 34 11 10 5 8 1.337581942517136 74.76177482765239 0.041698455810546875 4 0.875793483855 3.464886254078412 0.0 0.0 1.0 - - - - - - - 0.0 0 0 BRD1 bromodomain containing 1 1125 143 C20140709_OR011_01 C20140709_OR011_01 TB416690.[MT7]-LLIELLRK[MT7].3y5_1.heavy 429.298 / 802.527 206.0 42.0321741104126 34 11 10 5 8 1.337581942517136 74.76177482765239 0.041698455810546875 4 0.875793483855 3.464886254078412 206.0 2.1333333333333333 2.0 - - - - - - - 0.0 0 0 BRD1 bromodomain containing 1 1127 143 C20140709_OR011_01 C20140709_OR011_01 TB416690.[MT7]-LLIELLRK[MT7].3b4_1.heavy 429.298 / 613.404 825.0 42.0321741104126 34 11 10 5 8 1.337581942517136 74.76177482765239 0.041698455810546875 4 0.875793483855 3.464886254078412 825.0 0.8009708737864075 0.0 - - - - - - - 0.0 1 0 BRD1 bromodomain containing 1 1129 143 C20140709_OR011_01 C20140709_OR011_01 TB416690.[MT7]-LLIELLRK[MT7].3y7_2.heavy 429.298 / 514.851 2577.0 42.0321741104126 34 11 10 5 8 1.337581942517136 74.76177482765239 0.041698455810546875 4 0.875793483855 3.464886254078412 2577.0 37.529126213592235 0.0 - - - - - - - 618.0 5 1 BRD1 bromodomain containing 1 1131 144 C20140709_OR011_01 C20140709_OR011_01 TB447353.[MT7]-GRISVGSDSDLVIWDPDAVK[MT7].4b8_1.heavy 605.078 / 916.497 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL3 dihydropyrimidinase-like 3 1133 144 C20140709_OR011_01 C20140709_OR011_01 TB447353.[MT7]-GRISVGSDSDLVIWDPDAVK[MT7].4y5_1.heavy 605.078 / 673.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL3 dihydropyrimidinase-like 3 1135 144 C20140709_OR011_01 C20140709_OR011_01 TB447353.[MT7]-GRISVGSDSDLVIWDPDAVK[MT7].4b10_1.heavy 605.078 / 1118.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL3 dihydropyrimidinase-like 3 1137 144 C20140709_OR011_01 C20140709_OR011_01 TB447353.[MT7]-GRISVGSDSDLVIWDPDAVK[MT7].4b10_2.heavy 605.078 / 559.782 N/A N/A - - - - - - - - - 0.0 - - - - - - - DPYSL3 dihydropyrimidinase-like 3 1139 145 C20140709_OR011_01 C20140709_OR011_01 TB447359.[MT7]-LINNLEVQLNSEGGSMQVFK[MT7].3b6_1.heavy 836.784 / 841.49 1173.0 43.10519886016846 39 17 9 5 8 5.544469404801099 18.035990948639274 0.040798187255859375 4 0.9783666807893369 8.375576904881877 1173.0 2.794893617021277 1.0 - - - - - - - 189.3846153846154 2 13 KLF8 Kruppel-like factor 8 1141 145 C20140709_OR011_01 C20140709_OR011_01 TB447359.[MT7]-LINNLEVQLNSEGGSMQVFK[MT7].3b4_1.heavy 836.784 / 599.363 1408.0 43.10519886016846 39 17 9 5 8 5.544469404801099 18.035990948639274 0.040798187255859375 4 0.9783666807893369 8.375576904881877 1408.0 6.361961620469083 0.0 - - - - - - - 284.85714285714283 2 14 KLF8 Kruppel-like factor 8 1143 145 C20140709_OR011_01 C20140709_OR011_01 TB447359.[MT7]-LINNLEVQLNSEGGSMQVFK[MT7].3b5_1.heavy 836.784 / 712.447 704.0 43.10519886016846 39 17 9 5 8 5.544469404801099 18.035990948639274 0.040798187255859375 4 0.9783666807893369 8.375576904881877 704.0 3.2209808102345416 1.0 - - - - - - - 258.0 2 10 KLF8 Kruppel-like factor 8 1145 145 C20140709_OR011_01 C20140709_OR011_01 TB447359.[MT7]-LINNLEVQLNSEGGSMQVFK[MT7].3y8_1.heavy 836.784 / 997.526 704.0 43.10519886016846 39 17 9 5 8 5.544469404801099 18.035990948639274 0.040798187255859375 4 0.9783666807893369 8.375576904881877 704.0 1.3034150696824547 6.0 - - - - - - - 264.0 3 12 KLF8 Kruppel-like factor 8 1147 146 C20140709_OR011_01 C20140709_OR011_01 TB589759.[MT7]-EDDVSFLMK[MT7].3y3_1.heavy 457.907 / 535.339 4625.0 36.19587421417236 42 17 10 5 10 3.4510027363234763 25.51886856310003 0.048900604248046875 3 0.9772524635424871 8.16711120541142 4625.0 39.78860294117647 0.0 - - - - - - - 244.8 9 5 TRIM35 tripartite motif-containing 35 1149 146 C20140709_OR011_01 C20140709_OR011_01 TB589759.[MT7]-EDDVSFLMK[MT7].3b4_1.heavy 457.907 / 603.274 2448.0 36.19587421417236 42 17 10 5 10 3.4510027363234763 25.51886856310003 0.048900604248046875 3 0.9772524635424871 8.16711120541142 2448.0 6.207272727272727 0.0 - - - - - - - 272.0 4 3 TRIM35 tripartite motif-containing 35 1151 146 C20140709_OR011_01 C20140709_OR011_01 TB589759.[MT7]-EDDVSFLMK[MT7].3b5_1.heavy 457.907 / 690.306 3672.0 36.19587421417236 42 17 10 5 10 3.4510027363234763 25.51886856310003 0.048900604248046875 3 0.9772524635424871 8.16711120541142 3672.0 53.46 0.0 - - - - - - - 181.33333333333334 7 3 TRIM35 tripartite motif-containing 35 1153 146 C20140709_OR011_01 C20140709_OR011_01 TB589759.[MT7]-EDDVSFLMK[MT7].3b3_1.heavy 457.907 / 504.206 9793.0 36.19587421417236 42 17 10 5 10 3.4510027363234763 25.51886856310003 0.048900604248046875 3 0.9772524635424871 8.16711120541142 9793.0 94.68966911764706 0.0 - - - - - - - 272.0 19 3 TRIM35 tripartite motif-containing 35 1155 147 C20140709_OR011_01 C20140709_OR011_01 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 164974.0 26.515899658203125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 164974.0 195.11865109691092 0.0 - - - - - - - 1151.0 329 1 1157 147 C20140709_OR011_01 C20140709_OR011_01 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 249396.0 26.515899658203125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 249396.0 469.8317004553488 0.0 - - - - - - - 1151.0 498 1 1159 147 C20140709_OR011_01 C20140709_OR011_01 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 278479.0 26.515899658203125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 278479.0 255.2882452878866 0.0 - - - - - - - 2720.25 556 4 1161 148 C20140709_OR011_01 C20140709_OR011_01 TB417098.[MT7]-RHEFTAEC[CAM]PSVLELGFETVR.4b8_2.heavy 631.071 / 588.273 36552.0 38.99359893798828 47 17 10 10 10 6.923820947830601 14.442892263314869 0.0 3 0.9719235433489686 7.348011528799673 36552.0 111.81693584905659 0.0 - - - - - - - 302.42857142857144 73 7 CRYBA4 crystallin, beta A4 1163 148 C20140709_OR011_01 C20140709_OR011_01 TB417098.[MT7]-RHEFTAEC[CAM]PSVLELGFETVR.4b7_1.heavy 631.071 / 1015.51 15760.0 38.99359893798828 47 17 10 10 10 6.923820947830601 14.442892263314869 0.0 3 0.9719235433489686 7.348011528799673 15760.0 128.59764174151837 0.0 - - - - - - - 286.6666666666667 31 6 CRYBA4 crystallin, beta A4 1165 148 C20140709_OR011_01 C20140709_OR011_01 TB417098.[MT7]-RHEFTAEC[CAM]PSVLELGFETVR.4y7_1.heavy 631.071 / 821.452 29931.0 38.99359893798828 47 17 10 10 10 6.923820947830601 14.442892263314869 0.0 3 0.9719235433489686 7.348011528799673 29931.0 268.92435768261964 0.0 - - - - - - - 240.54545454545453 59 11 CRYBA4 crystallin, beta A4 1167 148 C20140709_OR011_01 C20140709_OR011_01 TB417098.[MT7]-RHEFTAEC[CAM]PSVLELGFETVR.4y6_1.heavy 631.071 / 708.367 68072.0 38.99359893798828 47 17 10 10 10 6.923820947830601 14.442892263314869 0.0 3 0.9719235433489686 7.348011528799673 68072.0 262.63824605995114 0.0 - - - - - - - 264.625 136 8 CRYBA4 crystallin, beta A4 1169 149 C20140709_OR011_01 C20140709_OR011_01 TB589857.[MT7]-LTIFEQENFLGK[MT7].3b6_1.heavy 576.325 / 876.495 21057.0 42.911598205566406 47 17 10 10 10 2.3545549429992367 33.802331501548096 0.0 3 0.9722651749842846 7.393341293606641 21057.0 32.521336264858384 1.0 - - - - - - - 277.25 43 8 CRYBA4 crystallin, beta A4 1171 149 C20140709_OR011_01 C20140709_OR011_01 TB589857.[MT7]-LTIFEQENFLGK[MT7].3b4_1.heavy 576.325 / 619.394 70426.0 42.911598205566406 47 17 10 10 10 2.3545549429992367 33.802331501548096 0.0 3 0.9722651749842846 7.393341293606641 70426.0 125.03235723951285 0.0 - - - - - - - 221.8 140 5 CRYBA4 crystallin, beta A4 1173 149 C20140709_OR011_01 C20140709_OR011_01 TB589857.[MT7]-LTIFEQENFLGK[MT7].3b5_1.heavy 576.325 / 748.436 52996.0 42.911598205566406 47 17 10 10 10 2.3545549429992367 33.802331501548096 0.0 3 0.9722651749842846 7.393341293606641 52996.0 100.718794009468 0.0 - - - - - - - 277.125 105 8 CRYBA4 crystallin, beta A4 1175 149 C20140709_OR011_01 C20140709_OR011_01 TB589857.[MT7]-LTIFEQENFLGK[MT7].3y4_1.heavy 576.325 / 608.389 58135.0 42.911598205566406 47 17 10 10 10 2.3545549429992367 33.802331501548096 0.0 3 0.9722651749842846 7.393341293606641 58135.0 172.77747256655567 0.0 - - - - - - - 285.5 116 6 CRYBA4 crystallin, beta A4 1177 150 C20140709_OR011_01 C20140709_OR011_01 TB416795.[MT7]-LLEREGALQK[MT7].3y3_1.heavy 482.296 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - LZTS1 leucine zipper, putative tumor suppressor 1 1179 150 C20140709_OR011_01 C20140709_OR011_01 TB416795.[MT7]-LLEREGALQK[MT7].3b3_1.heavy 482.296 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - LZTS1 leucine zipper, putative tumor suppressor 1 1181 150 C20140709_OR011_01 C20140709_OR011_01 TB416795.[MT7]-LLEREGALQK[MT7].3y5_1.heavy 482.296 / 660.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - LZTS1 leucine zipper, putative tumor suppressor 1 1183 150 C20140709_OR011_01 C20140709_OR011_01 TB416795.[MT7]-LLEREGALQK[MT7].3y9_2.heavy 482.296 / 594.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - LZTS1 leucine zipper, putative tumor suppressor 1 1185 151 C20140709_OR011_01 C20140709_OR011_01 TB447216.[MT7]-QIGDNLIVPGGVK[MT7].4y4_1.heavy 400.243 / 504.326 1673.0 34.482550621032715 32 10 10 2 10 4.331184912540497 23.088370046372383 0.08810043334960938 3 0.8263725071551835 2.9178244494164844 1673.0 10.690695067264572 3.0 - - - - - - - 334.5 3 4 DPYSL3 dihydropyrimidinase-like 3 1187 151 C20140709_OR011_01 C20140709_OR011_01 TB447216.[MT7]-QIGDNLIVPGGVK[MT7].4b5_1.heavy 400.243 / 672.343 223.0 34.482550621032715 32 10 10 2 10 4.331184912540497 23.088370046372383 0.08810043334960938 3 0.8263725071551835 2.9178244494164844 223.0 1.9317857142857142 7.0 - - - - - - - 0.0 0 0 DPYSL3 dihydropyrimidinase-like 3 1189 151 C20140709_OR011_01 C20140709_OR011_01 TB447216.[MT7]-QIGDNLIVPGGVK[MT7].4b6_1.heavy 400.243 / 785.427 669.0 34.482550621032715 32 10 10 2 10 4.331184912540497 23.088370046372383 0.08810043334960938 3 0.8263725071551835 2.9178244494164844 669.0 6.372617270788912 0.0 - - - - - - - 0.0 1 0 DPYSL3 dihydropyrimidinase-like 3 1191 151 C20140709_OR011_01 C20140709_OR011_01 TB447216.[MT7]-QIGDNLIVPGGVK[MT7].4b4_1.heavy 400.243 / 558.3 1338.0 34.482550621032715 32 10 10 2 10 4.331184912540497 23.088370046372383 0.08810043334960938 3 0.8263725071551835 2.9178244494164844 1338.0 8.209285714285715 0.0 - - - - - - - 167.66666666666666 2 6 DPYSL3 dihydropyrimidinase-like 3 1193 152 C20140709_OR011_01 C20140709_OR011_01 TB416796.[MT7]-SAADLISQARK[MT7].3y6_1.heavy 483.287 / 846.528 843.0 27.367850303649902 39 17 8 6 8 4.838512867399922 20.667507298319354 0.03909873962402344 4 0.970969321962293 7.225659427403069 843.0 16.057142857142857 0.0 - - - - - - - 0.0 1 0 DPYSL3 dihydropyrimidinase-like 3 1195 152 C20140709_OR011_01 C20140709_OR011_01 TB416796.[MT7]-SAADLISQARK[MT7].3b4_1.heavy 483.287 / 489.242 4427.0 27.367850303649902 39 17 8 6 8 4.838512867399922 20.667507298319354 0.03909873962402344 4 0.970969321962293 7.225659427403069 4427.0 25.535787989681445 1.0 - - - - - - - 162.63636363636363 11 11 DPYSL3 dihydropyrimidinase-like 3 1197 152 C20140709_OR011_01 C20140709_OR011_01 TB416796.[MT7]-SAADLISQARK[MT7].3b5_1.heavy 483.287 / 602.327 1897.0 27.367850303649902 39 17 8 6 8 4.838512867399922 20.667507298319354 0.03909873962402344 4 0.970969321962293 7.225659427403069 1897.0 10.563862559241706 0.0 - - - - - - - 179.0 3 10 DPYSL3 dihydropyrimidinase-like 3 1199 152 C20140709_OR011_01 C20140709_OR011_01 TB416796.[MT7]-SAADLISQARK[MT7].3y5_1.heavy 483.287 / 733.444 3794.0 27.367850303649902 39 17 8 6 8 4.838512867399922 20.667507298319354 0.03909873962402344 4 0.970969321962293 7.225659427403069 3794.0 22.691962025316457 0.0 - - - - - - - 245.66666666666666 7 3 DPYSL3 dihydropyrimidinase-like 3 1201 153 C20140709_OR011_01 C20140709_OR011_01 TB589858.[MT7]-GMTTVDDFFQGTK[MT7].2y8_1.heavy 867.934 / 1101.53 7721.0 38.87110137939453 40 10 10 10 10 0.767837319328539 74.70735921338988 0.0 3 0.8255674848284831 2.910874931900827 7721.0 62.11631578947369 0.0 - - - - - - - 199.5 15 10 DPYSL3 dihydropyrimidinase-like 3 1203 153 C20140709_OR011_01 C20140709_OR011_01 TB589858.[MT7]-GMTTVDDFFQGTK[MT7].2y5_1.heavy 867.934 / 724.411 1331.0 38.87110137939453 40 10 10 10 10 0.767837319328539 74.70735921338988 0.0 3 0.8255674848284831 2.910874931900827 1331.0 0.5243567610012154 2.0 - - - - - - - 304.0 3 7 DPYSL3 dihydropyrimidinase-like 3 1205 153 C20140709_OR011_01 C20140709_OR011_01 TB589858.[MT7]-GMTTVDDFFQGTK[MT7].2y6_1.heavy 867.934 / 871.479 3727.0 38.87110137939453 40 10 10 10 10 0.767837319328539 74.70735921338988 0.0 3 0.8255674848284831 2.910874931900827 3727.0 8.580401002506266 1.0 - - - - - - - 247.0 7 7 DPYSL3 dihydropyrimidinase-like 3 1207 153 C20140709_OR011_01 C20140709_OR011_01 TB589858.[MT7]-GMTTVDDFFQGTK[MT7].2b7_1.heavy 867.934 / 864.389 2929.0 38.87110137939453 40 10 10 10 10 0.767837319328539 74.70735921338988 0.0 3 0.8255674848284831 2.910874931900827 2929.0 28.599959899749372 0.0 - - - - - - - 266.0 5 6 DPYSL3 dihydropyrimidinase-like 3 1209 154 C20140709_OR011_01 C20140709_OR011_01 TB447210.[MT7]-MVVWDEDGFQGR.2y5_1.heavy 791.876 / 564.289 16053.0 37.75699996948242 45 15 10 10 10 2.406789236953134 32.891444393164946 0.0 3 0.9547171494323704 5.777538816426496 16053.0 29.752675593098488 0.0 - - - - - - - 201.0 32 4 CRYBA4 crystallin, beta A4 1211 154 C20140709_OR011_01 C20140709_OR011_01 TB447210.[MT7]-MVVWDEDGFQGR.2y9_1.heavy 791.876 / 1109.46 19799.0 37.75699996948242 45 15 10 10 10 2.406789236953134 32.891444393164946 0.0 3 0.9547171494323704 5.777538816426496 19799.0 63.12402352513865 0.0 - - - - - - - 305.7142857142857 39 7 CRYBA4 crystallin, beta A4 1213 154 C20140709_OR011_01 C20140709_OR011_01 TB447210.[MT7]-MVVWDEDGFQGR.2y10_1.heavy 791.876 / 1208.53 4950.0 37.75699996948242 45 15 10 10 10 2.406789236953134 32.891444393164946 0.0 3 0.9547171494323704 5.777538816426496 4950.0 24.028455851583203 0.0 - - - - - - - 267.8 9 5 CRYBA4 crystallin, beta A4 1215 154 C20140709_OR011_01 C20140709_OR011_01 TB447210.[MT7]-MVVWDEDGFQGR.2y7_1.heavy 791.876 / 808.358 10167.0 37.75699996948242 45 15 10 10 10 2.406789236953134 32.891444393164946 0.0 3 0.9547171494323704 5.777538816426496 10167.0 32.441139304205855 0.0 - - - - - - - 178.55555555555554 20 9 CRYBA4 crystallin, beta A4 1217 155 C20140709_OR011_01 C20140709_OR011_01 TB589655.[MT7]-LLNTHHR.2y4_1.heavy 517.802 / 550.284 602.0 17.47897481918335 42 18 10 6 8 3.5356342510724 28.283468509127832 0.03650093078613281 4 0.9861706158088852 10.482362465223263 602.0 4.223333333333334 6.0 - - - - - - - 0.0 1 0 SDF2L1 stromal cell-derived factor 2-like 1 1219 155 C20140709_OR011_01 C20140709_OR011_01 TB589655.[MT7]-LLNTHHR.2y5_1.heavy 517.802 / 664.327 1978.0 17.47897481918335 42 18 10 6 8 3.5356342510724 28.283468509127832 0.03650093078613281 4 0.9861706158088852 10.482362465223263 1978.0 20.124999999999996 0.0 - - - - - - - 210.22222222222223 3 9 SDF2L1 stromal cell-derived factor 2-like 1 1221 155 C20140709_OR011_01 C20140709_OR011_01 TB589655.[MT7]-LLNTHHR.2b4_1.heavy 517.802 / 586.368 516.0 17.47897481918335 42 18 10 6 8 3.5356342510724 28.283468509127832 0.03650093078613281 4 0.9861706158088852 10.482362465223263 516.0 4.89 7.0 - - - - - - - 172.0 4 9 SDF2L1 stromal cell-derived factor 2-like 1 1223 155 C20140709_OR011_01 C20140709_OR011_01 TB589655.[MT7]-LLNTHHR.2y6_1.heavy 517.802 / 777.411 2580.0 17.47897481918335 42 18 10 6 8 3.5356342510724 28.283468509127832 0.03650093078613281 4 0.9861706158088852 10.482362465223263 2580.0 37.5 0.0 - - - - - - - 215.0 5 6 SDF2L1 stromal cell-derived factor 2-like 1 1225 156 C20140709_OR011_01 C20140709_OR011_01 TB589907.[MT7]-MDENQFVAVTSTNAAK[MT7].3b6_1.heavy 672.01 / 909.389 18400.0 31.82110023498535 48 18 10 10 10 3.603778108042598 27.74865627182448 0.0 3 0.9875522572824457 11.05008293706971 18400.0 226.4619846173244 0.0 - - - - - - - 182.0 36 13 CRMP1;DPYSL2;DPYSL3 collapsin response mediator protein 1;dihydropyrimidinase-like 2;dihydropyrimidinase-like 3 1227 156 C20140709_OR011_01 C20140709_OR011_01 TB589907.[MT7]-MDENQFVAVTSTNAAK[MT7].3b4_1.heavy 672.01 / 634.262 9252.0 31.82110023498535 48 18 10 10 10 3.603778108042598 27.74865627182448 0.0 3 0.9875522572824457 11.05008293706971 9252.0 34.20533213453371 0.0 - - - - - - - 279.14285714285717 18 7 CRMP1;DPYSL2;DPYSL3 collapsin response mediator protein 1;dihydropyrimidinase-like 2;dihydropyrimidinase-like 3 1229 156 C20140709_OR011_01 C20140709_OR011_01 TB589907.[MT7]-MDENQFVAVTSTNAAK[MT7].3b5_1.heavy 672.01 / 762.321 33717.0 31.82110023498535 48 18 10 10 10 3.603778108042598 27.74865627182448 0.0 3 0.9875522572824457 11.05008293706971 33717.0 228.5114658776841 0.0 - - - - - - - 257.0 67 8 CRMP1;DPYSL2;DPYSL3 collapsin response mediator protein 1;dihydropyrimidinase-like 2;dihydropyrimidinase-like 3 1231 156 C20140709_OR011_01 C20140709_OR011_01 TB589907.[MT7]-MDENQFVAVTSTNAAK[MT7].3b3_1.heavy 672.01 / 520.219 6579.0 31.82110023498535 48 18 10 10 10 3.603778108042598 27.74865627182448 0.0 3 0.9875522572824457 11.05008293706971 6579.0 44.03314683993805 1.0 - - - - - - - 265.5833333333333 13 12 CRMP1;DPYSL2;DPYSL3 collapsin response mediator protein 1;dihydropyrimidinase-like 2;dihydropyrimidinase-like 3 1233 157 C20140709_OR011_01 C20140709_OR011_01 TB589657.[MT7]-TTVQTLSR.2y5_1.heavy 525.307 / 604.341 5806.0 21.405000686645508 48 20 10 10 8 9.405661846563959 10.631894026312633 0.0 4 0.9926472171687645 14.383680734102466 5806.0 52.937058823529405 1.0 - - - - - - - 203.84615384615384 15 13 DENND2C DENN/MADD domain containing 2C 1235 157 C20140709_OR011_01 C20140709_OR011_01 TB589657.[MT7]-TTVQTLSR.2b4_1.heavy 525.307 / 574.332 3056.0 21.405000686645508 48 20 10 10 8 9.405661846563959 10.631894026312633 0.0 4 0.9926472171687645 14.383680734102466 3056.0 35.59591463120875 0.0 - - - - - - - 264.8 6 10 DENND2C DENN/MADD domain containing 2C 1237 157 C20140709_OR011_01 C20140709_OR011_01 TB589657.[MT7]-TTVQTLSR.2y6_1.heavy 525.307 / 703.41 4584.0 21.405000686645508 48 20 10 10 8 9.405661846563959 10.631894026312633 0.0 4 0.9926472171687645 14.383680734102466 4584.0 45.69019607843137 0.0 - - - - - - - 160.28571428571428 9 7 DENND2C DENN/MADD domain containing 2C 1239 157 C20140709_OR011_01 C20140709_OR011_01 TB589657.[MT7]-TTVQTLSR.2y7_1.heavy 525.307 / 804.457 13547.0 21.405000686645508 48 20 10 10 8 9.405661846563959 10.631894026312633 0.0 4 0.9926472171687645 14.383680734102466 13547.0 91.71489340945223 0.0 - - - - - - - 305.8 27 5 DENND2C DENN/MADD domain containing 2C 1241 158 C20140709_OR011_01 C20140709_OR011_01 TB416994.[MT7]-DAGAQVSIMTYDEFK[MT7].3b6_1.heavy 654.996 / 686.359 4070.0 38.0846004486084 45 20 10 5 10 7.871775735556734 12.70361394422112 0.044002532958984375 3 0.9940504457975559 15.992066985861719 4070.0 22.267527675276753 0.0 - - - - - - - 282.5 8 12 LOC100506375;APOBEC3A probable DNA dC->dU-editing enzyme APOBEC-3A-like;apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A 1243 158 C20140709_OR011_01 C20140709_OR011_01 TB416994.[MT7]-DAGAQVSIMTYDEFK[MT7].3b5_1.heavy 654.996 / 587.291 16552.0 38.0846004486084 45 20 10 5 10 7.871775735556734 12.70361394422112 0.044002532958984375 3 0.9940504457975559 15.992066985861719 16552.0 33.93203169864048 0.0 - - - - - - - 298.4 33 5 LOC100506375;APOBEC3A probable DNA dC->dU-editing enzyme APOBEC-3A-like;apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A 1245 158 C20140709_OR011_01 C20140709_OR011_01 TB416994.