Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140709_OR012_04 C20140709_OR012_04 TB416242.[MT7]-DLDEEQAGQTDLEK[MT7].3b6_1.heavy 626.977 / 874.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 3 1 C20140709_OR012_04 C20140709_OR012_04 TB416242.[MT7]-DLDEEQAGQTDLEK[MT7].3y3_1.heavy 626.977 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 5 1 C20140709_OR012_04 C20140709_OR012_04 TB416242.[MT7]-DLDEEQAGQTDLEK[MT7].3b4_1.heavy 626.977 / 617.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 7 1 C20140709_OR012_04 C20140709_OR012_04 TB416242.[MT7]-DLDEEQAGQTDLEK[MT7].3b5_1.heavy 626.977 / 746.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 9 2 C20140709_OR012_04 C20140709_OR012_04 TB416244.[MT7]-LEAGLANTITSFIDK[MT7].2y9_1.heavy 941.032 / 1182.65 2556.0 48.39899826049805 46 16 10 10 10 3.6427303262946396 27.45193605965318 0.0 3 0.9641480482731014 6.498301078285202 2556.0 6.035635062611807 0.0 - - - - - - - 239.8 5 15 GDF5 growth differentiation factor 5 11 2 C20140709_OR012_04 C20140709_OR012_04 TB416244.[MT7]-LEAGLANTITSFIDK[MT7].2b4_1.heavy 941.032 / 515.295 5832.0 48.39899826049805 46 16 10 10 10 3.6427303262946396 27.45193605965318 0.0 3 0.9641480482731014 6.498301078285202 5832.0 40.83704114490162 0.0 - - - - - - - 199.91666666666666 11 12 GDF5 growth differentiation factor 5 13 2 C20140709_OR012_04 C20140709_OR012_04 TB416244.[MT7]-LEAGLANTITSFIDK[MT7].2y6_1.heavy 941.032 / 854.474 3275.0 48.39899826049805 46 16 10 10 10 3.6427303262946396 27.45193605965318 0.0 3 0.9641480482731014 6.498301078285202 3275.0 29.857083333333335 0.0 - - - - - - - 159.9 6 10 GDF5 growth differentiation factor 5 15 2 C20140709_OR012_04 C20140709_OR012_04 TB416244.[MT7]-LEAGLANTITSFIDK[MT7].2b5_1.heavy 941.032 / 628.379 3914.0 48.39899826049805 46 16 10 10 10 3.6427303262946396 27.45193605965318 0.0 3 0.9641480482731014 6.498301078285202 3914.0 31.08320668058455 0.0 - - - - - - - 177.66666666666666 7 9 GDF5 growth differentiation factor 5 17 3 C20140709_OR012_04 C20140709_OR012_04 TB434375.[MT7]-SHQVLAQLLDTLLAIGTK[MT7].3b6_1.heavy 737.11 / 780.448 964.0 54.73699951171875 45 15 10 10 10 1.8269428596784087 38.51046139905708 0.0 3 0.9562402009066159 5.8779803383582925 964.0 -2.586762075134168 0.0 - - - - - - - 0.0 1 0 INTS4 integrator complex subunit 4 19 3 C20140709_OR012_04 C20140709_OR012_04 TB434375.[MT7]-SHQVLAQLLDTLLAIGTK[MT7].3b4_1.heavy 737.11 / 596.327 1790.0 54.73699951171875 45 15 10 10 10 1.8269428596784087 38.51046139905708 0.0 3 0.9562402009066159 5.8779803383582925 1790.0 2.878728377746611 0.0 - - - - - - - 78.0 3 19 INTS4 integrator complex subunit 4 21 3 C20140709_OR012_04 C20140709_OR012_04 TB434375.[MT7]-SHQVLAQLLDTLLAIGTK[MT7].3b5_1.heavy 737.11 / 709.411 1394.0 54.73699951171875 45 15 10 10 10 1.8269428596784087 38.51046139905708 0.0 3 0.9562402009066159 5.8779803383582925 1394.0 6.483720930232558 0.0 - - - - - - - 65.0 2 32 INTS4 integrator complex subunit 4 23 3 C20140709_OR012_04 C20140709_OR012_04 TB434375.[MT7]-SHQVLAQLLDTLLAIGTK[MT7].3y4_1.heavy 737.11 / 562.368 1876.0 54.73699951171875 45 15 10 10 10 1.8269428596784087 38.51046139905708 0.0 3 0.9562402009066159 5.8779803383582925 1876.0 17.557435897435898 0.0 - - - - - - - 60.608695652173914 3 23 INTS4 integrator complex subunit 4 25 4 C20140709_OR012_04 C20140709_OR012_04 TB434371.[MT7]-VVIWNMSPVLQEDDEK[MT7].4y5_1.heavy 548.289 / 779.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 27 4 C20140709_OR012_04 C20140709_OR012_04 TB434371.[MT7]-VVIWNMSPVLQEDDEK[MT7].4y4_1.heavy 548.289 / 650.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 29 4 C20140709_OR012_04 C20140709_OR012_04 TB434371.[MT7]-VVIWNMSPVLQEDDEK[MT7].4b5_1.heavy 548.289 / 756.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 31 4 C20140709_OR012_04 C20140709_OR012_04 TB434371.[MT7]-VVIWNMSPVLQEDDEK[MT7].4y3_1.heavy 548.289 / 535.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 33 5 C20140709_OR012_04 C20140709_OR012_04 TB416347.[MT7]-TPVWNDDTQSYVLNFHGR.3y7_1.heavy 765.042 / 842.463 2176.0 37.252899169921875 44 14 10 10 10 10.797573202921736 9.261340314223645 0.0 3 0.9336715098070149 4.765210275147224 2176.0 23.8 0.0 - - - - - - - 128.0 4 8 TUB tubby homolog (mouse) 35 5 C20140709_OR012_04 C20140709_OR012_04 TB416347.[MT7]-TPVWNDDTQSYVLNFHGR.3y6_1.heavy 765.042 / 743.395 3072.0 37.252899169921875 44 14 10 10 10 10.797573202921736 9.261340314223645 0.0 3 0.9336715098070149 4.765210275147224 3072.0 12.0 0.0 - - - - - - - 237.71428571428572 6 7 TUB tubby homolog (mouse) 37 5 C20140709_OR012_04 C20140709_OR012_04 TB416347.[MT7]-TPVWNDDTQSYVLNFHGR.3b7_1.heavy 765.042 / 972.454 640.0 37.252899169921875 44 14 10 10 10 10.797573202921736 9.261340314223645 0.0 3 0.9336715098070149 4.765210275147224 640.0 2.2833333333333337 4.0 - - - - - - - 0.0 1 0 TUB tubby homolog (mouse) 39 5 C20140709_OR012_04 C20140709_OR012_04 TB416347.[MT7]-TPVWNDDTQSYVLNFHGR.3y5_1.heavy 765.042 / 630.311 3840.0 37.252899169921875 44 14 10 10 10 10.797573202921736 9.261340314223645 0.0 3 0.9336715098070149 4.765210275147224 3840.0 17.849999999999998 0.0 - - - - - - - 224.0 7 8 TUB tubby homolog (mouse) 41 6 C20140709_OR012_04 C20140709_OR012_04 TB416246.[MT7]-GPNTLDDLFQELDK[MT7].3y3_1.heavy 631.666 / 519.326 21506.0 46.45600128173828 43 13 10 10 10 2.905411516501256 34.41853225680803 0.0 3 0.9263701028896479 4.519951752979093 21506.0 72.0224355971897 0.0 - - - - - - - 194.625 43 8 S100G S100 calcium binding protein G 43 6 C20140709_OR012_04 C20140709_OR012_04 TB416246.[MT7]-GPNTLDDLFQELDK[MT7].3y4_1.heavy 631.666 / 648.369 21323.0 46.45600128173828 43 13 10 10 10 2.905411516501256 34.41853225680803 0.0 3 0.9263701028896479 4.519951752979093 21323.0 226.6296994535519 0.0 - - - - - - - 194.625 42 8 S100G S100 calcium binding protein G 45 6 C20140709_OR012_04 C20140709_OR012_04 TB416246.[MT7]-GPNTLDDLFQELDK[MT7].3b8_1.heavy 631.666 / 970.496 26357.0 46.45600128173828 43 13 10 10 10 2.905411516501256 34.41853225680803 0.0 3 0.9263701028896479 4.519951752979093 26357.0 117.57168377719599 0.0 - - - - - - - 201.6 52 5 S100G S100 calcium binding protein G 47 6 C20140709_OR012_04 C20140709_OR012_04 TB416246.[MT7]-GPNTLDDLFQELDK[MT7].3b7_1.heavy 631.666 / 857.412 35051.0 46.45600128173828 43 13 10 10 10 2.905411516501256 34.41853225680803 0.0 3 0.9263701028896479 4.519951752979093 35051.0 153.77864461003477 0.0 - - - - - - - 293.2 70 10 S100G S100 calcium binding protein G 49 7 C20140709_OR012_04 C20140709_OR012_04 TB416145.[MT7]-SLVALLVETQMK[MT7].3b4_1.heavy 540.66 / 515.331 2376.0 47.88224983215332 38 13 10 5 10 1.7851776761889508 56.016833133093456 0.040699005126953125 3 0.9290867180548252 4.606786722763095 2376.0 28.421772151898736 0.0 - - - - - - - 184.66666666666666 4 3 SMARCC1;SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 51 7 C20140709_OR012_04 C20140709_OR012_04 TB416145.[MT7]-SLVALLVETQMK[MT7].3b5_1.heavy 540.66 / 628.415 2217.0 47.88224983215332 38 13 10 5 10 1.7851776761889508 56.016833133093456 0.040699005126953125 3 0.9290867180548252 4.606786722763095 2217.0 14.255584963559647 1.0 - - - - - - - 98.75 4 4 SMARCC1;SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 53 7 C20140709_OR012_04 C20140709_OR012_04 TB416145.[MT7]-SLVALLVETQMK[MT7].3y4_1.heavy 540.66 / 651.362 1584.0 47.88224983215332 38 13 10 5 10 1.7851776761889508 56.016833133093456 0.040699005126953125 3 0.9290867180548252 4.606786722763095 1584.0 28.37164556962025 0.0 - - - - - - - 174.0 3 5 SMARCC1;SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 55 7 C20140709_OR012_04 C20140709_OR012_04 TB416145.[MT7]-SLVALLVETQMK[MT7].3y5_1.heavy 540.66 / 780.404 713.0 47.88224983215332 38 13 10 5 10 1.7851776761889508 56.016833133093456 0.040699005126953125 3 0.9290867180548252 4.606786722763095 713.0 13.447721518987342 0.0 - - - - - - - 0.0 1 0 SMARCC1;SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 57 8 C20140709_OR012_04 C20140709_OR012_04 TB415873.[MT7]-LTTSYLK[MT7].2y4_1.heavy 557.342 / 654.394 26636.0 27.948350429534912 40 14 10 6 10 1.2740364589780215 46.60801808120597 0.03899955749511719 3 0.9498114743225206 5.485633887946263 26636.0 223.3601793721973 0.0 - - - - - - - 236.75 53 8 SIM1;SIM2 single-minded homolog 1 (Drosophila);single-minded homolog 2 (Drosophila) 59 8 C20140709_OR012_04 C20140709_OR012_04 TB415873.[MT7]-LTTSYLK[MT7].2b4_1.heavy 557.342 / 547.321 12148.0 27.948350429534912 40 14 10 6 10 1.2740364589780215 46.60801808120597 0.03899955749511719 3 0.9498114743225206 5.485633887946263 12148.0 31.994482465217885 0.0 - - - - - - - 654.75 24 8 SIM1;SIM2 single-minded homolog 1 (Drosophila);single-minded homolog 2 (Drosophila) 61 8 C20140709_OR012_04 C20140709_OR012_04 TB415873.[MT7]-LTTSYLK[MT7].2y3_1.heavy 557.342 / 567.362 21175.0 27.948350429534912 40 14 10 6 10 1.2740364589780215 46.60801808120597 0.03899955749511719 3 0.9498114743225206 5.485633887946263 21175.0 65.05645624928135 0.0 - - - - - - - 210.33333333333334 42 9 SIM1;SIM2 single-minded homolog 1 (Drosophila);single-minded homolog 2 (Drosophila) 63 8 C20140709_OR012_04 C20140709_OR012_04 TB415873.[MT7]-LTTSYLK[MT7].2b5_1.heavy 557.342 / 710.384 9919.0 27.948350429534912 40 14 10 6 10 1.2740364589780215 46.60801808120597 0.03899955749511719 3 0.9498114743225206 5.485633887946263 9919.0 64.71813901345291 0.0 - - - - - - - 208.75 19 8 SIM1;SIM2 single-minded homolog 1 (Drosophila);single-minded homolog 2 (Drosophila) 65 9 C20140709_OR012_04 C20140709_OR012_04 TB446686.[MT7]-MSVIVPGMNMVHER.3b4_1.heavy 581.966 / 575.334 42238.0 36.794898986816406 46 16 10 10 10 3.182509544162367 31.421743945254967 0.0 3 0.9697558323326252 7.078493833668316 42238.0 57.87071719066778 0.0 - - - - - - - 824.4285714285714 84 7 TUB tubby homolog (mouse) 67 9 C20140709_OR012_04 C20140709_OR012_04 TB446686.[MT7]-MSVIVPGMNMVHER.3b5_1.heavy 581.966 / 674.403 14691.0 36.794898986816406 46 16 10 10 10 3.182509544162367 31.421743945254967 0.0 3 0.9697558323326252 7.078493833668316 14691.0 131.16056444929117 0.0 - - - - - - - 213.125 29 8 TUB tubby homolog (mouse) 69 9 C20140709_OR012_04 C20140709_OR012_04 TB446686.[MT7]-MSVIVPGMNMVHER.3y8_1.heavy 581.966 / 973.434 11674.0 36.794898986816406 46 16 10 10 10 3.182509544162367 31.421743945254967 0.0 3 0.9697558323326252 7.078493833668316 11674.0 53.41282172129161 0.0 - - - - - - - 196.66666666666666 23 6 TUB tubby homolog (mouse) 71 9 C20140709_OR012_04 C20140709_OR012_04 TB446686.[MT7]-MSVIVPGMNMVHER.3y9_1.heavy 581.966 / 1070.49 14954.0 36.794898986816406 46 16 10 10 10 3.182509544162367 31.421743945254967 0.0 3 0.9697558323326252 7.078493833668316 14954.0 91.15810515536171 1.0 - - - - - - - 157.2 36 5 TUB tubby homolog (mouse) 73 10 C20140709_OR012_04 C20140709_OR012_04 TB446684.[MT7]-C[CAM]LQLLGNLGSLEK[MT7].3y3_1.heavy 578.334 / 533.341 3223.0 42.35672569274902 43 17 10 6 10 5.344211889125665 18.711832927784684 0.03929901123046875 3 0.9767834101624998 8.083869975251224 3223.0 -3.7368115942028988 1.0 - - - - - - - 258.75 6 8 INTS4 integrator complex subunit 4 75 10 C20140709_OR012_04 C20140709_OR012_04 TB446684.[MT7]-C[CAM]LQLLGNLGSLEK[MT7].3b3_1.heavy 578.334 / 546.283 12663.0 42.35672569274902 43 17 10 6 10 5.344211889125665 18.711832927784684 0.03929901123046875 3 0.9767834101624998 8.083869975251224 12663.0 -4.713275434243176 0.0 - - - - - - - 191.66666666666666 25 3 INTS4 integrator complex subunit 4 77 10 C20140709_OR012_04 C20140709_OR012_04 TB446684.[MT7]-C[CAM]LQLLGNLGSLEK[MT7].3b7_1.heavy 578.334 / 943.515 1496.0 42.35672569274902 43 17 10 6 10 5.344211889125665 18.711832927784684 0.03929901123046875 3 0.9767834101624998 8.083869975251224 1496.0 -0.6498696785403997 1.0 - - - - - - - 306.6666666666667 4 3 INTS4 integrator complex subunit 4 79 10 C20140709_OR012_04 C20140709_OR012_04 TB446684.[MT7]-C[CAM]LQLLGNLGSLEK[MT7].3y5_1.heavy 578.334 / 677.395 10360.0 42.35672569274902 43 17 10 6 10 5.344211889125665 18.711832927784684 0.03929901123046875 3 0.9767834101624998 8.083869975251224 10360.0 -3.8560794044665023 0.0 - - - - - - - 287.5 20 6 INTS4 integrator complex subunit 4 81 11 C20140709_OR012_04 C20140709_OR012_04 TB434236.[MT7]-LQALANALLEK[MT7].2y8_1.heavy 736.458 / 1015.63 1851.0 44.63840103149414 48 18 10 10 10 3.7578607625015836 21.26245993297473 0.0 3 0.9865522391164088 10.63039704157575 1851.0 5.758698630136986 1.0 - - - - - - - 216.33333333333334 3 9 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 83 11 C20140709_OR012_04 C20140709_OR012_04 TB434236.[MT7]-LQALANALLEK[MT7].2b4_1.heavy 736.458 / 570.373 3313.0 44.63840103149414 48 18 10 10 10 3.7578607625015836 21.26245993297473 0.0 3 0.9865522391164088 10.63039704157575 3313.0 42.95427544277029 0.0 - - - - - - - 194.66666666666666 6 12 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 85 11 C20140709_OR012_04 C20140709_OR012_04 TB434236.[MT7]-LQALANALLEK[MT7].2y3_1.heavy 736.458 / 533.341 2533.0 44.63840103149414 48 18 10 10 10 3.7578607625015836 21.26245993297473 0.0 3 0.9865522391164088 10.63039704157575 2533.0 14.223769230769232 0.0 - - - - - - - 243.5 5 10 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 87 11 C20140709_OR012_04 C20140709_OR012_04 TB434236.