[MT7]-DAGAQVSIMTYDEFK[MT7].3y4_1.heavy 654.996 / 682.353 7191.0 38.0846004486084 45 20 10 5 10 7.871775735556734 12.70361394422112 0.044002532958984375 3 0.9940504457975559 15.992066985861719 7191.0 28.092604422604424 0.0 - - - - - - - 312.0 14 10 LOC100506375;APOBEC3A probable DNA dC->dU-editing enzyme APOBEC-3A-like;apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A 1247 158 C20140709_OR011_01 C20140709_OR011_01 TB416994.[MT7]-DAGAQVSIMTYDEFK[MT7].3y5_1.heavy 654.996 / 845.416 3934.0 38.0846004486084 45 20 10 5 10 7.871775735556734 12.70361394422112 0.044002532958984375 3 0.9940504457975559 15.992066985861719 3934.0 27.146051660516605 0.0 - - - - - - - 241.22222222222223 7 9 LOC100506375;APOBEC3A probable DNA dC->dU-editing enzyme APOBEC-3A-like;apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A 1249 159 C20140709_OR011_01 C20140709_OR011_01 TB446893.[MT7]-NAGSVK[MT7].2y4_1.heavy 432.263 / 534.337 5061.0 14.86520004272461 44 18 6 10 10 8.645085035503957 11.567266208408162 0.0 3 0.9826430732437745 9.35396580020724 5061.0 76.83184782608694 0.0 - - - - - - - 129.63636363636363 10 11 KLF8 Kruppel-like factor 8 1251 159 C20140709_OR011_01 C20140709_OR011_01 TB446893.[MT7]-NAGSVK[MT7].2y5_1.heavy 432.263 / 605.374 4555.0 14.86520004272461 44 18 6 10 10 8.645085035503957 11.567266208408162 0.0 3 0.9826430732437745 9.35396580020724 4555.0 33.17228260869565 0.0 - - - - - - - 184.0 9 11 KLF8 Kruppel-like factor 8 1253 159 C20140709_OR011_01 C20140709_OR011_01 TB446893.[MT7]-NAGSVK[MT7].2b4_1.heavy 432.263 / 474.243 874.0 14.86520004272461 44 18 6 10 10 8.645085035503957 11.567266208408162 0.0 3 0.9826430732437745 9.35396580020724 874.0 9.5 2.0 - - - - - - - 145.07692307692307 16 13 KLF8 Kruppel-like factor 8 1255 159 C20140709_OR011_01 C20140709_OR011_01 TB446893.[MT7]-NAGSVK[MT7].2y3_1.heavy 432.263 / 477.315 2071.0 14.86520004272461 44 18 6 10 10 8.645085035503957 11.567266208408162 0.0 3 0.9826430732437745 9.35396580020724 2071.0 7.435408432147563 0.0 - - - - - - - 187.53846153846155 4 13 KLF8 Kruppel-like factor 8 1257 160 C20140709_OR011_01 C20140709_OR011_01 TB447084.[MT7]-VIHWNSPK[MT7].3y3_1.heavy 423.583 / 475.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - GYLTL1B;LARGE glycosyltransferase-like 1B;like-glycosyltransferase 1259 160 C20140709_OR011_01 C20140709_OR011_01 TB447084.[MT7]-VIHWNSPK[MT7].3y4_1.heavy 423.583 / 589.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - GYLTL1B;LARGE glycosyltransferase-like 1B;like-glycosyltransferase 1261 160 C20140709_OR011_01 C20140709_OR011_01 TB447084.[MT7]-VIHWNSPK[MT7].3b3_1.heavy 423.583 / 494.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - GYLTL1B;LARGE glycosyltransferase-like 1B;like-glycosyltransferase 1263 160 C20140709_OR011_01 C20140709_OR011_01 TB447084.[MT7]-VIHWNSPK[MT7].3y5_1.heavy 423.583 / 775.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - GYLTL1B;LARGE glycosyltransferase-like 1B;like-glycosyltransferase 1265 161 C20140709_OR011_01 C20140709_OR011_01 TB416903.[MT7]-GVNSFMVYMAYK[MT7].3b6_1.heavy 566.626 / 780.383 7304.0 42.16379928588867 42 12 10 10 10 1.942904128843834 40.979595539639455 0.0 3 0.8983777308986614 3.8381291748874373 7304.0 96.46792452830188 0.0 - - - - - - - 159.0 14 2 DPYSL3 dihydropyrimidinase-like 3 1267 161 C20140709_OR011_01 C20140709_OR011_01 TB416903.[MT7]-GVNSFMVYMAYK[MT7].3b4_1.heavy 566.626 / 502.274 12068.0 42.16379928588867 42 12 10 10 10 1.942904128843834 40.979595539639455 0.0 3 0.8983777308986614 3.8381291748874373 12068.0 52.778151636705786 0.0 - - - - - - - 243.6 24 10 DPYSL3 dihydropyrimidinase-like 3 1269 161 C20140709_OR011_01 C20140709_OR011_01 TB416903.[MT7]-GVNSFMVYMAYK[MT7].3b5_1.heavy 566.626 / 649.343 18102.0 42.16379928588867 42 12 10 10 10 1.942904128843834 40.979595539639455 0.0 3 0.8983777308986614 3.8381291748874373 18102.0 53.43293659499781 0.0 - - - - - - - 251.75 36 8 DPYSL3 dihydropyrimidinase-like 3 1271 161 C20140709_OR011_01 C20140709_OR011_01 TB416903.[MT7]-GVNSFMVYMAYK[MT7].3y4_1.heavy 566.626 / 656.356 16408.0 42.16379928588867 42 12 10 10 10 1.942904128843834 40.979595539639455 0.0 3 0.8983777308986614 3.8381291748874373 16408.0 98.0725978309315 0.0 - - - - - - - 250.45454545454547 32 11 DPYSL3 dihydropyrimidinase-like 3 1273 162 C20140709_OR011_01 C20140709_OR011_01 TB446993.[MT7]-LQMEMK[MT7].2y4_1.heavy 534.295 / 682.338 7241.0 28.665075302124023 44 18 10 6 10 5.096904449993212 19.619751749541464 0.03530120849609375 3 0.9887387510243125 11.618784249171373 7241.0 -0.8117713004484308 0.0 - - - - - - - 222.66666666666666 14 3 TRIM35 tripartite motif-containing 35 1275 162 C20140709_OR011_01 C20140709_OR011_01 TB446993.[MT7]-LQMEMK[MT7].2y5_1.heavy 534.295 / 810.397 4790.0 28.665075302124023 44 18 10 6 10 5.096904449993212 19.619751749541464 0.03530120849609375 3 0.9887387510243125 11.618784249171373 4790.0 -0.1719928186714541 0.0 - - - - - - - 222.8 9 5 TRIM35 tripartite motif-containing 35 1277 162 C20140709_OR011_01 C20140709_OR011_01 TB446993.[MT7]-LQMEMK[MT7].2b4_1.heavy 534.295 / 646.335 3342.0 28.665075302124023 44 18 10 6 10 5.096904449993212 19.619751749541464 0.03530120849609375 3 0.9887387510243125 11.618784249171373 3342.0 -1.1999999999999993 1.0 - - - - - - - 245.0 6 5 TRIM35 tripartite motif-containing 35 1279 162 C20140709_OR011_01 C20140709_OR011_01 TB446993.[MT7]-LQMEMK[MT7].2y3_1.heavy 534.295 / 551.298 4456.0 28.665075302124023 44 18 10 6 10 5.096904449993212 19.619751749541464 0.03530120849609375 3 0.9887387510243125 11.618784249171373 4456.0 -1.1425641025641022 0.0 - - - - - - - 222.75 8 4 TRIM35 tripartite motif-containing 35 1281 163 C20140709_OR011_01 C20140709_OR011_01 TB589752.[MT7]-LTSLPLYQK[MT7].2y4_1.heavy 675.915 / 695.421 N/A 35.726600646972656 48 20 10 10 8 5.470172362302345 18.280959607260147 0.0 4 0.991388827350647 13.28981940935546 0.0 0.0 37.0 - - - - - - - 308.57142857142856 24 7 ZFP30 zinc finger protein 30 homolog (mouse) 1283 163 C20140709_OR011_01 C20140709_OR011_01 TB589752.[MT7]-LTSLPLYQK[MT7].2y8_1.heavy 675.915 / 1093.64 4460.0 35.726600646972656 48 20 10 10 8 5.470172362302345 18.280959607260147 0.0 4 0.991388827350647 13.28981940935546 4460.0 18.665925925925926 1.0 - - - - - - - 270.0 9 6 ZFP30 zinc finger protein 30 homolog (mouse) 1285 163 C20140709_OR011_01 C20140709_OR011_01 TB589752.[MT7]-LTSLPLYQK[MT7].2y5_1.heavy 675.915 / 792.474 30545.0 35.726600646972656 48 20 10 10 8 5.470172362302345 18.280959607260147 0.0 4 0.991388827350647 13.28981940935546 30545.0 110.37980591497227 0.0 - - - - - - - 270.0 61 5 ZFP30 zinc finger protein 30 homolog (mouse) 1287 163 C20140709_OR011_01 C20140709_OR011_01 TB589752.[MT7]-LTSLPLYQK[MT7].2y3_1.heavy 675.915 / 582.337 6082.0 35.726600646972656 48 20 10 10 8 5.470172362302345 18.280959607260147 0.0 4 0.991388827350647 13.28981940935546 6082.0 36.492 0.0 - - - - - - - 270.0 12 5 ZFP30 zinc finger protein 30 homolog (mouse) 1289 164 C20140709_OR011_01 C20140709_OR011_01 TB416908.[MT7]-FQIGELANTLTSK[MT7].3b6_1.heavy 570.661 / 832.469 2866.0 41.50384998321533 41 18 8 5 10 5.932124449311929 16.857367180083195 0.043399810791015625 3 0.9868210428602798 10.73850263375127 2866.0 23.944993133754462 0.0 - - - - - - - 261.875 5 8 FNBP4 formin binding protein 4 1291 164 C20140709_OR011_01 C20140709_OR011_01 TB416908.[MT7]-FQIGELANTLTSK[MT7].3b5_1.heavy 570.661 / 719.385 7055.0 41.50384998321533 41 18 8 5 10 5.932124449311929 16.857367180083195 0.043399810791015625 3 0.9868210428602798 10.73850263375127 7055.0 77.33954133479813 0.0 - - - - - - - 208.22222222222223 14 9 FNBP4 formin binding protein 4 1293 164 C20140709_OR011_01 C20140709_OR011_01 TB416908.[MT7]-FQIGELANTLTSK[MT7].3y4_1.heavy 570.661 / 592.379 2866.0 41.50384998321533 41 18 8 5 10 5.932124449311929 16.857367180083195 0.043399810791015625 3 0.9868210428602798 10.73850263375127 2866.0 13.112807316737724 0.0 - - - - - - - 275.375 5 8 FNBP4 formin binding protein 4 1295 164 C20140709_OR011_01 C20140709_OR011_01 TB416908.[MT7]-FQIGELANTLTSK[MT7].3b3_1.heavy 570.661 / 533.32 2315.0 41.50384998321533 41 18 8 5 10 5.932124449311929 16.857367180083195 0.043399810791015625 3 0.9868210428602798 10.73850263375127 2315.0 6.6815061890007 3.0 - - - - - - - 250.45454545454547 19 11 FNBP4 formin binding protein 4 1297 165 C20140709_OR011_01 C20140709_OR011_01 TB447347.[MT7]-LVAWDPAC[CAM]LPLPPPPPAFK[MT7].3y6_1.heavy 792.113 / 800.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEBPB CCAAT/enhancer binding protein (C/EBP), beta 1299 165 C20140709_OR011_01 C20140709_OR011_01 TB447347.[MT7]-LVAWDPAC[CAM]LPLPPPPPAFK[MT7].3b5_1.heavy 792.113 / 729.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEBPB CCAAT/enhancer binding protein (C/EBP), beta 1301 165 C20140709_OR011_01 C20140709_OR011_01 TB447347.[MT7]-LVAWDPAC[CAM]LPLPPPPPAFK[MT7].3y4_1.heavy 792.113 / 606.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEBPB CCAAT/enhancer binding protein (C/EBP), beta 1303 165 C20140709_OR011_01 C20140709_OR011_01 TB447347.[MT7]-LVAWDPAC[CAM]LPLPPPPPAFK[MT7].3y5_1.heavy 792.113 / 703.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - CEBPB CCAAT/enhancer binding protein (C/EBP), beta 1305 166 C20140709_OR011_01 C20140709_OR011_01 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 196825.0 37.62310028076172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 196825.0 158.4870780458945 0.0 - - - - - - - 314.1111111111111 393 9 1307 166 C20140709_OR011_01 C20140709_OR011_01 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 375610.0 37.62310028076172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 375610.0 582.3626529813355 0.0 - - - - - - - 269.5 751 2 1309 166 C20140709_OR011_01 C20140709_OR011_01 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 474965.0 37.62310028076172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 474965.0 111.08066907956784 0.0 - - - - - - - 807.7142857142857 949 7 1311 167 C20140709_OR011_01 C20140709_OR011_01 TB417087.[MT7]-LVLVDRNTGPDPQDPEESASR.3b9_2.heavy 813.746 / 556.831 588.0 29.846149921417236 35 12 10 3 10 1.2420539089821303 53.6314053760903 0.06920051574707031 3 0.880165079311824 3.528865818540714 588.0 3.28 1.0 - - - - - - - 0.0 1 0 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 1313 167 C20140709_OR011_01 C20140709_OR011_01 TB417087.[MT7]-LVLVDRNTGPDPQDPEESASR.3b11_2.heavy 813.746 / 662.871 4411.0 29.846149921417236 35 12 10 3 10 1.2420539089821303 53.6314053760903 0.06920051574707031 3 0.880165079311824 3.528865818540714 4411.0 26.931105442176868 0.0 - - - - - - - 225.4 8 10 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 1315 167 C20140709_OR011_01 C20140709_OR011_01 TB417087.[MT7]-LVLVDRNTGPDPQDPEESASR.3y5_1.heavy 813.746 / 549.263 490.0 29.846149921417236 35 12 10 3 10 1.2420539089821303 53.6314053760903 0.06920051574707031 3 0.880165079311824 3.528865818540714 490.0 1.2125 5.0 - - - - - - - 0.0 1 0 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 1317 167 C20140709_OR011_01 C20140709_OR011_01 TB417087.[MT7]-LVLVDRNTGPDPQDPEESASR.3y10_1.heavy 813.746 / 1115.5 3626.0 29.846149921417236 35 12 10 3 10 1.2420539089821303 53.6314053760903 0.06920051574707031 3 0.880165079311824 3.528865818540714 3626.0 44.276666666666664 0.0 - - - - - - - 203.0 7 14 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 1319 168 C20140709_OR011_01 C20140709_OR011_01 TB447202.[MT7]-HNQVEAAWLEGR.3y7_1.heavy 518.603 / 802.421 972.0 28.527949810028076 28 7 10 3 8 1.3930441538298064 71.78523360158862 0.06690025329589844 4 0.706720297787625 2.2206772424906283 972.0 2.6999999999999997 1.0 - - - - - - - 0.0 1 0 TRIM35 tripartite motif-containing 35 1321 168 C20140709_OR011_01 C20140709_OR011_01 TB447202.[MT7]-HNQVEAAWLEGR.3y6_1.heavy 518.603 / 731.383 432.0 28.527949810028076 28 7 10 3 8 1.3930441538298064 71.78523360158862 0.06690025329589844 4 0.706720297787625 2.2206772424906283 432.0 0.8444444444444443 18.0 - - - - - - - 0.0 1 0 TRIM35 tripartite motif-containing 35 1323 168 C20140709_OR011_01 C20140709_OR011_01 TB447202.[MT7]-HNQVEAAWLEGR.3b3_1.heavy 518.603 / 524.27 19431.0 28.527949810028076 28 7 10 3 8 1.3930441538298064 71.78523360158862 0.06690025329589844 4 0.706720297787625 2.2206772424906283 19431.0 37.12957853391588 0.0 - - - - - - - 283.5 38 8 TRIM35 tripartite motif-containing 35 1325 168 C20140709_OR011_01 C20140709_OR011_01 TB447202.[MT7]-HNQVEAAWLEGR.3y5_1.heavy 518.603 / 660.346 972.0 28.527949810028076 28 7 10 3 8 1.3930441538298064 71.78523360158862 0.06690025329589844 4 0.706720297787625 2.2206772424906283 972.0 3.7285714285714286 2.0 - - - - - - - 223.71428571428572 5 14 TRIM35 tripartite motif-containing 35 1327 169 C20140709_OR011_01 C20140709_OR011_01 TB589667.[MT7]-RIVAPPGGR.2y8_1.heavy 533.834 / 766.457 2025.0 19.463250160217285 35 11 10 6 8 0.8609220475379531 71.65136457104379 0.03669929504394531 4 0.8624178621067738 3.2883004932901803 2025.0 4.952445652173913 0.0 - - - - - - - 184.0 4 9 DPYSL3 dihydropyrimidinase-like 3 1329 169 C20140709_OR011_01 C20140709_OR011_01 TB589667.[MT7]-RIVAPPGGR.2b4_1.heavy 533.834 / 584.4 736.0 19.463250160217285 35 11 10 6 8 0.8609220475379531 71.65136457104379 0.03669929504394531 4 0.8624178621067738 3.2883004932901803 736.0 1.4222222222222223 2.0 - - - - - - - 0.0 1 0 DPYSL3 dihydropyrimidinase-like 3 1331 169 C20140709_OR011_01 C20140709_OR011_01 TB589667.[MT7]-RIVAPPGGR.2y6_1.heavy 533.834 / 554.305 736.0 19.463250160217285 35 11 10 6 8 0.8609220475379531 71.65136457104379 0.03669929504394531 4 0.8624178621067738 3.2883004932901803 736.0 7.2 2.0 - - - - - - - 0.0 1 0 DPYSL3 dihydropyrimidinase-like 3 1333 169 C20140709_OR011_01 C20140709_OR011_01 TB589667.[MT7]-RIVAPPGGR.2y7_1.heavy 533.834 / 653.373 920.0 19.463250160217285 35 11 10 6 8 0.8609220475379531 71.65136457104379 0.03669929504394531 4 0.8624178621067738 3.2883004932901803 920.0 0.0 1.0 - - - - - - - 0.0 1 0 DPYSL3 dihydropyrimidinase-like 3 1335 170 C20140709_OR011_01 C20140709_OR011_01 TB417090.[MT7]-EELLC[CAM]AVC[CAM]YDPFRDAVTLR.3b6_1.heavy 824.411 / 860.43 624.0 44.213998794555664 40 14 10 6 10 2.6859629522332757 37.230595424577174 0.03839874267578125 3 0.9371386696006047 4.896309653115529 624.0 9.465168539325843 3.0 - - - - - - - 0.0 1 0 TRIM35 tripartite motif-containing 35 1337 170 C20140709_OR011_01 C20140709_OR011_01 TB417090.[MT7]-EELLC[CAM]AVC[CAM]YDPFRDAVTLR.3b3_1.heavy 824.411 / 516.279 3474.0 44.213998794555664 40 14 10 6 10 2.6859629522332757 37.230595424577174 0.03839874267578125 3 0.9371386696006047 4.896309653115529 3474.0 48.79213483146067 0.0 - - - - - - - 155.75 6 8 TRIM35 tripartite motif-containing 35 1339 170 C20140709_OR011_01 C20140709_OR011_01 TB417090.[MT7]-EELLC[CAM]AVC[CAM]YDPFRDAVTLR.3y5_1.heavy 824.411 / 559.356 1603.0 44.213998794555664 40 14 10 6 10 2.6859629522332757 37.230595424577174 0.03839874267578125 3 0.9371386696006047 4.896309653115529 1603.0 19.812359550561798 1.0 - - - - - - - 195.8 3 5 TRIM35 tripartite motif-containing 35 1341 170 C20140709_OR011_01 C20140709_OR011_01 TB417090.[MT7]-EELLC[CAM]AVC[CAM]YDPFRDAVTLR.3y9_2.heavy 824.411 / 537.806 7394.0 44.213998794555664 40 14 10 6 10 2.6859629522332757 37.230595424577174 0.03839874267578125 3 0.9371386696006047 4.896309653115529 7394.0 96.78662921348314 0.0 - - - - - - - 118.66666666666667 14 9 TRIM35 tripartite motif-containing 35 1343 171 C20140709_OR011_01 C20140709_OR011_01 TB589668.[MT7]-SYEAIAK[MT7].2y4_1.heavy 535.31 / 546.373 4733.0 23.552499771118164 46 16 10 10 10 2.150869625508227 37.11602983350198 0.0 3 0.9630154005642169 6.3974105660518585 4733.0 12.131598966394936 1.0 - - - - - - - 220.0 9 3 TRIM35 tripartite motif-containing 35 1345 171 C20140709_OR011_01 C20140709_OR011_01 TB589668.[MT7]-SYEAIAK[MT7].2b3_1.heavy 535.31 / 524.247 5063.0 23.552499771118164 46 16 10 10 10 2.150869625508227 37.11602983350198 0.0 3 0.9630154005642169 6.3974105660518585 5063.0 13.742428571428572 0.0 - - - - - - - 261.25 10 8 TRIM35 tripartite motif-containing 35 1347 171 C20140709_OR011_01 C20140709_OR011_01 TB589668.[MT7]-SYEAIAK[MT7].2b4_1.heavy 535.31 / 595.284 2972.0 23.552499771118164 46 16 10 10 10 2.150869625508227 37.11602983350198 0.0 3 0.9630154005642169 6.3974105660518585 2972.0 8.355757575757575 1.0 - - - - - - - 281.1111111111111 5 9 TRIM35 tripartite motif-containing 35 1349 171 C20140709_OR011_01 C20140709_OR011_01 TB589668.[MT7]-SYEAIAK[MT7].2y6_1.heavy 535.31 / 838.479 1101.0 23.552499771118164 46 16 10 10 10 2.150869625508227 37.11602983350198 0.0 3 0.9630154005642169 6.3974105660518585 1101.0 9.208363636363638 0.0 - - - - - - - 183.33333333333334 2 6 TRIM35 tripartite motif-containing 35 1351 172 C20140709_OR011_01 C20140709_OR011_01 TB417094.[MT7]-SARDEQGALLLGHELQSFLK[MT7].4y4_1.heavy 625.849 / 638.399 11657.0 43.57259941101074 37 11 10 6 10 0.8784048547239994 70.2403503680807 0.039402008056640625 3 0.8569661462151098 3.223480314649939 11657.0 124.89642857142856 0.0 - - - - - - - 220.5 23 8 HMGXB4 HMG box domain containing 4 1353 172 C20140709_OR011_01 C20140709_OR011_01 TB417094.[MT7]-SARDEQGALLLGHELQSFLK[MT7].4b8_1.heavy 625.849 / 959.466 2645.0 43.57259941101074 37 11 10 6 10 0.8784048547239994 70.2403503680807 0.039402008056640625 3 0.8569661462151098 3.223480314649939 2645.0 1.6591836734693879 1.0 - - - - - - - 238.0 5 14 HMGXB4 HMG box domain containing 4 1355 172 C20140709_OR011_01 C20140709_OR011_01 TB417094.[MT7]-SARDEQGALLLGHELQSFLK[MT7].4b9_1.heavy 625.849 / 1072.55 1371.0 43.57259941101074 37 11 10 6 10 0.8784048547239994 70.2403503680807 0.039402008056640625 3 0.8569661462151098 3.223480314649939 1371.0 5.931673469387755 0.0 - - - - - - - 269.5 2 8 HMGXB4 HMG box domain containing 4 1357 172 C20140709_OR011_01 C20140709_OR011_01 TB417094.[MT7]-SARDEQGALLLGHELQSFLK[MT7].4b9_2.heavy 625.849 / 536.779 11363.0 43.57259941101074 37 11 10 6 10 0.8784048547239994 70.2403503680807 0.039402008056640625 3 0.8569661462151098 3.223480314649939 11363.0 120.2970663265306 0.0 - - - - - - - 215.6 22 10 HMGXB4 HMG box domain containing 4 1359 173 C20140709_OR011_01 C20140709_OR011_01 TB589862.[MT7]-VILYELENFQGK[MT7].3b6_1.heavy 580.997 / 875.536 16835.0 43.95199966430664 47 17 10 10 10 4.999003823817478 20.00398549878188 0.0 3 0.9776358017371812 8.237074166898589 16835.0 299.2888888888889 0.0 - - - - - - - 162.0 33 10 CRYBB3 crystallin, beta B3 1361 173 C20140709_OR011_01 C20140709_OR011_01 TB589862.[MT7]-VILYELENFQGK[MT7].3b5_1.heavy 580.997 / 762.452 65811.0 43.95199966430664 47 17 10 10 10 4.999003823817478 20.00398549878188 0.0 3 0.9776358017371812 8.237074166898589 65811.0 535.6284166666667 0.0 - - - - - - - 210.0 131 9 CRYBB3 crystallin, beta B3 1363 173 C20140709_OR011_01 C20140709_OR011_01 TB589862.[MT7]-VILYELENFQGK[MT7].3y4_1.heavy 580.997 / 623.363 32050.0 43.95199966430664 47 17 10 10 10 4.999003823817478 20.00398549878188 0.0 3 0.9776358017371812 8.237074166898589 32050.0 286.6694444444444 0.0 - - - - - - - 225.0 64 6 CRYBB3 crystallin, beta B3 1365 173 C20140709_OR011_01 C20140709_OR011_01 TB589862.[MT7]-VILYELENFQGK[MT7].3y5_1.heavy 580.997 / 737.406 24938.0 43.95199966430664 47 17 10 10 10 4.999003823817478 20.00398549878188 0.0 3 0.9776358017371812 8.237074166898589 24938.0 281.1192727272727 0.0 - - - - - - - 191.25 49 8 CRYBB3 crystallin, beta B3 1367 174 C20140709_OR011_01 C20140709_OR011_01 TB589766.[MT7]-AYNLSSTLTK[MT7].2b3_1.heavy 693.398 / 493.253 3545.0 30.421900272369385 33 14 10 3 6 3.3741969924479562 29.636681030721533 0.06480026245117188 6 0.941333268570026 5.070140458232271 3545.0 5.878504239283223 1.0 - - - - - - - 227.0 7 13 ZNF595 zinc finger protein 595 1369 174 C20140709_OR011_01 C20140709_OR011_01 TB589766.