[MT7]-LQALANALLEK[MT7].2b7_1.heavy 736.458 / 826.49 2533.0 44.63840103149414 48 18 10 10 10 3.7578607625015836 21.26245993297473 0.0 3 0.9865522391164088 10.63039704157575 2533.0 9.645506680543445 0.0 - - - - - - - 238.11111111111111 5 9 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 89 12 C20140709_OR012_04 C20140709_OR012_04 TB446682.[MT7]-TVEEVTVERNEK[MT7].3y7_1.heavy 574.315 / 1019.56 3410.0 22.873600006103516 47 17 10 10 10 3.1019696209661425 25.738881178540385 0.0 3 0.9703988334568763 7.155348533957215 3410.0 18.91 0.0 - - - - - - - 256.6666666666667 6 6 TJP1 tight junction protein 1 (zona occludens 1) 91 12 C20140709_OR012_04 C20140709_OR012_04 TB446682.[MT7]-TVEEVTVERNEK[MT7].3y3_1.heavy 574.315 / 534.3 3960.0 22.873600006103516 47 17 10 10 10 3.1019696209661425 25.738881178540385 0.0 3 0.9703988334568763 7.155348533957215 3960.0 15.911999999999999 0.0 - - - - - - - 281.1111111111111 7 9 TJP1 tight junction protein 1 (zona occludens 1) 93 12 C20140709_OR012_04 C20140709_OR012_04 TB446682.[MT7]-TVEEVTVERNEK[MT7].3b4_1.heavy 574.315 / 603.311 4070.0 22.873600006103516 47 17 10 10 10 3.1019696209661425 25.738881178540385 0.0 3 0.9703988334568763 7.155348533957215 4070.0 20.646 0.0 - - - - - - - 204.28571428571428 8 7 TJP1 tight junction protein 1 (zona occludens 1) 95 12 C20140709_OR012_04 C20140709_OR012_04 TB446682.[MT7]-TVEEVTVERNEK[MT7].3b5_1.heavy 574.315 / 702.379 990.0 22.873600006103516 47 17 10 10 10 3.1019696209661425 25.738881178540385 0.0 3 0.9703988334568763 7.155348533957215 990.0 8.235 2.0 - - - - - - - 247.5 2 8 TJP1 tight junction protein 1 (zona occludens 1) 97 13 C20140709_OR012_04 C20140709_OR012_04 TB446816.[MT7]-LEPGEDFAVVQQEIIMMK[MT7].4y4_1.heavy 592.065 / 666.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 99 13 C20140709_OR012_04 C20140709_OR012_04 TB446816.[MT7]-LEPGEDFAVVQQEIIMMK[MT7].4b8_1.heavy 592.065 / 1003.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 101 13 C20140709_OR012_04 C20140709_OR012_04 TB446816.[MT7]-LEPGEDFAVVQQEIIMMK[MT7].4y3_1.heavy 592.065 / 553.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 103 13 C20140709_OR012_04 C20140709_OR012_04 TB446816.[MT7]-LEPGEDFAVVQQEIIMMK[MT7].4b6_1.heavy 592.065 / 785.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 105 14 C20140709_OR012_04 C20140709_OR012_04 TB446815.[MT7]-SLEDIMVSAPQTPTHGALAK[MT7].3b6_1.heavy 785.426 / 833.419 2626.0 35.91709899902344 47 17 10 10 10 4.41338042157573 22.658368517503988 0.0 3 0.9762045450064701 7.984549085400303 2626.0 -0.020045801526716645 0.0 - - - - - - - 175.0 5 3 C17orf53 chromosome 17 open reading frame 53 107 14 C20140709_OR012_04 C20140709_OR012_04 TB446815.[MT7]-SLEDIMVSAPQTPTHGALAK[MT7].3b4_1.heavy 785.426 / 589.295 4727.0 35.91709899902344 47 17 10 10 10 4.41338042157573 22.658368517503988 0.0 3 0.9762045450064701 7.984549085400303 4727.0 40.75656876041384 0.0 - - - - - - - 262.6666666666667 9 6 C17orf53 chromosome 17 open reading frame 53 109 14 C20140709_OR012_04 C20140709_OR012_04 TB446815.[MT7]-SLEDIMVSAPQTPTHGALAK[MT7].3b5_1.heavy 785.426 / 702.379 1838.0 35.91709899902344 47 17 10 10 10 4.41338042157573 22.658368517503988 0.0 3 0.9762045450064701 7.984549085400303 1838.0 9.579697265978634 0.0 - - - - - - - 219.0 3 3 C17orf53 chromosome 17 open reading frame 53 111 14 C20140709_OR012_04 C20140709_OR012_04 TB446815.[MT7]-SLEDIMVSAPQTPTHGALAK[MT7].3y5_1.heavy 785.426 / 603.395 2363.0 35.91709899902344 47 17 10 10 10 4.41338042157573 22.658368517503988 0.0 3 0.9762045450064701 7.984549085400303 2363.0 -0.17992385786802068 0.0 - - - - - - - 218.66666666666666 4 3 C17orf53 chromosome 17 open reading frame 53 113 15 C20140709_OR012_04 C20140709_OR012_04 TB446817.[MT7]-TLAGLVVQLLQFQEDAFGK[MT7].4b8_1.heavy 592.09 / 926.579 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC1 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 115 15 C20140709_OR012_04 C20140709_OR012_04 TB446817.[MT7]-TLAGLVVQLLQFQEDAFGK[MT7].4y4_1.heavy 592.09 / 566.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC1 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 117 15 C20140709_OR012_04 C20140709_OR012_04 TB446817.[MT7]-TLAGLVVQLLQFQEDAFGK[MT7].4b5_1.heavy 592.09 / 600.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC1 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 119 15 C20140709_OR012_04 C20140709_OR012_04 TB446817.[MT7]-TLAGLVVQLLQFQEDAFGK[MT7].4b6_1.heavy 592.09 / 699.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC1 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 121 16 C20140709_OR012_04 C20140709_OR012_04 TB416046.[MT7]-NVNTGELAAIK[MT7].3y3_1.heavy 473.28 / 475.336 4862.0 30.40244960784912 29 12 4 5 8 1.4801714026798178 53.36921245300667 0.04170036315917969 4 0.8891752465540034 3.672391940707891 4862.0 59.32215792646173 1.0 - - - - - - - 237.28571428571428 17 7 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 123 16 C20140709_OR012_04 C20140709_OR012_04 TB416046.[MT7]-NVNTGELAAIK[MT7].3b6_1.heavy 473.28 / 759.375 2846.0 30.40244960784912 29 12 4 5 8 1.4801714026798178 53.36921245300667 0.04170036315917969 4 0.8891752465540034 3.672391940707891 2846.0 24.19830765639589 1.0 - - - - - - - 197.66666666666666 5 3 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 125 16 C20140709_OR012_04 C20140709_OR012_04 TB416046.[MT7]-NVNTGELAAIK[MT7].3b5_1.heavy 473.28 / 630.333 593.0 30.40244960784912 29 12 4 5 8 1.4801714026798178 53.36921245300667 0.04170036315917969 4 0.8891752465540034 3.672391940707891 593.0 1.5827952401270562 8.0 - - - - - - - 229.46666666666667 4 15 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 127 16 C20140709_OR012_04 C20140709_OR012_04 TB416046.[MT7]-NVNTGELAAIK[MT7].3y4_1.heavy 473.28 / 546.373 2253.0 30.40244960784912 29 12 4 5 8 1.4801714026798178 53.36921245300667 0.04170036315917969 4 0.8891752465540034 3.672391940707891 2253.0 15.21012658227848 0.0 - - - - - - - 178.125 4 8 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 129 17 C20140709_OR012_04 C20140709_OR012_04 TB446541.[MT7]-SFTTVYNLK[MT7].3y3_1.heavy 454.262 / 518.342 4519.0 34.276100158691406 47 17 10 10 10 5.153569215342765 19.404027737182332 0.0 3 0.9717185497755573 7.321206277455381 4519.0 39.95959664856217 0.0 - - - - - - - 219.875 9 8 ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 131 17 C20140709_OR012_04 C20140709_OR012_04 TB446541.[MT7]-SFTTVYNLK[MT7].3b4_1.heavy 454.262 / 581.305 3013.0 34.276100158691406 47 17 10 10 10 5.153569215342765 19.404027737182332 0.0 3 0.9717185497755573 7.321206277455381 3013.0 33.283427559602856 0.0 - - - - - - - 167.66666666666666 6 6 ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 133 17 C20140709_OR012_04 C20140709_OR012_04 TB446541.[MT7]-SFTTVYNLK[MT7].3b5_1.heavy 454.262 / 680.374 1758.0 34.276100158691406 47 17 10 10 10 5.153569215342765 19.404027737182332 0.0 3 0.9717185497755573 7.321206277455381 1758.0 -5.603187250996016 0.0 - - - - - - - 188.5 3 2 ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 135 17 C20140709_OR012_04 C20140709_OR012_04 TB446541.[MT7]-SFTTVYNLK[MT7].3y4_1.heavy 454.262 / 681.405 1381.0 34.276100158691406 47 17 10 10 10 5.153569215342765 19.404027737182332 0.0 3 0.9717185497755573 7.321206277455381 1381.0 9.903585657370519 0.0 - - - - - - - 201.2 2 5 ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 137 18 C20140709_OR012_04 C20140709_OR012_04 TB416041.[MT7]-MLVMQDPIYR.3b4_1.heavy 470.585 / 619.343 861.0 38.15842533111572 45 20 10 5 10 6.785567680450214 14.737160501413658 0.043102264404296875 3 0.9950127108621716 17.468251453363134 861.0 7.3149999999999995 1.0 - - - - - - - 0.0 1 0 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 139 18 C20140709_OR012_04 C20140709_OR012_04 TB416041.[MT7]-MLVMQDPIYR.3b3_1.heavy 470.585 / 488.302 2953.0 38.15842533111572 45 20 10 5 10 6.785567680450214 14.737160501413658 0.043102264404296875 3 0.9950127108621716 17.468251453363134 2953.0 6.202168021680217 1.0 - - - - - - - 266.5 5 6 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 141 18 C20140709_OR012_04 C20140709_OR012_04 TB416041.[MT7]-MLVMQDPIYR.3y4_1.heavy 470.585 / 548.319 3568.0 38.15842533111572 45 20 10 5 10 6.785567680450214 14.737160501413658 0.043102264404296875 3 0.9950127108621716 17.468251453363134 3568.0 55.69560975609756 0.0 - - - - - - - 287.0 7 3 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 143 18 C20140709_OR012_04 C20140709_OR012_04 TB416041.[MT7]-MLVMQDPIYR.3y5_1.heavy 470.585 / 663.346 246.0 38.15842533111572 45 20 10 5 10 6.785567680450214 14.737160501413658 0.043102264404296875 3 0.9950127108621716 17.468251453363134 246.0 3.2 10.0 - - - - - - - 0.0 0 0 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 145 19 C20140709_OR012_04 C20140709_OR012_04 TB446587.[MT7]-TVYEYLFSQR.2y8_1.heavy 725.378 / 1105.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 147 19 C20140709_OR012_04 C20140709_OR012_04 TB446587.[MT7]-TVYEYLFSQR.2b4_1.heavy 725.378 / 637.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 149 19 C20140709_OR012_04 C20140709_OR012_04 TB446587.[MT7]-TVYEYLFSQR.2y9_1.heavy 725.378 / 1204.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 151 19 C20140709_OR012_04 C20140709_OR012_04 TB446587.[MT7]-TVYEYLFSQR.2y6_1.heavy 725.378 / 813.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 153 20 C20140709_OR012_04 C20140709_OR012_04 TB416330.[MT7]-GRDQTLEALEAELQATAK[MT7].4y4_1.heavy 558.807 / 534.337 15462.0 40.68360137939453 41 11 10 10 10 1.2012340532295016 57.59538549789187 0.0 3 0.8683735042308364 3.3636257903092015 15462.0 47.483171019934844 0.0 - - - - - - - 341.25 30 8 RNF112 ring finger protein 112 155 20 C20140709_OR012_04 C20140709_OR012_04 TB416330.[MT7]-GRDQTLEALEAELQATAK[MT7].4b8_1.heavy 558.807 / 1015.53 3752.0 40.68360137939453 41 11 10 10 10 1.2012340532295016 57.59538549789187 0.0 3 0.8683735042308364 3.3636257903092015 3752.0 60.558596491228066 0.0 - - - - - - - 204.8 7 5 RNF112 ring finger protein 112 157 20 C20140709_OR012_04 C20140709_OR012_04 TB416330.[MT7]-GRDQTLEALEAELQATAK[MT7].4b8_2.heavy 558.807 / 508.268 13415.0 40.68360137939453 41 11 10 10 10 1.2012340532295016 57.59538549789187 0.0 3 0.8683735042308364 3.3636257903092015 13415.0 35.29093870917814 0.0 - - - - - - - 265.1666666666667 26 6 RNF112 ring finger protein 112 159 20 C20140709_OR012_04 C20140709_OR012_04 TB416330.[MT7]-GRDQTLEALEAELQATAK[MT7].4b10_2.heavy 558.807 / 629.331 23193.0 40.68360137939453 41 11 10 10 10 1.2012340532295016 57.59538549789187 0.0 3 0.8683735042308364 3.3636257903092015 23193.0 119.48936592922496 0.0 - - - - - - - 290.44444444444446 46 9 RNF112 ring finger protein 112 161 21 C20140709_OR012_04 C20140709_OR012_04 TB434387.[MT7]-LEPGEDFAVVQQEIIMMK[MT7].2b8_1.heavy 1183.12 / 1003.49 926.0 48.24620056152344 48 18 10 10 10 5.107714944915733 19.578226482576312 0.0 3 0.9889425505978559 11.725568096961915 926.0 20.945238095238096 0.0 - - - - - - - 0.0 1 0 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 163 21 C20140709_OR012_04 C20140709_OR012_04 TB434387.[MT7]-LEPGEDFAVVQQEIIMMK[MT7].2b6_1.heavy 1183.12 / 785.38 674.0 48.24620056152344 48 18 10 10 10 5.107714944915733 19.578226482576312 0.0 3 0.9889425505978559 11.725568096961915 674.0 15.806904761904761 0.0 - - - - - - - 0.0 1 0 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 165 21 C20140709_OR012_04 C20140709_OR012_04 TB434387.[MT7]-LEPGEDFAVVQQEIIMMK[MT7].2y3_1.heavy 1183.12 / 553.296 1010.0 48.24620056152344 48 18 10 10 10 5.107714944915733 19.578226482576312 0.0 3 0.9889425505978559 11.725568096961915 1010.0 17.975595238095238 0.0 - - - - - - - 218.8 2 5 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 167 21 C20140709_OR012_04 C20140709_OR012_04 TB434387.[MT7]-LEPGEDFAVVQQEIIMMK[MT7].2b10_1.heavy 1183.12 / 1201.62 337.0 48.24620056152344 48 18 10 10 10 5.107714944915733 19.578226482576312 0.0 3 0.9889425505978559 11.725568096961915 337.0 3.6107142857142858 12.0 - - - - - - - 0.0 1 0 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 169 22 C20140709_OR012_04 C20140709_OR012_04 TB416438.[MT7]-EAASAPSPTAPEQPVDVEVQDLEEFALRPAPQGITIK[MT7].4b5_1.heavy 1048.05 / 574.295 1982.0 47.30587673187256 37 16 10 1 10 1.4903360834032666 42.51825635969022 0.09090042114257812 3 0.9689713292919104 6.987975540813933 1982.0 30.500777777777778 0.0 - - - - - - - 170.0 3 9 TUB tubby homolog (mouse) 171 22 C20140709_OR012_04 C20140709_OR012_04 TB416438.[MT7]-EAASAPSPTAPEQPVDVEVQDLEEFALRPAPQGITIK[MT7].4b7_1.heavy 1048.05 / 758.38 631.0 47.30587673187256 37 16 10 1 10 1.4903360834032666 42.51825635969022 0.09090042114257812 3 0.9689713292919104 6.987975540813933 631.0 3.739259259259259 2.0 - - - - - - - 0.0 1 0 TUB tubby homolog (mouse) 173 22 C20140709_OR012_04 C20140709_OR012_04 TB416438.[MT7]-EAASAPSPTAPEQPVDVEVQDLEEFALRPAPQGITIK[MT7].4y9_1.heavy 1048.05 / 1068.65 721.0 47.30587673187256 37 16 10 1 10 1.4903360834032666 42.51825635969022 0.09090042114257812 3 0.9689713292919104 6.987975540813933 721.0 10.01388888888889 1.0 - - - - - - - 0.0 1 0 TUB tubby homolog (mouse) 175 22 C20140709_OR012_04 C20140709_OR012_04 TB416438.[MT7]-EAASAPSPTAPEQPVDVEVQDLEEFALRPAPQGITIK[MT7].4b4_1.heavy 1048.05 / 503.258 631.0 47.30587673187256 37 16 10 1 10 1.4903360834032666 42.51825635969022 0.09090042114257812 3 0.9689713292919104 6.987975540813933 631.0 0.05823704497501672 3.0 - - - - - - - 0.0 1 0 TUB tubby homolog (mouse) 177 23 C20140709_OR012_04 C20140709_OR012_04 TB416130.[MT7]-NTESIIELQNK[MT7].3b6_1.heavy 526.298 / 802.443 3857.0 31.015199661254883 47 17 10 10 10 3.117446342656575 32.07753687102233 0.0 3 0.9734667310185319 7.559655647346611 3857.0 23.138374750693472 0.0 - - - - - - - 275.7142857142857 7 7 TUB tubby homolog (mouse) 179 23 C20140709_OR012_04 C20140709_OR012_04 TB416130.[MT7]-NTESIIELQNK[MT7].3b4_1.heavy 526.298 / 576.275 13860.0 31.015199661254883 47 17 10 10 10 3.117446342656575 32.07753687102233 0.0 3 0.9734667310185319 7.559655647346611 13860.0 139.44801607232546 0.0 - - - - - - - 241.375 27 8 TUB tubby homolog (mouse) 181 23 C20140709_OR012_04 C20140709_OR012_04 TB416130.[MT7]-NTESIIELQNK[MT7].3b5_1.heavy 526.298 / 689.359 12534.0 31.015199661254883 47 17 10 10 10 3.117446342656575 32.07753687102233 0.0 3 0.9734667310185319 7.559655647346611 12534.0 56.558306549597674 0.0 - - - - - - - 254.77777777777777 25 9 TUB tubby homolog (mouse) 183 23 C20140709_OR012_04 C20140709_OR012_04 TB416130.[MT7]-NTESIIELQNK[MT7].3y4_1.heavy 526.298 / 646.4 8195.0 31.015199661254883 47 17 10 10 10 3.117446342656575 32.07753687102233 0.0 3 0.9734667310185319 7.559655647346611 8195.0 29.416313300933037 2.0 - - - - - - - 256.5 16 8 TUB tubby homolog (mouse) 185 24 C20140709_OR012_04 C20140709_OR012_04 TB434382.[MT7]-LSPISILFIDSANNVVYK[MT7].3y3_1.heavy 761.106 / 553.347 1990.0 51.64659881591797 40 10 10 10 10 0.7520783691313466 69.03437469810747 0.0 3 0.8319674580292876 2.9674803165609602 1990.0 39.76711951532954 0.0 - - - - - - - 216.26666666666668 3 15 GDF5 growth differentiation factor 5 187 24 C20140709_OR012_04 C20140709_OR012_04 TB434382.[MT7]-LSPISILFIDSANNVVYK[MT7].3b6_1.heavy 761.106 / 755.478 785.0 51.64659881591797 40 10 10 10 10 0.7520783691313466 69.03437469810747 0.0 3 0.8319674580292876 2.9674803165609602 785.0 1.707824427480916 1.0 - - - - - - - 0.0 1 0 GDF5 growth differentiation factor 5 189 24 C20140709_OR012_04 C20140709_OR012_04 TB434382.[MT7]-LSPISILFIDSANNVVYK[MT7].3b5_1.heavy 761.106 / 642.394 524.0 51.64659881591797 40 10 10 10 10 0.7520783691313466 69.03437469810747 0.0 3 0.8319674580292876 2.9674803165609602 524.0 6.09554431533379 1.0 - - - - - - - 0.0 1 0 GDF5 growth differentiation factor 5 191 24 C20140709_OR012_04 C20140709_OR012_04 TB434382.[MT7]-LSPISILFIDSANNVVYK[MT7].3b7_1.heavy 761.106 / 868.562 733.0 51.64659881591797 40 10 10 10 10 0.7520783691313466 69.03437469810747 0.0 3 0.8319674580292876 2.9674803165609602 733.0 14.347550220480157 1.0 - - - - - - - 0.0 1 0 GDF5 growth differentiation factor 5 193 25 C20140709_OR012_04 C20140709_OR012_04 TB416337.[MT7]-DHQHGEILTQVPDDMLK[MT7].3b6_1.heavy 755.391 / 848.377 788.0 35.75210094451904 28 5 10 5 8 0.36601600475046925 115.08556888773069 0.044399261474609375 4 0.6431244488357468 2.001008440546681 788.0 -2.406106870229008 1.0 - - - - - - - 197.0 2 6 ZNF625 zinc finger protein 625 195 25 C20140709_OR012_04 C20140709_OR012_04 TB416337.[MT7]-DHQHGEILTQVPDDMLK[MT7].3y3_1.heavy 755.391 / 535.339 7220.0 35.75210094451904 28 5 10 5 8 0.36601600475046925 115.08556888773069 0.044399261474609375 4 0.6431244488357468 2.001008440546681 7220.0 14.123094270228416 0.0 - - - - - - - 131.0 14 1 ZNF625 zinc finger protein 625 197 25 C20140709_OR012_04 C20140709_OR012_04 TB416337.[MT7]-DHQHGEILTQVPDDMLK[MT7].3y6_1.heavy 755.391 / 862.446 1969.0 35.75210094451904 28 5 10 5 8 0.36601600475046925 115.08556888773069 0.044399261474609375 4 0.6431244488357468 2.001008440546681 1969.0 -0.7500952380952377 1.0 - - - - - - - 656.2857142857143 13 7 ZNF625 zinc finger protein 625 199 25 C20140709_OR012_04 C20140709_OR012_04 TB416337.[MT7]-DHQHGEILTQVPDDMLK[MT7].3b3_1.heavy 755.391 / 525.254 12734.0 35.75210094451904 28 5 10 5 8 0.36601600475046925 115.08556888773069 0.044399261474609375 4 0.6431244488357468 2.001008440546681 12734.0 25.872253968253972 1.0 - - - - - - - 236.4 25 5 ZNF625 zinc finger protein 625 201 26 C20140709_OR012_04 C20140709_OR012_04 TB416334.[MT7]-K[MT7]RQEPLMVQANADGRPR.4b7_2.heavy 564.316 / 586.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - TUB tubby homolog (mouse) 203 26 C20140709_OR012_04 C20140709_OR012_04 TB416334.[MT7]-K[MT7]RQEPLMVQANADGRPR.4y13_2.heavy 564.316 / 712.875 N/A N/A - - - - - - - - - 0.0 - - - - - - - TUB tubby homolog (mouse) 205 26 C20140709_OR012_04 C20140709_OR012_04 TB416334.[MT7]-K[MT7]RQEPLMVQANADGRPR.4b9_2.heavy 564.316 / 699.91 N/A N/A - - - - - - - - - 0.0 - - - - - - - TUB tubby homolog (mouse) 207 26 C20140709_OR012_04 C20140709_OR012_04 TB416334.[MT7]-K[MT7]RQEPLMVQANADGRPR.4b6_2.heavy 564.316 / 520.826 N/A N/A - - - - - - - - - 0.0 - - - - - - - TUB tubby homolog (mouse) 209 27 C20140709_OR012_04 C20140709_OR012_04 TB416134.[MT7]-QDPSVLHTEEMR.3b6_1.heavy 529.264 / 784.432 9405.0 24.817800521850586 47 17 10 10 10 3.483736380230697 28.70481261655564 0.0 3 0.9764867900608973 8.032518700021114 9405.0 44.99744036918784 0.0 - - - - - - - 244.0 18 3 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 211 27 C20140709_OR012_04 C20140709_OR012_04 TB416134.[MT7]-QDPSVLHTEEMR.3y6_1.heavy 529.264 / 802.351 10504.0 24.817800521850586 47 17 10 10 10 3.483736380230697 28.70481261655564 0.0 3 0.9764867900608973 8.032518700021114 10504.0 164.447868852459 0.0 - - - - - - - 183.0 21 4 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 213 27 C20140709_OR012_04 C20140709_OR012_04 TB416134.[MT7]-QDPSVLHTEEMR.3b4_1.heavy 529.264 / 572.28 10504.0 24.817800521850586 47 17 10 10 10 3.483736380230697 28.70481261655564 0.0 3 0.9764867900608973 8.032518700021114 10504.0 20.10489252814739 0.0 - - - - - - - 271.22222222222223 21 9 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 215 27 C20140709_OR012_04 C20140709_OR012_04 TB416134.[MT7]-QDPSVLHTEEMR.3y5_1.heavy 529.264 / 665.292 23207.0 24.817800521850586 47 17 10 10 10 3.483736380230697 28.70481261655564 0.0 3 0.9764867900608973 8.032518700021114 23207.0 125.67287978142076 0.0 - - - - - - - 209.14285714285714 46 7 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 217 28 C20140709_OR012_04 C20140709_OR012_04 TB416133.[MT7]-DMLQHISLLVK[MT7].3y3_1.heavy 528.984 / 503.367 7462.0 40.02389907836914 45 15 10 10 10 2.3980056316836245 32.69974328024899 0.0 3 0.9536534124858425 5.710336648384501 7462.0 34.33840707964602 0.0 - - - - - - - 316.4 14 5 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 219 28 C20140709_OR012_04 C20140709_OR012_04 TB416133.[MT7]-DMLQHISLLVK[MT7].3b4_1.heavy 528.984 / 632.319 12098.0 40.02389907836914 45 15 10 10 10 2.3980056316836245 32.69974328024899 0.0 3 0.9536534124858425 5.710336648384501 12098.0 65.66466076696165 0.0 - - - - - - - 271.2 24 5 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 221 28 C20140709_OR012_04 C20140709_OR012_04 TB416133.[MT7]-DMLQHISLLVK[MT7].3b3_1.heavy 528.984 / 504.261 7010.0 40.02389907836914 45 15 10 10 10 2.3980056316836245 32.69974328024899 0.0 3 0.9536534124858425 5.710336648384501 7010.0 57.6929203539823 0.0 - - - - - - - 211.875 14 8 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 223 28 C20140709_OR012_04 C20140709_OR012_04 TB416133.[MT7]-DMLQHISLLVK[MT7].3y5_1.heavy 528.984 / 703.483 12550.0 40.02389907836914 45 15 10 10 10 2.3980056316836245 32.69974328024899 0.0 3 0.9536534124858425 5.710336648384501 12550.0 124.38938053097345 0.0 - - - - - - - 226.0 25 10 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 225 29 C20140709_OR012_04 C20140709_OR012_04 TB416430.[MT7]-ATSPADALQYLLQFARK[MT7]PVEAESVEGVVR.4b8_1.heavy 858.974 / 871.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 227 29 C20140709_OR012_04 C20140709_OR012_04 TB416430.[MT7]-ATSPADALQYLLQFARK[MT7]PVEAESVEGVVR.4b7_1.heavy 858.974 / 758.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 229 29 C20140709_OR012_04 C20140709_OR012_04 TB416430.[MT7]-ATSPADALQYLLQFARK[MT7]PVEAESVEGVVR.4y20_2.heavy 858.974 / 1217.68 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 231 29 C20140709_OR012_04 C20140709_OR012_04 TB416430.[MT7]-ATSPADALQYLLQFARK[MT7]PVEAESVEGVVR.4b6_1.heavy 858.974 / 687.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 233 30 C20140709_OR012_04 C20140709_OR012_04 TB434241.[MT7]-QHRK[MT7]PGPLK[MT7].2b3_1.heavy 746.975 / 566.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - TUB tubby homolog (mouse) 235 30 C20140709_OR012_04 C20140709_OR012_04 TB434241.[MT7]-QHRK[MT7]PGPLK[MT7].2y8_1.heavy 746.975 / 1220.78 N/A N/A - - - - - - - - - 0.0 - - - - - - - TUB tubby homolog (mouse) 237 30 C20140709_OR012_04 C20140709_OR012_04 TB434241.[MT7]-QHRK[MT7]PGPLK[MT7].2y5_1.heavy 746.975 / 655.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - TUB tubby homolog (mouse) 239 30 C20140709_OR012_04 C20140709_OR012_04 TB434241.[MT7]-QHRK[MT7]PGPLK[MT7].2y3_1.heavy 746.975 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - TUB tubby homolog (mouse) 241 31 C20140709_OR012_04 C20140709_OR012_04 TB415863.[MT7]-VMNLISK[MT7].2y4_1.heavy 546.838 / 604.415 2237.0 33.396300315856934 44 18 10 6 10 6.987147962507526 14.311991178173406 0.039600372314453125 3 0.9853945147068474 10.199393855167855 2237.0 17.99342896647079 0.0 - - - - - - - 230.375 4 8 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 243 31 C20140709_OR012_04 C20140709_OR012_04 TB415863.[MT7]-VMNLISK[MT7].2y5_1.heavy 546.838 / 718.458 4079.0 33.396300315856934 44 18 10 6 10 6.987147962507526 14.311991178173406 0.039600372314453125 3 0.9853945147068474 10.199393855167855 4079.0 4.652851711026616 1.0 - - - - - - - 207.0 8 7 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 245 31 C20140709_OR012_04 C20140709_OR012_04 TB415863.[MT7]-VMNLISK[MT7].2b4_1.heavy 546.838 / 602.345 7238.0 33.396300315856934 44 18 10 6 10 6.987147962507526 14.311991178173406 0.039600372314453125 3 0.9853945147068474 10.199393855167855 7238.0 30.81819490934827 0.0 - - - - - - - 225.71428571428572 14 7 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 247 31 C20140709_OR012_04 C20140709_OR012_04 TB415863.[MT7]-VMNLISK[MT7].2y6_1.heavy 546.838 / 849.498 9475.0 33.396300315856934 44 18 10 6 10 6.987147962507526 14.311991178173406 0.039600372314453125 3 0.9853945147068474 10.199393855167855 9475.0 55.93337344178659 0.0 - - - - - - - 244.57142857142858 18 7 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 249 32 C20140709_OR012_04 C20140709_OR012_04 TB415862.[MT7]-LVDVAC[CAM]K[MT7].2y4_1.heavy 546.82 / 621.351 6564.0 27.637749671936035 31 20 0 3 8 11.605468596797708 8.616627511929416 0.07290077209472656 4 0.9953746100356488 18.139305378657607 6564.0 11.800449438202246 1.0 - - - - - - - 250.125 47 8 INTS4 integrator complex subunit 4 251 32 C20140709_OR012_04 C20140709_OR012_04 TB415862.[MT7]-LVDVAC[CAM]K[MT7].2y5_1.heavy 546.82 / 736.378 5451.0 27.637749671936035 31 20 0 3 8 11.605468596797708 8.616627511929416 0.07290077209472656 4 0.9953746100356488 18.139305378657607 5451.0 61.66449263634892 0.0 - - - - - - - 197.55555555555554 10 9 INTS4 integrator complex subunit 4 253 32 C20140709_OR012_04 C20140709_OR012_04 TB415862.[MT7]-LVDVAC[CAM]K[MT7].2y3_1.heavy 546.82 / 522.283 6341.0 27.637749671936035 31 20 0 3 8 11.605468596797708 8.616627511929416 0.07290077209472656 4 0.9953746100356488 18.139305378657607 6341.0 5.701198801198801 1.0 - - - - - - - 312.875 12 16 INTS4 integrator complex subunit 4 255 32 C20140709_OR012_04 C20140709_OR012_04 TB415862.[MT7]-LVDVAC[CAM]K[MT7].2y6_1.heavy 546.82 / 835.446 4672.0 27.637749671936035 31 20 0 3 8 11.605468596797708 8.616627511929416 0.07290077209472656 4 0.9953746100356488 18.139305378657607 4672.0 49.39907965519477 1.0 - - - - - - - 259.44444444444446 48 9 INTS4 integrator complex subunit 4 257 33 C20140709_OR012_04 C20140709_OR012_04 TB416038.[MT7]-GTSGPAALAEDK[MT7].3y3_1.heavy 468.924 / 535.284 1318.0 25.328950881958008 25 14 2 5 4 2.6151227758845295 38.239122431326905 0.04010009765625 7 0.9467800992756232 5.325742615801928 1318.0 1.9064255910987482 2.0 - - - - - - - 259.8333333333333 2 6 TUB tubby homolog (mouse) 259 33 C20140709_OR012_04 C20140709_OR012_04 TB416038.[MT7]-GTSGPAALAEDK[MT7].3b6_1.heavy 468.924 / 615.322 1678.0 25.328950881958008 25 14 2 5 4 2.6151227758845295 38.239122431326905 0.04010009765625 7 0.9467800992756232 5.325742615801928 1678.0 2.910977858727241 3.0 - - - - - - - 222.85714285714286 3 7 TUB tubby homolog (mouse) 261 33 C20140709_OR012_04 C20140709_OR012_04 TB416038.[MT7]-GTSGPAALAEDK[MT7].3y4_1.heavy 468.924 / 606.321 1318.0 25.328950881958008 25 14 2 5 4 2.6151227758845295 38.239122431326905 0.04010009765625 7 0.9467800992756232 5.325742615801928 1318.0 1.0079191206649254 4.0 - - - - - - - 280.0 6 9 TUB tubby homolog (mouse) 263 33 C20140709_OR012_04 C20140709_OR012_04 TB416038.[MT7]-GTSGPAALAEDK[MT7].3b7_1.heavy 468.924 / 686.359 839.0 25.328950881958008 25 14 2 5 4 2.6151227758845295 38.239122431326905 0.04010009765625 7 0.9467800992756232 5.325742615801928 839.0 0.3733296523180536 3.0 - - - - - - - 299.7 2 10 TUB tubby homolog (mouse) 265 34 C20140709_OR012_04 C20140709_OR012_04 TB446671.