[MT7]-AYNLSSTLTK[MT7].2y8_1.heavy 693.398 / 1007.59 689.0 30.421900272369385 33 14 10 3 6 3.3741969924479562 29.636681030721533 0.06480026245117188 6 0.941333268570026 5.070140458232271 689.0 0.19949238578680184 6.0 - - - - - - - 196.75 2 16 ZNF595 zinc finger protein 595 1371 174 C20140709_OR011_01 C20140709_OR011_01 TB589766.[MT7]-AYNLSSTLTK[MT7].2y3_1.heavy 693.398 / 505.347 1280.0 30.421900272369385 33 14 10 3 6 3.3741969924479562 29.636681030721533 0.06480026245117188 6 0.941333268570026 5.070140458232271 1280.0 4.981387478849407 4.0 - - - - - - - 204.91666666666666 2 12 ZNF595 zinc finger protein 595 1373 174 C20140709_OR011_01 C20140709_OR011_01 TB589766.[MT7]-AYNLSSTLTK[MT7].2y7_1.heavy 693.398 / 893.542 886.0 30.421900272369385 33 14 10 3 6 3.3741969924479562 29.636681030721533 0.06480026245117188 6 0.941333268570026 5.070140458232271 886.0 11.106436341033875 0.0 - - - - - - - 0.0 1 0 ZNF595 zinc finger protein 595 1375 175 C20140709_OR011_01 C20140709_OR011_01 TB589762.[MT7]-M[OXI]K[MT7]LILSPK[MT7].3y3_1.heavy 459.967 / 475.3 15279.0 38.194000244140625 38 8 10 10 10 0.6403768620943862 79.91928380899627 0.0 3 0.7726051923412296 2.537324856215148 15279.0 219.5648888888889 0.0 - - - - - - - 185.75 30 8 HMGXB4 HMG box domain containing 4 1377 175 C20140709_OR011_01 C20140709_OR011_01 TB589762.[MT7]-M[OXI]K[MT7]LILSPK[MT7].3b3_1.heavy 459.967 / 677.426 17442.0 38.194000244140625 38 8 10 10 10 0.6403768620943862 79.91928380899627 0.0 3 0.7726051923412296 2.537324856215148 17442.0 188.63199999999998 0.0 - - - - - - - 168.75 34 4 HMGXB4 HMG box domain containing 4 1379 175 C20140709_OR011_01 C20140709_OR011_01 TB589762.[MT7]-M[OXI]K[MT7]LILSPK[MT7].3y4_1.heavy 459.967 / 588.384 38264.0 38.194000244140625 38 8 10 10 10 0.6403768620943862 79.91928380899627 0.0 3 0.7726051923412296 2.537324856215148 38264.0 201.96634190841087 0.0 - - - - - - - 247.83333333333334 76 6 HMGXB4 HMG box domain containing 4 1381 175 C20140709_OR011_01 C20140709_OR011_01 TB589762.[MT7]-M[OXI]K[MT7]LILSPK[MT7].3y5_1.heavy 459.967 / 701.468 5003.0 38.194000244140625 38 8 10 10 10 0.6403768620943862 79.91928380899627 0.0 3 0.7726051923412296 2.537324856215148 5003.0 49.38191935778143 0.0 - - - - - - - 406.0 10 1 HMGXB4 HMG box domain containing 4 1383 176 C20140709_OR011_01 C20140709_OR011_01 TB447231.[MT7]-AFNQSSTLILHK[MT7].3y3_1.heavy 549.654 / 541.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF595 zinc finger protein 595 1385 176 C20140709_OR011_01 C20140709_OR011_01 TB447231.[MT7]-AFNQSSTLILHK[MT7].3b4_1.heavy 549.654 / 605.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF595 zinc finger protein 595 1387 176 C20140709_OR011_01 C20140709_OR011_01 TB447231.[MT7]-AFNQSSTLILHK[MT7].3b5_1.heavy 549.654 / 692.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF595 zinc finger protein 595 1389 176 C20140709_OR011_01 C20140709_OR011_01 TB447231.[MT7]-AFNQSSTLILHK[MT7].3y4_1.heavy 549.654 / 654.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF595 zinc finger protein 595 1391 177 C20140709_OR011_01 C20140709_OR011_01 TB416598.[MT7]-QSPAYMK[MT7].2y4_1.heavy 556.804 / 656.356 1012.0 21.3302001953125 40 14 10 10 6 2.0031429001782075 40.39949730060785 0.0 5 0.9458540369073941 5.279587263127909 1012.0 7.6552605523710255 4.0 - - - - - - - 283.3 2 10 IKZF2 IKAROS family zinc finger 2 (Helios) 1393 177 C20140709_OR011_01 C20140709_OR011_01 TB416598.[MT7]-QSPAYMK[MT7].2y5_1.heavy 556.804 / 753.409 1518.0 21.3302001953125 40 14 10 10 6 2.0031429001782075 40.39949730060785 0.0 5 0.9458540369073941 5.279587263127909 1518.0 0.0 3.0 - - - - - - - 244.41666666666666 3 12 IKZF2 IKAROS family zinc finger 2 (Helios) 1395 177 C20140709_OR011_01 C20140709_OR011_01 TB416598.[MT7]-QSPAYMK[MT7].2y3_1.heavy 556.804 / 585.319 1012.0 21.3302001953125 40 14 10 10 6 2.0031429001782075 40.39949730060785 0.0 5 0.9458540369073941 5.279587263127909 1012.0 4.398765432098765 0.0 - - - - - - - 253.0 2 6 IKZF2 IKAROS family zinc finger 2 (Helios) 1397 177 C20140709_OR011_01 C20140709_OR011_01 TB416598.[MT7]-QSPAYMK[MT7].2y6_1.heavy 556.804 / 840.441 1822.0 21.3302001953125 40 14 10 10 6 2.0031429001782075 40.39949730060785 0.0 5 0.9458540369073941 5.279587263127909 1822.0 0.0 1.0 - - - - - - - 189.625 3 8 IKZF2 IKAROS family zinc finger 2 (Helios) 1399 178 C20140709_OR011_01 C20140709_OR011_01 TB416596.[MT7]-GQLNLHQR.2y5_1.heavy 555.318 / 667.363 1096.0 19.38984966278076 30 14 2 6 8 1.3595279537644684 51.408544390966924 0.03669929504394531 4 0.9414004754592763 5.073076096040709 1096.0 7.7923497267759565 0.0 - - - - - - - 200.86666666666667 2 15 ZFP30 zinc finger protein 30 homolog (mouse) 1401 178 C20140709_OR011_01 C20140709_OR011_01 TB416596.[MT7]-GQLNLHQR.2y6_1.heavy 555.318 / 780.448 1371.0 19.38984966278076 30 14 2 6 8 1.3595279537644684 51.408544390966924 0.03669929504394531 4 0.9414004754592763 5.073076096040709 1371.0 14.159508196721312 0.0 - - - - - - - 136.875 2 8 ZFP30 zinc finger protein 30 homolog (mouse) 1403 178 C20140709_OR011_01 C20140709_OR011_01 TB416596.[MT7]-GQLNLHQR.2b5_1.heavy 555.318 / 670.4 914.0 19.38984966278076 30 14 2 6 8 1.3595279537644684 51.408544390966924 0.03669929504394531 4 0.9414004754592763 5.073076096040709 914.0 11.840891130727197 2.0 - - - - - - - 228.16666666666666 6 6 ZFP30 zinc finger protein 30 homolog (mouse) 1405 178 C20140709_OR011_01 C20140709_OR011_01 TB416596.[MT7]-GQLNLHQR.2y7_1.heavy 555.318 / 908.506 914.0 19.38984966278076 30 14 2 6 8 1.3595279537644684 51.408544390966924 0.03669929504394531 4 0.9414004754592763 5.073076096040709 914.0 9.359591148577449 0.0 - - - - - - - 0.0 1 0 ZFP30 zinc finger protein 30 homolog (mouse) 1407 179 C20140709_OR011_01 C20140709_OR011_01 TB589677.[MT7]-QLLADEK[MT7].2y4_1.heavy 552.829 / 606.321 11036.0 24.74690055847168 47 17 10 10 10 2.1046085005686157 32.8934265634244 0.0 3 0.9716379761522295 7.310749876289461 11036.0 28.219271723116307 0.0 - - - - - - - 278.5 22 12 TRIM35 tripartite motif-containing 35 1409 179 C20140709_OR011_01 C20140709_OR011_01 TB589677.[MT7]-QLLADEK[MT7].2y5_1.heavy 552.829 / 719.406 7134.0 24.74690055847168 47 17 10 10 10 2.1046085005686157 32.8934265634244 0.0 3 0.9716379761522295 7.310749876289461 7134.0 74.18460792631195 0.0 - - - - - - - 173.22222222222223 14 9 TRIM35 tripartite motif-containing 35 1411 179 C20140709_OR011_01 C20140709_OR011_01 TB589677.[MT7]-QLLADEK[MT7].2y3_1.heavy 552.829 / 535.284 5462.0 24.74690055847168 47 17 10 10 10 2.1046085005686157 32.8934265634244 0.0 3 0.9716379761522295 7.310749876289461 5462.0 14.905278276481152 0.0 - - - - - - - 267.3 10 10 TRIM35 tripartite motif-containing 35 1413 179 C20140709_OR011_01 C20140709_OR011_01 TB589677.[MT7]-QLLADEK[MT7].2y6_1.heavy 552.829 / 832.49 9252.0 24.74690055847168 47 17 10 10 10 2.1046085005686157 32.8934265634244 0.0 3 0.9716379761522295 7.310749876289461 9252.0 65.59327891302597 0.0 - - - - - - - 213.33333333333334 18 12 TRIM35 tripartite motif-containing 35 1415 180 C20140709_OR011_01 C20140709_OR011_01 TB589678.[MT7]-SDHLSLHR.2y4_1.heavy 554.803 / 512.294 530.0 18.78154945373535 38 20 10 6 2 8.1464807018043 12.275239291716701 0.039699554443359375 11 0.9913586004049034 13.266522145610418 530.0 0.4796380090497738 19.0 - - - - - - - 0.0 1 0 KLF8 Kruppel-like factor 8 1417 180 C20140709_OR011_01 C20140709_OR011_01 TB589678.[MT7]-SDHLSLHR.2y5_1.heavy 554.803 / 625.378 707.0 18.78154945373535 38 20 10 6 2 8.1464807018043 12.275239291716701 0.039699554443359375 11 0.9913586004049034 13.266522145610418 707.0 4.7954834269617965 1.0 - - - - - - - 0.0 1 0 KLF8 Kruppel-like factor 8 1419 180 C20140709_OR011_01 C20140709_OR011_01 TB589678.[MT7]-SDHLSLHR.2y6_1.heavy 554.803 / 762.437 1502.0 18.78154945373535 38 20 10 6 2 8.1464807018043 12.275239291716701 0.039699554443359375 11 0.9913586004049034 13.266522145610418 1502.0 13.081312178387648 0.0 - - - - - - - 138.85714285714286 3 7 KLF8 Kruppel-like factor 8 1421 180 C20140709_OR011_01 C20140709_OR011_01 TB589678.[MT7]-SDHLSLHR.2y7_1.heavy 554.803 / 877.464 177.0 18.78154945373535 38 20 10 6 2 8.1464807018043 12.275239291716701 0.039699554443359375 11 0.9913586004049034 13.266522145610418 177.0 0.9299999999999999 13.0 - - - - - - - 0.0 1 0 KLF8 Kruppel-like factor 8 1423 181 C20140709_OR011_01 C20140709_OR011_01 TB589929.[MT7]-HLMDPHIFTSNFNNGIGR.4y4_1.heavy 554.28 / 402.246 12406.0 36.496999740600586 30 15 10 1 4 2.5692978809499962 30.493039429172104 0.098602294921875 7 0.9544585730094594 5.760987284318171 12406.0 5.433572466684684 0.0 - - - - - - - 135.0 24 2 LOC100506375;APOBEC3A probable DNA dC->dU-editing enzyme APOBEC-3A-like;apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A 1425 181 C20140709_OR011_01 C20140709_OR011_01 TB589929.[MT7]-HLMDPHIFTSNFNNGIGR.4b5_1.heavy 554.28 / 738.372 944.0 36.496999740600586 30 15 10 1 4 2.5692978809499962 30.493039429172104 0.098602294921875 7 0.9544585730094594 5.760987284318171 944.0 3.6013472007688874 9.0 - - - - - - - 654.7142857142857 3 7 LOC100506375;APOBEC3A probable DNA dC->dU-editing enzyme APOBEC-3A-like;apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A 1427 181 C20140709_OR011_01 C20140709_OR011_01 TB589929.[MT7]-HLMDPHIFTSNFNNGIGR.4b6_1.heavy 554.28 / 875.431 674.0 36.496999740600586 30 15 10 1 4 2.5692978809499962 30.493039429172104 0.098602294921875 7 0.9544585730094594 5.760987284318171 674.0 3.6948148148148148 3.0 - - - - - - - 0.0 1 0 LOC100506375;APOBEC3A probable DNA dC->dU-editing enzyme APOBEC-3A-like;apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A 1429 181 C20140709_OR011_01 C20140709_OR011_01 TB589929.[MT7]-HLMDPHIFTSNFNNGIGR.4b4_1.heavy 554.28 / 641.32 10249.0 36.496999740600586 30 15 10 1 4 2.5692978809499962 30.493039429172104 0.098602294921875 7 0.9544585730094594 5.760987284318171 10249.0 1.3869001298755403 1.0 - - - - - - - 324.0 20 5 LOC100506375;APOBEC3A probable DNA dC->dU-editing enzyme APOBEC-3A-like;apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A 1431 182 C20140709_OR011_01 C20140709_OR011_01 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 92994.0 40.44150161743164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 92994.0 311.8622378579987 0.0 - - - - - - - 235.8 185 5 1433 182 C20140709_OR011_01 C20140709_OR011_01 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 133186.0 40.44150161743164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 133186.0 412.8208832535473 0.0 - - - - - - - 265.25 266 4 1435 182 C20140709_OR011_01 C20140709_OR011_01 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 177974.0 40.44150161743164 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 177974.0 412.6273390707513 0.0 - - - - - - - 353.5 355 4 1437 183 C20140709_OR011_01 C20140709_OR011_01 TB589874.[MT7]-GAVRPTAFK[MT7]PVLPR.3b9_2.heavy 599.708 / 608.874 5440.0 29.30364990234375 31 14 10 3 4 1.8543278693855914 53.927895735684416 0.07080078125 8 0.9300422938548252 4.638522015654842 5440.0 8.321223709369026 0.0 - - - - - - - 261.4166666666667 10 12 LZTS1 leucine zipper, putative tumor suppressor 1 1439 183 C20140709_OR011_01 C20140709_OR011_01 TB589874.[MT7]-GAVRPTAFK[MT7]PVLPR.3y10_2.heavy 599.708 / 635.394 628.0 29.30364990234375 31 14 10 3 4 1.8543278693855914 53.927895735684416 0.07080078125 8 0.9300422938548252 4.638522015654842 628.0 0.9014354066985646 5.0 - - - - - - - 0.0 1 0 LZTS1 leucine zipper, putative tumor suppressor 1 1441 183 C20140709_OR011_01 C20140709_OR011_01 TB589874.[MT7]-GAVRPTAFK[MT7]PVLPR.3b3_1.heavy 599.708 / 372.236 942.0 29.30364990234375 31 14 10 3 4 1.8543278693855914 53.927895735684416 0.07080078125 8 0.9300422938548252 4.638522015654842 942.0 2.317624911757785 9.0 - - - - - - - 261.5 3 16 LZTS1 leucine zipper, putative tumor suppressor 1 1443 183 C20140709_OR011_01 C20140709_OR011_01 TB589874.[MT7]-GAVRPTAFK[MT7]PVLPR.3y5_1.heavy 599.708 / 581.377 5858.0 29.30364990234375 31 14 10 3 4 1.8543278693855914 53.927895735684416 0.07080078125 8 0.9300422938548252 4.638522015654842 5858.0 13.663786242405653 0.0 - - - - - - - 209.2941176470588 11 17 LZTS1 leucine zipper, putative tumor suppressor 1 1445 184 C20140709_OR011_01 C20140709_OR011_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 82070.0 35.52920150756836 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 82070.0 339.70842376797293 0.0 - - - - - - - 194.57142857142858 164 7 1447 184 C20140709_OR011_01 C20140709_OR011_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 20858.0 35.52920150756836 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 20858.0 25.28439034282415 2.0 - - - - - - - 218.0 121 5 1449 184 C20140709_OR011_01 C20140709_OR011_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 17723.0 35.52920150756836 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 17723.0 64.84711369193154 0.0 - - - - - - - 221.5 35 8 1451 185 C20140709_OR011_01 C20140709_OR011_01 TB447339.[MT7]-HFREWGSHAPTFQVQSIR.4y4_1.heavy 582.553 / 503.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRYBA4 crystallin, beta A4 1453 185 C20140709_OR011_01 C20140709_OR011_01 TB447339.[MT7]-HFREWGSHAPTFQVQSIR.4y5_1.heavy 582.553 / 602.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRYBA4 crystallin, beta A4 1455 185 C20140709_OR011_01 C20140709_OR011_01 TB447339.[MT7]-HFREWGSHAPTFQVQSIR.4b7_1.heavy 582.553 / 1044.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRYBA4 crystallin, beta A4 1457 185 C20140709_OR011_01 C20140709_OR011_01 TB447339.[MT7]-HFREWGSHAPTFQVQSIR.4y6_1.heavy 582.553 / 730.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRYBA4 crystallin, beta A4 1459 186 C20140709_OR011_01 C20140709_OR011_01 TB589920.[MT7]-ENPYEDIPVQPLPMWR.2y9_1.heavy 1064.54 / 1123.61 4686.0 44.444549560546875 39 13 10 6 10 3.595921975846564 27.809279698416614 0.039398193359375 3 0.9163600495687354 4.237219273027588 4686.0 26.293643149846844 0.0 - - - - - - - 234.78571428571428 9 14 DENND2C DENN/MADD domain containing 2C 1461 186 C20140709_OR011_01 C20140709_OR011_01 TB589920.[MT7]-ENPYEDIPVQPLPMWR.2b6_1.heavy 1064.54 / 892.38 2220.0 44.444549560546875 39 13 10 6 10 3.595921975846564 27.809279698416614 0.039398193359375 3 0.9163600495687354 4.237219273027588 2220.0 31.655037437912377 0.0 - - - - - - - 164.4 4 5 DENND2C DENN/MADD domain containing 2C 1463 186 C20140709_OR011_01 C20140709_OR011_01 TB589920.[MT7]-ENPYEDIPVQPLPMWR.2y6_1.heavy 1064.54 / 799.428 987.0 44.444549560546875 39 13 10 6 10 3.595921975846564 27.809279698416614 0.039398193359375 3 0.9163600495687354 4.237219273027588 987.0 12.672039103386986 0.0 - - - - - - - 0.0 1 0 DENND2C DENN/MADD domain containing 2C 1465 186 C20140709_OR011_01 C20140709_OR011_01 TB589920.[MT7]-ENPYEDIPVQPLPMWR.2y10_1.heavy 1064.54 / 1236.69 493.0 44.444549560546875 39 13 10 6 10 3.595921975846564 27.809279698416614 0.039398193359375 3 0.9163600495687354 4.237219273027588 493.0 1.096761133603239 7.0 - - - - - - - 0.0 1 0 DENND2C DENN/MADD domain containing 2C 1467 187 C20140709_OR011_01 C20140709_OR011_01 TB589733.[MT7]-ESQTEVNAK[MT7].2y6_1.heavy 647.348 / 805.454 1001.0 16.822275638580322 43 18 10 5 10 7.0041084962480555 14.277334517814474 0.04170036315917969 3 0.9877534454480205 11.140666995898455 1001.0 26.787323943661967 0.0 - - - - - - - 98.0 2 8 LZTS1 leucine zipper, putative tumor suppressor 1 1469 187 C20140709_OR011_01 C20140709_OR011_01 TB589733.[MT7]-ESQTEVNAK[MT7].2y4_1.heavy 647.348 / 575.363 786.0 16.822275638580322 43 18 10 5 10 7.0041084962480555 14.277334517814474 0.04170036315917969 3 0.9877534454480205 11.140666995898455 786.0 9.056338028169014 4.0 - - - - - - - 188.27272727272728 2 11 LZTS1 leucine zipper, putative tumor suppressor 1 1471 187 C20140709_OR011_01 C20140709_OR011_01 TB589733.[MT7]-ESQTEVNAK[MT7].2y8_1.heavy 647.348 / 1020.54 1859.0 16.822275638580322 43 18 10 5 10 7.0041084962480555 14.277334517814474 0.04170036315917969 3 0.9877534454480205 11.140666995898455 1859.0 6.949532710280374 0.0 - - - - - - - 151.625 3 8 LZTS1 leucine zipper, putative tumor suppressor 1 1473 187 C20140709_OR011_01 C20140709_OR011_01 TB589733.[MT7]-ESQTEVNAK[MT7].2b5_1.heavy 647.348 / 719.333 1144.0 16.822275638580322 43 18 10 5 10 7.0041084962480555 14.277334517814474 0.04170036315917969 3 0.9877534454480205 11.140666995898455 1144.0 6.676635514018692 0.0 - - - - - - - 178.33333333333334 2 6 LZTS1 leucine zipper, putative tumor suppressor 1 1475 188 C20140709_OR011_01 C20140709_OR011_01 TB589747.[MT7]-SEDFFYIK[MT7].2y4_1.heavy 668.855 / 714.431 3127.0 37.99709892272949 38 13 10 5 10 10.096737072075214 9.904189768056096 0.043201446533203125 3 0.9024913320361324 3.919647070633764 3127.0 16.478063725490195 0.0 - - - - - - - 317.3333333333333 6 9 LZTS1 leucine zipper, putative tumor suppressor 1 1477 188 C20140709_OR011_01 C20140709_OR011_01 TB589747.[MT7]-SEDFFYIK[MT7].2b4_1.heavy 668.855 / 623.279 2855.0 37.99709892272949 38 13 10 5 10 10.096737072075214 9.904189768056096 0.043201446533203125 3 0.9024913320361324 3.919647070633764 2855.0 21.112605042016806 0.0 - - - - - - - 241.77777777777777 5 9 LZTS1 leucine zipper, putative tumor suppressor 1 1479 188 C20140709_OR011_01 C20140709_OR011_01 TB589747.[MT7]-SEDFFYIK[MT7].2y3_1.heavy 668.855 / 567.362 5438.0 37.99709892272949 38 13 10 5 10 10.096737072075214 9.904189768056096 0.043201446533203125 3 0.9024913320361324 3.919647070633764 5438.0 25.457303921568627 0.0 - - - - - - - 317.3333333333333 10 6 LZTS1 leucine zipper, putative tumor suppressor 1 1481 188 C20140709_OR011_01 C20140709_OR011_01 TB589747.[MT7]-SEDFFYIK[MT7].2b5_1.heavy 668.855 / 770.348 4487.0 37.99709892272949 38 13 10 5 10 10.096737072075214 9.904189768056096 0.043201446533203125 3 0.9024913320361324 3.919647070633764 4487.0 42.560514705882355 0.0 - - - - - - - 204.0 8 2 LZTS1 leucine zipper, putative tumor suppressor 1 1483 189 C20140709_OR011_01 C20140709_OR011_01 TB589746.[MT7]-SEDFFYIK[MT7].3y3_1.heavy 446.239 / 567.362 7074.0 37.99709892272949 30 5 10 5 10 0.39029532688217544 120.85549002595573 0.043201446533203125 3 0.6285622164267844 1.9586384506714754 7074.0 50.71433823529412 0.0 - - - - - - - 272.0 14 1 LZTS1 leucine zipper, putative tumor suppressor 1 1485 189 C20140709_OR011_01 C20140709_OR011_01 TB589746.[MT7]-SEDFFYIK[MT7].3b4_1.heavy 446.239 / 623.279 4081.0 37.99709892272949 30 5 10 5 10 0.39029532688217544 120.85549002595573 0.043201446533203125 3 0.6285622164267844 1.9586384506714754 4081.0 45.01102941176471 0.0 - - - - - - - 408.0 8 1 LZTS1 leucine zipper, putative tumor suppressor 1 1487 189 C20140709_OR011_01 C20140709_OR011_01 TB589746.[MT7]-SEDFFYIK[MT7].3b5_1.heavy 446.239 / 770.348 2041.0 37.99709892272949 30 5 10 5 10 0.39029532688217544 120.85549002595573 0.043201446533203125 3 0.6285622164267844 1.9586384506714754 2041.0 15.507598039215686 0.0 - - - - - - - 136.0 4 3 LZTS1 leucine zipper, putative tumor suppressor 1 1489 189 C20140709_OR011_01 C20140709_OR011_01 TB589746.[MT7]-SEDFFYIK[MT7].3b3_1.heavy 446.239 / 476.211 2585.0 37.99709892272949 30 5 10 5 10 0.39029532688217544 120.85549002595573 0.043201446533203125 3 0.6285622164267844 1.9586384506714754 2585.0 24.075980392156865 0.0 - - - - - - - 408.0 5 3 LZTS1 leucine zipper, putative tumor suppressor 1 1491 190 C20140709_OR011_01 C20140709_OR011_01 TB447220.[MT7]-AFRGEQFVLEK[MT7].3b6_1.heavy 537.975 / 833.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRYBB3 crystallin, beta B3 1493 190 C20140709_OR011_01 C20140709_OR011_01 TB447220.[MT7]-AFRGEQFVLEK[MT7].3y3_1.heavy 537.975 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRYBB3 crystallin, beta B3 1495 190 C20140709_OR011_01 C20140709_OR011_01 TB447220.[MT7]-AFRGEQFVLEK[MT7].3b5_1.heavy 537.975 / 705.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRYBB3 crystallin, beta B3 1497 190 C20140709_OR011_01 C20140709_OR011_01 TB447220.[MT7]-AFRGEQFVLEK[MT7].3b7_1.heavy 537.975 / 980.507 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRYBB3 crystallin, beta B3 1499 191 C20140709_OR011_01 C20140709_OR011_01 TB589917.[MT7]-MALRPTAFSGC[CAM]LNC[CAM]SK[MT7].3y15_2.heavy 701.025 / 913.462 1998.0 32.40420150756836 39 16 10 5 8 4.887097737287265 20.462042172192795 0.04199981689453125 4 0.9628902334003159 6.386545037084468 1998.0 10.803949779436714 0.0 - - - - - - - 240.28571428571428 3 7 EMID1 EMI domain containing 1 1501 191 C20140709_OR011_01 C20140709_OR011_01 TB589917.[MT7]-MALRPTAFSGC[CAM]LNC[CAM]SK[MT7].3y3_1.heavy 701.025 / 538.278 2418.0 32.40420150756836 39 16 10 5 8 4.887097737287265 20.462042172192795 0.04199981689453125 4 0.9628902334003159 6.386545037084468 2418.0 14.195234774733983 2.0 - - - - - - - 175.0 6 9 EMID1 EMI domain containing 1 1503 191 C20140709_OR011_01 C20140709_OR011_01 TB589917.[MT7]-MALRPTAFSGC[CAM]LNC[CAM]SK[MT7].3y4_1.heavy 701.025 / 652.32 3680.0 32.40420150756836 39 16 10 5 8 4.887097737287265 20.462042172192795 0.04199981689453125 4 0.9628902334003159 6.386545037084468 3680.0 21.020575774035855 0.0 - - - - - - - 220.6 7 10 EMID1 EMI domain containing 1 1505 191 C20140709_OR011_01 C20140709_OR011_01 TB589917.[MT7]-MALRPTAFSGC[CAM]LNC[CAM]SK[MT7].3y5_1.heavy 701.025 / 765.404 631.0 32.40420150756836 39 16 10 5 8 4.887097737287265 20.462042172192795 0.04199981689453125 4 0.9628902334003159 6.386545037084468 631.0 4.246730158730159 8.0 - - - - - - - 0.0 1 0 EMID1 EMI domain containing 1 1507 192 C20140709_OR011_01 C20140709_OR011_01 TB446889.[MT7]-LLREEAEGAR.3y7_1.heavy 429.909 / 761.342 1303.0 22.774099349975586 38 13 10 5 10 3.215160720527399 31.102644219787713 0.04199981689453125 3 0.9261254248341084 4.512365763724184 1303.0 26.06 0.0 - - - - - - - 100.0 2 2 TRIM35 tripartite motif-containing 35 1509 192 C20140709_OR011_01 C20140709_OR011_01 TB446889.[MT7]-LLREEAEGAR.3y6_1.heavy 429.909 / 632.3 2205.0 22.774099349975586 38 13 10 5 10 3.215160720527399 31.102644219787713 0.04199981689453125 3 0.9261254248341084 4.512365763724184 2205.0 16.44446511627907 0.0 - - - - - - - 200.25 4 4 TRIM35 tripartite motif-containing 35 1511 192 C20140709_OR011_01 C20140709_OR011_01 TB446889.[MT7]-LLREEAEGAR.3y4_1.heavy 429.909 / 432.22 6716.0 22.774099349975586 38 13 10 5 10 3.215160720527399 31.102644219787713 0.04199981689453125 3 0.9261254248341084 4.512365763724184 6716.0 74.25530897009966 0.0 - - - - - - - 200.22222222222223 13 9 TRIM35 tripartite motif-containing 35 1513 192 C20140709_OR011_01 C20140709_OR011_01 TB446889.[MT7]-LLREEAEGAR.3y5_1.heavy 429.909 / 503.257 7418.0 22.774099349975586 38 13 10 5 10 3.215160720527399 31.102644219787713 0.04199981689453125 3 0.9261254248341084 4.512365763724184 7418.0 55.3220146179402 0.0 - - - - - - - 233.83333333333334 14 6 TRIM35 tripartite motif-containing 35 1515 193 C20140709_OR011_01 C20140709_OR011_01 TB589918.[MT7]-SC[CAM]GLEEQESPHEVC[CAM]FR.3b6_1.heavy 703.315 / 820.363 5181.0 27.358075618743896 44 18 10 6 10 4.466210644347841 22.390345633731762 0.03909873962402344 3 0.98754197239638 11.04551121545047 5181.0 11.013333333333334 1.0 - - - - - - - 315.2 10 5 ZFP30 zinc finger protein 30 homolog (mouse) 1517 193 C20140709_OR011_01 C20140709_OR011_01 TB589918.[MT7]-SC[CAM]GLEEQESPHEVC[CAM]FR.3b4_1.heavy 703.315 / 562.278 7884.0 27.358075618743896 44 18 10 6 10 4.466210644347841 22.390345633731762 0.03909873962402344 3 0.98754197239638 11.04551121545047 7884.0 57.815999999999995 0.0 - - - - - - - 225.36363636363637 15 11 ZFP30 zinc finger protein 30 homolog (mouse) 1519 193 C20140709_OR011_01 C20140709_OR011_01 TB589918.[MT7]-SC[CAM]GLEEQESPHEVC[CAM]FR.3b5_1.heavy 703.315 / 691.32 11262.0 27.358075618743896 44 18 10 6 10 4.466210644347841 22.390345633731762 0.03909873962402344 3 0.98754197239638 11.04551121545047 11262.0 34.98550295857988 0.0 - - - - - - - 193.28571428571428 22 7 ZFP30 zinc finger protein 30 homolog (mouse) 1521 193 C20140709_OR011_01 C20140709_OR011_01 TB589918.[MT7]-SC[CAM]GLEEQESPHEVC[CAM]FR.3y5_1.heavy 703.315 / 710.329 9798.0 27.358075618743896 44 18 10 6 10 4.466210644347841 22.390345633731762 0.03909873962402344 3 0.98754197239638 11.04551121545047 9798.0 91.1782418879056 0.0 - - - - - - - 225.25 19 4 ZFP30 zinc finger protein 30 homolog (mouse) 1523 194 C20140709_OR011_01 C20140709_OR011_01 TB589689.[MT7]-RNFISSK[MT7].2y4_1.heavy 570.342 / 578.363 500.0 19.771174907684326 23 3 10 6 4 0.49865925351547374 93.4519803577688 0.03849983215332031 9 0.5356595608888685 1.7357691486116984 500.0 3.833333333333333 12.0 - - - - - - - 0.0 1 0 C22orf31 chromosome 22 open reading frame 31 1525 194 C20140709_OR011_01 C20140709_OR011_01 TB589689.[MT7]-RNFISSK[MT7].2y5_1.heavy 570.342 / 725.431 500.0 19.771174907684326 23 3 10 6 4 0.49865925351547374 93.4519803577688 0.03849983215332031 9 0.5356595608888685 1.7357691486116984 500.0 0.0 7.0 - - - - - - - 0.0 1 0 C22orf31 chromosome 22 open reading frame 31 1527 194 C20140709_OR011_01 C20140709_OR011_01 TB589689.[MT7]-RNFISSK[MT7].2b6_1.heavy 570.342 / 849.47 3500.0 19.771174907684326 23 3 10 6 4 0.49865925351547374 93.4519803577688 0.03849983215332031 9 0.5356595608888685 1.7357691486116984 3500.0 47.775 0.0 - - - - - - - 175.0 7 8 C22orf31 chromosome 22 open reading frame 31 1529 194 C20140709_OR011_01 C20140709_OR011_01 TB589689.[MT7]-RNFISSK[MT7].2y6_1.heavy 570.342 / 839.474 200.0 19.771174907684326 23 3 10 6 4 0.49865925351547374 93.4519803577688 0.03849983215332031 9 0.5356595608888685 1.7357691486116984 200.0 2.0 12.0 - - - - - - - 225.0 2 4 C22orf31 chromosome 22 open reading frame 31 1531 195 C20140709_OR011_01 C20140709_OR011_01 TB447225.[MT7]-VNLLEQELQELR.2b3_1.heavy 814.46 / 471.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - LZTS1 leucine zipper, putative tumor suppressor 1 1533 195 C20140709_OR011_01 C20140709_OR011_01 TB447225.[MT7]-VNLLEQELQELR.2y8_1.heavy 814.46 / 1044.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - LZTS1 leucine zipper, putative tumor suppressor 1 1535 195 C20140709_OR011_01 C20140709_OR011_01 TB447225.[MT7]-VNLLEQELQELR.2y9_1.heavy 814.46 / 1157.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - LZTS1 leucine zipper, putative tumor suppressor 1 1537 195 C20140709_OR011_01 C20140709_OR011_01 TB447225.[MT7]-VNLLEQELQELR.2y7_1.heavy 814.46 / 915.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - LZTS1 leucine zipper, putative tumor suppressor 1 1539 196 C20140709_OR011_01 C20140709_OR011_01 TB589683.[MT7]-SIHSEQK[MT7].2y4_1.heavy 558.816 / 635.348 2304.0 14.714699745178223 43 14 9 10 10 2.2591305804257287 44.26481623791538 0.0 3 0.9447646524378747 5.226780152442066 2304.0 22.249036544850497 1.0 - - - - - - - 135.2 4 10 ZNF595 zinc finger protein 595 1541 196 C20140709_OR011_01 C20140709_OR011_01 TB589683.[MT7]-SIHSEQK[MT7].2y5_1.heavy 558.816 / 772.407 852.0 14.714699745178223 43 14 9 10 10 2.2591305804257287 44.26481623791538 0.0 3 0.9447646524378747 5.226780152442066 852.0 24.708 0.0 - - - - - - - 0.0 1 0 ZNF595 zinc finger protein 595 1543 196 C20140709_OR011_01 C20140709_OR011_01 TB589683.[MT7]-SIHSEQK[MT7].2y3_1.heavy 558.816 / 548.316 501.0 14.714699745178223 43 14 9 10 10 2.2591305804257287 44.26481623791538 0.0 3 0.9447646524378747 5.226780152442066 501.0 1.336 4.0 - - - - - - - 134.69230769230768 5 13 ZNF595 zinc finger protein 595 1545 196 C20140709_OR011_01 C20140709_OR011_01 TB589683.[MT7]-SIHSEQK[MT7].2y6_1.heavy 558.816 / 885.491 551.0 14.714699745178223 43 14 9 10 10 2.2591305804257287 44.26481623791538 0.0 3 0.9447646524378747 5.226780152442066 551.0 0.0 1.0 - - - - - - - 0.0 1 0 ZNF595 zinc finger protein 595 1547 197 C20140709_OR011_01 C20140709_OR011_01 TB589886.[MT7]-K[MT7]AQLMQYLSLPK[MT7].3b4_1.heavy 618.041 / 729.486 3416.0 38.0296745300293 33 8 10 5 10 0.6363180112084724 90.10730334198604 0.0438995361328125 3 0.7526161346009254 2.4282162560455136 3416.0 19.17696560350219 0.0 - - - - - - - 205.08333333333334 6 12 C22orf42 chromosome 22 open reading frame 42 1549 197 C20140709_OR011_01 C20140709_OR011_01 TB589886.[MT7]-K[MT7]AQLMQYLSLPK[MT7].3b5_1.heavy 618.041 / 860.527 4099.0 38.0296745300293 33 8 10 5 10 0.6363180112084724 90.10730334198604 0.0438995361328125 3 0.7526161346009254 2.4282162560455136 4099.0 19.510812892165724 0.0 - - - - - - - 205.0 8 6 C22orf42 chromosome 22 open reading frame 42 1551 197 C20140709_OR011_01 C20140709_OR011_01 TB589886.[MT7]-K[MT7]AQLMQYLSLPK[MT7].3y4_1.heavy 618.041 / 588.384 11204.0 38.0296745300293 33 8 10 5 10 0.6363180112084724 90.10730334198604 0.0438995361328125 3 0.7526161346009254 2.4282162560455136 11204.0 13.84559349593496 0.0 - - - - - - - 683.2857142857143 22 7 C22orf42 chromosome 22 open reading frame 42 1553 197 C20140709_OR011_01 C20140709_OR011_01 TB589886.[MT7]-K[MT7]AQLMQYLSLPK[MT7].3b3_1.heavy 618.041 / 616.402 3962.0 38.0296745300293 33 8 10 5 10 0.6363180112084724 90.10730334198604 0.0438995361328125 3 0.7526161346009254 2.4282162560455136 3962.0 13.544680073126141 0.0 - - - - - - - 585.8571428571429 7 7 C22orf42 chromosome 22 open reading frame 42 1555 198 C20140709_OR011_01 C20140709_OR011_01 TB446881.[MT7]-AQAALAR.2y5_1.heavy 422.76 / 501.314 2774.0 18.426199913024902 43 17 10 6 10 3.5830720823641573 27.909011513387895 0.03959846496582031 3 0.9753266592904822 7.840637347159349 2774.0 10.140363137571754 0.0 - - - - - - - 258.3333333333333 5 12 LZTS1 leucine zipper, putative tumor suppressor 1 1557 198 C20140709_OR011_01 C20140709_OR011_01 TB446881.[MT7]-AQAALAR.2b4_1.heavy 422.76 / 486.279 2856.0 18.426199913024902 43 17 10 6 10 3.5830720823641573 27.909011513387895 0.03959846496582031 3 0.9753266592904822 7.840637347159349 2856.0 44.859242855005235 0.0 - - - - - - - 179.6 5 10 LZTS1 leucine zipper, putative tumor suppressor 1 1559 198 C20140709_OR011_01 C20140709_OR011_01 TB446881.[MT7]-AQAALAR.2y6_1.heavy 422.76 / 629.373 6038.0 18.426199913024902 43 17 10 6 10 3.5830720823641573 27.909011513387895 0.03959846496582031 3 0.9753266592904822 7.840637347159349 6038.0 103.67507107586414 0.0 - - - - - - - 170.16666666666666 12 12 LZTS1 leucine zipper, putative tumor suppressor 1 1561 198 C20140709_OR011_01 C20140709_OR011_01 TB446881.[MT7]-AQAALAR.2b5_1.heavy 422.76 / 599.363 1795.0 18.426199913024902 43 17 10 6 10 3.5830720823641573 27.909011513387895 0.03959846496582031 3 0.9753266592904822 7.840637347159349 1795.0 11.012269938650308 1.0 - - - - - - - 109.0 3 3 LZTS1 leucine zipper, putative tumor suppressor 1 1563 199 C20140709_OR011_01 C20140709_OR011_01 TB589885.[MT7]-VEEQAILDAMAEETR.2b3_1.heavy 924.96 / 502.263 4563.0 41.68819999694824 39 14 10 5 10 1.4584692657946112 48.60826163353517 0.041400909423828125 3 0.9380067983513931 4.930838560598485 4563.0 23.37536842105263 0.0 - - - - - - - 260.57142857142856 9 7 TRIM35 tripartite motif-containing 35 1565 199 C20140709_OR011_01 C20140709_OR011_01 TB589885.[MT7]-VEEQAILDAMAEETR.2b5_1.heavy 924.96 / 701.359 7414.0 41.68819999694824 39 14 10 5 10 1.4584692657946112 48.60826163353517 0.041400909423828125 3 0.9380067983513931 4.930838560598485 7414.0 51.70289473684211 0.0 - - - - - - - 250.8 14 5 TRIM35 tripartite motif-containing 35 1567 199 C20140709_OR011_01 C20140709_OR011_01 TB589885.[MT7]-VEEQAILDAMAEETR.2y11_1.heavy 924.96 / 1219.6 3422.0 41.68819999694824 39 14 10 5 10 1.4584692657946112 48.60826163353517 0.041400909423828125 3 0.9380067983513931 4.930838560598485 3422.0 12.007017543859648 0.0 - - - - - - - 291.3333333333333 6 9 TRIM35 tripartite motif-containing 35 1569 199 C20140709_OR011_01 C20140709_OR011_01 TB589885.[MT7]-VEEQAILDAMAEETR.2y7_1.heavy 924.96 / 807.367 3992.0 41.68819999694824 39 14 10 5 10 1.4584692657946112 48.60826163353517 0.041400909423828125 3 0.9380067983513931 4.930838560598485 3992.0 25.44608187134503 0.0 - - - - - - - 273.6 7 10 TRIM35 tripartite motif-containing 35 1571 200 C20140709_OR011_01 C20140709_OR011_01 TB589884.[MT7]-DFLREEEEIAAQVR.3y6_1.heavy 616.991 / 657.404 12499.0 39.49789810180664 44 14 10 10 10 1.0424404183777634 61.291781425094484 0.0 3 0.9307881009695106 4.663744186158121 12499.0 33.83187969924812 0.0 - - - - - - - 299.25 24 12 HMGXB4 HMG box domain containing 4 1573 200 C20140709_OR011_01 C20140709_OR011_01 TB589884.[MT7]-DFLREEEEIAAQVR.3b8_1.heavy 616.991 / 1192.56 3058.0 39.49789810180664 44 14 10 10 10 1.0424404183777634 61.291781425094484 0.0 3 0.9307881009695106 4.663744186158121 3058.0 45.502120300751876 0.0 - - - - - - - 159.6 6 5 HMGXB4 HMG box domain containing 4 1575 200 C20140709_OR011_01 C20140709_OR011_01 TB589884.[MT7]-DFLREEEEIAAQVR.3y5_1.heavy 616.991 / 544.32 28988.0 39.49789810180664 44 14 10 10 10 1.0424404183777634 61.291781425094484 0.0 3 0.9307881009695106 4.663744186158121 28988.0 83.73100250626567 0.0 - - - - - - - 266.0 57 6 HMGXB4 HMG box domain containing 4 1577 200 C20140709_OR011_01 C20140709_OR011_01 TB589884.[MT7]-DFLREEEEIAAQVR.3b8_2.heavy 616.991 / 596.784 N/A 39.49789810180664 44 14 10 10 10 1.0424404183777634 61.291781425094484 0.0 3 0.9307881009695106 4.663744186158121 16355.0 16.815295192217178 1.0 - - - - - - - 221.66666666666666 46 3 HMGXB4 HMG box domain containing 4 1579 201 C20140709_OR011_01 C20140709_OR011_01 TB446885.[MT7]-GASAQK[MT7].2y4_1.heavy 425.255 / 577.343 1168.0 12.839099884033203 38 16 6 10 6 6.362781386344628 15.716397268435664 0.0 5 0.9671624592863332 6.7917455573185315 1168.0 10.234355118565645 1.0 - - - - - - - 146.64705882352942 3 17 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 1581 201 C20140709_OR011_01 C20140709_OR011_01 TB446885.[MT7]-GASAQK[MT7].2b5_1.heavy 425.255 / 559.296 247.0 12.839099884033203 38 16 6 10 6 6.362781386344628 15.716397268435664 0.0 5 0.9671624592863332 6.7917455573185315 247.0 3.503106710671067 2.0 - - - - - - - 0.0 1 0 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 1583 201 C20140709_OR011_01 C20140709_OR011_01 TB446885.[MT7]-GASAQK[MT7].2y5_1.heavy 425.255 / 648.38 202.0 12.839099884033203 38 16 6 10 6 6.362781386344628 15.716397268435664 0.0 5 0.9671624592863332 6.7917455573185315 202.0 10.879434343434344 0.0 - - - - - - - 0.0 0 0 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 1585 201 C20140709_OR011_01 C20140709_OR011_01 TB446885.[MT7]-GASAQK[MT7].2y3_1.heavy 425.255 / 490.311 449.0 12.839099884033203 38 16 6 10 6 6.362781386344628 15.716397268435664 0.0 5 0.9671624592863332 6.7917455573185315 449.0 12.165898089171975 0.0 - - - - - - - 0.0 0 0 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 1587 202 C20140709_OR011_01 C20140709_OR011_01 TB589742.[MT7]-GSPTRPNPPVR.3y6_1.heavy 441.253 / 679.389 1244.0 18.249000549316406 40 20 9 5 6 5.790882918831468 17.26852388515892 0.04119873046875 5 0.9907888619359656 12.849073021169827 1244.0 7.70827392256364 1.0 - - - - - - - 193.66666666666666 2 9 DPYSL3 dihydropyrimidinase-like 3 1589 202 C20140709_OR011_01 C20140709_OR011_01 TB589742.[MT7]-GSPTRPNPPVR.3y4_1.heavy 441.253 / 468.293 1410.0 18.249000549316406 40 20 9 5 6 5.790882918831468 17.26852388515892 0.04119873046875 5 0.9907888619359656 12.849073021169827 1410.0 2.2699055431370496 1.0 - - - - - - - 285.8888888888889 2 9 DPYSL3 dihydropyrimidinase-like 3 1591 202 C20140709_OR011_01 C20140709_OR011_01 TB589742.[MT7]-GSPTRPNPPVR.3y5_1.heavy 441.253 / 582.336 415.0 18.249000549316406 40 20 9 5 6 5.790882918831468 17.26852388515892 0.04119873046875 5 0.9907888619359656 12.849073021169827 415.0 3.1 4.0 - - - - - - - 0.0 1 0 DPYSL3 dihydropyrimidinase-like 3 1593 202 C20140709_OR011_01 C20140709_OR011_01 TB589742.[MT7]-GSPTRPNPPVR.3b7_2.heavy 441.253 / 427.734 1742.0 18.249000549316406 40 20 9 5 6 5.790882918831468 17.26852388515892 0.04119873046875 5 0.9907888619359656 12.849073021169827 1742.0 5.416728407351153 2.0 - - - - - - - 781.7142857142857 3 7 DPYSL3 dihydropyrimidinase-like 3 1595 203 C20140709_OR011_01 C20140709_OR011_01 TB447329.[MT7]-NFVYSDDEPFK[MT7]PWK[MT7].4b4_1.heavy 551.79 / 668.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 1597 203 C20140709_OR011_01 C20140709_OR011_01 TB447329.[MT7]-NFVYSDDEPFK[MT7]PWK[MT7].4y6_2.heavy 551.79 / 545.836 N/A N/A - - - - - - - - - 0.0 - - - - - - - APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 1599 203 C20140709_OR011_01 C20140709_OR011_01 TB447329.[MT7]-NFVYSDDEPFK[MT7]PWK[MT7].4y3_1.heavy 551.79 / 574.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 1601 203 C20140709_OR011_01 C20140709_OR011_01 TB447329.[MT7]-NFVYSDDEPFK[MT7]PWK[MT7].4b3_1.heavy 551.79 / 505.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D 1603 204 C20140709_OR011_01 C20140709_OR011_01 TB417054.[MT7]-GLRGEPGPQGSAGQRGEPGPK[MT7].3b5_1.heavy 774.083 / 657.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 1605 204 C20140709_OR011_01 C20140709_OR011_01 TB417054.[MT7]-GLRGEPGPQGSAGQRGEPGPK[MT7].3y4_1.heavy 774.083 / 542.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 1607 204 C20140709_OR011_01 C20140709_OR011_01 TB417054.[MT7]-GLRGEPGPQGSAGQRGEPGPK[MT7].3b17_2.heavy 774.083 / 889.954 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 1609 204 C20140709_OR011_01 C20140709_OR011_01 TB417054.[MT7]-GLRGEPGPQGSAGQRGEPGPK[MT7].3b7_1.heavy 774.083 / 811.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - EMID1 EMI domain containing 1 1611 205 C20140709_OR011_01 C20140709_OR011_01 TB417053.[MT7]-TSFGPALEETQWEVC[CAM]QK[MT7].4b7_1.heavy 575.288 / 818.453 955.0 37.88789939880371 36 14 10 2 10 1.394758319037539 47.79800611812833 0.08699798583984375 3 0.9347093033365383 4.803358093989092 955.0 6.698992673992674 5.0 - - - - - - - 253.42857142857142 3 7 LZTS1 leucine zipper, putative tumor suppressor 1 1613 205 C20140709_OR011_01 C20140709_OR011_01 TB417053.[MT7]-TSFGPALEETQWEVC[CAM]QK[MT7].4y3_1.heavy 575.288 / 579.304 5455.0 37.88789939880371 36 14 10 2 10 1.394758319037539 47.79800611812833 0.08699798583984375 3 0.9347093033365383 4.803358093989092 5455.0 12.572078495628464 0.0 - - - - - - - 221.5 10 8 LZTS1 leucine zipper, putative tumor suppressor 1 1615 205 C20140709_OR011_01 C20140709_OR011_01 TB417053.[MT7]-TSFGPALEETQWEVC[CAM]QK[MT7].4b6_1.heavy 575.288 / 705.369 4091.0 37.88789939880371 36 14 10 2 10 1.394758319037539 47.79800611812833 0.08699798583984375 3 0.9347093033365383 4.803358093989092 4091.0 19.204694376528117 0.0 - - - - - - - 221.375 8 8 LZTS1 leucine zipper, putative tumor suppressor 1 1617 205 C20140709_OR011_01 C20140709_OR011_01 TB417053.[MT7]-TSFGPALEETQWEVC[CAM]QK[MT7].4b4_1.heavy 575.288 / 537.279 3409.0 37.88789939880371 36 14 10 2 10 1.394758319037539 47.79800611812833 0.08699798583984375 3 0.9347093033365383 4.803358093989092 3409.0 20.88609799928118 3.0 - - - - - - - 318.0 6 3 LZTS1 leucine zipper, putative tumor suppressor 1 1619 206 C20140709_OR011_01 C20140709_OR011_01 TB416602.[MT7]-ASEILGLK[MT7].2y4_1.heavy 559.855 / 574.404 12983.0 33.38370132446289 50 20 10 10 10 19.944582410055016 5.013892893018669 0.0 3 0.9989474316111258 38.03637383902527 12983.0 67.92050918796839 0.0 - - - - - - - 618.0 25 7 LZTS1 leucine zipper, putative tumor suppressor 1 1621 206 C20140709_OR011_01 C20140709_OR011_01 TB416602.