[MT7]-VSHPQEPMLTASPR.3y7_1.heavy 565.299 / 775.413 8165.0 25.530449867248535 41 15 10 6 10 2.2368352829889298 38.23892544691418 0.03949928283691406 3 0.9586710880987873 6.049621128226971 8165.0 31.14144204851752 0.0 - - - - - - - 353.2857142857143 16 7 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 267 34 C20140709_OR012_04 C20140709_OR012_04 TB446671.[MT7]-VSHPQEPMLTASPR.3y6_1.heavy 565.299 / 644.373 11134.0 25.530449867248535 41 15 10 6 10 2.2368352829889298 38.23892544691418 0.03949928283691406 3 0.9586710880987873 6.049621128226971 11134.0 33.60803361558079 0.0 - - - - - - - 309.25 22 4 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 269 34 C20140709_OR012_04 C20140709_OR012_04 TB446671.[MT7]-VSHPQEPMLTASPR.3y8_1.heavy 565.299 / 872.466 18061.0 25.530449867248535 41 15 10 6 10 2.2368352829889298 38.23892544691418 0.03949928283691406 3 0.9586710880987873 6.049621128226971 18061.0 78.84293869720224 0.0 - - - - - - - 265.0 36 7 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 271 34 C20140709_OR012_04 C20140709_OR012_04 TB446671.[MT7]-VSHPQEPMLTASPR.3y5_1.heavy 565.299 / 531.289 15340.0 25.530449867248535 41 15 10 6 10 2.2368352829889298 38.23892544691418 0.03949928283691406 3 0.9586710880987873 6.049621128226971 15340.0 80.50331961980423 0.0 - - - - - - - 165.11111111111111 30 9 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 273 35 C20140709_OR012_04 C20140709_OR012_04 TB415864.[MT7]-RASVFVK[MT7].2b6_1.heavy 547.85 / 804.485 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 275 35 C20140709_OR012_04 C20140709_OR012_04 TB415864.[MT7]-RASVFVK[MT7].2y3_1.heavy 547.85 / 537.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 277 35 C20140709_OR012_04 C20140709_OR012_04 TB415864.[MT7]-RASVFVK[MT7].2y6_1.heavy 547.85 / 794.489 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 279 35 C20140709_OR012_04 C20140709_OR012_04 TB415864.[MT7]-RASVFVK[MT7].2b5_1.heavy 547.85 / 705.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 281 36 C20140709_OR012_04 C20140709_OR012_04 TB416034.[MT7]-ELLPVIGQNLR.3y6_1.heavy 465.953 / 700.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 283 36 C20140709_OR012_04 C20140709_OR012_04 TB416034.[MT7]-ELLPVIGQNLR.3b5_1.heavy 465.953 / 696.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 285 36 C20140709_OR012_04 C20140709_OR012_04 TB416034.[MT7]-ELLPVIGQNLR.3b3_1.heavy 465.953 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 287 36 C20140709_OR012_04 C20140709_OR012_04 TB416034.[MT7]-ELLPVIGQNLR.3y5_1.heavy 465.953 / 587.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 289 37 C20140709_OR012_04 C20140709_OR012_04 TB446532.[MT7]-EIFEQHLK[MT7].3y3_1.heavy 444.59 / 541.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 291 37 C20140709_OR012_04 C20140709_OR012_04 TB446532.[MT7]-EIFEQHLK[MT7].3b4_1.heavy 444.59 / 663.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 293 37 C20140709_OR012_04 C20140709_OR012_04 TB446532.[MT7]-EIFEQHLK[MT7].3b5_1.heavy 444.59 / 791.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 295 37 C20140709_OR012_04 C20140709_OR012_04 TB446532.[MT7]-EIFEQHLK[MT7].3b3_1.heavy 444.59 / 534.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 297 38 C20140709_OR012_04 C20140709_OR012_04 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 151840.0 30.08489990234375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 151840.0 1245.2150627615065 0.0 - - - - - - - 319.0 303 3 299 38 C20140709_OR012_04 C20140709_OR012_04 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 55802.0 30.08489990234375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 55802.0 242.03434953589186 0.0 - - - - - - - 191.6 111 5 301 38 C20140709_OR012_04 C20140709_OR012_04 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 56880.0 30.08489990234375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 56880.0 114.02984790776276 0.0 - - - - - - - 199.44444444444446 113 9 303 39 C20140709_OR012_04 C20140709_OR012_04 TB446575.[MT7]-QQQQQLDQK[MT7].3y3_1.heavy 477.931 / 534.3 2035.0 17.632200241088867 43 13 10 10 10 1.919876958494649 40.58395200094349 0.0 3 0.9010406523037273 3.89032327208788 2035.0 36.80287109664052 0.0 - - - - - - - 116.25 4 4 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 305 39 C20140709_OR012_04 C20140709_OR012_04 TB446575.[MT7]-QQQQQLDQK[MT7].3b4_1.heavy 477.931 / 657.344 349.0 17.632200241088867 43 13 10 10 10 1.919876958494649 40.58395200094349 0.0 3 0.9010406523037273 3.89032327208788 349.0 2.2867588580924685 2.0 - - - - - - - 0.0 1 0 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 307 39 C20140709_OR012_04 C20140709_OR012_04 TB446575.[MT7]-QQQQQLDQK[MT7].3y4_1.heavy 477.931 / 647.385 581.0 17.632200241088867 43 13 10 10 10 1.919876958494649 40.58395200094349 0.0 3 0.9010406523037273 3.89032327208788 581.0 13.873879310344828 1.0 - - - - - - - 0.0 1 0 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 309 39 C20140709_OR012_04 C20140709_OR012_04 TB446575.[MT7]-QQQQQLDQK[MT7].3b3_1.heavy 477.931 / 529.285 1047.0 17.632200241088867 43 13 10 10 10 1.919876958494649 40.58395200094349 0.0 3 0.9010406523037273 3.89032327208788 1047.0 5.111393415364151 0.0 - - - - - - - 159.75 2 12 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 311 40 C20140709_OR012_04 C20140709_OR012_04 TB446827.[MT7]-EPFRPPPITPHEYMLSLYR.4y5_1.heavy 622.58 / 651.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 313 40 C20140709_OR012_04 C20140709_OR012_04 TB446827.[MT7]-EPFRPPPITPHEYMLSLYR.4y7_1.heavy 622.58 / 945.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 315 40 C20140709_OR012_04 C20140709_OR012_04 TB446827.[MT7]-EPFRPPPITPHEYMLSLYR.4y6_1.heavy 622.58 / 782.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 317 40 C20140709_OR012_04 C20140709_OR012_04 TB446827.[MT7]-EPFRPPPITPHEYMLSLYR.4b9_2.heavy 622.58 / 590.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 319 41 C20140709_OR012_04 C20140709_OR012_04 TB446825.[MT7]-LLGSMEQVSSHFLEQTLDK[MT7].4b7_1.heavy 613.326 / 903.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 321 41 C20140709_OR012_04 C20140709_OR012_04 TB446825.[MT7]-LLGSMEQVSSHFLEQTLDK[MT7].4b4_1.heavy 613.326 / 515.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 323 41 C20140709_OR012_04 C20140709_OR012_04 TB446825.[MT7]-LLGSMEQVSSHFLEQTLDK[MT7].4y3_1.heavy 613.326 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 325 41 C20140709_OR012_04 C20140709_OR012_04 TB446825.[MT7]-LLGSMEQVSSHFLEQTLDK[MT7].4b6_1.heavy 613.326 / 775.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 327 42 C20140709_OR012_04 C20140709_OR012_04 TB434100.[MT7]-ARDEAGVPR.2b4_1.heavy 557.808 / 616.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 329 42 C20140709_OR012_04 C20140709_OR012_04 TB434100.[MT7]-ARDEAGVPR.2b6_1.heavy 557.808 / 744.376 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 331 42 C20140709_OR012_04 C20140709_OR012_04 TB434100.[MT7]-ARDEAGVPR.2y6_1.heavy 557.808 / 628.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 333 42 C20140709_OR012_04 C20140709_OR012_04 TB434100.[MT7]-ARDEAGVPR.2b7_1.heavy 557.808 / 843.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 335 43 C20140709_OR012_04 C20140709_OR012_04 TB446823.[MT7]-SFIGTPYWMAPEVAAVERK[MT7].3b5_1.heavy 814.103 / 650.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K2;MAP4K3 mitogen-activated protein kinase kinase kinase kinase 2;mitogen-activated protein kinase kinase kinase kinase 3 337 43 C20140709_OR012_04 C20140709_OR012_04 TB446823.[MT7]-SFIGTPYWMAPEVAAVERK[MT7].3b7_1.heavy 814.103 / 910.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K2;MAP4K3 mitogen-activated protein kinase kinase kinase kinase 2;mitogen-activated protein kinase kinase kinase kinase 3 339 43 C20140709_OR012_04 C20140709_OR012_04 TB446823.[MT7]-SFIGTPYWMAPEVAAVERK[MT7].3y10_1.heavy 814.103 / 1213.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K2;MAP4K3 mitogen-activated protein kinase kinase kinase kinase 2;mitogen-activated protein kinase kinase kinase kinase 3 341 43 C20140709_OR012_04 C20140709_OR012_04 TB446823.[MT7]-SFIGTPYWMAPEVAAVERK[MT7].3y9_1.heavy 814.103 / 1142.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K2;MAP4K3 mitogen-activated protein kinase kinase kinase kinase 2;mitogen-activated protein kinase kinase kinase kinase 3 343 44 C20140709_OR012_04 C20140709_OR012_04 TB446578.[MT7]-FATGGQGQDSGK[MT7].3b6_1.heavy 480.916 / 706.364 1070.0 19.696800231933594 43 13 10 10 10 2.739355119062959 36.50494209535222 0.0 3 0.9292166929868617 4.611065639113254 1070.0 9.078787878787878 0.0 - - - - - - - 181.2 2 5 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 345 44 C20140709_OR012_04 C20140709_OR012_04 TB446578.[MT7]-FATGGQGQDSGK[MT7].3b4_1.heavy 480.916 / 521.284 3458.0 19.696800231933594 43 13 10 10 10 2.739355119062959 36.50494209535222 0.0 3 0.9292166929868617 4.611065639113254 3458.0 24.737060900264783 0.0 - - - - - - - 200.0 6 7 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 347 44 C20140709_OR012_04 C20140709_OR012_04 TB446578.[MT7]-FATGGQGQDSGK[MT7].3b5_1.heavy 480.916 / 578.305 4694.0 19.696800231933594 43 13 10 10 10 2.739355119062959 36.50494209535222 0.0 3 0.9292166929868617 4.611065639113254 4694.0 32.25505336768495 0.0 - - - - - - - 262.0 9 11 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 349 44 C20140709_OR012_04 C20140709_OR012_04 TB446578.[MT7]-FATGGQGQDSGK[MT7].3y4_1.heavy 480.916 / 550.295 11034.0 19.696800231933594 43 13 10 10 10 2.739355119062959 36.50494209535222 0.0 3 0.9292166929868617 4.611065639113254 11034.0 122.37709090909091 0.0 - - - - - - - 192.08333333333334 22 12 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 351 45 C20140709_OR012_04 C20140709_OR012_04 TB446528.[MT7]-VHMGAC[CAM]FSK[MT7].3y3_1.heavy 442.23 / 525.315 4705.0 25.590499877929688 45 15 10 10 10 2.5814161207271544 38.73842701959697 0.0 3 0.9594291170739594 6.106266940523197 4705.0 16.92411391543467 0.0 - - - - - - - 346.6 9 5 MAP4K2;MAP4K3 mitogen-activated protein kinase kinase kinase kinase 2;mitogen-activated protein kinase kinase kinase kinase 3 353 45 C20140709_OR012_04 C20140709_OR012_04 TB446528.[MT7]-VHMGAC[CAM]FSK[MT7].3b4_1.heavy 442.23 / 569.299 1857.0 25.590499877929688 45 15 10 10 10 2.5814161207271544 38.73842701959697 0.0 3 0.9594291170739594 6.106266940523197 1857.0 16.960292287153216 0.0 - - - - - - - 165.33333333333334 3 3 MAP4K2;MAP4K3 mitogen-activated protein kinase kinase kinase kinase 2;mitogen-activated protein kinase kinase kinase kinase 3 355 45 C20140709_OR012_04 C20140709_OR012_04 TB446528.[MT7]-VHMGAC[CAM]FSK[MT7].3b5_1.heavy 442.23 / 640.336 867.0 25.590499877929688 45 15 10 10 10 2.5814161207271544 38.73842701959697 0.0 3 0.9594291170739594 6.106266940523197 867.0 0.6991935483870967 0.0 - - - - - - - 0.0 1 0 MAP4K2;MAP4K3 mitogen-activated protein kinase kinase kinase kinase 2;mitogen-activated protein kinase kinase kinase kinase 3 357 45 C20140709_OR012_04 C20140709_OR012_04 TB446528.[MT7]-VHMGAC[CAM]FSK[MT7].3y4_1.heavy 442.23 / 685.346 867.0 25.590499877929688 45 15 10 10 10 2.5814161207271544 38.73842701959697 0.0 3 0.9594291170739594 6.106266940523197 867.0 3.4784879032258065 0.0 - - - - - - - 0.0 1 0 MAP4K2;MAP4K3 mitogen-activated protein kinase kinase kinase kinase 2;mitogen-activated protein kinase kinase kinase kinase 3 359 46 C20140709_OR012_04 C20140709_OR012_04 TB416321.[MT7]-VVIWNMSPVLQEDDEK[MT7].3y7_1.heavy 730.717 / 1020.5 3695.0 42.9818000793457 42 16 10 6 10 3.2934211274703635 30.36356303355859 0.037200927734375 3 0.9612547060792971 6.249432515019861 3695.0 44.463166666666666 0.0 - - - - - - - 235.5 7 14 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 361 46 C20140709_OR012_04 C20140709_OR012_04 TB416321.[MT7]-VVIWNMSPVLQEDDEK[MT7].3y3_1.heavy 730.717 / 535.284 2596.0 42.9818000793457 42 16 10 6 10 3.2934211274703635 30.36356303355859 0.037200927734375 3 0.9612547060792971 6.249432515019861 2596.0 2.924155193992491 1.0 - - - - - - - 229.8 5 10 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 363 46 C20140709_OR012_04 C20140709_OR012_04 TB416321.[MT7]-VVIWNMSPVLQEDDEK[MT7].3b5_1.heavy 730.717 / 756.453 5192.0 42.9818000793457 42 16 10 6 10 3.2934211274703635 30.36356303355859 0.037200927734375 3 0.9612547060792971 6.249432515019861 5192.0 5.19777530589544 1.0 - - - - - - - 185.71428571428572 10 7 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 365 46 C20140709_OR012_04 C20140709_OR012_04 TB416321.[MT7]-VVIWNMSPVLQEDDEK[MT7].3y5_1.heavy 730.717 / 779.354 3695.0 42.9818000793457 42 16 10 6 10 3.2934211274703635 30.36356303355859 0.037200927734375 3 0.9612547060792971 6.249432515019861 3695.0 11.450277823105342 0.0 - - - - - - - 254.27272727272728 7 11 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 367 47 C20140709_OR012_04 C20140709_OR012_04 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 30215.0 16.33449935913086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 30215.0 171.02501289586925 0.0 - - - - - - - 174.11111111111111 60 9 369 47 C20140709_OR012_04 C20140709_OR012_04 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 33411.0 16.33449935913086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 33411.0 210.647937721859 0.0 - - - - - - - 127.33333333333333 66 9 371 47 C20140709_OR012_04 C20140709_OR012_04 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 27561.0 16.33449935913086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 27561.0 245.33832952833203 0.0 - - - - - - - 175.83333333333334 55 12 373 48 C20140709_OR012_04 C20140709_OR012_04 TB416070.