[MT7]-ASEILGLK[MT7].2b4_1.heavy 559.855 / 545.305 11201.0 33.38370132446289 50 20 10 10 10 19.944582410055016 5.013892893018669 0.0 3 0.9989474316111258 38.03637383902527 11201.0 20.6193497075095 0.0 - - - - - - - 672.7142857142857 22 7 LZTS1 leucine zipper, putative tumor suppressor 1 1623 206 C20140709_OR011_01 C20140709_OR011_01 TB416602.[MT7]-ASEILGLK[MT7].2b5_1.heavy 559.855 / 658.389 4073.0 33.38370132446289 50 20 10 10 10 19.944582410055016 5.013892893018669 0.0 3 0.9989474316111258 38.03637383902527 4073.0 6.399476954093336 0.0 - - - - - - - 280.1 8 10 LZTS1 leucine zipper, putative tumor suppressor 1 1625 206 C20140709_OR011_01 C20140709_OR011_01 TB416602.[MT7]-ASEILGLK[MT7].2y7_1.heavy 559.855 / 903.563 5855.0 33.38370132446289 50 20 10 10 10 19.944582410055016 5.013892893018669 0.0 3 0.9989474316111258 38.03637383902527 5855.0 27.574602293747688 0.0 - - - - - - - 297.3333333333333 11 3 LZTS1 leucine zipper, putative tumor suppressor 1 1627 207 C20140709_OR011_01 C20140709_OR011_01 TB416601.[MT7]-LETLLQPR.2y4_1.heavy 557.341 / 513.314 1777.0 36.12244892120361 33 16 8 5 4 10.701837249125566 9.344189943476376 0.048999786376953125 10 0.9684275873984242 6.927223007979156 1777.0 2.210351223080629 11.0 - - - - - - - 769.125 9 8 BRD1 bromodomain containing 1 1629 207 C20140709_OR011_01 C20140709_OR011_01 TB416601.[MT7]-LETLLQPR.2b4_1.heavy 557.341 / 601.368 1914.0 36.12244892120361 33 16 8 5 4 10.701837249125566 9.344189943476376 0.048999786376953125 10 0.9684275873984242 6.927223007979156 1914.0 1.5358995853212645 3.0 - - - - - - - 273.25 10 4 BRD1 bromodomain containing 1 1631 207 C20140709_OR011_01 C20140709_OR011_01 TB416601.[MT7]-LETLLQPR.2y6_1.heavy 557.341 / 727.446 1230.0 36.12244892120361 33 16 8 5 4 10.701837249125566 9.344189943476376 0.048999786376953125 10 0.9684275873984242 6.927223007979156 1230.0 4.705494505494506 6.0 - - - - - - - 195.28571428571428 2 7 BRD1 bromodomain containing 1 1633 207 C20140709_OR011_01 C20140709_OR011_01 TB416601.[MT7]-LETLLQPR.2y7_1.heavy 557.341 / 856.489 4238.0 36.12244892120361 33 16 8 5 4 10.701837249125566 9.344189943476376 0.048999786376953125 10 0.9684275873984242 6.927223007979156 4238.0 11.733294745347951 0.0 - - - - - - - 273.25 8 4 BRD1 bromodomain containing 1 1635 208 C20140709_OR011_01 C20140709_OR011_01 TB447311.[MT7]-APPTAC[CAM]YAGAAPAPSQVK[MT7].3y7_1.heavy 682.362 / 870.516 16353.0 26.476200103759766 48 18 10 10 10 5.418324957617838 18.455888264768255 0.0 3 0.9894179097566328 11.986514512733823 16353.0 39.83000828048956 0.0 - - - - - - - 248.5 32 4 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 1637 208 C20140709_OR011_01 C20140709_OR011_01 TB447311.[MT7]-APPTAC[CAM]YAGAAPAPSQVK[MT7].3b6_1.heavy 682.362 / 742.367 9282.0 26.476200103759766 48 18 10 10 10 5.418324957617838 18.455888264768255 0.0 3 0.9894179097566328 11.986514512733823 9282.0 24.864191671769746 0.0 - - - - - - - 245.22222222222223 18 9 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 1639 208 C20140709_OR011_01 C20140709_OR011_01 TB447311.[MT7]-APPTAC[CAM]YAGAAPAPSQVK[MT7].3b5_1.heavy 682.362 / 582.337 3867.0 26.476200103759766 48 18 10 10 10 5.418324957617838 18.455888264768255 0.0 3 0.9894179097566328 11.986514512733823 3867.0 16.815272928599747 0.0 - - - - - - - 283.85714285714283 7 7 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 1641 208 C20140709_OR011_01 C20140709_OR011_01 TB447311.[MT7]-APPTAC[CAM]YAGAAPAPSQVK[MT7].3y5_1.heavy 682.362 / 702.427 14475.0 26.476200103759766 48 18 10 10 10 5.418324957617838 18.455888264768255 0.0 3 0.9894179097566328 11.986514512733823 14475.0 21.048385704167227 0.0 - - - - - - - 820.5714285714286 28 7 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 1643 209 C20140709_OR011_01 C20140709_OR011_01 TB447315.[MT7]-AITIASQTNC[CAM]PLYVTK[MT7].3y6_1.heavy 690.05 / 864.531 44093.0 34.187198638916016 48 18 10 10 10 4.855700634611596 20.594350336838453 0.0 3 0.9873763579050091 10.972664676679242 44093.0 462.6837177954847 0.0 - - - - - - - 236.8 88 10 DPYSL3 dihydropyrimidinase-like 3 1645 209 C20140709_OR011_01 C20140709_OR011_01 TB447315.[MT7]-AITIASQTNC[CAM]PLYVTK[MT7].3b4_1.heavy 690.05 / 543.362 24520.0 34.187198638916016 48 18 10 10 10 4.855700634611596 20.594350336838453 0.0 3 0.9873763579050091 10.972664676679242 24520.0 54.29701394615794 0.0 - - - - - - - 269.0 49 6 DPYSL3 dihydropyrimidinase-like 3 1647 209 C20140709_OR011_01 C20140709_OR011_01 TB447315.[MT7]-AITIASQTNC[CAM]PLYVTK[MT7].3b5_1.heavy 690.05 / 614.399 28069.0 34.187198638916016 48 18 10 10 10 4.855700634611596 20.594350336838453 0.0 3 0.9873763579050091 10.972664676679242 28069.0 282.1285060292851 0.0 - - - - - - - 310.8888888888889 56 9 DPYSL3 dihydropyrimidinase-like 3 1649 209 C20140709_OR011_01 C20140709_OR011_01 TB447315.[MT7]-AITIASQTNC[CAM]PLYVTK[MT7].3y4_1.heavy 690.05 / 654.394 30113.0 34.187198638916016 48 18 10 10 10 4.855700634611596 20.594350336838453 0.0 3 0.9873763579050091 10.972664676679242 30113.0 125.59622823549753 0.0 - - - - - - - 768.2857142857143 60 7 DPYSL3 dihydropyrimidinase-like 3 1651 210 C20140709_OR011_01 C20140709_OR011_01 TB589944.[MT7]-EFLRVEEQAILDAMAEETR.4y5_1.heavy 599.308 / 605.289 1687.0 48.256574630737305 24 11 2 3 8 0.8221435868042968 69.73521111111685 0.06490325927734375 4 0.8568111921177567 3.221691749451334 1687.0 0.0 2.0 - - - - - - - 144.75 3 12 TRIM35 tripartite motif-containing 35 1653 210 C20140709_OR011_01 C20140709_OR011_01 TB589944.[MT7]-EFLRVEEQAILDAMAEETR.4b8_2.heavy 599.308 / 588.313 1329.0 48.256574630737305 24 11 2 3 8 0.8221435868042968 69.73521111111685 0.06490325927734375 4 0.8568111921177567 3.221691749451334 1329.0 11.226470588235294 2.0 - - - - - - - 126.23529411764706 19 17 TRIM35 tripartite motif-containing 35 1655 210 C20140709_OR011_01 C20140709_OR011_01 TB589944.[MT7]-EFLRVEEQAILDAMAEETR.4b7_2.heavy 599.308 / 524.283 256.0 48.256574630737305 24 11 2 3 8 0.8221435868042968 69.73521111111685 0.06490325927734375 4 0.8568111921177567 3.221691749451334 256.0 0.6253062198103643 27.0 - - - - - - - 0.0 1 0 TRIM35 tripartite motif-containing 35 1657 210 C20140709_OR011_01 C20140709_OR011_01 TB589944.[MT7]-EFLRVEEQAILDAMAEETR.4b9_2.heavy 599.308 / 623.831 2915.0 48.256574630737305 24 11 2 3 8 0.8221435868042968 69.73521111111685 0.06490325927734375 4 0.8568111921177567 3.221691749451334 2915.0 13.534600160875417 0.0 - - - - - - - 146.0 5 7 TRIM35 tripartite motif-containing 35 1659 211 C20140709_OR011_01 C20140709_OR011_01 TB589797.[MT7]-AFNQSSGLIIHR.3y7_1.heavy 496.28 / 795.484 3928.0 29.165199279785156 31 15 2 6 8 14.320629786022755 6.982933117760098 0.033599853515625 4 0.9521609378910371 5.6198445119026035 3928.0 40.33933117583603 0.0 - - - - - - - 172.16666666666666 7 6 ZNF595 zinc finger protein 595 1661 211 C20140709_OR011_01 C20140709_OR011_01 TB589797.[MT7]-AFNQSSGLIIHR.3y6_1.heavy 496.28 / 708.451 3928.0 29.165199279785156 31 15 2 6 8 14.320629786022755 6.982933117760098 0.033599853515625 4 0.9521609378910371 5.6198445119026035 3928.0 46.8519150133671 0.0 - - - - - - - 162.28571428571428 7 7 ZNF595 zinc finger protein 595 1663 211 C20140709_OR011_01 C20140709_OR011_01 TB589797.[MT7]-AFNQSSGLIIHR.3b4_1.heavy 496.28 / 605.316 2171.0 29.165199279785156 31 15 2 6 8 14.320629786022755 6.982933117760098 0.033599853515625 4 0.9521609378910371 5.6198445119026035 2171.0 9.804516129032258 4.0 - - - - - - - 175.5 4 10 ZNF595 zinc finger protein 595 1665 211 C20140709_OR011_01 C20140709_OR011_01 TB589797.[MT7]-AFNQSSGLIIHR.3y4_1.heavy 496.28 / 538.346 6099.0 29.165199279785156 31 15 2 6 8 14.320629786022755 6.982933117760098 0.033599853515625 4 0.9521609378910371 5.6198445119026035 6099.0 27.224508459935027 1.0 - - - - - - - 167.875 26 8 ZNF595 zinc finger protein 595 1667 212 C20140709_OR011_01 C20140709_OR011_01 TB447113.[MT7]-IFNLYPRK[MT7].3y3_1.heavy 446.943 / 544.369 4496.0 33.172698974609375 38 13 9 10 6 1.619572576646302 48.44385372537339 0.0 5 0.9038239669308287 3.9471638995736718 4496.0 16.57027445742905 1.0 - - - - - - - 260.0 8 5 CRMP1;DPYS;DPYSL3 collapsin response mediator protein 1;dihydropyrimidinase;dihydropyrimidinase-like 3 1669 212 C20140709_OR011_01 C20140709_OR011_01 TB447113.[MT7]-IFNLYPRK[MT7].3y6_1.heavy 446.943 / 934.559 N/A 33.172698974609375 38 13 9 10 6 1.619572576646302 48.44385372537339 0.0 5 0.9038239669308287 3.9471638995736718 0.0 0.0 9.0 - - - - - - - 0.0 0 0 CRMP1;DPYS;DPYSL3 collapsin response mediator protein 1;dihydropyrimidinase;dihydropyrimidinase-like 3 1671 212 C20140709_OR011_01 C20140709_OR011_01 TB447113.[MT7]-IFNLYPRK[MT7].3y7_2.heavy 446.943 / 541.317 12888.0 33.172698974609375 38 13 9 10 6 1.619572576646302 48.44385372537339 0.0 5 0.9038239669308287 3.9471638995736718 12888.0 150.78959999999998 1.0 - - - - - - - 200.0 28 6 CRMP1;DPYS;DPYSL3 collapsin response mediator protein 1;dihydropyrimidinase;dihydropyrimidinase-like 3 1673 212 C20140709_OR011_01 C20140709_OR011_01 TB447113.[MT7]-IFNLYPRK[MT7].3b3_1.heavy 446.943 / 519.305 6794.0 33.172698974609375 38 13 9 10 6 1.619572576646302 48.44385372537339 0.0 5 0.9038239669308287 3.9471638995736718 6794.0 22.28169785112043 2.0 - - - - - - - 222.22222222222223 19 9 CRMP1;DPYS;DPYSL3 collapsin response mediator protein 1;dihydropyrimidinase;dihydropyrimidinase-like 3 1675 213 C20140709_OR011_01 C20140709_OR011_01 TB446953.[MT7]-IHTSDK[MT7].2y4_1.heavy 494.787 / 594.321 1393.0 15.231599807739258 48 20 10 10 8 7.1266792816708895 14.031780587796348 0.0 4 0.9942109232786682 16.212425027848873 1393.0 9.466990291262135 0.0 - - - - - - - 131.45454545454547 2 11 ZFP30;ZNF607 zinc finger protein 30 homolog (mouse);zinc finger protein 607 1677 213 C20140709_OR011_01 C20140709_OR011_01 TB446953.[MT7]-IHTSDK[MT7].2y5_1.heavy 494.787 / 731.38 1290.0 15.231599807739258 48 20 10 10 8 7.1266792816708895 14.031780587796348 0.0 4 0.9942109232786682 16.212425027848873 1290.0 49.41692307692307 0.0 - - - - - - - 129.25 2 4 ZFP30;ZNF607 zinc finger protein 30 homolog (mouse);zinc finger protein 607 1679 213 C20140709_OR011_01 C20140709_OR011_01 TB446953.[MT7]-IHTSDK[MT7].2y3_1.heavy 494.787 / 493.274 929.0 15.231599807739258 48 20 10 10 8 7.1266792816708895 14.031780587796348 0.0 4 0.9942109232786682 16.212425027848873 929.0 21.47303970223325 1.0 - - - - - - - 183.44444444444446 2 9 ZFP30;ZNF607 zinc finger protein 30 homolog (mouse);zinc finger protein 607 1681 213 C20140709_OR011_01 C20140709_OR011_01 TB446953.[MT7]-IHTSDK[MT7].2b5_1.heavy 494.787 / 698.359 310.0 15.231599807739258 48 20 10 10 8 7.1266792816708895 14.031780587796348 0.0 4 0.9942109232786682 16.212425027848873 310.0 8.298461538461538 5.0 - - - - - - - 0.0 0 0 ZFP30;ZNF607 zinc finger protein 30 homolog (mouse);zinc finger protein 607 1683 214 C20140709_OR011_01 C20140709_OR011_01 TB447116.[MT7]-LTSLPLYQK[MT7].3b6_1.heavy 450.946 / 769.494 1474.0 35.726600646972656 50 20 10 10 10 10.463758357995776 9.556795615753684 0.0 3 0.9930687603187344 14.815139391285797 1474.0 9.746775067750677 0.0 - - - - - - - 205.0 2 3 ZFP30 zinc finger protein 30 homolog (mouse) 1685 214 C20140709_OR011_01 C20140709_OR011_01 TB447116.[MT7]-LTSLPLYQK[MT7].3y3_1.heavy 450.946 / 582.337 12532.0 35.726600646972656 50 20 10 10 10 10.463758357995776 9.556795615753684 0.0 3 0.9930687603187344 14.815139391285797 12532.0 64.52791327913279 0.0 - - - - - - - 307.5 25 2 ZFP30 zinc finger protein 30 homolog (mouse) 1687 214 C20140709_OR011_01 C20140709_OR011_01 TB447116.[MT7]-LTSLPLYQK[MT7].3b4_1.heavy 450.946 / 559.357 9215.0 35.726600646972656 50 20 10 10 10 10.463758357995776 9.556795615753684 0.0 3 0.9930687603187344 14.815139391285797 9215.0 147.96443089430895 0.0 - - - - - - - 147.6 18 5 ZFP30 zinc finger protein 30 homolog (mouse) 1689 214 C20140709_OR011_01 C20140709_OR011_01 TB447116.[MT7]-LTSLPLYQK[MT7].3y4_1.heavy 450.946 / 695.421 1966.0 35.726600646972656 50 20 10 10 10 10.463758357995776 9.556795615753684 0.0 3 0.9930687603187344 14.815139391285797 1966.0 15.184552845528456 0.0 - - - - - - - 221.4 3 5 ZFP30 zinc finger protein 30 homolog (mouse) 1691 215 C20140709_OR011_01 C20140709_OR011_01 TB589614.[MT7]-GGTPAGSAR.2y6_1.heavy 459.25 / 558.299 3750.0 13.407600402832031 47 17 10 10 10 1.9904766629432569 37.695974205264655 0.0 3 0.9793440573531897 8.572143833670411 3750.0 61.846475251767735 0.0 - - - - - - - 108.66666666666667 7 9 DPYSL3 dihydropyrimidinase-like 3 1693 215 C20140709_OR011_01 C20140709_OR011_01 TB589614.[MT7]-GGTPAGSAR.2y8_1.heavy 459.25 / 716.369 359.0 13.407600402832031 47 17 10 10 10 1.9904766629432569 37.695974205264655 0.0 3 0.9793440573531897 8.572143833670411 359.0 9.917272727272728 1.0 - - - - - - - 0.0 0 0 DPYSL3 dihydropyrimidinase-like 3 1695 215 C20140709_OR011_01 C20140709_OR011_01 TB589614.[MT7]-GGTPAGSAR.2b7_1.heavy 459.25 / 672.343 456.0 13.407600402832031 47 17 10 10 10 1.9904766629432569 37.695974205264655 0.0 3 0.9793440573531897 8.572143833670411 456.0 11.2176 0.0 - - - - - - - 0.0 0 0 DPYSL3 dihydropyrimidinase-like 3 1697 215 C20140709_OR011_01 C20140709_OR011_01 TB589614.[MT7]-GGTPAGSAR.2b6_1.heavy 459.25 / 585.311 326.0 13.407600402832031 47 17 10 10 10 1.9904766629432569 37.695974205264655 0.0 3 0.9793440573531897 8.572143833670411 326.0 8.936503496503496 0.0 - - - - - - - 0.0 0 0 DPYSL3 dihydropyrimidinase-like 3 1699 216 C20140709_OR011_01 C20140709_OR011_01 TB416606.[MT7]-LLWQTAVR.2b3_1.heavy 565.844 / 557.357 7899.0 37.667701721191406 50 20 10 10 10 10.314071099285933 9.695492598157795 0.0 3 0.9977847887246766 26.216492639582103 7899.0 9.806545344238918 0.0 - - - - - - - 268.0 15 8 ADCY8 adenylate cyclase 8 (brain) 1701 216 C20140709_OR011_01 C20140709_OR011_01 TB416606.[MT7]-LLWQTAVR.2y5_1.heavy 565.844 / 574.331 11648.0 37.667701721191406 50 20 10 10 10 10.314071099285933 9.695492598157795 0.0 3 0.9977847887246766 26.216492639582103 11648.0 54.47323383084577 0.0 - - - - - - - 282.8888888888889 23 9 ADCY8 adenylate cyclase 8 (brain) 1703 216 C20140709_OR011_01 C20140709_OR011_01 TB416606.[MT7]-LLWQTAVR.2y6_1.heavy 565.844 / 760.41 19681.0 37.667701721191406 50 20 10 10 10 10.314071099285933 9.695492598157795 0.0 3 0.9977847887246766 26.216492639582103 19681.0 75.88445273631841 0.0 - - - - - - - 312.6666666666667 39 9 ADCY8 adenylate cyclase 8 (brain) 1705 216 C20140709_OR011_01 C20140709_OR011_01 TB416606.[MT7]-LLWQTAVR.2y7_1.heavy 565.844 / 873.494 26777.0 37.667701721191406 50 20 10 10 10 10.314071099285933 9.695492598157795 0.0 3 0.9977847887246766 26.216492639582103 26777.0 238.4531785801932 0.0 - - - - - - - 156.33333333333334 53 6 ADCY8 adenylate cyclase 8 (brain) 1707 217 C20140709_OR011_01 C20140709_OR011_01 TB589896.[MT7]-GMYDGPVFDLTTTPK[MT7].2b4_1.heavy 965.497 / 611.262 9884.0 39.59287643432617 41 16 10 5 10 4.22490486074021 23.669172039646792 0.0438995361328125 3 0.9621096787679307 6.320003272782119 9884.0 55.04852694685471 0.0 - - - - - - - 190.0 19 6 DPYSL3 dihydropyrimidinase-like 3 1709 217 C20140709_OR011_01 C20140709_OR011_01 TB589896.[MT7]-GMYDGPVFDLTTTPK[MT7].2b7_1.heavy 965.497 / 864.404 1647.0 39.59287643432617 41 16 10 5 10 4.22490486074021 23.669172039646792 0.0438995361328125 3 0.9621096787679307 6.320003272782119 1647.0 6.761368421052632 0.0 - - - - - - - 253.33333333333334 3 6 DPYSL3 dihydropyrimidinase-like 3 1711 217 C20140709_OR011_01 C20140709_OR011_01 TB589896.[MT7]-GMYDGPVFDLTTTPK[MT7].2b5_1.heavy 965.497 / 668.283 2661.0 39.59287643432617 41 16 10 5 10 4.22490486074021 23.669172039646792 0.0438995361328125 3 0.9621096787679307 6.320003272782119 2661.0 25.297695814338997 0.0 - - - - - - - 232.33333333333334 5 6 DPYSL3 dihydropyrimidinase-like 3 1713 217 C20140709_OR011_01 C20140709_OR011_01 TB589896.[MT7]-GMYDGPVFDLTTTPK[MT7].2b9_1.heavy 965.497 / 1126.5 1774.0 39.59287643432617 41 16 10 5 10 4.22490486074021 23.669172039646792 0.0438995361328125 3 0.9621096787679307 6.320003272782119 1774.0 8.408697211372797 1.0 - - - - - - - 269.125 3 8 DPYSL3 dihydropyrimidinase-like 3 1715 218 C20140709_OR011_01 C20140709_OR011_01 TB589619.[MT7]-HITEQR.2y4_1.heavy 464.26 / 533.268 1160.0 14.248075246810913 39 16 10 5 8 2.853710537339943 35.042096488599704 0.041899681091308594 4 0.9666476726087794 6.738834442252015 1160.0 31.715858617453858 0.0 - - - - - - - 197.25 2 4 ADCY8 adenylate cyclase 8 (brain) 1717 218 C20140709_OR011_01 C20140709_OR011_01 TB589619.[MT7]-HITEQR.2y5_1.heavy 464.26 / 646.352 1671.0 14.248075246810913 39 16 10 5 8 2.853710537339943 35.042096488599704 0.041899681091308594 4 0.9666476726087794 6.738834442252015 1671.0 31.263870967741937 0.0 - - - - - - - 77.33333333333333 3 3 ADCY8 adenylate cyclase 8 (brain) 1719 218 C20140709_OR011_01 C20140709_OR011_01 TB589619.[MT7]-HITEQR.2b4_1.heavy 464.26 / 625.343 325.0 14.248075246810913 39 16 10 5 8 2.853710537339943 35.042096488599704 0.041899681091308594 4 0.9666476726087794 6.738834442252015 325.0 13.565217391304348 0.0 - - - - - - - 0.0 0 0 ADCY8 adenylate cyclase 8 (brain) 1721 218 C20140709_OR011_01 C20140709_OR011_01 TB589619.[MT7]-HITEQR.2y3_1.heavy 464.26 / 432.22 464.0 14.248075246810913 39 16 10 5 8 2.853710537339943 35.042096488599704 0.041899681091308594 4 0.9666476726087794 6.738834442252015 464.0 2.8 5.0 - - - - - - - 0.0 1 0 ADCY8 adenylate cyclase 8 (brain) 1723 219 C20140709_OR011_01 C20140709_OR011_01 TB447110.[MT7]-GSPVRC[CAM]GQAVR.3b9_2.heavy 444.243 / 529.27 1129.0 16.854050636291504 36 11 10 5 10 0.784609595232707 74.46132683608349 0.04269981384277344 3 0.872534014246764 3.4193244460959793 1129.0 17.21437033653114 0.0 - - - - - - - 132.71428571428572 2 7 SDF2L1 stromal cell-derived factor 2-like 1 1725 219 C20140709_OR011_01 C20140709_OR011_01 TB447110.[MT7]-GSPVRC[CAM]GQAVR.3y6_1.heavy 444.243 / 690.335 863.0 16.854050636291504 36 11 10 5 10 0.784609595232707 74.46132683608349 0.04269981384277344 3 0.872534014246764 3.4193244460959793 863.0 11.199927090453407 0.0 - - - - - - - 0.0 1 0 SDF2L1 stromal cell-derived factor 2-like 1 1727 219 C20140709_OR011_01 C20140709_OR011_01 TB447110.[MT7]-GSPVRC[CAM]GQAVR.3y5_1.heavy 444.243 / 530.305 730.0 16.854050636291504 36 11 10 5 10 0.784609595232707 74.46132683608349 0.04269981384277344 3 0.872534014246764 3.4193244460959793 730.0 12.376762600883204 4.0 - - - - - - - 0.0 1 0 SDF2L1 stromal cell-derived factor 2-like 1 1729 219 C20140709_OR011_01 C20140709_OR011_01 TB447110.[MT7]-GSPVRC[CAM]GQAVR.3b8_2.heavy 444.243 / 493.751 598.0 16.854050636291504 36 11 10 5 10 0.784609595232707 74.46132683608349 0.04269981384277344 3 0.872534014246764 3.4193244460959793 598.0 9.046981089086353 0.0 - - - - - - - 0.0 1 0 SDF2L1 stromal cell-derived factor 2-like 1 1731 220 C20140709_OR011_01 C20140709_OR011_01 TB417041.[MT7]-AQQVLHLQVLQLQQEK[MT7].3b4_1.heavy 731.098 / 571.332 7517.0 36.74599838256836 43 13 10 10 10 0.9979415911625411 66.80417697493104 0.0 3 0.9059773415048569 3.9928508612215157 7517.0 21.08426829268293 0.0 - - - - - - - 273.2 15 10 LZTS1 leucine zipper, putative tumor suppressor 1 1733 220 C20140709_OR011_01 C20140709_OR011_01 TB417041.[MT7]-AQQVLHLQVLQLQQEK[MT7].3b5_1.heavy 731.098 / 684.416 12300.0 36.74599838256836 43 13 10 10 10 0.9979415911625411 66.80417697493104 0.0 3 0.9059773415048569 3.9928508612215157 12300.0 71.6043956043956 0.0 - - - - - - - 239.25 24 4 LZTS1 leucine zipper, putative tumor suppressor 1 1735 220 C20140709_OR011_01 C20140709_OR011_01 TB417041.[MT7]-AQQVLHLQVLQLQQEK[MT7].3y5_1.heavy 731.098 / 789.459 5877.0 36.74599838256836 43 13 10 10 10 0.9979415911625411 66.80417697493104 0.0 3 0.9059773415048569 3.9928508612215157 5877.0 49.27030190977974 0.0 - - - - - - - 253.85714285714286 11 7 LZTS1 leucine zipper, putative tumor suppressor 1 1737 220 C20140709_OR011_01 C20140709_OR011_01 TB417041.[MT7]-AQQVLHLQVLQLQQEK[MT7].3b8_2.heavy 731.098 / 531.813 13120.0 36.74599838256836 43 13 10 10 10 0.9979415911625411 66.80417697493104 0.0 3 0.9059773415048569 3.9928508612215157 13120.0 119.83080666292345 0.0 - - - - - - - 205.0 26 4 LZTS1 leucine zipper, putative tumor suppressor 1 1739 221 C20140709_OR011_01 C20140709_OR011_01 TB417042.[MT7]-AQQVLHLQVLQLQQEK[MT7].4b8_2.heavy 548.576 / 531.813 25156.0 36.74599838256836 37 9 10 10 8 0.7357749936013237 85.48769180338223 0.0 4 0.8168940157911566 2.8388985261674016 25156.0 111.92011893042972 0.0 - - - - - - - 296.0 50 6 LZTS1 leucine zipper, putative tumor suppressor 1 1741 221 C20140709_OR011_01 C20140709_OR011_01 TB417042.[MT7]-AQQVLHLQVLQLQQEK[MT7].4b4_1.heavy 548.576 / 571.332 6426.0 36.74599838256836 37 9 10 10 8 0.7357749936013237 85.48769180338223 0.0 4 0.8168940157911566 2.8388985261674016 6426.0 19.194619877825836 0.0 - - - - - - - 318.8333333333333 12 6 LZTS1 leucine zipper, putative tumor suppressor 1 1743 221 C20140709_OR011_01 C20140709_OR011_01 TB417042.[MT7]-AQQVLHLQVLQLQQEK[MT7].4b5_1.heavy 548.576 / 684.416 7519.0 36.74599838256836 37 9 10 10 8 0.7357749936013237 85.48769180338223 0.0 4 0.8168940157911566 2.8388985261674016 7519.0 35.48601219512195 1.0 - - - - - - - 205.2 38 10 LZTS1 leucine zipper, putative tumor suppressor 1 1745 221 C20140709_OR011_01 C20140709_OR011_01 TB417042.[MT7]-AQQVLHLQVLQLQQEK[MT7].4b9_2.heavy 548.576 / 581.347 33632.0 36.74599838256836 37 9 10 10 8 0.7357749936013237 85.48769180338223 0.0 4 0.8168940157911566 2.8388985261674016 33632.0 129.16235608864315 0.0 - - - - - - - 286.9 67 10 LZTS1 leucine zipper, putative tumor suppressor 1 1747 222 C20140709_OR011_01 C20140709_OR011_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 148832.0 43.99129867553711 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 148832.0 370.15601846678453 0.0 - - - - - - - 210.57142857142858 297 7 1749 222 C20140709_OR011_01 C20140709_OR011_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 179084.0 43.99129867553711 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 179084.0 334.34460938231996 0.0 - - - - - - - 321.85714285714283 358 7 1751 222 C20140709_OR011_01 C20140709_OR011_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 135223.0 43.99129867553711 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 135223.0 258.72057376185455 0.0 - - - - - - - 238.25 270 4 1753 223 C20140709_OR011_01 C20140709_OR011_01 TB589623.[MT7]-ALQQLAR.2b3_1.heavy 472.294 / 457.289 3826.0 25.670900344848633 34 16 0 10 8 1.7417689427732492 39.96566658646001 0.0 4 0.9604995125370441 6.18900886959876 3826.0 8.174316622524728 1.0 - - - - - - - 244.0 7 6 LZTS1 leucine zipper, putative tumor suppressor 1 1755 223 C20140709_OR011_01 C20140709_OR011_01 TB589623.[MT7]-ALQQLAR.2y5_1.heavy 472.294 / 615.357 2925.0 25.670900344848633 34 16 0 10 8 1.7417689427732492 39.96566658646001 0.0 4 0.9604995125370441 6.18900886959876 2925.0 3.7074391046741275 1.0 - - - - - - - 253.375 6 8 LZTS1 leucine zipper, putative tumor suppressor 1 1757 223 C20140709_OR011_01 C20140709_OR011_01 TB589623.[MT7]-ALQQLAR.2b4_1.heavy 472.294 / 585.348 3713.0 25.670900344848633 34 16 0 10 8 1.7417689427732492 39.96566658646001 0.0 4 0.9604995125370441 6.18900886959876 3713.0 19.598953621472273 0.0 - - - - - - - 187.66666666666666 7 3 LZTS1 leucine zipper, putative tumor suppressor 1 1759 223 C20140709_OR011_01 C20140709_OR011_01 TB589623.[MT7]-ALQQLAR.2y6_1.heavy 472.294 / 728.441 3263.0 25.670900344848633 34 16 0 10 8 1.7417689427732492 39.96566658646001 0.0 4 0.9604995125370441 6.18900886959876 3263.0 35.736317222600405 2.0 - - - - - - - 211.375 72 8 LZTS1 leucine zipper, putative tumor suppressor 1 1761 224 C20140709_OR011_01 C20140709_OR011_01 TB589936.[MT7]-HFREWGSHAPTFQVQSIR.3y8_1.heavy 776.402 / 978.537 699.0 30.462400436401367 43 13 10 10 10 0.9225590784549458 68.28857995425602 0.0 3 0.9229130495224274 4.416129290390786 699.0 1.1649999999999998 1.0 - - - - - - - 0.0 1 0 CRYBA4 crystallin, beta A4 1763 224 C20140709_OR011_01 C20140709_OR011_01 TB589936.[MT7]-HFREWGSHAPTFQVQSIR.3b7_1.heavy 776.402 / 1044.51 799.0 30.462400436401367 43 13 10 10 10 0.9225590784549458 68.28857995425602 0.0 3 0.9229130495224274 4.416129290390786 799.0 3.08414 0.0 - - - - - - - 0.0 1 0 CRYBA4 crystallin, beta A4 1765 224 C20140709_OR011_01 C20140709_OR011_01 TB589936.[MT7]-HFREWGSHAPTFQVQSIR.3b8_2.heavy 776.402 / 591.29 3597.0 30.462400436401367 43 13 10 10 10 0.9225590784549458 68.28857995425602 0.0 3 0.9229130495224274 4.416129290390786 3597.0 24.27975 0.0 - - - - - - - 169.23076923076923 7 13 CRYBA4 crystallin, beta A4 1767 224 C20140709_OR011_01 C20140709_OR011_01 TB589936.[MT7]-HFREWGSHAPTFQVQSIR.3y9_1.heavy 776.402 / 1075.59 6195.0 30.462400436401367 43 13 10 10 10 0.9225590784549458 68.28857995425602 0.0 3 0.9229130495224274 4.416129290390786 6195.0 24.78 0.0 - - - - - - - 155.55555555555554 12 9 CRYBA4 crystallin, beta A4 1769 225 C20140709_OR011_01 C20140709_OR011_01 TB589938.[MT7]-MVIPGGIDVHTHFQMPYK[MT7].4y4_1.heavy 590.314 / 682.371 11895.0 37.74582481384277 45 20 10 5 10 8.128591955550938 12.302253643290701 0.04470062255859375 3 0.997773643706363 26.150766837587344 11895.0 45.93852053915276 0.0 - - - - - - - 296.1666666666667 23 6 DPYSL3 dihydropyrimidinase-like 3 1771 225 C20140709_OR011_01 C20140709_OR011_01 TB589938.[MT7]-MVIPGGIDVHTHFQMPYK[MT7].4y6_1.heavy 590.314 / 957.498 3965.0 37.74582481384277 45 20 10 5 10 8.128591955550938 12.302253643290701 0.04470062255859375 3 0.997773643706363 26.150766837587344 3965.0 26.86904761904762 0.0 - - - - - - - 188.0 7 8 DPYSL3 dihydropyrimidinase-like 3 1773 225 C20140709_OR011_01 C20140709_OR011_01 TB589938.[MT7]-MVIPGGIDVHTHFQMPYK[MT7].4y3_1.heavy 590.314 / 551.331 55373.0 37.74582481384277 45 20 10 5 10 8.128591955550938 12.302253643290701 0.04470062255859375 3 0.997773643706363 26.150766837587344 55373.0 155.84262038743742 0.0 - - - - - - - 273.3333333333333 110 6 DPYSL3 dihydropyrimidinase-like 3 1775 225 C20140709_OR011_01 C20140709_OR011_01 TB589938.[MT7]-MVIPGGIDVHTHFQMPYK[MT7].4b6_1.heavy 590.314 / 699.398 8750.0 37.74582481384277 45 20 10 5 10 8.128591955550938 12.302253643290701 0.04470062255859375 3 0.997773643706363 26.150766837587344 8750.0 60.478265636922295 1.0 - - - - - - - 290.375 17 8 DPYSL3 dihydropyrimidinase-like 3 1777 226 C20140709_OR011_01 C20140709_OR011_01 TB447108.[MT7]-YQGLVDGRK[MT7].3y7_1.heavy 441.926 / 888.538 312.0 24.1825008392334 39 9 10 10 10 1.4837133723104599 67.39846244310554 0.0 3 0.8133477491528014 2.810908800404116 312.0 -0.5999999999999996 0.0 - - - - - - - 0.0 0 0 HIC2 hypermethylated in cancer 2 1779 226 C20140709_OR011_01 C20140709_OR011_01 TB447108.[MT7]-YQGLVDGRK[MT7].3y3_1.heavy 441.926 / 504.337 4985.0 24.1825008392334 39 9 10 10 10 1.4837133723104599 67.39846244310554 0.0 3 0.8133477491528014 2.810908800404116 4985.0 84.84086538461538 0.0 - - - - - - - 187.2 9 5 HIC2 hypermethylated in cancer 2 1781 226 C20140709_OR011_01 C20140709_OR011_01 TB447108.[MT7]-YQGLVDGRK[MT7].3b6_1.heavy 441.926 / 820.432 623.0 24.1825008392334 39 9 10 10 10 1.4837133723104599 67.39846244310554 0.0 3 0.8133477491528014 2.810908800404116 623.0 3.3915560897435895 0.0 - - - - - - - 0.0 1 0 HIC2 hypermethylated in cancer 2 1783 226 C20140709_OR011_01 C20140709_OR011_01 TB447108.[MT7]-YQGLVDGRK[MT7].3b3_1.heavy 441.926 / 493.253 5920.0 24.1825008392334 39 9 10 10 10 1.4837133723104599 67.39846244310554 0.0 3 0.8133477491528014 2.810908800404116 5920.0 32.670188446092055 0.0 - - - - - - - 252.28571428571428 11 7 HIC2 hypermethylated in cancer 2 1785 227 C20140709_OR011_01 C20140709_OR011_01 TB589933.[MT7]-TSFGPALEETQWEVC[CAM]QK[MT7].3y6_1.heavy 766.715 / 993.494 3554.0 37.887699127197266 43 13 10 10 10 1.4150341460693951 56.200840276134635 0.0 3 0.929654732722267 4.625573249469749 3554.0 5.07399503300134 1.0 - - - - - - - 218.8 11 5 LZTS1 leucine zipper, putative tumor suppressor 1 1787 227 C20140709_OR011_01 C20140709_OR011_01 TB589933.[MT7]-TSFGPALEETQWEVC[CAM]QK[MT7].3y3_1.heavy 766.715 / 579.304 7382.0 37.887699127197266 43 13 10 10 10 1.4150341460693951 56.200840276134635 0.0 3 0.929654732722267 4.625573249469749 7382.0 15.84851051673035 0.0 - - - - - - - 234.28571428571428 14 7 LZTS1 leucine zipper, putative tumor suppressor 1 1789 227 C20140709_OR011_01 C20140709_OR011_01 TB589933.[MT7]-TSFGPALEETQWEVC[CAM]QK[MT7].3b6_1.heavy 766.715 / 705.369 7655.0 37.887699127197266 43 13 10 10 10 1.4150341460693951 56.200840276134635 0.0 3 0.929654732722267 4.625573249469749 7655.0 29.99969400518181 0.0 - - - - - - - 188.0 15 8 LZTS1 leucine zipper, putative tumor suppressor 1 1791 227 C20140709_OR011_01 C20140709_OR011_01 TB589933.[MT7]-TSFGPALEETQWEVC[CAM]QK[MT7].3b4_1.heavy 766.715 / 537.279 4101.0 37.887699127197266 43 13 10 10 10 1.4150341460693951 56.200840276134635 0.0 3 0.929654732722267 4.625573249469749 4101.0 17.42285521213779 0.0 - - - - - - - 239.125 8 8 LZTS1 leucine zipper, putative tumor suppressor 1 1793 228 C20140709_OR011_01 C20140709_OR011_01 TB589934.[MT7]-VNLLEQELQELRAQAALAR.3y18_2.heavy 770.44 / 1033.57 6374.0 46.5181999206543 33 7 10 6 10 1.2363639430715234 80.88233287648944 0.035797119140625 3 0.7333781999836831 2.3348313015156386 6374.0 79.39158212887976 0.0 - - - - - - - 187.78571428571428 12 14 LZTS1 leucine zipper, putative tumor suppressor 1 1795 228 C20140709_OR011_01 C20140709_OR011_01 TB589934.[MT7]-VNLLEQELQELRAQAALAR.3y7_1.heavy 770.44 / 700.41 789.0 46.5181999206543 33 7 10 6 10 1.2363639430715234 80.88233287648944 0.035797119140625 3 0.7333781999836831 2.3348313015156386 789.0 13.204504006631668 0.0 - - - - - - - 0.0 1 0 LZTS1 leucine zipper, putative tumor suppressor 1 1797 228 C20140709_OR011_01 C20140709_OR011_01 TB589934.[MT7]-VNLLEQELQELRAQAALAR.3y15_2.heavy 770.44 / 863.466 1643.0 46.5181999206543 33 7 10 6 10 1.2363639430715234 80.88233287648944 0.035797119140625 3 0.7333781999836831 2.3348313015156386 1643.0 37.34090909090909 0.0 - - - - - - - 173.45454545454547 3 11 LZTS1 leucine zipper, putative tumor suppressor 1 1799 228 C20140709_OR011_01 C20140709_OR011_01 TB589934.[MT7]-VNLLEQELQELRAQAALAR.3b5_1.heavy 770.44 / 713.431 657.0 46.5181999206543 33 7 10 6 10 1.2363639430715234 80.88233287648944 0.035797119140625 3 0.7333781999836831 2.3348313015156386 657.0 0.4446700507614213 8.0 - - - - - - - 126.78571428571429 3 14 LZTS1 leucine zipper, putative tumor suppressor 1 1801 229 C20140709_OR011_01 C20140709_OR011_01 TB416760.[MT7]-SPPVQESQSER.2y9_1.heavy 694.35 / 1059.51 3015.0 17.406099319458008 33 7 10 6 10 0.5564157901236663 94.5997554129576 0.03639984130859375 3 0.7263689499752839 2.303237197172697 3015.0 37.788000000000004 0.0 - - - - - - - 193.71428571428572 6 7 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 1803 229 C20140709_OR011_01 C20140709_OR011_01 TB416760.[MT7]-SPPVQESQSER.2y10_1.heavy 694.35 / 1156.56 2337.0 17.406099319458008 33 7 10 6 10 0.5564157901236663 94.5997554129576 0.03639984130859375 3 0.7263689499752839 2.303237197172697 2337.0 0.0 0.0 - - - - - - - 264.0 4 4 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 1805 229 C20140709_OR011_01 C20140709_OR011_01 TB416760.[MT7]-SPPVQESQSER.2y10_2.heavy 694.35 / 578.783 8141.0 17.406099319458008 33 7 10 6 10 0.5564157901236663 94.5997554129576 0.03639984130859375 3 0.7263689499752839 2.303237197172697 8141.0 25.878675496688743 0.0 - - - - - - - 276.6666666666667 16 3 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 1807 229 C20140709_OR011_01 C20140709_OR011_01 TB416760.[MT7]-SPPVQESQSER.2y7_1.heavy 694.35 / 863.385 829.0 17.406099319458008 33 7 10 6 10 0.5564157901236663 94.5997554129576 0.03639984130859375 3 0.7263689499752839 2.303237197172697 829.0 12.151346578366445 0.0 - - - - - - - 0.0 1 0 LOC100506888;TCEB3C;TCEB3CL RNA polymerase II transcription factor SIII subunit A3-like-2-like;transcription elongation factor B polypeptide 3C (elongin A3);transcription elongation factor B polypeptide 3C-like 1809 230 C20140709_OR011_01 C20140709_OR011_01 TB416487.[MT7]-SAGPWK[MT7].2y4_1.heavy 467.273 / 631.368 6501.0 23.055350303649902 36 15 8 5 8 2.0898821758407458 47.84958748201709 0.04269981384277344 4 0.9517027914028005 5.592908749243209 6501.0 20.70420458703885 0.0 - - - - - - - 176.2 13 5 CRYBA4 crystallin, beta A4 1811 230 C20140709_OR011_01 C20140709_OR011_01 TB416487.[MT7]-SAGPWK[MT7].2y5_1.heavy 467.273 / 702.406 2424.0 23.055350303649902 36 15 8 5 8 2.0898821758407458 47.84958748201709 0.04269981384277344 4 0.9517027914028005 5.592908749243209 2424.0 0.6798548094373866 3.0 - - - - - - - 146.66666666666666 17 3 CRYBA4 crystallin, beta A4 1813 230 C20140709_OR011_01 C20140709_OR011_01 TB416487.[MT7]-SAGPWK[MT7].2y3_1.heavy 467.273 / 574.347 6721.0 23.055350303649902 36 15 8 5 8 2.0898821758407458 47.84958748201709 0.04269981384277344 4 0.9517027914028005 5.592908749243209 6721.0 33.59834664246824 0.0 - - - - - - - 242.4 13 5 CRYBA4 crystallin, beta A4 1815 230 C20140709_OR011_01 C20140709_OR011_01 TB416487.[MT7]-SAGPWK[MT7].2b5_1.heavy 467.273 / 643.332 661.0 23.055350303649902 36 15 8 5 8 2.0898821758407458 47.84958748201709 0.04269981384277344 4 0.9517027914028005 5.592908749243209 661.0 1.2987154982839055 4.0 - - - - - - - 267.7142857142857 3 7 CRYBA4 crystallin, beta A4 1817 231 C20140709_OR011_01 C20140709_OR011_01 TB416488.[MT7]-EGALQK[MT7].2y5_1.heavy 467.284 / 660.416 2198.0 18.920725345611572 31 10 10 3 8 3.9570252469276173 25.271509217092753 0.07950019836425781 4 0.8253396912703612 2.9089170877371635 2198.0 31.14053913849004 0.0 - - - - - - - 220.1 4 10 LZTS1 leucine zipper, putative tumor suppressor 1 1819 231 C20140709_OR011_01 C20140709_OR011_01 TB416488.[MT7]-EGALQK[MT7].2b4_1.heavy 467.284 / 515.295 1015.0 18.920725345611572 31 10 10 3 8 3.9570252469276173 25.271509217092753 0.07950019836425781 4 0.8253396912703612 2.9089170877371635 1015.0 5.028804378176131 2.0 - - - - - - - 281.8333333333333 2 6 LZTS1 leucine zipper, putative tumor suppressor 1 1821 231 C20140709_OR011_01 C20140709_OR011_01 TB416488.[MT7]-EGALQK[MT7].2y3_1.heavy 467.284 / 532.357 1268.0 18.920725345611572 31 10 10 3 8 3.9570252469276173 25.271509217092753 0.07950019836425781 4 0.8253396912703612 2.9089170877371635 1268.0 13.443536373129133 0.0 - - - - - - - 154.0 2 11 LZTS1 leucine zipper, putative tumor suppressor 1 1823 231 C20140709_OR011_01 C20140709_OR011_01 TB416488.[MT7]-EGALQK[MT7].2b5_1.heavy 467.284 / 643.353 338.0 18.920725345611572 31 10 10 3 8 3.9570252469276173 25.271509217092753 0.07950019836425781 4 0.8253396912703612 2.9089170877371635 338.0 0.995 19.0 - - - - - - - 253.72727272727272 2 11 LZTS1 leucine zipper, putative tumor suppressor 1 1825 232 C20140709_OR011_01 C20140709_OR011_01 TB589632.[MT7]-LNIAEK[MT7].2y4_1.heavy 488.307 / 604.379 2585.0 26.31049919128418 46 20 8 10 8 9.248243175673926 10.812864465224546 0.0 4 0.996589197693912 21.125674183185367 2585.0 6.294440575725648 0.0 - - - - - - - 281.25 5 4 ZFP30 zinc finger protein 30 homolog (mouse) 1827 232 C20140709_OR011_01 C20140709_OR011_01 TB589632.[MT7]-LNIAEK[MT7].2y5_1.heavy 488.307 / 718.422 4946.0 26.31049919128418 46 20 8 10 8 9.248243175673926 10.812864465224546 0.0 4 0.996589197693912 21.125674183185367 4946.0 52.0625380952381 1.0 - - - - - - - 224.66666666666666 24 6 ZFP30 zinc finger protein 30 homolog (mouse) 1829 232 C20140709_OR011_01 C20140709_OR011_01 TB589632.[MT7]-LNIAEK[MT7].2b4_1.heavy 488.307 / 556.357 1124.0 26.31049919128418 46 20 8 10 8 9.248243175673926 10.812864465224546 0.0 4 0.996589197693912 21.125674183185367 1124.0 12.230190476190478 1.0 - - - - - - - 252.875 2 8 ZFP30 zinc finger protein 30 homolog (mouse) 1831 232 C20140709_OR011_01 C20140709_OR011_01 TB589632.[MT7]-LNIAEK[MT7].2y3_1.heavy 488.307 / 491.295 8656.0 26.31049919128418 46 20 8 10 8 9.248243175673926 10.812864465224546 0.0 4 0.996589197693912 21.125674183185367 8656.0 36.46421470558293 0.0 - - - - - - - 202.4 17 5 ZFP30 zinc finger protein 30 homolog (mouse) 1833 233 C20140709_OR011_01 C20140709_OR011_01 TB589634.[MT7]-YLSAPER.2b3_1.heavy 490.27 / 508.289 1003.0 24.897799491882324 40 17 10 5 8 1.45442011717878 43.436620795810015 0.04360008239746094 4 0.9726540974033914 7.445974727676109 1003.0 1.221780904934793 3.0 - - - - - - - 241.33333333333334 2 6 NKX2-6;NKX2-5;NKX2-3;NKX2-8;NKX2-2;NKX3-1;NKX2-4;NKX2-1 NK2 transcription factor related, locus 6 (Drosophila);NK2 transcription factor related, locus 5 (Drosophila);NK2 transcription factor related, locus 3 (Drosophila);NK2 homeobox 8;NK2 homeobox 2;NK3 homeobox 1;NK2 homeobox 4;NK2 homeobox 1 1835 233 C20140709_OR011_01 C20140709_OR011_01 TB589634.[MT7]-YLSAPER.2y5_1.heavy 490.27 / 559.284 4902.0 24.897799491882324 40 17 10 5 8 1.45442011717878 43.436620795810015 0.04360008239746094 4 0.9726540974033914 7.445974727676109 4902.0 20.333408071748877 0.0 - - - - - - - 273.54545454545456 9 11 NKX2-6;NKX2-5;NKX2-3;NKX2-8;NKX2-2;NKX3-1;NKX2-4;NKX2-1 NK2 transcription factor related, locus 6 (Drosophila);NK2 transcription factor related, locus 5 (Drosophila);NK2 transcription factor related, locus 3 (Drosophila);NK2 homeobox 8;NK2 homeobox 2;NK3 homeobox 1;NK2 homeobox 4;NK2 homeobox 1 1837 233 C20140709_OR011_01 C20140709_OR011_01 TB589634.[MT7]-YLSAPER.2b4_1.heavy 490.27 / 579.326 2785.0 24.897799491882324 40 17 10 5 8 1.45442011717878 43.436620795810015 0.04360008239746094 4 0.9726540974033914 7.445974727676109 2785.0 19.482511210762333 0.0 - - - - - - - 190.85714285714286 5 7 NKX2-6;NKX2-5;NKX2-3;NKX2-8;NKX2-2;NKX3-1;NKX2-4;NKX2-1 NK2 transcription factor related, locus 6 (Drosophila);NK2 transcription factor related, locus 5 (Drosophila);NK2 transcription factor related, locus 3 (Drosophila);NK2 homeobox 8;NK2 homeobox 2;NK3 homeobox 1;NK2 homeobox 4;NK2 homeobox 1 1839 233 C20140709_OR011_01 C20140709_OR011_01 TB589634.[MT7]-YLSAPER.2b6_1.heavy 490.27 / 805.421 223.0 24.897799491882324 40 17 10 5 8 1.45442011717878 43.436620795810015 0.04360008239746094 4 0.9726540974033914 7.445974727676109 223.0 2.6062072072072073 13.0 - - - - - - - 0.0 1 0 NKX2-6;NKX2-5;NKX2-3;NKX2-8;NKX2-2;NKX3-1;NKX2-4;NKX2-1 NK2 transcription factor related, locus 6 (Drosophila);NK2 transcription factor related, locus 5 (Drosophila);NK2 transcription factor related, locus 3 (Drosophila);NK2 homeobox 8;NK2 homeobox 2;NK3 homeobox 1;NK2 homeobox 4;NK2 homeobox 1 1841 234 C20140709_OR011_01 C20140709_OR011_01 TB417077.[MT7]-RC[CAM]ELSAEC[CAM]PSLTDSLLEK[MT7].4b8_2.heavy 599.806 / 575.759 22100.0 35.15959930419922 41 11 10 10 10 0.6576890280982068 77.8406248773243 0.0 3 0.8524797204660424 3.172831481896868 22100.0 38.44391634980988 0.0 - - - - - - - 301.0 44 7 CRYBB3 crystallin, beta B3 1843 234 C20140709_OR011_01 C20140709_OR011_01 TB417077.[MT7]-RC[CAM]ELSAEC[CAM]PSLTDSLLEK[MT7].4b7_1.heavy 599.806 / 990.479 6709.0 35.15959930419922 41 11 10 10 10 0.6576890280982068 77.8406248773243 0.0 3 0.8524797204660424 3.172831481896868 6709.0 4.875626360031637 1.0 - - - - - - - 175.66666666666666 14 6 CRYBB3 crystallin, beta B3 1845 234 C20140709_OR011_01 C20140709_OR011_01 TB417077.