[MT7]-VPSGTGRQQQPR.3b9_1.heavy 485.603 / 1055.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 375 48 C20140709_OR012_04 C20140709_OR012_04 TB416070.[MT7]-VPSGTGRQQQPR.3y10_2.heavy 485.603 / 557.789 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 377 48 C20140709_OR012_04 C20140709_OR012_04 TB416070.[MT7]-VPSGTGRQQQPR.3y11_2.heavy 485.603 / 606.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 379 48 C20140709_OR012_04 C20140709_OR012_04 TB416070.[MT7]-VPSGTGRQQQPR.3y9_2.heavy 485.603 / 514.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 381 49 C20140709_OR012_04 C20140709_OR012_04 TB416121.[MT7]-TRSEITFGQVK[MT7].3b4_1.heavy 518.635 / 618.333 7829.0 27.477674961090088 34 11 10 3 10 2.2547330842761686 33.986034448543045 0.07559967041015625 3 0.8535499689079936 3.184704136503537 7829.0 75.72693452380952 0.0 - - - - - - - 242.5 15 12 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 383 49 C20140709_OR012_04 C20140709_OR012_04 TB416121.[MT7]-TRSEITFGQVK[MT7].3b5_1.heavy 518.635 / 731.417 3691.0 27.477674961090088 34 11 10 3 10 2.2547330842761686 33.986034448543045 0.07559967041015625 3 0.8535499689079936 3.184704136503537 3691.0 62.61517857142857 0.0 - - - - - - - 383.2857142857143 7 7 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 385 49 C20140709_OR012_04 C20140709_OR012_04 TB416121.[MT7]-TRSEITFGQVK[MT7].3y4_1.heavy 518.635 / 575.363 17224.0 27.477674961090088 34 11 10 3 10 2.2547330842761686 33.986034448543045 0.07559967041015625 3 0.8535499689079936 3.184704136503537 17224.0 30.228356704486785 0.0 - - - - - - - 352.7692307692308 34 13 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 387 49 C20140709_OR012_04 C20140709_OR012_04 TB416121.[MT7]-TRSEITFGQVK[MT7].3y8_2.heavy 518.635 / 533.307 1230.0 27.477674961090088 34 11 10 3 10 2.2547330842761686 33.986034448543045 0.07559967041015625 3 0.8535499689079936 3.184704136503537 1230.0 2.476510067114094 13.0 - - - - - - - 307.625 23 8 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 389 50 C20140709_OR012_04 C20140709_OR012_04 TB416267.[MT7]-HYGMVPIQHLDLLVR.4y5_1.heavy 484.524 / 615.382 2538.0 38.73375129699707 22 9 2 5 6 1.2278498117946315 54.110914392410706 0.040500640869140625 5 0.8008085348408228 2.7179364614870676 2538.0 9.448595041322315 2.0 - - - - - - - 255.22222222222223 12 9 RNF112 ring finger protein 112 391 50 C20140709_OR012_04 C20140709_OR012_04 TB416267.[MT7]-HYGMVPIQHLDLLVR.4y4_1.heavy 484.524 / 500.355 2659.0 38.73375129699707 22 9 2 5 6 1.2278498117946315 54.110914392410706 0.040500640869140625 5 0.8008085348408228 2.7179364614870676 2659.0 30.589487603305784 1.0 - - - - - - - 272.25 7 4 RNF112 ring finger protein 112 393 50 C20140709_OR012_04 C20140709_OR012_04 TB416267.[MT7]-HYGMVPIQHLDLLVR.4y7_1.heavy 484.524 / 865.525 967.0 38.73375129699707 22 9 2 5 6 1.2278498117946315 54.110914392410706 0.040500640869140625 5 0.8008085348408228 2.7179364614870676 967.0 2.4639118457300277 1.0 - - - - - - - 0.0 1 0 RNF112 ring finger protein 112 395 50 C20140709_OR012_04 C20140709_OR012_04 TB416267.[MT7]-HYGMVPIQHLDLLVR.4b3_1.heavy 484.524 / 502.253 483.0 38.73375129699707 22 9 2 5 6 1.2278498117946315 54.110914392410706 0.040500640869140625 5 0.8008085348408228 2.7179364614870676 483.0 4.151669312024519 5.0 - - - - - - - 0.0 1 0 RNF112 ring finger protein 112 397 51 C20140709_OR012_04 C20140709_OR012_04 TB416123.[MT7]-TVGQAFEVC[CAM]HK[MT7].3y3_1.heavy 521.945 / 588.304 11112.0 26.504700660705566 40 14 10 6 10 1.3458906516053346 43.47969113433069 0.036800384521484375 3 0.9441397741376454 5.197187061613291 11112.0 42.97854981212552 0.0 - - - - - - - 309.4 22 10 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 399 51 C20140709_OR012_04 C20140709_OR012_04 TB416123.[MT7]-TVGQAFEVC[CAM]HK[MT7].3b4_1.heavy 521.945 / 530.305 10769.0 26.504700660705566 40 14 10 6 10 1.3458906516053346 43.47969113433069 0.036800384521484375 3 0.9441397741376454 5.197187061613291 10769.0 104.56691645800137 0.0 - - - - - - - 186.375 21 8 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 401 51 C20140709_OR012_04 C20140709_OR012_04 TB416123.[MT7]-TVGQAFEVC[CAM]HK[MT7].3b5_1.heavy 521.945 / 601.343 18101.0 26.504700660705566 40 14 10 6 10 1.3458906516053346 43.47969113433069 0.036800384521484375 3 0.9441397741376454 5.197187061613291 18101.0 121.65371991469485 0.0 - - - - - - - 242.0 36 9 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 403 51 C20140709_OR012_04 C20140709_OR012_04 TB416123.[MT7]-TVGQAFEVC[CAM]HK[MT7].3b7_1.heavy 521.945 / 877.454 3666.0 26.504700660705566 40 14 10 6 10 1.3458906516053346 43.47969113433069 0.036800384521484375 3 0.9441397741376454 5.197187061613291 3666.0 25.599547324058086 0.0 - - - - - - - 229.25 7 8 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 405 52 C20140709_OR012_04 C20140709_OR012_04 TB416269.[MT7]-APC[CAM]IVYIDEIDAVGK[MT7].3b6_1.heavy 651.02 / 848.446 2256.0 41.547550201416016 44 18 10 6 10 5.411919360353478 18.477732822957016 0.03330230712890625 3 0.9897547286116631 12.182296042735684 2256.0 29.78841816996305 0.0 - - - - - - - 195.0 4 11 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 407 52 C20140709_OR012_04 C20140709_OR012_04 TB416269.[MT7]-APC[CAM]IVYIDEIDAVGK[MT7].3b4_1.heavy 651.02 / 586.314 4833.0 41.547550201416016 44 18 10 6 10 5.411919360353478 18.477732822957016 0.03330230712890625 3 0.9897547286116631 12.182296042735684 4833.0 12.007453416149069 0.0 - - - - - - - 256.15384615384613 9 13 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 409 52 C20140709_OR012_04 C20140709_OR012_04 TB416269.[MT7]-APC[CAM]IVYIDEIDAVGK[MT7].3y4_1.heavy 651.02 / 518.342 2041.0 41.547550201416016 44 18 10 6 10 5.411919360353478 18.477732822957016 0.03330230712890625 3 0.9897547286116631 12.182296042735684 2041.0 1.2663908996897622 3.0 - - - - - - - 187.875 4 8 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 411 52 C20140709_OR012_04 C20140709_OR012_04 TB416269.[MT7]-APC[CAM]IVYIDEIDAVGK[MT7].3y5_1.heavy 651.02 / 633.369 3544.0 41.547550201416016 44 18 10 6 10 5.411919360353478 18.477732822957016 0.03330230712890625 3 0.9897547286116631 12.182296042735684 3544.0 2.863607419412012 0.0 - - - - - - - 272.06666666666666 7 15 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 413 53 C20140709_OR012_04 C20140709_OR012_04 TB416327.[MT7]-GMYPTYFLHLDREDGK[MT7].4y5_1.heavy 558.286 / 748.407 764.0 37.54930019378662 30 9 10 1 10 0.7234048796047173 84.4249721970655 0.12360000610351562 3 0.8014281514276361 2.7223253710532687 764.0 2.460479963483051 1.0 - - - - - - - 0.0 1 0 TUB tubby homolog (mouse) 415 53 C20140709_OR012_04 C20140709_OR012_04 TB416327.[MT7]-GMYPTYFLHLDREDGK[MT7].4y8_2.heavy 558.286 / 557.292 1783.0 37.54930019378662 30 9 10 1 10 0.7234048796047173 84.4249721970655 0.12360000610351562 3 0.8014281514276361 2.7223253710532687 1783.0 5.439971255517914 3.0 - - - - - - - 238.75 3 8 TUB tubby homolog (mouse) 417 53 C20140709_OR012_04 C20140709_OR012_04 TB416327.[MT7]-GMYPTYFLHLDREDGK[MT7].4b5_1.heavy 558.286 / 694.335 2037.0 37.54930019378662 30 9 10 1 10 0.7234048796047173 84.4249721970655 0.12360000610351562 3 0.8014281514276361 2.7223253710532687 2037.0 14.858117647058823 0.0 - - - - - - - 229.2 4 10 TUB tubby homolog (mouse) 419 53 C20140709_OR012_04 C20140709_OR012_04 TB416327.[MT7]-GMYPTYFLHLDREDGK[MT7].4y9_2.heavy 558.286 / 613.834 3565.0 37.54930019378662 30 9 10 1 10 0.7234048796047173 84.4249721970655 0.12360000610351562 3 0.8014281514276361 2.7223253710532687 3565.0 5.846583981961693 0.0 - - - - - - - 254.71428571428572 7 7 TUB tubby homolog (mouse) 421 54 C20140709_OR012_04 C20140709_OR012_04 TB434393.[MT7]-DTDLDYLEMFVHVAEVMGK[MT7].4b4_1.heavy 625.814 / 589.295 2529.0 54.339599609375 50 20 10 10 10 97.99643479544221 1.0204452866957867 0.0 3 0.9996916083138342 70.27484191041998 2529.0 -6.104482758620691 0.0 - - - - - - - 88.11111111111111 5 9 RNF112 ring finger protein 112 423 54 C20140709_OR012_04 C20140709_OR012_04 TB434393.[MT7]-DTDLDYLEMFVHVAEVMGK[MT7].4b5_1.heavy 625.814 / 704.322 16378.0 54.339599609375 50 20 10 10 10 97.99643479544221 1.0204452866957867 0.0 3 0.9996916083138342 70.27484191041998 16378.0 -5.5834090909091 0.0 - - - - - - - 79.85714285714286 32 7 RNF112 ring finger protein 112 425 54 C20140709_OR012_04 C20140709_OR012_04 TB434393.[MT7]-DTDLDYLEMFVHVAEVMGK[MT7].4y6_1.heavy 625.814 / 778.425 4264.0 54.339599609375 50 20 10 10 10 97.99643479544221 1.0204452866957867 0.0 3 0.9996916083138342 70.27484191041998 4264.0 -3.6135593220339004 0.0 - - - - - - - 81.77777777777777 8 9 RNF112 ring finger protein 112 427 54 C20140709_OR012_04 C20140709_OR012_04 TB434393.[MT7]-DTDLDYLEMFVHVAEVMGK[MT7].4b6_1.heavy 625.814 / 867.385 4646.0 54.339599609375 50 20 10 10 10 97.99643479544221 1.0204452866957867 0.0 3 0.9996916083138342 70.27484191041998 4646.0 -9.612413793103457 0.0 - - - - - - - 88.0 9 3 RNF112 ring finger protein 112 429 55 C20140709_OR012_04 C20140709_OR012_04 TB416326.[MT7]-LLGHWEEAAHDLALAC[CAM]K[MT7].4b8_2.heavy 556.296 / 540.783 1273.0 40.5484504699707 32 17 6 5 4 3.1440711497348497 24.75200754420163 0.0410003662109375 7 0.9708922957832533 7.216045835339312 1273.0 9.903264279568468 6.0 - - - - - - - 254.6 5 5 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 431 55 C20140709_OR012_04 C20140709_OR012_04 TB416326.[MT7]-LLGHWEEAAHDLALAC[CAM]K[MT7].4b7_2.heavy 556.296 / 505.265 1967.0 40.5484504699707 32 17 6 5 4 3.1440711497348497 24.75200754420163 0.0410003662109375 7 0.9708922957832533 7.216045835339312 1967.0 11.921212121212122 2.0 - - - - - - - 260.4166666666667 3 12 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 433 55 C20140709_OR012_04 C20140709_OR012_04 TB416326.[MT7]-LLGHWEEAAHDLALAC[CAM]K[MT7].4b4_1.heavy 556.296 / 565.358 1042.0 40.5484504699707 32 17 6 5 4 3.1440711497348497 24.75200754420163 0.0410003662109375 7 0.9708922957832533 7.216045835339312 1042.0 -0.31868483238014667 5.0 - - - - - - - 181.85714285714286 3 14 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 435 55 C20140709_OR012_04 C20140709_OR012_04 TB416326.[MT7]-LLGHWEEAAHDLALAC[CAM]K[MT7].4y3_1.heavy 556.296 / 522.283 3703.0 40.5484504699707 32 17 6 5 4 3.1440711497348497 24.75200754420163 0.0410003662109375 7 0.9708922957832533 7.216045835339312 3703.0 5.562796802089351 2.0 - - - - - - - 270.0 10 6 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 437 56 C20140709_OR012_04 C20140709_OR012_04 TB446423.[MT7]-GGDSYIGK[MT7].2b3_1.heavy 542.797 / 374.179 4911.0 21.707599639892578 50 20 10 10 10 9.77585232873047 10.229287087951173 0.0 3 0.9969593378848604 22.375264692197128 4911.0 32.19172248803828 0.0 - - - - - - - 248.0 9 8 TUB tubby homolog (mouse) 439 56 C20140709_OR012_04 C20140709_OR012_04 TB446423.[MT7]-GGDSYIGK[MT7].2y5_1.heavy 542.797 / 711.416 2612.0 21.707599639892578 50 20 10 10 10 9.77585232873047 10.229287087951173 0.0 3 0.9969593378848604 22.375264692197128 2612.0 30.423262789841736 0.0 - - - - - - - 208.66666666666666 5 6 TUB tubby homolog (mouse) 441 56 C20140709_OR012_04 C20140709_OR012_04 TB446423.[MT7]-GGDSYIGK[MT7].2b6_1.heavy 542.797 / 737.359 836.0 21.707599639892578 50 20 10 10 10 9.77585232873047 10.229287087951173 0.0 3 0.9969593378848604 22.375264692197128 836.0 4.8 0.0 - - - - - - - 0.0 1 0 TUB tubby homolog (mouse) 443 57 C20140709_OR012_04 C20140709_OR012_04 TB415898.[MT7]-AFVSFNSVR.2y8_1.heavy 585.823 / 955.5 33542.0 34.29789924621582 38 13 10 5 10 2.6877914269795644 37.20526786275828 0.043598175048828125 3 0.9211113223026831 4.36473358746757 33542.0 109.97047966062911 0.0 - - - - - - - 209.2 67 5 ZNF625 zinc finger protein 625 445 57 C20140709_OR012_04 C20140709_OR012_04 TB415898.[MT7]-AFVSFNSVR.2y6_1.heavy 585.823 / 709.363 11616.0 34.29789924621582 38 13 10 5 10 2.6877914269795644 37.20526786275828 0.043598175048828125 3 0.9211113223026831 4.36473358746757 11616.0 19.966000612557426 0.0 - - - - - - - 196.2 23 10 ZNF625 zinc finger protein 625 447 57 C20140709_OR012_04 C20140709_OR012_04 TB415898.[MT7]-AFVSFNSVR.2b5_1.heavy 585.823 / 696.384 1566.0 34.29789924621582 38 13 10 5 10 2.6877914269795644 37.20526786275828 0.043598175048828125 3 0.9211113223026831 4.36473358746757 1566.0 1.6106783369803066 4.0 - - - - - - - 248.2 3 10 ZNF625 zinc finger protein 625 449 57 C20140709_OR012_04 C20140709_OR012_04 TB415898.[MT7]-AFVSFNSVR.2y7_1.heavy 585.823 / 808.431 7309.0 34.29789924621582 38 13 10 5 10 2.6877914269795644 37.20526786275828 0.043598175048828125 3 0.9211113223026831 4.36473358746757 7309.0 27.798088982719527 0.0 - - - - - - - 261.25 14 8 ZNF625 zinc finger protein 625 451 58 C20140709_OR012_04 C20140709_OR012_04 TB415789.[MT7]-VLPDTMR.2y4_1.heavy 488.274 / 522.234 898.0 28.0250244140625 44 20 10 6 8 8.619140728563629 11.602084610198132 0.03730010986328125 4 0.9924159080411825 14.16236277199017 898.0 1.0658753709198814 1.0 - - - - - - - 214.36363636363637 12 11 RNF112 ring finger protein 112 453 58 C20140709_OR012_04 C20140709_OR012_04 TB415789.