[MT7]-RC[CAM]ELSAEC[CAM]PSLTDSLLEK[MT7].4y3_1.heavy 599.806 / 533.341 29992.0 35.15959930419922 41 11 10 10 10 0.6576890280982068 77.8406248773243 0.0 3 0.8524797204660424 3.172831481896868 29992.0 40.05446254071661 0.0 - - - - - - - 263.5 59 2 CRYBB3 crystallin, beta B3 1847 234 C20140709_OR011_01 C20140709_OR011_01 TB417077.[MT7]-RC[CAM]ELSAEC[CAM]PSLTDSLLEK[MT7].4b6_1.heavy 599.806 / 861.437 3026.0 35.15959930419922 41 11 10 10 10 0.6576890280982068 77.8406248773243 0.0 3 0.8524797204660424 3.172831481896868 3026.0 25.228273878020715 0.0 - - - - - - - 186.66666666666666 6 12 CRYBB3 crystallin, beta B3 1849 235 C20140709_OR011_01 C20140709_OR011_01 TB416775.[MT7]-ENPYEDIPVQPLPMWR.3y6_1.heavy 710.027 / 799.428 14181.0 44.444549560546875 44 18 10 6 10 4.477808571568509 22.33235262332161 0.039398193359375 3 0.9879689485426993 11.240204061338618 14181.0 117.14218673218673 0.0 - - - - - - - 234.0 28 8 DENND2C DENN/MADD domain containing 2C 1851 235 C20140709_OR011_01 C20140709_OR011_01 TB416775.[MT7]-ENPYEDIPVQPLPMWR.3b6_1.heavy 710.027 / 892.38 13121.0 44.444549560546875 44 18 10 6 10 4.477808571568509 22.33235262332161 0.039398193359375 3 0.9879689485426993 11.240204061338618 13121.0 48.01533244901343 0.0 - - - - - - - 254.5 26 8 DENND2C DENN/MADD domain containing 2C 1853 235 C20140709_OR011_01 C20140709_OR011_01 TB416775.[MT7]-ENPYEDIPVQPLPMWR.3y4_1.heavy 710.027 / 589.292 5705.0 44.444549560546875 44 18 10 6 10 4.477808571568509 22.33235262332161 0.039398193359375 3 0.9879689485426993 11.240204061338618 5705.0 32.46680327868852 0.0 - - - - - - - 203.5 11 8 DENND2C DENN/MADD domain containing 2C 1855 235 C20140709_OR011_01 C20140709_OR011_01 TB416775.[MT7]-ENPYEDIPVQPLPMWR.3y9_1.heavy 710.027 / 1123.61 5949.0 44.444549560546875 44 18 10 6 10 4.477808571568509 22.33235262332161 0.039398193359375 3 0.9879689485426993 11.240204061338618 5949.0 13.35595640942848 0.0 - - - - - - - 177.63636363636363 11 11 DENND2C DENN/MADD domain containing 2C 1857 236 C20140709_OR011_01 C20140709_OR011_01 TB416622.[MT7]-GISGHPGEK[MT7].2y4_1.heavy 585.329 / 574.332 2389.0 16.397725105285645 37 11 10 6 10 2.0205648262018268 49.49111194218689 0.039699554443359375 3 0.860053147262268 3.25972343078254 2389.0 15.407325853013056 1.0 - - - - - - - 179.0 4 11 EMID1 EMI domain containing 1 1859 236 C20140709_OR011_01 C20140709_OR011_01 TB416622.[MT7]-GISGHPGEK[MT7].2b6_1.heavy 585.329 / 693.38 70.0 16.397725105285645 37 11 10 6 10 2.0205648262018268 49.49111194218689 0.039699554443359375 3 0.860053147262268 3.25972343078254 70.0 -0.3672985781990521 33.0 - - - - - - - 0.0 1 0 EMID1 EMI domain containing 1 1861 236 C20140709_OR011_01 C20140709_OR011_01 TB416622.[MT7]-GISGHPGEK[MT7].2b5_1.heavy 585.329 / 596.327 2248.0 16.397725105285645 37 11 10 6 10 2.0205648262018268 49.49111194218689 0.039699554443359375 3 0.860053147262268 3.25972343078254 2248.0 28.788976697061806 0.0 - - - - - - - 128.83333333333334 4 6 EMID1 EMI domain containing 1 1863 236 C20140709_OR011_01 C20140709_OR011_01 TB416622.[MT7]-GISGHPGEK[MT7].2y7_1.heavy 585.329 / 855.444 773.0 16.397725105285645 37 11 10 6 10 2.0205648262018268 49.49111194218689 0.039699554443359375 3 0.860053147262268 3.25972343078254 773.0 6.879598668952305 0.0 - - - - - - - 0.0 1 0 EMID1 EMI domain containing 1 1865 237 C20140709_OR011_01 C20140709_OR011_01 TB589779.[MT7]-NRDPPEIEYR.2b8_1.heavy 716.869 / 1095.56 1283.0 22.948699951171875 45 15 10 10 10 2.5946029311126764 30.08201412763352 0.0 3 0.9519729006432713 5.6087427598519985 1283.0 11.8707476635514 0.0 - - - - - - - 183.42857142857142 2 7 KLF8 Kruppel-like factor 8 1867 237 C20140709_OR011_01 C20140709_OR011_01 TB589779.[MT7]-NRDPPEIEYR.2b3_1.heavy 716.869 / 530.28 4171.0 22.948699951171875 45 15 10 10 10 2.5946029311126764 30.08201412763352 0.0 3 0.9519729006432713 5.6087427598519985 4171.0 44.43869158878505 0.0 - - - - - - - 229.28571428571428 8 7 KLF8 Kruppel-like factor 8 1869 237 C20140709_OR011_01 C20140709_OR011_01 TB589779.[MT7]-NRDPPEIEYR.2b6_1.heavy 716.869 / 853.428 428.0 22.948699951171875 45 15 10 10 10 2.5946029311126764 30.08201412763352 0.0 3 0.9519729006432713 5.6087427598519985 428.0 0.44 3.0 - - - - - - - 0.0 1 0 KLF8 Kruppel-like factor 8 1871 237 C20140709_OR011_01 C20140709_OR011_01 TB589779.[MT7]-NRDPPEIEYR.2y7_1.heavy 716.869 / 903.457 3530.0 22.948699951171875 45 15 10 10 10 2.5946029311126764 30.08201412763352 0.0 3 0.9519729006432713 5.6087427598519985 3530.0 16.74919261880518 1.0 - - - - - - - 107.0 7 1 KLF8 Kruppel-like factor 8 1873 238 C20140709_OR011_01 C20140709_OR011_01 TB416875.[MT7]-MVPLGIDETIDK[MT7].3y3_1.heavy 540.304 / 519.326 4177.0 37.70114994049072 26 13 2 5 6 1.584636144395052 49.66003304280932 0.044597625732421875 5 0.9065592888248916 4.005466457255001 4177.0 18.64893573070206 0.0 - - - - - - - 284.1111111111111 8 9 BRD1 bromodomain containing 1 1875 238 C20140709_OR011_01 C20140709_OR011_01 TB416875.[MT7]-MVPLGIDETIDK[MT7].3b4_1.heavy 540.304 / 585.355 1617.0 37.70114994049072 26 13 2 5 6 1.584636144395052 49.66003304280932 0.044597625732421875 5 0.9065592888248916 4.005466457255001 1617.0 3.806691449814126 2.0 - - - - - - - 235.625 18 8 BRD1 bromodomain containing 1 1877 238 C20140709_OR011_01 C20140709_OR011_01 TB416875.[MT7]-MVPLGIDETIDK[MT7].3b5_1.heavy 540.304 / 642.377 2695.0 37.70114994049072 26 13 2 5 6 1.584636144395052 49.66003304280932 0.044597625732421875 5 0.9065592888248916 4.005466457255001 2695.0 19.112973143566872 1.0 - - - - - - - 269.4 7 5 BRD1 bromodomain containing 1 1879 238 C20140709_OR011_01 C20140709_OR011_01 TB416875.[MT7]-MVPLGIDETIDK[MT7].3y4_1.heavy 540.304 / 620.374 1752.0 37.70114994049072 26 13 2 5 6 1.584636144395052 49.66003304280932 0.044597625732421875 5 0.9065592888248916 4.005466457255001 1752.0 12.528888888888888 1.0 - - - - - - - 157.33333333333334 3 6 BRD1 bromodomain containing 1 1881 239 C20140709_OR011_01 C20140709_OR011_01 TB416872.[MT7]-IHQC[CAM]DFAGC[CAM]SK[MT7].3b5_1.heavy 537.593 / 798.369 8740.0 22.143800735473633 48 18 10 10 10 2.719278957578416 28.500529079447205 0.0 3 0.9879134719760163 11.214326327019958 8740.0 80.65815631808279 0.0 - - - - - - - 247.0 17 7 KLF8 Kruppel-like factor 8 1883 239 C20140709_OR011_01 C20140709_OR011_01 TB416872.[MT7]-IHQC[CAM]DFAGC[CAM]SK[MT7].3b3_1.heavy 537.593 / 523.311 5285.0 22.143800735473633 48 18 10 10 10 2.719278957578416 28.500529079447205 0.0 3 0.9879134719760163 11.214326327019958 5285.0 12.486883587186389 0.0 - - - - - - - 784.0 10 7 KLF8 Kruppel-like factor 8 1885 239 C20140709_OR011_01 C20140709_OR011_01 TB416872.[MT7]-IHQC[CAM]DFAGC[CAM]SK[MT7].3y4_1.heavy 537.593 / 595.299 29778.0 22.143800735473633 48 18 10 10 10 2.719278957578416 28.500529079447205 0.0 3 0.9879134719760163 11.214326327019958 29778.0 43.58052743273401 0.0 - - - - - - - 139.875 59 8 KLF8 Kruppel-like factor 8 1887 239 C20140709_OR011_01 C20140709_OR011_01 TB416872.[MT7]-IHQC[CAM]DFAGC[CAM]SK[MT7].3y5_1.heavy 537.593 / 666.336 15753.0 22.143800735473633 48 18 10 10 10 2.719278957578416 28.500529079447205 0.0 3 0.9879134719760163 11.214326327019958 15753.0 52.20750757622765 1.0 - - - - - - - 233.9 31 10 KLF8 Kruppel-like factor 8 1889 240 C20140709_OR011_01 C20140709_OR011_01 TB416878.[MT7]-TGAELVTC[CAM]GSVLK[MT7].2y8_1.heavy 811.955 / 1007.57 3210.0 31.86039924621582 40 10 10 10 10 0.814620187560624 72.57785081201001 0.0 3 0.8424492990874195 3.067453663610283 3210.0 42.75 0.0 - - - - - - - 168.14285714285714 6 7 SDF2L1 stromal cell-derived factor 2-like 1 1891 240 C20140709_OR011_01 C20140709_OR011_01 TB416878.[MT7]-TGAELVTC[CAM]GSVLK[MT7].2b6_1.heavy 811.955 / 715.411 1498.0 31.86039924621582 40 10 10 10 10 0.814620187560624 72.57785081201001 0.0 3 0.8424492990874195 3.067453663610283 1498.0 23.799999999999997 0.0 - - - - - - - 249.66666666666666 2 3 SDF2L1 stromal cell-derived factor 2-like 1 1893 240 C20140709_OR011_01 C20140709_OR011_01 TB416878.[MT7]-TGAELVTC[CAM]GSVLK[MT7].2b5_1.heavy 811.955 / 616.342 2461.0 31.86039924621582 40 10 10 10 10 0.814620187560624 72.57785081201001 0.0 3 0.8424492990874195 3.067453663610283 2461.0 18.974999999999998 0.0 - - - - - - - 214.0 4 5 SDF2L1 stromal cell-derived factor 2-like 1 1895 240 C20140709_OR011_01 C20140709_OR011_01 TB416878.[MT7]-TGAELVTC[CAM]GSVLK[MT7].2y7_1.heavy 811.955 / 908.499 3745.0 31.86039924621582 40 10 10 10 10 0.814620187560624 72.57785081201001 0.0 3 0.8424492990874195 3.067453663610283 3745.0 41.58 0.0 - - - - - - - 214.0 7 5 SDF2L1 stromal cell-derived factor 2-like 1 1897 241 C20140709_OR011_01 C20140709_OR011_01 TB416877.[MT7]-RQVSIEEGERK[MT7].3y6_1.heavy 540.309 / 891.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC150786;RAB6A RAB6C-like;RAB6A, member RAS oncogene family 1899 241 C20140709_OR011_01 C20140709_OR011_01 TB416877.[MT7]-RQVSIEEGERK[MT7].3b6_1.heavy 540.309 / 857.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC150786;RAB6A RAB6C-like;RAB6A, member RAS oncogene family 1901 241 C20140709_OR011_01 C20140709_OR011_01 TB416877.[MT7]-RQVSIEEGERK[MT7].3y8_1.heavy 540.309 / 1091.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC150786;RAB6A RAB6C-like;RAB6A, member RAS oncogene family 1903 241 C20140709_OR011_01 C20140709_OR011_01 TB416877.[MT7]-RQVSIEEGERK[MT7].3b7_1.heavy 540.309 / 986.539 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC150786;RAB6A RAB6C-like;RAB6A, member RAS oncogene family 1905 242 C20140709_OR011_01 C20140709_OR011_01 TB589960.[MT7]-LREFLRVEEQAILDAMAEETR.4y5_1.heavy 666.604 / 605.289 5385.0 50.73770046234131 43 17 10 6 10 7.1906601421333685 13.906928991686623 0.033199310302734375 3 0.977472449965546 8.207042846960602 5385.0 40.183522727272724 0.0 - - - - - - - 156.25 10 16 TRIM35 tripartite motif-containing 35 1907 242 C20140709_OR011_01 C20140709_OR011_01 TB589960.[MT7]-LREFLRVEEQAILDAMAEETR.4b11_2.heavy 666.604 / 758.424 5948.0 50.73770046234131 43 17 10 6 10 7.1906601421333685 13.906928991686623 0.033199310302734375 3 0.977472449965546 8.207042846960602 5948.0 24.126011479322504 0.0 - - - - - - - 223.58823529411765 11 17 TRIM35 tripartite motif-containing 35 1909 242 C20140709_OR011_01 C20140709_OR011_01 TB589960.[MT7]-LREFLRVEEQAILDAMAEETR.4b14_2.heavy 666.604 / 929.021 5737.0 50.73770046234131 43 17 10 6 10 7.1906601421333685 13.906928991686623 0.033199310302734375 3 0.977472449965546 8.207042846960602 5737.0 105.71540097402597 0.0 - - - - - - - 137.75 11 12 TRIM35 tripartite motif-containing 35 1911 242 C20140709_OR011_01 C20140709_OR011_01 TB589960.[MT7]-LREFLRVEEQAILDAMAEETR.4b10_2.heavy 666.604 / 722.905 2816.0 50.73770046234131 43 17 10 6 10 7.1906601421333685 13.906928991686623 0.033199310302734375 3 0.977472449965546 8.207042846960602 2816.0 21.191489361702125 0.0 - - - - - - - 157.26666666666668 5 15 TRIM35 tripartite motif-containing 35 1913 243 C20140709_OR011_01 C20140709_OR011_01 TB589772.[MT7]-QLLLQLNQQR.2y8_1.heavy 699.421 / 1012.59 9134.0 35.20560073852539 45 15 10 10 10 9.202802234909106 10.866255456481367 0.0 3 0.9568687706182774 5.920971735144329 9134.0 52.656131984096966 0.0 - - - - - - - 208.77777777777777 18 9 HIC2 hypermethylated in cancer 2 1915 243 C20140709_OR011_01 C20140709_OR011_01 TB589772.[MT7]-QLLLQLNQQR.2y9_1.heavy 699.421 / 1125.67 7657.0 35.20560073852539 45 15 10 10 10 9.202802234909106 10.866255456481367 0.0 3 0.9568687706182774 5.920971735144329 7657.0 30.6247135746575 0.0 - - - - - - - 215.0 15 5 HIC2 hypermethylated in cancer 2 1917 243 C20140709_OR011_01 C20140709_OR011_01 TB589772.[MT7]-QLLLQLNQQR.2y6_1.heavy 699.421 / 786.422 8194.0 35.20560073852539 45 15 10 10 10 9.202802234909106 10.866255456481367 0.0 3 0.9568687706182774 5.920971735144329 8194.0 39.58581283877801 0.0 - - - - - - - 235.25 16 4 HIC2 hypermethylated in cancer 2 1919 243 C20140709_OR011_01 C20140709_OR011_01 TB589772.[MT7]-QLLLQLNQQR.2y7_1.heavy 699.421 / 899.506 9671.0 35.20560073852539 45 15 10 10 10 9.202802234909106 10.866255456481367 0.0 3 0.9568687706182774 5.920971735144329 9671.0 41.19425344611818 0.0 - - - - - - - 235.0 19 8 HIC2 hypermethylated in cancer 2 1921 244 C20140709_OR011_01 C20140709_OR011_01 TB416496.[MT7]-RLAQLQPSSK[MT7].3b6_1.heavy 472.624 / 854.533 940.0 22.208799839019775 41 17 10 6 8 3.8735435441006625 25.81615486220575 0.03719902038574219 4 0.9784302397706001 8.387952643851087 940.0 11.75 0.0 - - - - - - - 0.0 1 0 DENND2C DENN/MADD domain containing 2C 1923 244 C20140709_OR011_01 C20140709_OR011_01 TB416496.[MT7]-RLAQLQPSSK[MT7].3b4_1.heavy 472.624 / 613.39 3968.0 22.208799839019775 41 17 10 6 8 3.8735435441006625 25.81615486220575 0.03719902038574219 4 0.9784302397706001 8.387952643851087 3968.0 19.9531253343932 0.0 - - - - - - - 268.2857142857143 7 7 DENND2C DENN/MADD domain containing 2C 1925 244 C20140709_OR011_01 C20140709_OR011_01 TB416496.[MT7]-RLAQLQPSSK[MT7].3b5_1.heavy 472.624 / 726.474 1566.0 22.208799839019775 41 17 10 6 8 3.8735435441006625 25.81615486220575 0.03719902038574219 4 0.9784302397706001 8.387952643851087 1566.0 8.744818625128026 1.0 - - - - - - - 208.8 5 5 DENND2C DENN/MADD domain containing 2C 1927 244 C20140709_OR011_01 C20140709_OR011_01 TB416496.[MT7]-RLAQLQPSSK[MT7].3y4_1.heavy 472.624 / 562.332 9397.0 22.208799839019775 41 17 10 6 8 3.8735435441006625 25.81615486220575 0.03719902038574219 4 0.9784302397706001 8.387952643851087 9397.0 56.667274377165484 0.0 - - - - - - - 193.71428571428572 18 7 DENND2C DENN/MADD domain containing 2C 1929 245 C20140709_OR011_01 C20140709_OR011_01 TB589964.[MT7]-QLTEETEVLAHEIERLQMEMK[MT7].4b7_1.heavy 712.122 / 975.475 5135.0 48.15919876098633 41 11 10 10 10 0.7835892344930838 67.16153114850579 0.0 3 0.8777605353169073 3.4932529322457566 5135.0 51.83443396226415 0.0 - - - - - - - 154.58333333333334 10 12 TRIM35 tripartite motif-containing 35 1931 245 C20140709_OR011_01 C20140709_OR011_01 TB589964.[MT7]-QLTEETEVLAHEIERLQMEMK[MT7].4y10_2.heavy 712.122 / 725.879 5823.0 48.15919876098633 41 11 10 10 10 0.7835892344930838 67.16153114850579 0.0 3 0.8777605353169073 3.4932529322457566 5823.0 84.04896226415093 0.0 - - - - - - - 141.33333333333334 11 9 TRIM35 tripartite motif-containing 35 1933 245 C20140709_OR011_01 C20140709_OR011_01 TB589964.[MT7]-QLTEETEVLAHEIERLQMEMK[MT7].4b4_1.heavy 712.122 / 616.342 2170.0 48.15919876098633 41 11 10 10 10 0.7835892344930838 67.16153114850579 0.0 3 0.8777605353169073 3.4932529322457566 2170.0 24.566037735849058 0.0 - - - - - - - 151.42857142857142 4 21 TRIM35 tripartite motif-containing 35 1935 245 C20140709_OR011_01 C20140709_OR011_01 TB589964.[MT7]-QLTEETEVLAHEIERLQMEMK[MT7].4b5_1.heavy 712.122 / 745.385 1853.0 48.15919876098633 41 11 10 10 10 0.7835892344930838 67.16153114850579 0.0 3 0.8777605353169073 3.4932529322457566 1853.0 16.082641509433962 1.0 - - - - - - - 116.6 6 15 TRIM35 tripartite motif-containing 35 1937 246 C20140709_OR011_01 C20140709_OR011_01 TB589963.[MT7]-NLVSLGFVISNPDLVTC[CAM]LEQIK[MT7].3b6_1.heavy 916.513 / 728.442 3854.0 52.272300720214844 45 15 10 10 10 1.3823460563656382 44.04855725902473 0.0 3 0.9517649844486895 5.596542796615198 3854.0 59.49676392572944 0.0 - - - - - - - 117.96666666666667 7 30 ZNF595 zinc finger protein 595 1939 246 C20140709_OR011_01 C20140709_OR011_01 TB589963.[MT7]-NLVSLGFVISNPDLVTC[CAM]LEQIK[MT7].3b4_1.heavy 916.513 / 558.337 1906.0 52.272300720214844 45 15 10 10 10 1.3823460563656382 44.04855725902473 0.0 3 0.9517649844486895 5.596542796615198 1906.0 18.431515535827522 0.0 - - - - - - - 140.96774193548387 3 31 ZNF595 zinc finger protein 595 1941 246 C20140709_OR011_01 C20140709_OR011_01 TB589963.[MT7]-NLVSLGFVISNPDLVTC[CAM]LEQIK[MT7].3b8_1.heavy 916.513 / 974.579 4082.0 52.272300720214844 45 15 10 10 10 1.3823460563656382 44.04855725902473 0.0 3 0.9517649844486895 5.596542796615198 4082.0 32.07063310450038 0.0 - - - - - - - 114.37931034482759 8 29 ZNF595 zinc finger protein 595 1943 246 C20140709_OR011_01 C20140709_OR011_01 TB589963.[MT7]-NLVSLGFVISNPDLVTC[CAM]LEQIK[MT7].3b7_1.heavy 916.513 / 875.511 3357.0 52.272300720214844 45 15 10 10 10 1.3823460563656382 44.04855725902473 0.0 3 0.9517649844486895 5.596542796615198 3357.0 33.2007124148769 0.0 - - - - - - - 126.4 6 30 ZNF595 zinc finger protein 595 1945 247 C20140709_OR011_01 C20140709_OR011_01 TB589776.[MT7]-AFNWSSSLTK[MT7].3y3_1.heavy 476.929 / 505.347 30579.0 35.775001525878906 43 13 10 10 10 4.544270719692215 22.005731209335394 0.0 2 0.9271463766421472 4.544270657782141 30579.0 140.31892846462006 0.0 - - - - - - - 193.55555555555554 61 9 ZNF595;ZNF91 zinc finger protein 595;zinc finger protein 91 1947 247 C20140709_OR011_01 C20140709_OR011_01 TB589776.[MT7]-AFNWSSSLTK[MT7].3y5_1.heavy 476.929 / 679.411 N/A 35.775001525878906 43 13 10 10 10 4.544270719692215 22.005731209335394 0.0 2 0.9271463766421472 4.544270657782141 402.0 1.525623003194888 8.0 - - - - - - - 0.0 1 0 ZNF595;ZNF91 zinc finger protein 595;zinc finger protein 91 1949 247 C20140709_OR011_01 C20140709_OR011_01 TB589776.[MT7]-AFNWSSSLTK[MT7].3b4_1.heavy 476.929 / 663.337 6169.0 35.775001525878906 43 13 10 10 10 4.544270719692215 22.005731209335394 0.0 2 0.9271463766421472 4.544270657782141 6169.0 23.632487562189052 0.0 - - - - - - - 172.28571428571428 12 7 ZNF595;ZNF91 zinc finger protein 595;zinc finger protein 91 1951 247 C20140709_OR011_01 C20140709_OR011_01 TB589776.[MT7]-AFNWSSSLTK[MT7].3y4_1.heavy 476.929 / 592.379 N/A 35.775001525878906 43 13 10 10 10 4.544270719692215 22.005731209335394 0.0 2 0.9271463766421472 4.544270657782141 134.0 1.25 19.0 - - - - - - - 0.0 1 0 ZNF595;ZNF91 zinc finger protein 595;zinc finger protein 91 1953 248 C20140709_OR011_01 C20140709_OR011_01 TB416628.[MT7]-QVTASVRNR.2b3_1.heavy 587.842 / 473.284 15158.0 23.10865068435669 35 10 10 5 10 1.123165245399926 55.92761920004556 0.04260063171386719 3 0.8388308805905904 3.0318528254128907 15158.0 45.7273612514897 0.0 - - - - - - - 256.44444444444446 30 9 KLF8 Kruppel-like factor 8 1955 248 C20140709_OR011_01 C20140709_OR011_01 TB416628.[MT7]-QVTASVRNR.2y3_1.heavy 587.842 / 445.263 2307.0 23.10865068435669 35 10 10 5 10 1.123165245399926 55.92761920004556 0.04260063171386719 3 0.8388308805905904 3.0318528254128907 2307.0 23.282590443686004 0.0 - - - - - - - 293.0 4 6 KLF8 Kruppel-like factor 8 1957 248 C20140709_OR011_01 C20140709_OR011_01 TB416628.[MT7]-QVTASVRNR.2y6_1.heavy 587.842 / 702.401 9007.0 23.10865068435669 35 10 10 5 10 1.123165245399926 55.92761920004556 0.04260063171386719 3 0.8388308805905904 3.0318528254128907 9007.0 27.073214695722257 0.0 - - - - - - - 274.8333333333333 18 6 KLF8 Kruppel-like factor 8 1959 248 C20140709_OR011_01 C20140709_OR011_01 TB416628.[MT7]-QVTASVRNR.2b7_1.heavy 587.842 / 886.523 2197.0 23.10865068435669 35 10 10 5 10 1.123165245399926 55.92761920004556 0.04260063171386719 3 0.8388308805905904 3.0318528254128907 2197.0 35.152 1.0 - - - - - - - 183.33333333333334 4 6 KLF8 Kruppel-like factor 8 1961 249 C20140709_OR011_01 C20140709_OR011_01 TB416615.[MT7]-MADLHAVPR.2y5_1.heavy 577.317 / 579.336 1464.0 28.284799575805664 29 3 10 10 6 0.3894053841717013 127.05444623975787 0.0 6 0.5282923782303651 1.720878650666839 1464.0 -1.5602131438721136 1.0 - - - - - - - 263.0 4 6 DPYSL3 dihydropyrimidinase-like 3 1963 249 C20140709_OR011_01 C20140709_OR011_01 TB416615.[MT7]-MADLHAVPR.2b4_1.heavy 577.317 / 575.298 14079.0 28.284799575805664 29 3 10 10 6 0.3894053841717013 127.05444623975787 0.0 6 0.5282923782303651 1.720878650666839 14079.0 -1.250355239786856 0.0 - - - - - - - 286.90909090909093 28 11 DPYSL3 dihydropyrimidinase-like 3 1965 249 C20140709_OR011_01 C20140709_OR011_01 TB416615.[MT7]-MADLHAVPR.2y6_1.heavy 577.317 / 692.42 788.0 28.284799575805664 29 3 10 10 6 0.3894053841717013 127.05444623975787 0.0 6 0.5282923782303651 1.720878650666839 788.0 0.0 9.0 - - - - - - - 267.5 3 8 DPYSL3 dihydropyrimidinase-like 3 1967 249 C20140709_OR011_01 C20140709_OR011_01 TB416615.[MT7]-MADLHAVPR.2y7_1.heavy 577.317 / 807.447 676.0 28.284799575805664 29 3 10 10 6 0.3894053841717013 127.05444623975787 0.0 6 0.5282923782303651 1.720878650666839 676.0 -0.4496674057649668 3.0 - - - - - - - 234.75 2 12 DPYSL3 dihydropyrimidinase-like 3 1969 250 C20140709_OR011_01 C20140709_OR011_01 TB416614.[MT7]-AHSTC[CAM]GTK[MT7].2y4_1.heavy 575.3 / 609.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADCY8 adenylate cyclase 8 (brain) 1971 250 C20140709_OR011_01 C20140709_OR011_01 TB416614.[MT7]-AHSTC[CAM]GTK[MT7].2y5_1.heavy 575.3 / 710.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADCY8 adenylate cyclase 8 (brain) 1973 250 C20140709_OR011_01 C20140709_OR011_01 TB416614.[MT7]-AHSTC[CAM]GTK[MT7].2y6_1.heavy 575.3 / 797.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADCY8 adenylate cyclase 8 (brain) 1975 250 C20140709_OR011_01 C20140709_OR011_01 TB416614.[MT7]-AHSTC[CAM]GTK[MT7].2y7_1.heavy 575.3 / 934.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADCY8 adenylate cyclase 8 (brain) 1977 251 C20140709_OR011_01 C20140709_OR011_01 TB416612.[MT7]-YLGSLQYR.2y4_1.heavy 572.318 / 579.325 2319.0 32.46730041503906 48 18 10 10 10 7.22310629977177 13.84445913569896 0.0 3 0.9871613628268822 10.880207139481788 2319.0 7.404833836858006 4.0 - - - - - - - 246.15384615384616 5 13 TRIM35 tripartite motif-containing 35 1979 251 C20140709_OR011_01 C20140709_OR011_01 TB416612.[MT7]-YLGSLQYR.2b4_1.heavy 572.318 / 565.31 3092.0 32.46730041503906 48 18 10 10 10 7.22310629977177 13.84445913569896 0.0 3 0.9871613628268822 10.880207139481788 3092.0 4.12200389422818 1.0 - - - - - - - 772.7142857142857 7 7 TRIM35 tripartite motif-containing 35 1981 251 C20140709_OR011_01 C20140709_OR011_01 TB416612.[MT7]-YLGSLQYR.2y6_1.heavy 572.318 / 723.378 12366.0 32.46730041503906 48 18 10 10 10 7.22310629977177 13.84445913569896 0.0 3 0.9871613628268822 10.880207139481788 12366.0 130.28300781571372 0.0 - - - - - - - 196.11111111111111 24 9 TRIM35 tripartite motif-containing 35 1983 251 C20140709_OR011_01 C20140709_OR011_01 TB416612.[MT7]-YLGSLQYR.2y7_1.heavy 572.318 / 836.463 14354.0 32.46730041503906 48 18 10 10 10 7.22310629977177 13.84445913569896 0.0 3 0.9871613628268822 10.880207139481788 14354.0 57.167962396024194 0.0 - - - - - - - 130.1818181818182 28 11 TRIM35 tripartite motif-containing 35 1985 252 C20140709_OR011_01 C20140709_OR011_01 TB416611.[MT7]-SPDVSPGPSR.2y5_1.heavy 571.8 / 513.278 3458.0 18.514999389648438 44 18 10 6 10 5.537243261175065 18.059528050927437 0.0391998291015625 3 0.9839797489422779 9.737471694105343 3458.0 10.999193962748876 0.0 - - - - - - - 207.2 6 10 TRIM35 tripartite motif-containing 35 1987 252 C20140709_OR011_01 C20140709_OR011_01 TB416611.[MT7]-SPDVSPGPSR.2y9_1.heavy 571.8 / 911.458 12708.0 18.514999389648438 44 18 10 6 10 5.537243261175065 18.059528050927437 0.0391998291015625 3 0.9839797489422779 9.737471694105343 12708.0 163.2645167361204 0.0 - - - - - - - 158.33333333333334 25 6 TRIM35 tripartite motif-containing 35 1989 252 C20140709_OR011_01 C20140709_OR011_01 TB416611.[MT7]-SPDVSPGPSR.2y6_1.heavy 571.8 / 600.31 3026.0 18.514999389648438 44 18 10 6 10 5.537243261175065 18.059528050927437 0.0391998291015625 3 0.9839797489422779 9.737471694105343 3026.0 48.113359322489586 0.0 - - - - - - - 230.5 6 6 TRIM35 tripartite motif-containing 35 1991 252 C20140709_OR011_01 C20140709_OR011_01 TB416611.[MT7]-SPDVSPGPSR.2y7_1.heavy 571.8 / 699.378 7348.0 18.514999389648438 44 18 10 6 10 5.537243261175065 18.059528050927437 0.0391998291015625 3 0.9839797489422779 9.737471694105343 7348.0 125.79214948245732 0.0 - - - - - - - 158.16666666666666 14 6 TRIM35 tripartite motif-containing 35 1993 253 C20140709_OR011_01 C20140709_OR011_01 TB416781.[MT7]-GRVLLPETQK[MT7].2y5_1.heavy 714.942 / 746.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - C22orf31 chromosome 22 open reading frame 31 1995 253 C20140709_OR011_01 C20140709_OR011_01 TB416781.[MT7]-GRVLLPETQK[MT7].2b7_1.heavy 714.942 / 909.564 N/A N/A - - - - - - - - - 0.0 - - - - - - - C22orf31 chromosome 22 open reading frame 31 1997 253 C20140709_OR011_01 C20140709_OR011_01 TB416781.[MT7]-GRVLLPETQK[MT7].2b5_1.heavy 714.942 / 683.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - C22orf31 chromosome 22 open reading frame 31 1999 253 C20140709_OR011_01 C20140709_OR011_01 TB416781.[MT7]-GRVLLPETQK[MT7].2b9_1.heavy 714.942 / 1138.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - C22orf31 chromosome 22 open reading frame 31 2001 254 C20140709_OR011_01 C20140709_OR011_01 TB416783.[MT7]-RDPSIPIYGLR.2y9_1.heavy 715.915 / 1015.59 6370.0 32.83647537231445 37 18 10 5 4 3.2976495283494103 22.133143349038658 0.0417022705078125 9 0.9829949782970208 9.45053542795853 6370.0 6.786515387236208 0.0 - - - - - - - 250.75 12 8 C22orf31 chromosome 22 open reading frame 31 2003 254 C20140709_OR011_01 C20140709_OR011_01 TB416783.[MT7]-RDPSIPIYGLR.2y6_1.heavy 715.915 / 718.425 590.0 32.83647537231445 37 18 10 5 4 3.2976495283494103 22.133143349038658 0.0417022705078125 9 0.9829949782970208 9.45053542795853 590.0 5.699999999999999 7.0 - - - - - - - 227.57142857142858 2 14 C22orf31 chromosome 22 open reading frame 31 2005 254 C20140709_OR011_01 C20140709_OR011_01 TB416783.[MT7]-RDPSIPIYGLR.2y10_1.heavy 715.915 / 1130.62 1062.0 32.83647537231445 37 18 10 5 4 3.2976495283494103 22.133143349038658 0.0417022705078125 9 0.9829949782970208 9.45053542795853 1062.0 2.6999999999999997 3.0 - - - - - - - 210.71428571428572 2 14 C22orf31 chromosome 22 open reading frame 31 2007 254 C20140709_OR011_01 C20140709_OR011_01 TB416783.[MT7]-RDPSIPIYGLR.2b5_1.heavy 715.915 / 713.406 708.0 32.83647537231445 37 18 10 5 4 3.2976495283494103 22.133143349038658 0.0417022705078125 9 0.9829949782970208 9.45053542795853 708.0 1.0 17.0 - - - - - - - 0.0 1 0 C22orf31 chromosome 22 open reading frame 31 2009 255 C20140709_OR011_01 C20140709_OR011_01 TB589957.[MT7]-IVNDDQSFYADIYMEDGLIK[MT7].3b4_1.heavy 879.771 / 586.332 1340.0 44.617401123046875 42 12 10 10 10 1.9613511774223558 36.11905659384668 0.0 3 0.8931427089418266 3.741234415614164 1340.0 10.745702221055895 1.0 - - - - - - - 141.69230769230768 8 13 DPYSL2;DPYSL3 dihydropyrimidinase-like 2;dihydropyrimidinase-like 3 2011 255 C20140709_OR011_01 C20140709_OR011_01 TB589957.[MT7]-IVNDDQSFYADIYMEDGLIK[MT7].3b5_1.heavy 879.771 / 701.359 3015.0 44.617401123046875 42 12 10 10 10 1.9613511774223558 36.11905659384668 0.0 3 0.8931427089418266 3.741234415614164 3015.0 20.36833415397322 0.0 - - - - - - - 184.2 6 10 DPYSL2;DPYSL3 dihydropyrimidinase-like 2;dihydropyrimidinase-like 3 2013 255 C20140709_OR011_01 C20140709_OR011_01 TB589957.[MT7]-IVNDDQSFYADIYMEDGLIK[MT7].3y4_1.heavy 879.771 / 574.404 3685.0 44.617401123046875 42 12 10 10 10 1.9613511774223558 36.11905659384668 0.0 3 0.8931427089418266 3.741234415614164 3685.0 19.789 0.0 - - - - - - - 233.21428571428572 7 14 DPYSL2;DPYSL3 dihydropyrimidinase-like 2;dihydropyrimidinase-like 3 2015 255 C20140709_OR011_01 C20140709_OR011_01 TB589957.[MT7]-IVNDDQSFYADIYMEDGLIK[MT7].3b7_1.heavy 879.771 / 916.449 4020.0 44.617401123046875 42 12 10 10 10 1.9613511774223558 36.11905659384668 0.0 3 0.8931427089418266 3.741234415614164 4020.0 58.7632327831531 0.0 - - - - - - - 204.55555555555554 8 9 DPYSL2;DPYSL3 dihydropyrimidinase-like 2;dihydropyrimidinase-like 3 2017 256 C20140709_OR011_01 C20140709_OR011_01 TB416782.[MT7]-GAPLVVIC[CAM]QGK[MT7].3b6_1.heavy 477.286 / 681.442 4111.0 31.67685031890869 39 13 10 6 10 0.9267018222696475 54.014237162016656 0.037799835205078125 3 0.910098106446612 4.084785879868009 4111.0 71.29436936936938 0.0 - - - - - - - 199.8 8 5 DPYSL3 dihydropyrimidinase-like 3 2019 256 C20140709_OR011_01 C20140709_OR011_01 TB416782.[MT7]-GAPLVVIC[CAM]QGK[MT7].3b4_1.heavy 477.286 / 483.305 5000.0 31.67685031890869 39 13 10 6 10 0.9267018222696475 54.014237162016656 0.037799835205078125 3 0.910098106446612 4.084785879868009 5000.0 41.666666666666664 0.0 - - - - - - - 222.0 10 6 DPYSL3 dihydropyrimidinase-like 3 2021 256 C20140709_OR011_01 C20140709_OR011_01 TB416782.[MT7]-GAPLVVIC[CAM]QGK[MT7].3b5_1.heavy 477.286 / 582.373 12223.0 31.67685031890869 39 13 10 6 10 0.9267018222696475 54.014237162016656 0.037799835205078125 3 0.910098106446612 4.084785879868009 12223.0 117.33713493253374 0.0 - - - - - - - 222.0 24 6 DPYSL3 dihydropyrimidinase-like 3 2023 256 C20140709_OR011_01 C20140709_OR011_01 TB416782.[MT7]-GAPLVVIC[CAM]QGK[MT7].3y4_1.heavy 477.286 / 636.326 6334.0 31.67685031890869 39 13 10 6 10 0.9267018222696475 54.014237162016656 0.037799835205078125 3 0.910098106446612 4.084785879868009 6334.0 109.56108108108108 0.0 - - - - - - - 111.0 12 3 DPYSL3 dihydropyrimidinase-like 3 2025 257 C20140709_OR011_01 C20140709_OR011_01 TB416887.[MT7]-QLQQSYVAMYQR.3y6_1.heavy 553.62 / 767.387 7525.0 31.02869987487793 42 18 10 6 8 5.7773344163410645 17.309020526343808 0.034198760986328125 4 0.9880772144676088 11.291224891693512 7525.0 60.80808080808081 0.0 - - - - - - - 165.0 15 12 LZTS1 leucine zipper, putative tumor suppressor 1 2027 257 C20140709_OR011_01 C20140709_OR011_01 TB416887.[MT7]-QLQQSYVAMYQR.3b5_1.heavy 553.62 / 729.401 2970.0 31.02869987487793 42 18 10 6 8 5.7773344163410645 17.309020526343808 0.034198760986328125 4 0.9880772144676088 11.291224891693512 2970.0 14.442857142857143 1.0 - - - - - - - 247.5 6 12 LZTS1 leucine zipper, putative tumor suppressor 1 2029 257 C20140709_OR011_01 C20140709_OR011_01 TB416887.[MT7]-QLQQSYVAMYQR.3b3_1.heavy 553.62 / 514.311 7228.0 31.02869987487793 42 18 10 6 8 5.7773344163410645 17.309020526343808 0.034198760986328125 4 0.9880772144676088 11.291224891693512 7228.0 25.40751515151515 0.0 - - - - - - - 281.7692307692308 14 13 LZTS1 leucine zipper, putative tumor suppressor 1 2031 257 C20140709_OR011_01 C20140709_OR011_01 TB416887.[MT7]-QLQQSYVAMYQR.3y5_1.heavy 553.62 / 668.318 10693.0 31.02869987487793 42 18 10 6 8 5.7773344163410645 17.309020526343808 0.034198760986328125 4 0.9880772144676088 11.291224891693512 10693.0 49.68464646464647 1.0 - - - - - - - 209.0 21 9 LZTS1 leucine zipper, putative tumor suppressor 1 2033 258 C20140709_OR011_01 C20140709_OR011_01 TB589950.[MT7]-RHEFTAEC[CAM]PSVLELGFETVR.3y7_1.heavy 841.092 / 821.452 8855.0 38.99359893798828 47 17 10 10 10 2.234752614613306 30.625548222090508 0.0 3 0.9732675647757162 7.531315689805061 8855.0 125.55597014925374 0.0 - - - - - - - 294.8 17 5 CRYBA4 crystallin, beta A4 2035 258 C20140709_OR011_01 C20140709_OR011_01 TB589950.[MT7]-RHEFTAEC[CAM]PSVLELGFETVR.3y8_1.heavy 841.092 / 950.494 11136.0 38.99359893798828 47 17 10 10 10 2.234752614613306 30.625548222090508 0.0 3 0.9732675647757162 7.531315689805061 11136.0 40.75380830571435 0.0 - - - - - - - 306.2857142857143 22 7 CRYBA4 crystallin, beta A4 2037 258 C20140709_OR011_01 C20140709_OR011_01 TB589950.[MT7]-RHEFTAEC[CAM]PSVLELGFETVR.3b7_1.heavy 841.092 / 1015.51 10062.0 38.99359893798828 47 17 10 10 10 2.234752614613306 30.625548222090508 0.0 3 0.9732675647757162 7.531315689805061 10062.0 42.39133828066372 0.0 - - - - - - - 268.0 20 7 CRYBA4 crystallin, beta A4 2039 258 C20140709_OR011_01 C20140709_OR011_01 TB589950.[MT7]-RHEFTAEC[CAM]PSVLELGFETVR.3y9_1.heavy 841.092 / 1063.58 16368.0 38.99359893798828 47 17 10 10 10 2.234752614613306 30.625548222090508 0.0 3 0.9732675647757162 7.531315689805061 16368.0 72.47522388059701 0.0 - - - - - - - 280.1818181818182 32 11 CRYBA4 crystallin, beta A4 2041 259 C20140709_OR011_01 C20140709_OR011_01 TB589785.[MT7]-VRQQLTFHQR.3b4_1.heavy 486.28 / 656.396 996.0 21.292325496673584 30 14 9 3 4 3.2004208077963723 24.741651943135984 0.07530021667480469 9 0.9303108578752199 4.647558011198629 996.0 9.359396984924622 8.0 - - - - - - - 265.5833333333333 3 12 ZFP30 zinc finger protein 30 homolog (mouse) 2043 259 C20140709_OR011_01 C20140709_OR011_01 TB589785.[MT7]-VRQQLTFHQR.3b3_1.heavy 486.28 / 528.337 697.0 21.292325496673584 30 14 9 3 4 3.2004208077963723 24.741651943135984 0.07530021667480469 9 0.9303108578752199 4.647558011198629 697.0 6.96303 5.0 - - - - - - - 0.0 1 0 ZFP30 zinc finger protein 30 homolog (mouse) 2045 259 C20140709_OR011_01 C20140709_OR011_01 TB589785.[MT7]-VRQQLTFHQR.3y4_1.heavy 486.28 / 587.305 1395.0 21.292325496673584 30 14 9 3 4 3.2004208077963723 24.741651943135984 0.07530021667480469 9 0.9303108578752199 4.647558011198629 1395.0 2.278795180722892 3.0 - - - - - - - 229.2 2 10 ZFP30 zinc finger protein 30 homolog (mouse) 2047 259 C20140709_OR011_01 C20140709_OR011_01 TB589785.[MT7]-VRQQLTFHQR.3y5_1.heavy 486.28 / 688.352 697.0 21.292325496673584 30 14 9 3 4 3.2004208077963723 24.741651943135984 0.07530021667480469 9 0.9303108578752199 4.647558011198629 697.0 4.879 2.0 - - - - - - - 0.0 1 0 ZFP30 zinc finger protein 30 homolog (mouse) 2049 260 C20140709_OR011_01 C20140709_OR011_01 TB446981.[MT7]-TNHTLNNLVEK[MT7].3y6_1.heavy 524.298 / 860.496 1541.0 25.907649993896484 40 15 10 5 10 4.897949239073402 20.41670811984938 0.04290008544921875 3 0.9591781823972676 6.0873409494824635 1541.0 27.59790909090909 0.0 - - - - - - - 128.33333333333334 3 6 TRIM35 tripartite motif-containing 35 2051 260 C20140709_OR011_01 C20140709_OR011_01 TB446981.[MT7]-TNHTLNNLVEK[MT7].3y3_1.heavy 524.298 / 519.326 25205.0 25.907649993896484 40 15 10 5 10 4.897949239073402 20.41670811984938 0.04290008544921875 3 0.9591781823972676 6.0873409494824635 25205.0 28.19003810516941 0.0 - - - - - - - 715.2 50 10 TRIM35 tripartite motif-containing 35 2053 260 C20140709_OR011_01 C20140709_OR011_01 TB446981.[MT7]-TNHTLNNLVEK[MT7].3b4_1.heavy 524.298 / 598.307 2091.0 25.907649993896484 40 15 10 5 10 4.897949239073402 20.41670811984938 0.04290008544921875 3 0.9591781823972676 6.0873409494824635 2091.0 5.474618181818181 0.0 - - - - - - - 275.0 4 6 TRIM35 tripartite motif-containing 35 2055 260 C20140709_OR011_01 C20140709_OR011_01 TB446981.[MT7]-TNHTLNNLVEK[MT7].3b5_1.heavy 524.298 / 711.391 991.0 25.907649993896484 40 15 10 5 10 4.897949239073402 20.41670811984938 0.04290008544921875 3 0.9591781823972676 6.0873409494824635 991.0 4.034272727272727 5.0 - - - - - - - 0.0 1 0 TRIM35 tripartite motif-containing 35 2057 261 C20140709_OR011_01 C20140709_OR011_01 TB417070.[MT7]-MEIVDDDVPSLWAHGFQDR.4y5_1.heavy 594.287 / 622.294 2836.0 42.66379928588867 44 16 10 10 8 4.736680425220993 21.11183170972199 0.0 4 0.9601627449492899 6.162618187783797 2836.0 29.92655238095238 0.0 - - - - - - - 252.0 5 10 CRYBB3 crystallin, beta B3 2059 261 C20140709_OR011_01 C20140709_OR011_01 TB417070.[MT7]-MEIVDDDVPSLWAHGFQDR.4y7_1.heavy 594.287 / 830.39 1156.0 42.66379928588867 44 16 10 10 8 4.736680425220993 21.11183170972199 0.0 4 0.9601627449492899 6.162618187783797 1156.0 5.614420603451531 1.0 - - - - - - - 180.0 2 7 CRYBB3 crystallin, beta B3 2061 261 C20140709_OR011_01 C20140709_OR011_01 TB417070.[MT7]-MEIVDDDVPSLWAHGFQDR.4y6_1.heavy 594.287 / 759.353 1681.0 42.66379928588867 44 16 10 10 8 4.736680425220993 21.11183170972199 0.0 4 0.9601627449492899 6.162618187783797 1681.0 3.3048236602651277 1.0 - - - - - - - 210.0 8 9 CRYBB3 crystallin, beta B3 2063 261 C20140709_OR011_01 C20140709_OR011_01 TB417070.[MT7]-MEIVDDDVPSLWAHGFQDR.4b3_1.heavy 594.287 / 518.276 4307.0 42.66379928588867 44 16 10 10 8 4.736680425220993 21.11183170972199 0.0 4 0.9601627449492899 6.162618187783797 4307.0 6.10493870790731 0.0 - - - - - - - 643.125 8 8 CRYBB3 crystallin, beta B3 2065 262 C20140709_OR011_01 C20140709_OR011_01 TB417071.[MT7]-LVAWDPAC[CAM]LPLPPPPPAFK[MT7].4y5_1.heavy 594.336 / 703.426 11604.0 48.33709907531738 46 20 10 6 10 7.660760648738335 13.05353405297543 0.031200408935546875 3 0.9954357705801019 18.260527262511953 11604.0 7.8274112086428085 1.0 - - - - - - - 1228.7142857142858 23 7 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 2067 262 C20140709_OR011_01 C20140709_OR011_01 TB417071.[MT7]-LVAWDPAC[CAM]LPLPPPPPAFK[MT7].4y4_1.heavy 594.336 / 606.373 15886.0 48.33709907531738 46 20 10 6 10 7.660760648738335 13.05353405297543 0.031200408935546875 3 0.9954357705801019 18.260527262511953 15886.0 3.3869738651994497 1.0 - - - - - - - 680.0 31 7 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 2069 262 C20140709_OR011_01 C20140709_OR011_01 TB417071.[MT7]-LVAWDPAC[CAM]LPLPPPPPAFK[MT7].4b5_1.heavy 594.336 / 729.405 20287.0 48.33709907531738 46 20 10 6 10 7.660760648738335 13.05353405297543 0.031200408935546875 3 0.9954357705801019 18.260527262511953 20287.0 126.79375 1.0 - - - - - - - 373.3333333333333 40 3 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 2071 262 C20140709_OR011_01 C20140709_OR011_01 TB417071.[MT7]-LVAWDPAC[CAM]LPLPPPPPAFK[MT7].4y6_1.heavy 594.336 / 800.479 7843.0 48.33709907531738 46 20 10 6 10 7.660760648738335 13.05353405297543 0.031200408935546875 3 0.9954357705801019 18.260527262511953 7843.0 19.07204998214923 0.0 - - - - - - - 307.6923076923077 15 13 CEBPB CCAAT/enhancer binding protein (C/EBP), beta 2073 263 C20140709_OR011_01 C20140709_OR011_01 TB416618.[MT7]-IANQVAIQR.2y8_1.heavy 578.85 / 899.506 8002.0 25.274499893188477 42 16 8 10 8 2.720005211737522 36.76463543837132 0.0 4 0.9631764202363087 6.411469604847806 8002.0 89.05404304340995 1.0 - - - - - - - 211.375 21 8 BRD1 bromodomain containing 1 2075 263 C20140709_OR011_01 C20140709_OR011_01 TB416618.[MT7]-IANQVAIQR.2b4_1.heavy 578.85 / 571.332 4395.0 25.274499893188477 42 16 8 10 8 2.720005211737522 36.76463543837132 0.0 4 0.9631764202363087 6.411469604847806 4395.0 29.933388560157795 0.0 - - - - - - - 266.27272727272725 8 11 BRD1 bromodomain containing 1 2077 263 C20140709_OR011_01 C20140709_OR011_01 TB416618.[MT7]-IANQVAIQR.2b5_1.heavy 578.85 / 670.4 3381.0 25.274499893188477 42 16 8 10 8 2.720005211737522 36.76463543837132 0.0 4 0.9631764202363087 6.411469604847806 3381.0 34.42611143111483 0.0 - - - - - - - 187.88888888888889 6 9 BRD1 bromodomain containing 1 2079 263 C20140709_OR011_01 C20140709_OR011_01 TB416618.[MT7]-IANQVAIQR.2y7_1.heavy 578.85 / 828.469 2254.0 25.274499893188477 42 16 8 10 8 2.720005211737522 36.76463543837132 0.0 4 0.9631764202363087 6.411469604847806 2254.0 18.303348693512067 0.0 - - - - - - - 248.0 4 5 BRD1 bromodomain containing 1 2081 264 C20140709_OR011_01 C20140709_OR011_01 TB589647.[MT7]-SLNEHK[MT7].2y4_1.heavy 508.292 / 671.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF595 zinc finger protein 595 2083 264 C20140709_OR011_01 C20140709_OR011_01 TB589647.[MT7]-SLNEHK[MT7].2y5_1.heavy 508.292 / 784.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF595 zinc finger protein 595 2085 264 C20140709_OR011_01 C20140709_OR011_01 TB589647.[MT7]-SLNEHK[MT7].2b4_1.heavy 508.292 / 588.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF595 zinc finger protein 595 2087 264 C20140709_OR011_01 C20140709_OR011_01 TB589647.[MT7]-SLNEHK[MT7].2y3_1.heavy 508.292 / 557.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF595 zinc finger protein 595