[MT7]-VLPDTMR.2y5_1.heavy 488.274 / 619.287 5951.0 28.0250244140625 44 20 10 6 8 8.619140728563629 11.602084610198132 0.03730010986328125 4 0.9924159080411825 14.16236277199017 5951.0 63.36969902501059 0.0 - - - - - - - 285.8181818181818 11 11 RNF112 ring finger protein 112 455 58 C20140709_OR012_04 C20140709_OR012_04 TB415789.[MT7]-VLPDTMR.2b4_1.heavy 488.274 / 569.341 898.0 28.0250244140625 44 20 10 6 8 8.619140728563629 11.602084610198132 0.03730010986328125 4 0.9924159080411825 14.16236277199017 898.0 -0.5 8.0 - - - - - - - 140.25 3 4 RNF112 ring finger protein 112 457 58 C20140709_OR012_04 C20140709_OR012_04 TB415789.[MT7]-VLPDTMR.2y6_1.heavy 488.274 / 732.371 3593.0 28.0250244140625 44 20 10 6 8 8.619140728563629 11.602084610198132 0.03730010986328125 4 0.9924159080411825 14.16236277199017 3593.0 18.05093944020356 0.0 - - - - - - - 247.2 7 5 RNF112 ring finger protein 112 459 59 C20140709_OR012_04 C20140709_OR012_04 TB416061.[MT7]-FATGGQGQDSGK[MT7].2y4_1.heavy 720.87 / 550.295 1245.0 19.715149879455566 43 17 10 6 10 4.468989706091225 22.376422094617983 0.03669929504394531 3 0.9748545579404851 7.766376915360258 1245.0 9.520960365853657 0.0 - - - - - - - 210.8 2 5 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 461 59 C20140709_OR012_04 C20140709_OR012_04 TB416061.[MT7]-FATGGQGQDSGK[MT7].2y9_1.heavy 720.87 / 977.477 2203.0 19.715149879455566 43 17 10 6 10 4.468989706091225 22.376422094617983 0.03669929504394531 3 0.9748545579404851 7.766376915360258 2203.0 11.473958333333334 0.0 - - - - - - - 223.66666666666666 4 3 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 463 59 C20140709_OR012_04 C20140709_OR012_04 TB416061.[MT7]-FATGGQGQDSGK[MT7].2y6_1.heavy 720.87 / 735.375 2011.0 19.715149879455566 43 17 10 6 10 4.468989706091225 22.376422094617983 0.03669929504394531 3 0.9748545579404851 7.766376915360258 2011.0 19.900520833333335 0.0 - - - - - - - 215.75 4 4 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 465 59 C20140709_OR012_04 C20140709_OR012_04 TB416061.[MT7]-FATGGQGQDSGK[MT7].2y11_1.heavy 720.87 / 1149.56 1149.0 19.715149879455566 43 17 10 6 10 4.468989706091225 22.376422094617983 0.03669929504394531 3 0.9748545579404851 7.766376915360258 1149.0 11.96875 0.0 - - - - - - - 167.75 2 4 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 467 60 C20140709_OR012_04 C20140709_OR012_04 TB415892.[MT7]-DQLAAEAAAR.2b3_1.heavy 580.313 / 501.279 5673.0 23.30970001220703 45 15 10 10 10 1.8083702707892242 37.21234404441237 0.0 3 0.9565174619495931 5.896829132568879 5673.0 27.469356332788593 0.0 - - - - - - - 277.5 11 8 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 469 60 C20140709_OR012_04 C20140709_OR012_04 TB415892.[MT7]-DQLAAEAAAR.2b4_1.heavy 580.313 / 572.316 1973.0 23.30970001220703 45 15 10 10 10 1.8083702707892242 37.21234404441237 0.0 3 0.9565174619495931 5.896829132568879 1973.0 2.0614516457361187 4.0 - - - - - - - 205.33333333333334 5 6 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 471 60 C20140709_OR012_04 C20140709_OR012_04 TB415892.[MT7]-DQLAAEAAAR.2y9_1.heavy 580.313 / 900.49 4440.0 23.30970001220703 45 15 10 10 10 1.8083702707892242 37.21234404441237 0.0 3 0.9565174619495931 5.896829132568879 4440.0 30.378947368421056 0.0 - - - - - - - 172.6 8 5 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 473 60 C20140709_OR012_04 C20140709_OR012_04 TB415892.[MT7]-DQLAAEAAAR.2y7_1.heavy 580.313 / 659.347 5549.0 23.30970001220703 45 15 10 10 10 1.8083702707892242 37.21234404441237 0.0 3 0.9565174619495931 5.896829132568879 5549.0 20.846243243243244 0.0 - - - - - - - 246.75 11 4 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 475 61 C20140709_OR012_04 C20140709_OR012_04 TB446524.[MT7]-LRSNLMGTK[MT7].3y3_1.heavy 436.595 / 449.284 22018.0 25.105499267578125 44 14 10 10 10 2.011769362201988 41.56139531560649 0.0 3 0.9331302027041809 4.745664582363063 22018.0 59.32373002259796 0.0 - - - - - - - 278.25 44 4 TUB;TULP3 tubby homolog (mouse);tubby like protein 3 477 61 C20140709_OR012_04 C20140709_OR012_04 TB446524.[MT7]-LRSNLMGTK[MT7].3b4_1.heavy 436.595 / 615.37 5566.0 25.105499267578125 44 14 10 10 10 2.011769362201988 41.56139531560649 0.0 3 0.9331302027041809 4.745664582363063 5566.0 26.85494627715879 0.0 - - - - - - - 247.42857142857142 11 7 TUB;TULP3 tubby homolog (mouse);tubby like protein 3 479 61 C20140709_OR012_04 C20140709_OR012_04 TB446524.[MT7]-LRSNLMGTK[MT7].3b5_1.heavy 436.595 / 728.453 1237.0 25.105499267578125 44 14 10 10 10 2.011769362201988 41.56139531560649 0.0 3 0.9331302027041809 4.745664582363063 1237.0 5.850336509242551 6.0 - - - - - - - 233.55555555555554 2 9 TUB;TULP3 tubby homolog (mouse);tubby like protein 3 481 61 C20140709_OR012_04 C20140709_OR012_04 TB446524.[MT7]-LRSNLMGTK[MT7].3y4_1.heavy 436.595 / 580.325 7793.0 25.105499267578125 44 14 10 10 10 2.011769362201988 41.56139531560649 0.0 3 0.9331302027041809 4.745664582363063 7793.0 58.68412955465587 0.0 - - - - - - - 226.5 15 6 TUB;TULP3 tubby homolog (mouse);tubby like protein 3 483 62 C20140709_OR012_04 C20140709_OR012_04 TB446514.[MT7]-K[MT7]VEEDLK[MT7].3y3_1.heavy 431.598 / 519.326 3243.0 20.921666463216145 38 13 10 5 10 2.389413639274186 41.8512719423399 0.04250144958496094 3 0.9284700963231164 4.5866453664392335 3243.0 21.87557575158879 1.0 - - - - - - - 268.90909090909093 6 11 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 485 62 C20140709_OR012_04 C20140709_OR012_04 TB446514.[MT7]-K[MT7]VEEDLK[MT7].3b5_1.heavy 431.598 / 889.487 N/A 20.921666463216145 38 13 10 5 10 2.389413639274186 41.8512719423399 0.04250144958496094 3 0.9284700963231164 4.5866453664392335 0.0 0.0 1.0 - - - - - - - 0.0 0 0 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 487 62 C20140709_OR012_04 C20140709_OR012_04 TB446514.[MT7]-K[MT7]VEEDLK[MT7].3y4_1.heavy 431.598 / 648.369 2766.0 20.921666463216145 38 13 10 5 10 2.389413639274186 41.8512719423399 0.04250144958496094 3 0.9284700963231164 4.5866453664392335 2766.0 38.4476036069194 0.0 - - - - - - - 206.66666666666666 5 6 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 489 62 C20140709_OR012_04 C20140709_OR012_04 TB446514.[MT7]-K[MT7]VEEDLK[MT7].3b5_2.heavy 431.598 / 445.247 11066.0 20.921666463216145 38 13 10 5 10 2.389413639274186 41.8512719423399 0.04250144958496094 3 0.9284700963231164 4.5866453664392335 11066.0 133.83486910994765 0.0 - - - - - - - 209.8 22 5 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 491 63 C20140709_OR012_04 C20140709_OR012_04 TB416118.[MT7]-NVEMFMNIEK[MT7].3y3_1.heavy 514.935 / 533.341 861.0 38.50079917907715 36 11 10 5 10 1.3426434208593592 59.455570114698205 0.04199981689453125 3 0.865415622239005 3.325595538306433 861.0 4.2 5.0 - - - - - - - 0.0 1 0 SMARCC1 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 493 63 C20140709_OR012_04 C20140709_OR012_04 TB416118.[MT7]-NVEMFMNIEK[MT7].3b4_1.heavy 514.935 / 618.304 2091.0 38.50079917907715 36 11 10 5 10 1.3426434208593592 59.455570114698205 0.04199981689453125 3 0.865415622239005 3.325595538306433 2091.0 6.724444444444445 0.0 - - - - - - - 344.4 4 5 SMARCC1 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 495 63 C20140709_OR012_04 C20140709_OR012_04 TB416118.[MT7]-NVEMFMNIEK[MT7].3b5_1.heavy 514.935 / 765.372 3198.0 38.50079917907715 36 11 10 5 10 1.3426434208593592 59.455570114698205 0.04199981689453125 3 0.865415622239005 3.325595538306433 3198.0 44.72 0.0 - - - - - - - 123.0 6 3 SMARCC1 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 497 63 C20140709_OR012_04 C20140709_OR012_04 TB416118.[MT7]-NVEMFMNIEK[MT7].3y4_1.heavy 514.935 / 647.385 2091.0 38.50079917907715 36 11 10 5 10 1.3426434208593592 59.455570114698205 0.04199981689453125 3 0.865415622239005 3.325595538306433 2091.0 10.426666666666666 1.0 - - - - - - - 228.42857142857142 4 7 SMARCC1 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 499 64 C20140709_OR012_04 C20140709_OR012_04 TB434129.[MT7]-YVQDFHPR.3y3_1.heavy 402.544 / 409.231 23157.0 25.750099182128906 44 14 10 10 10 1.7297779915727294 37.08516589380563 0.0 3 0.9418248155572698 5.091728436007514 23157.0 58.93449015004593 0.0 - - - - - - - 290.8 46 5 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 501 64 C20140709_OR012_04 C20140709_OR012_04 TB434129.[MT7]-YVQDFHPR.3b4_1.heavy 402.544 / 650.327 22672.0 25.750099182128906 44 14 10 10 10 1.7297779915727294 37.08516589380563 0.0 3 0.9418248155572698 5.091728436007514 22672.0 168.63471074380166 0.0 - - - - - - - 242.16666666666666 45 6 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 503 64 C20140709_OR012_04 C20140709_OR012_04 TB434129.[MT7]-YVQDFHPR.3y4_1.heavy 402.544 / 556.299 8851.0 25.750099182128906 44 14 10 10 10 1.7297779915727294 37.08516589380563 0.0 3 0.9418248155572698 5.091728436007514 8851.0 72.56357024793388 0.0 - - - - - - - 242.28571428571428 17 7 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 505 64 C20140709_OR012_04 C20140709_OR012_04 TB434129.[MT7]-YVQDFHPR.3b3_1.heavy 402.544 / 535.3 8366.0 25.750099182128906 44 14 10 10 10 1.7297779915727294 37.08516589380563 0.0 3 0.9418248155572698 5.091728436007514 8366.0 85.67533148669511 2.0 - - - - - - - 161.5 16 6 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 507 65 C20140709_OR012_04 C20140709_OR012_04 TB446558.[MT7]-ELLPVIGQNLR.2b3_1.heavy 698.426 / 500.32 2869.0 40.353599548339844 38 20 10 2 6 8.400760896162465 11.903683634857504 0.082000732421875 5 0.9960865047366267 19.721422063902523 2869.0 2.4987691417821063 1.0 - - - - - - - 199.4 5 5 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 509 65 C20140709_OR012_04 C20140709_OR012_04 TB446558.[MT7]-ELLPVIGQNLR.2y8_1.heavy 698.426 / 896.531 8732.0 40.353599548339844 38 20 10 2 6 8.400760896162465 11.903683634857504 0.082000732421875 5 0.9960865047366267 19.721422063902523 8732.0 16.922463351975047 0.0 - - - - - - - 327.25 17 8 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 511 65 C20140709_OR012_04 C20140709_OR012_04 TB446558.[MT7]-ELLPVIGQNLR.2y10_1.heavy 698.426 / 1122.7 N/A 40.353599548339844 38 20 10 2 6 8.400760896162465 11.903683634857504 0.082000732421875 5 0.9960865047366267 19.721422063902523 0.0 0.0 44.0 - - - - - - - 0.0 1 0 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 513 65 C20140709_OR012_04 C20140709_OR012_04 TB446558.[MT7]-ELLPVIGQNLR.2y9_1.heavy 698.426 / 1009.62 1372.0 40.353599548339844 38 20 10 2 6 8.400760896162465 11.903683634857504 0.082000732421875 5 0.9960865047366267 19.721422063902523 1372.0 11.19763246190858 3.0 - - - - - - - 296.125 5 8 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 515 66 C20140709_OR012_04 C20140709_OR012_04 TB416254.[MT7]-ATSPADALQYLLQFAR.3y7_1.heavy 637.015 / 910.515 4312.0 54.27909851074219 45 18 10 7 10 3.877442136152419 25.79019789041388 0.024200439453125 3 0.9875393543134866 11.044348358020754 4312.0 49.61080811049074 1.0 - - - - - - - 96.11538461538461 8 26 INTS4 integrator complex subunit 4 517 66 C20140709_OR012_04 C20140709_OR012_04 TB416254.[MT7]-ATSPADALQYLLQFAR.3b6_1.heavy 637.015 / 687.343 5240.0 54.27909851074219 45 18 10 7 10 3.877442136152419 25.79019789041388 0.024200439453125 3 0.9875393543134866 11.044348358020754 5240.0 32.75 1.0 - - - - - - - 152.28571428571428 10 21 INTS4 integrator complex subunit 4 519 66 C20140709_OR012_04 C20140709_OR012_04 TB416254.[MT7]-ATSPADALQYLLQFAR.3y5_1.heavy 637.015 / 634.367 4456.0 54.27909851074219 45 18 10 7 10 3.877442136152419 25.79019789041388 0.024200439453125 3 0.9875393543134866 11.044348358020754 4456.0 55.939569892473116 0.0 - - - - - - - 103.23809523809524 8 21 INTS4 integrator complex subunit 4 521 66 C20140709_OR012_04 C20140709_OR012_04 TB416254.[MT7]-ATSPADALQYLLQFAR.3b7_1.heavy 637.015 / 758.38 5384.0 54.27909851074219 45 18 10 7 10 3.877442136152419 25.79019789041388 0.024200439453125 3 0.9875393543134866 11.044348358020754 5384.0 39.98325710807756 0.0 - - - - - - - 147.27272727272728 10 22 INTS4 integrator complex subunit 4 523 67 C20140709_OR012_04 C20140709_OR012_04 TB416310.[MT7]-NVFRPGGHSYGGGATNANAR.4y5_1.heavy 537.521 / 545.279 24680.0 21.48509979248047 48 18 10 10 10 4.515384782409906 22.146506846893566 0.0 3 0.9823098590283164 9.265191685049247 24680.0 142.6915795755784 0.0 - - - - - - - 241.4 49 5 GDF5 growth differentiation factor 5 525 67 C20140709_OR012_04 C20140709_OR012_04 TB416310.[MT7]-NVFRPGGHSYGGGATNANAR.4b13_2.heavy 537.521 / 715.856 8665.0 21.48509979248047 48 18 10 10 10 4.515384782409906 22.146506846893566 0.0 3 0.9823098590283164 9.265191685049247 8665.0 8.593244300762427 1.0 - - - - - - - 246.625 18 8 GDF5 growth differentiation factor 5 527 67 C20140709_OR012_04 C20140709_OR012_04 TB416310.[MT7]-NVFRPGGHSYGGGATNANAR.4y6_1.heavy 537.521 / 646.327 14259.0 21.48509979248047 48 18 10 10 10 4.515384782409906 22.146506846893566 0.0 3 0.9823098590283164 9.265191685049247 14259.0 73.54741869820191 0.0 - - - - - - - 250.71428571428572 28 7 GDF5 growth differentiation factor 5 529 67 C20140709_OR012_04 C20140709_OR012_04 TB416310.[MT7]-NVFRPGGHSYGGGATNANAR.4b9_2.heavy 537.521 / 548.792 8556.0 21.48509979248047 48 18 10 10 10 4.515384782409906 22.146506846893566 0.0 3 0.9823098590283164 9.265191685049247 8556.0 69.15123287671233 0.0 - - - - - - - 255.83333333333334 17 6 GDF5 growth differentiation factor 5 531 68 C20140709_OR012_04 C20140709_OR012_04 TB416112.[MT7]-TNAALGFAQMLPR.3y6_1.heavy 511.949 / 715.392 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 533 68 C20140709_OR012_04 C20140709_OR012_04 TB416112.[MT7]-TNAALGFAQMLPR.3b6_1.heavy 511.949 / 672.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 535 68 C20140709_OR012_04 C20140709_OR012_04 TB416112.[MT7]-TNAALGFAQMLPR.3b4_1.heavy 511.949 / 502.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 537 68 C20140709_OR012_04 C20140709_OR012_04 TB416112.[MT7]-TNAALGFAQMLPR.3y4_1.heavy 511.949 / 516.296 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 539 69 C20140709_OR012_04 C20140709_OR012_04 TB416111.[MT7]-ILEGEGNQEAGK[MT7].3y5_1.heavy 511.61 / 676.375 N/A 24.491467157999676 44 20 9 5 10 8.142149573219742 12.281768972767209 0.044200897216796875 3 0.9947163117119093 16.970802017509108 122.0 0.6222546575036997 37.0 - - - - - - - 243.25 5 4 QRICH2 glutamine rich 2 541 69 C20140709_OR012_04 C20140709_OR012_04 TB416111.[MT7]-ILEGEGNQEAGK[MT7].3b5_1.heavy 511.61 / 686.384 1461.0 24.491467157999676 44 20 9 5 10 8.142149573219742 12.281768972767209 0.044200897216796875 3 0.9947163117119093 16.970802017509108 1461.0 5.046816274402481 1.0 - - - - - - - 229.77777777777777 2 9 QRICH2 glutamine rich 2 543 69 C20140709_OR012_04 C20140709_OR012_04 TB416111.[MT7]-ILEGEGNQEAGK[MT7].3b3_1.heavy 511.61 / 500.32 2191.0 24.491467157999676 44 20 9 5 10 8.142149573219742 12.281768972767209 0.044200897216796875 3 0.9947163117119093 16.970802017509108 2191.0 6.2985626283367555 0.0 - - - - - - - 314.4166666666667 4 12 QRICH2 glutamine rich 2 545 69 C20140709_OR012_04 C20140709_OR012_04 TB416111.[MT7]-ILEGEGNQEAGK[MT7].3y4_1.heavy 511.61 / 548.316 1217.0 24.491467157999676 44 20 9 5 10 8.142149573219742 12.281768972767209 0.044200897216796875 3 0.9947163117119093 16.970802017509108 1217.0 13.48322370640221 4.0 - - - - - - - 265.45454545454544 2 11 QRICH2 glutamine rich 2 547 70 C20140709_OR012_04 C20140709_OR012_04 TB416258.[MT7]-RATYIGPSTVFGSSGK[MT7].3b6_1.heavy 639.354 / 806.464 2821.0 31.501999855041504 33 11 10 2 10 0.6760789853926042 77.08451929331754 0.08960151672363281 3 0.8694037575898014 3.3771719576227945 2821.0 2.355253623188406 1.0 - - - - - - - 204.5 5 6 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 549 70 C20140709_OR012_04 C20140709_OR012_04 TB416258.[MT7]-RATYIGPSTVFGSSGK[MT7].3y6_1.heavy 639.354 / 726.39 7605.0 31.501999855041504 33 11 10 2 10 0.6760789853926042 77.08451929331754 0.08960151672363281 3 0.8694037575898014 3.3771719576227945 7605.0 17.33482899678466 0.0 - - - - - - - 398.75 15 4 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 551 70 C20140709_OR012_04 C20140709_OR012_04 TB416258.[MT7]-RATYIGPSTVFGSSGK[MT7].3y5_1.heavy 639.354 / 579.322 10794.0 31.501999855041504 33 11 10 2 10 0.6760789853926042 77.08451929331754 0.08960151672363281 3 0.8694037575898014 3.3771719576227945 10794.0 69.13260093167702 0.0 - - - - - - - 273.6923076923077 21 13 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 553 70 C20140709_OR012_04 C20140709_OR012_04 TB416258.[MT7]-RATYIGPSTVFGSSGK[MT7].3b4_1.heavy 639.354 / 636.359 2821.0 31.501999855041504 33 11 10 2 10 0.6760789853926042 77.08451929331754 0.08960151672363281 3 0.8694037575898014 3.3771719576227945 2821.0 5.859872193326284 0.0 - - - - - - - 368.125 5 8 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 555 71 C20140709_OR012_04 C20140709_OR012_04 TB416257.[MT7]-ATPGAPALTSMTPTAVER.3y6_1.heavy 639.007 / 672.367 11176.0 33.60770034790039 48 18 10 10 10 3.1153364037130924 25.200025065515945 0.0 3 0.9869681904114394 10.799091951269052 11176.0 41.974005825587774 0.0 - - - - - - - 275.7 22 10 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 557 71 C20140709_OR012_04 C20140709_OR012_04 TB416257.[MT7]-ATPGAPALTSMTPTAVER.3b5_1.heavy 639.007 / 542.305 17486.0 33.60770034790039 48 18 10 10 10 3.1153364037130924 25.200025065515945 0.0 3 0.9869681904114394 10.799091951269052 17486.0 93.74623574144486 0.0 - - - - - - - 229.875 34 8 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 559 71 C20140709_OR012_04 C20140709_OR012_04 TB416257.[MT7]-ATPGAPALTSMTPTAVER.3b7_1.heavy 639.007 / 710.395 6968.0 33.60770034790039 48 18 10 10 10 3.1153364037130924 25.200025065515945 0.0 3 0.9869681904114394 10.799091951269052 6968.0 12.329068308235316 1.0 - - - - - - - 246.125 22 8 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 561 71 C20140709_OR012_04 C20140709_OR012_04 TB416257.[MT7]-ATPGAPALTSMTPTAVER.3y9_1.heavy 639.007 / 991.488 5391.0 33.60770034790039 48 18 10 10 10 3.1153364037130924 25.200025065515945 0.0 3 0.9869681904114394 10.799091951269052 5391.0 75.72091603053435 0.0 - - - - - - - 170.5 10 10 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 563 72 C20140709_OR012_04 C20140709_OR012_04 TB416315.[MT7]-LRPVSSRPQETVQAQSSR.4y5_1.heavy 543.301 / 548.279 22090.0 21.03499984741211 50 20 10 10 10 8.291918998903128 12.059934499267083 0.0 3 0.990552057847921 12.68677479660666 22090.0 117.77983645574426 0.0 - - - - - - - 183.25 44 8 C17orf53 chromosome 17 open reading frame 53 565 72 C20140709_OR012_04 C20140709_OR012_04 TB416315.[MT7]-LRPVSSRPQETVQAQSSR.4b11_2.heavy 543.301 / 698.395 7329.0 21.03499984741211 50 20 10 10 10 8.291918998903128 12.059934499267083 0.0 3 0.990552057847921 12.68677479660666 7329.0 39.19967172369761 0.0 - - - - - - - 279.0 14 6 C17orf53 chromosome 17 open reading frame 53 567 72 C20140709_OR012_04 C20140709_OR012_04 TB416315.[MT7]-LRPVSSRPQETVQAQSSR.4b12_2.heavy 543.301 / 747.929 7747.0 21.03499984741211 50 20 10 10 10 8.291918998903128 12.059934499267083 0.0 3 0.990552057847921 12.68677479660666 7747.0 43.5774508494424 0.0 - - - - - - - 209.33333333333334 15 6 C17orf53 chromosome 17 open reading frame 53 569 72 C20140709_OR012_04 C20140709_OR012_04 TB416315.[MT7]-LRPVSSRPQETVQAQSSR.4y6_1.heavy 543.301 / 676.337 14867.0 21.03499984741211 50 20 10 10 10 8.291918998903128 12.059934499267083 0.0 3 0.990552057847921 12.68677479660666 14867.0 74.58911740814264 0.0 - - - - - - - 261.75 29 8 C17orf53 chromosome 17 open reading frame 53 571 73 C20140709_OR012_04 C20140709_OR012_04 TB416318.[MT7]-SVPGLDGSGWEVFDIWK[MT7].2y4_1.heavy 1090.57 / 705.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 573 73 C20140709_OR012_04 C20140709_OR012_04 TB416318.[MT7]-SVPGLDGSGWEVFDIWK[MT7].2y3_1.heavy 1090.57 / 590.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 575 73 C20140709_OR012_04 C20140709_OR012_04 TB416318.[MT7]-SVPGLDGSGWEVFDIWK[MT7].2b11_1.heavy 1090.57 / 1229.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 577 73 C20140709_OR012_04 C20140709_OR012_04 TB416318.[MT7]-SVPGLDGSGWEVFDIWK[MT7].2b10_1.heavy 1090.57 / 1100.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 579 74 C20140709_OR012_04 C20140709_OR012_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 149931.0 19.146699905395508 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 149931.0 1200.2540806451614 0.0 - - - - - - - 241.8 299 10 581 74 C20140709_OR012_04 C20140709_OR012_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 93719.0 19.146699905395508 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 93719.0 1162.249964157706 0.0 - - - - - - - 268.6666666666667 187 9 583 74 C20140709_OR012_04 C20140709_OR012_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 113542.0 19.146699905395508 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 113542.0 1558.6589964157706 0.0 - - - - - - - 248.0 227 12 585 75 C20140709_OR012_04 C20140709_OR012_04 TB416319.[MT7]-SVPGLDGSGWEVFDIWK[MT7].4y4_1.heavy 545.787 / 705.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 587 75 C20140709_OR012_04 C20140709_OR012_04 TB416319.[MT7]-SVPGLDGSGWEVFDIWK[MT7].4b7_1.heavy 545.787 / 770.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 589 75 C20140709_OR012_04 C20140709_OR012_04 TB416319.[MT7]-SVPGLDGSGWEVFDIWK[MT7].4b4_1.heavy 545.787 / 485.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 591 75 C20140709_OR012_04 C20140709_OR012_04 TB416319.[MT7]-SVPGLDGSGWEVFDIWK[MT7].4b6_1.heavy 545.787 / 713.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 593 76 C20140709_OR012_04 C20140709_OR012_04 TB434097.[MT7]-GPVPAIHK[MT7].2y4_1.heavy 553.85 / 612.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - C17orf53 chromosome 17 open reading frame 53 595 76 C20140709_OR012_04 C20140709_OR012_04 TB434097.[MT7]-GPVPAIHK[MT7].2y5_1.heavy 553.85 / 709.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - C17orf53 chromosome 17 open reading frame 53 597 76 C20140709_OR012_04 C20140709_OR012_04 TB434097.[MT7]-GPVPAIHK[MT7].2y3_1.heavy 553.85 / 541.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - C17orf53 chromosome 17 open reading frame 53 599 76 C20140709_OR012_04 C20140709_OR012_04 TB434097.[MT7]-GPVPAIHK[MT7].2b5_1.heavy 553.85 / 566.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - C17orf53 chromosome 17 open reading frame 53 601 77 C20140709_OR012_04 C20140709_OR012_04 TB415794.[MT7]-ALLEQK[MT7].2y4_1.heavy 495.315 / 661.4 7187.0 24.921449661254883 43 18 10 5 10 4.041269361886147 24.74470050007453 0.041900634765625 3 0.9820729833067756 9.20359320930177 7187.0 59.951298092141236 0.0 - - - - - - - 284.5833333333333 14 12 TAOK1;TUB TAO kinase 1;tubby homolog (mouse) 603 77 C20140709_OR012_04 C20140709_OR012_04 TB415794.[MT7]-ALLEQK[MT7].2y5_1.heavy 495.315 / 774.484 4359.0 24.921449661254883 43 18 10 5 10 4.041269361886147 24.74470050007453 0.041900634765625 3 0.9820729833067756 9.20359320930177 4359.0 48.022881355932206 1.0 - - - - - - - 303.0 13 7 TAOK1;TUB TAO kinase 1;tubby homolog (mouse) 605 77 C20140709_OR012_04 C20140709_OR012_04 TB415794.[MT7]-ALLEQK[MT7].2b4_1.heavy 495.315 / 571.357 4595.0 24.921449661254883 43 18 10 5 10 4.041269361886147 24.74470050007453 0.041900634765625 3 0.9820729833067756 9.20359320930177 4595.0 43.38851970999184 0.0 - - - - - - - 259.0 9 5 TAOK1;TUB TAO kinase 1;tubby homolog (mouse) 607 77 C20140709_OR012_04 C20140709_OR012_04 TB415794.[MT7]-ALLEQK[MT7].2y3_1.heavy 495.315 / 548.316 5773.0 24.921449661254883 43 18 10 5 10 4.041269361886147 24.74470050007453 0.041900634765625 3 0.9820729833067756 9.20359320930177 5773.0 13.110111594016544 0.0 - - - - - - - 252.57142857142858 11 7 TAOK1;TUB TAO kinase 1;tubby homolog (mouse) 609 78 C20140709_OR012_04 C20140709_OR012_04 TB415797.[MT7]-SPEELK[MT7].2y4_1.heavy 495.789 / 662.384 2061.0 21.574774742126465 38 18 10 2 8 3.2744155350748705 24.424740890913903 0.08810043334960938 4 0.9861728677633647 10.483218012259645 2061.0 26.016652173913045 1.0 - - - - - - - 206.4 4 5 S100G S100 calcium binding protein G 611 78 C20140709_OR012_04 C20140709_OR012_04 TB415797.[MT7]-SPEELK[MT7].2y5_1.heavy 495.789 / 759.437 5612.0 21.574774742126465 38 18 10 2 8 3.2744155350748705 24.424740890913903 0.08810043334960938 4 0.9861728677633647 10.483218012259645 5612.0 17.462341829998984 0.0 - - - - - - - 286.5 11 4 S100G S100 calcium binding protein G 613 78 C20140709_OR012_04 C20140709_OR012_04 TB415797.[MT7]-SPEELK[MT7].2b4_1.heavy 495.789 / 587.279 1031.0 21.574774742126465 38 18 10 2 8 3.2744155350748705 24.424740890913903 0.08810043334960938 4 0.9861728677633647 10.483218012259645 1031.0 1.5982751091703056 3.0 - - - - - - - 210.16666666666666 2 6 S100G S100 calcium binding protein G 615 78 C20140709_OR012_04 C20140709_OR012_04 TB415797.[MT7]-SPEELK[MT7].2y3_1.heavy 495.789 / 533.341 1832.0 21.574774742126465 38 18 10 2 8 3.2744155350748705 24.424740890913903 0.08810043334960938 4 0.9861728677633647 10.483218012259645 1832.0 10.626086956521739 0.0 - - - - - - - 186.375 3 8 S100G S100 calcium binding protein G 617 79 C20140709_OR012_04 C20140709_OR012_04 TB434094.[MT7]-FMDVYQR.2y4_1.heavy 551.777 / 565.309 43392.0 32.05080032348633 50 20 10 10 10 20.37620885234357 4.907684286348415 0.0 3 0.9980658746483617 28.05756888511037 43392.0 159.00714285714287 0.0 - - - - - - - 241.77777777777777 86 9 VEGFA vascular endothelial growth factor A 619 79 C20140709_OR012_04 C20140709_OR012_04 TB434094.[MT7]-FMDVYQR.2b3_1.heavy 551.777 / 538.245 44032.0 32.05080032348633 50 20 10 10 10 20.37620885234357 4.907684286348415 0.0 3 0.9980658746483617 28.05756888511037 44032.0 95.56945454545453 0.0 - - - - - - - 256.0 88 1 VEGFA vascular endothelial growth factor A 621 79 C20140709_OR012_04 C20140709_OR012_04 TB434094.[MT7]-FMDVYQR.2b4_1.heavy 551.777 / 637.314 13568.0 32.05080032348633 50 20 10 10 10 20.37620885234357 4.907684286348415 0.0 3 0.9980658746483617 28.05756888511037 13568.0 23.651869158878505 1.0 - - - - - - - 201.14285714285714 27 7 VEGFA vascular endothelial growth factor A 623 79 C20140709_OR012_04 C20140709_OR012_04 TB434094.[MT7]-FMDVYQR.2y6_1.heavy 551.777 / 811.377 25216.0 32.05080032348633 50 20 10 10 10 20.37620885234357 4.907684286348415 0.0 3 0.9980658746483617 28.05756888511037 25216.0 80.44166666666666 0.0 - - - - - - - 170.66666666666666 50 6 VEGFA vascular endothelial growth factor A 625 80 C20140709_OR012_04 C20140709_OR012_04 TB434120.[MT7]-GLVQPGAVQR.2y8_1.heavy 584.85 / 854.484 3804.0 24.417800903320312 48 18 10 10 10 5.103534582597883 19.594263227093958 0.0 3 0.9861704201525555 10.48228814267721 3804.0 21.95533646452471 0.0 - - - - - - - 260.75 7 8 QRICH2 glutamine rich 2 627 80 C20140709_OR012_04 C20140709_OR012_04 TB434120.[MT7]-GLVQPGAVQR.2b4_1.heavy 584.85 / 542.342 9817.0 24.417800903320312 48 18 10 10 10 5.103534582597883 19.594263227093958 0.0 3 0.9861704201525555 10.48228814267721 9817.0 89.82325103835278 0.0 - - - - - - - 233.1 19 10 QRICH2 glutamine rich 2 629 80 C20140709_OR012_04 C20140709_OR012_04 TB434120.[MT7]-GLVQPGAVQR.2y6_1.heavy 584.85 / 627.357 14357.0 24.417800903320312 48 18 10 10 10 5.103534582597883 19.594263227093958 0.0 3 0.9861704201525555 10.48228814267721 14357.0 54.1671181416713 0.0 - - - - - - - 184.25 28 4 QRICH2 glutamine rich 2 631 80 C20140709_OR012_04 C20140709_OR012_04 TB434120.[MT7]-GLVQPGAVQR.2y7_1.heavy 584.85 / 755.416 6381.0 24.417800903320312 48 18 10 10 10 5.103534582597883 19.594263227093958 0.0 3 0.9861704201525555 10.48228814267721 6381.0 24.585078051964086 1.0 - - - - - - - 291.25 16 8 QRICH2 glutamine rich 2 633 81 C20140709_OR012_04 C20140709_OR012_04 TB415984.[MT7]-IASLLGLLSK[MT7].3b6_1.heavy 434.958 / 699.452 63.0 49.303375244140625 33 7 10 6 10 1.9307822498298577 40.78219464356805 0.034698486328125 3 0.7223682625674129 2.2857329019044577 63.0 0.45999999999999996 7.0 - - - - - - - 0.0 0 0 INTS4 integrator complex subunit 4 635 81 C20140709_OR012_04 C20140709_OR012_04 TB415984.[MT7]-IASLLGLLSK[MT7].3y3_1.heavy 434.958 / 491.331 1834.0 49.303375244140625 33 7 10 6 10 1.9307822498298577 40.78219464356805 0.034698486328125 3 0.7223682625674129 2.2857329019044577 1834.0 37.79847953216374 0.0 - - - - - - - 253.0 3 6 INTS4 integrator complex subunit 4 637 81 C20140709_OR012_04 C20140709_OR012_04 TB415984.[MT7]-IASLLGLLSK[MT7].3b4_1.heavy 434.958 / 529.347 3099.0 49.303375244140625 33 7 10 6 10 1.9307822498298577 40.78219464356805 0.034698486328125 3 0.7223682625674129 2.2857329019044577 3099.0 26.06123094297007 0.0 - - - - - - - 221.25 6 4 INTS4 integrator complex subunit 4 639 81 C20140709_OR012_04 C20140709_OR012_04 TB415984.[MT7]-IASLLGLLSK[MT7].3b5_1.heavy 434.958 / 642.431 1328.0 49.303375244140625 33 7 10 6 10 1.9307822498298577 40.78219464356805 0.034698486328125 3 0.7223682625674129 2.2857329019044577 1328.0 31.61904761904762 0.0 - - - - - - - 232.0 2 3 INTS4 integrator complex subunit 4 641 82 C20140709_OR012_04 C20140709_OR012_04 TB446556.[MT7]-TPQQPTHPSTR.3y7_1.heavy 465.248 / 795.411 832.0 15.669125318527222 39 14 10 5 10 1.2353110340480187 46.34917695106872 0.04069995880126953 3 0.9303903143937315 4.650241350958717 832.0 37.10798122065728 0.0 - - - - - - - 0.0 1 0 C17orf53 chromosome 17 open reading frame 53 643 82 C20140709_OR012_04 C20140709_OR012_04 TB446556.[MT7]-TPQQPTHPSTR.3y5_1.heavy 465.248 / 597.31 927.0 15.669125318527222 39 14 10 5 10 1.2353110340480187 46.34917695106872 0.04069995880126953 3 0.9303903143937315 4.650241350958717 927.0 49.74464788732394 0.0 - - - - - - - 0.0 1 0 C17orf53 chromosome 17 open reading frame 53 645 82 C20140709_OR012_04 C20140709_OR012_04 TB446556.[MT7]-TPQQPTHPSTR.3b4_1.heavy 465.248 / 599.327 998.0 15.669125318527222 39 14 10 5 10 1.2353110340480187 46.34917695106872 0.04069995880126953 3 0.9303903143937315 4.650241350958717 998.0 18.02259630069574 0.0 - - - - - - - 0.0 1 0 C17orf53 chromosome 17 open reading frame 53 647 82 C20140709_OR012_04 C20140709_OR012_04 TB446556.[MT7]-TPQQPTHPSTR.3b3_1.heavy 465.248 / 471.268 760.0 15.669125318527222 39 14 10 5 10 1.2353110340480187 46.34917695106872 0.04069995880126953 3 0.9303903143937315 4.650241350958717 760.0 17.77591036414566 0.0 - - - - - - - 0.0 1 0 C17orf53 chromosome 17 open reading frame 53 649 83 C20140709_OR012_04 C20140709_OR012_04 TB415986.[MT7]-RHLQSHDK[MT7].3y3_1.heavy 436.917 / 543.301 415.0 12.846250057220459 43 17 10 6 10 3.123094290853187 32.019526369369196 0.03619956970214844 3 0.9772395789463073 8.164790350849007 415.0 21.028991596638654 0.0 - - - - - - - 0.0 0 0 ZXDB;ZXDA;ZXDC zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A;ZXD family zinc finger C 651 83 C20140709_OR012_04 C20140709_OR012_04 TB415986.[MT7]-RHLQSHDK[MT7].3b4_1.heavy 436.917 / 679.412 179.0 12.846250057220459 43 17 10 6 10 3.123094290853187 32.019526369369196 0.03619956970214844 3 0.9772395789463073 8.164790350849007 179.0 16.836376811594203 0.0 - - - - - - - 0.0 0 0 ZXDB;ZXDA;ZXDC zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A;ZXD family zinc finger C 653 83 C20140709_OR012_04 C20140709_OR012_04 TB415986.[MT7]-RHLQSHDK[MT7].3y4_1.heavy 436.917 / 630.333 403.0 12.846250057220459 43 17 10 6 10 3.123094290853187 32.019526369369196 0.03619956970214844 3 0.9772395789463073 8.164790350849007 403.0 16.491048593350385 0.0 - - - - - - - 0.0 0 0 ZXDB;ZXDA;ZXDC zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A;ZXD family zinc finger C 655 83 C20140709_OR012_04 C20140709_OR012_04 TB415986.[MT7]-RHLQSHDK[MT7].3b3_1.heavy 436.917 / 551.353 184.0 12.846250057220459 43 17 10 6 10 3.123094290853187 32.019526369369196 0.03619956970214844 3 0.9772395789463073 8.164790350849007 184.0 12.266666666666667 0.0 - - - - - - - 0.0 0 0 ZXDB;ZXDA;ZXDC zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A;ZXD family zinc finger C 657 84 C20140709_OR012_04 C20140709_OR012_04 TB434126.[MT7]-LASHIFVK[MT7].3y3_1.heavy 401.588 / 537.352 19595.0 30.08489990234375 45 17 10 10 8 3.3871428511559913 29.523407896974643 0.0 4 0.9768517282229319 8.09583673456243 19595.0 81.92064500110682 0.0 - - - - - - - 206.5 39 4 TJP1 tight junction protein 1 (zona occludens 1) 659 84 C20140709_OR012_04 C20140709_OR012_04 TB434126.[MT7]-LASHIFVK[MT7].3b4_1.heavy 401.588 / 553.321 6728.0 30.08489990234375 45 17 10 10 8 3.3871428511559913 29.523407896974643 0.0 4 0.9768517282229319 8.09583673456243 6728.0 36.009901992639996 0.0 - - - - - - - 259.6 13 10 TJP1 tight junction protein 1 (zona occludens 1) 661 84 C20140709_OR012_04 C20140709_OR012_04 TB434126.[MT7]-LASHIFVK[MT7].3y4_1.heavy 401.588 / 650.436 1535.0 30.08489990234375 45 17 10 10 8 3.3871428511559913 29.523407896974643 0.0 4 0.9768517282229319 8.09583673456243 1535.0 15.957062146892655 1.0 - - - - - - - 252.85714285714286 3 7 TJP1 tight junction protein 1 (zona occludens 1) 663 84 C20140709_OR012_04 C20140709_OR012_04 TB434126.[MT7]-LASHIFVK[MT7].3b3_1.heavy 401.588 / 416.263 5430.0 30.08489990234375 45 17 10 10 8 3.3871428511559913 29.523407896974643 0.0 4 0.9768517282229319 8.09583673456243 5430.0 4.5270242059744525 3.0 - - - - - - - 339.25 19 8 TJP1 tight junction protein 1 (zona occludens 1) 665 85 C20140709_OR012_04 C20140709_OR012_04 TB416056.[MT7]-ESPYGLSFNK[MT7].3y3_1.heavy 477.257 / 552.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1 tight junction protein 1 (zona occludens 1) 667 85 C20140709_OR012_04 C20140709_OR012_04 TB416056.[MT7]-ESPYGLSFNK[MT7].3b4_1.heavy 477.257 / 621.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1 tight junction protein 1 (zona occludens 1) 669 85 C20140709_OR012_04 C20140709_OR012_04 TB416056.[MT7]-ESPYGLSFNK[MT7].3b5_1.heavy 477.257 / 678.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1 tight junction protein 1 (zona occludens 1) 671 85 C20140709_OR012_04 C20140709_OR012_04 TB416056.[MT7]-ESPYGLSFNK[MT7].3y4_1.heavy 477.257 / 639.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1 tight junction protein 1 (zona occludens 1) 673 86 C20140709_OR012_04 C20140709_OR012_04 TB434127.[MT7]-FPEILATLR.2b3_1.heavy 602.365 / 518.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 675 86 C20140709_OR012_04 C20140709_OR012_04 TB434127.[MT7]-FPEILATLR.2y5_1.heavy 602.365 / 573.372 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 677 86 C20140709_OR012_04 C20140709_OR012_04 TB434127.[MT7]-FPEILATLR.2b4_1.heavy 602.365 / 631.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 679 86 C20140709_OR012_04 C20140709_OR012_04 TB434127.[MT7]-FPEILATLR.2y6_1.heavy 602.365 / 686.456 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 681 87 C20140709_OR012_04 C20140709_OR012_04 TB416057.[MT7]-QQQQQLDQK[MT7].2b3_1.heavy 716.393 / 529.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 683 87 C20140709_OR012_04 C20140709_OR012_04 TB416057.[MT7]-QQQQQLDQK[MT7].2b4_1.heavy 716.393 / 657.344 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 685 87 C20140709_OR012_04 C20140709_OR012_04 TB416057.[MT7]-QQQQQLDQK[MT7].2b7_1.heavy 716.393 / 1013.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 687 87 C20140709_OR012_04 C20140709_OR012_04 TB416057.[MT7]-QQQQQLDQK[MT7].2b5_1.heavy 716.393 / 785.402 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 689 88 C20140709_OR012_04 C20140709_OR012_04 TB446513.[MT7]-VPNMAVMIK[MT7].2y4_1.heavy 645.879 / 634.408 2612.0 36.62919998168945 36 8 10 10 8 0.9563010301039364 65.64682855773664 0.0 4 0.7888539695481673 2.6370293945783327 2612.0 2.665306122448979 1.0 - - - - - - - 228.625 8 8 C17orf53 chromosome 17 open reading frame 53 691 88 C20140709_OR012_04 C20140709_OR012_04 TB446513.[MT7]-VPNMAVMIK[MT7].2y8_1.heavy 645.879 / 1047.58 14759.0 36.62919998168945 36 8 10 10 8 0.9563010301039364 65.64682855773664 0.0 4 0.7888539695481673 2.6370293945783327 14759.0 90.43046680741261 0.0 - - - - - - - 233.35714285714286 29 14 C17orf53 chromosome 17 open reading frame 53 693 88 C20140709_OR012_04 C20140709_OR012_04 TB446513.[MT7]-VPNMAVMIK[MT7].2y5_1.heavy 645.879 / 705.445 2090.0 36.62919998168945 36 8 10 10 8 0.9563010301039364 65.64682855773664 0.0 4 0.7888539695481673 2.6370293945783327 2090.0 9.478718323329401 0.0 - - - - - - - 559.4285714285714 4 7 C17orf53 chromosome 17 open reading frame 53 695 88 C20140709_OR012_04 C20140709_OR012_04 TB446513.[MT7]-VPNMAVMIK[MT7].2y3_1.heavy 645.879 / 535.339 4702.0 36.62919998168945 36 8 10 10 8 0.9563010301039364 65.64682855773664 0.0 4 0.7888539695481673 2.6370293945783327 4702.0 15.067281776416538 0.0 - - - - - - - 636.5 9 8 C17orf53 chromosome 17 open reading frame 53 697 89 C20140709_OR012_04 C20140709_OR012_04 TB434098.[MT7]-ATQQMIK[MT7].2b4_1.heavy 554.325 / 573.311 3063.0 21.707599639892578 46 16 10 10 10 2.2094392592727665 36.018677768342805 0.0 3 0.9671412693349505 6.7895431367711465 3063.0 11.37836503628086 0.0 - - - - - - - 235.66666666666666 6 6 SIM1 single-minded homolog 1 (Drosophila) 699 89 C20140709_OR012_04 C20140709_OR012_04 TB434098.[MT7]-ATQQMIK[MT7].2y3_1.heavy 554.325 / 535.339 2238.0 21.707599639892578 46 16 10 10 10 2.2094392592727665 36.018677768342805 0.0 3 0.9671412693349505 6.7895431367711465 2238.0 7.792757478273394 0.0 - - - - - - - 209.55555555555554 4 9 SIM1 single-minded homolog 1 (Drosophila) 701 89 C20140709_OR012_04 C20140709_OR012_04 TB434098.[MT7]-ATQQMIK[MT7].2y6_1.heavy 554.325 / 892.504 2474.0 21.707599639892578 46 16 10 10 10 2.2094392592727665 36.018677768342805 0.0 3 0.9671412693349505 6.7895431367711465 2474.0 18.76466101694915 0.0 - - - - - - - 188.8 4 5 SIM1 single-minded homolog 1 (Drosophila) 703 89 C20140709_OR012_04 C20140709_OR012_04 TB434098.[MT7]-ATQQMIK[MT7].2b5_1.heavy 554.325 / 704.352 1649.0 21.707599639892578 46 16 10 10 10 2.2094392592727665 36.018677768342805 0.0 3 0.9671412693349505 6.7895431367711465 1649.0 6.445027877519351 1.0 - - - - - - - 392.3333333333333 3 3 SIM1 single-minded homolog 1 (Drosophila) 705 90 C20140709_OR012_04 C20140709_OR012_04 TB416054.[MT7]-GALLLGPPGC[CAM]GK[MT7].3b6_1.heavy 476.614 / 669.442 2368.0 32.988423347473145 45 20 10 5 10 7.15075398243559 13.984539287133943 0.043498992919921875 3 0.995853370756463 19.15863576686227 2368.0 8.576178659094191 0.0 - - - - - - - 285.3333333333333 4 6 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 707 90 C20140709_OR012_04 C20140709_OR012_04 TB416054.[MT7]-GALLLGPPGC[CAM]GK[MT7].3b4_1.heavy 476.614 / 499.336 5263.0 32.988423347473145 45 20 10 5 10 7.15075398243559 13.984539287133943 0.043498992919921875 3 0.995853370756463 19.15863576686227 5263.0 3.1643783392543328 1.0 - - - - - - - 219.55555555555554 11 9 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 709 90 C20140709_OR012_04 C20140709_OR012_04 TB416054.[MT7]-GALLLGPPGC[CAM]GK[MT7].3y4_1.heavy 476.614 / 565.288 3815.0 32.988423347473145 45 20 10 5 10 7.15075398243559 13.984539287133943 0.043498992919921875 3 0.995853370756463 19.15863576686227 3815.0 6.948772687427151 1.0 - - - - - - - 210.8 7 5 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 711 90 C20140709_OR012_04 C20140709_OR012_04 TB416054.[MT7]-GALLLGPPGC[CAM]GK[MT7].3y5_1.heavy 476.614 / 662.341 6447.0 32.988423347473145 45 20 10 5 10 7.15075398243559 13.984539287133943 0.043498992919921875 3 0.995853370756463 19.15863576686227 6447.0 47.31068441064639 0.0 - - - - - - - 237.0 12 5 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 713 91 C20140709_OR012_04 C20140709_OR012_04 TB434124.[MT7]-VFLLAGRK[MT7].2y4_1.heavy 596.394 / 575.375 2063.0 32.05080032348633 46 18 10 10 8 5.87809420725914 17.012316658093916 0.0 4 0.9844844347094158 9.894991762332328 2063.0 2.198837209302326 7.0 - - - - - - - 693.375 6 8 TUB;TULP1 tubby homolog (mouse);tubby like protein 1 715 91 C20140709_OR012_04 C20140709_OR012_04 TB434124.[MT7]-VFLLAGRK[MT7].2b4_1.heavy 596.394 / 617.414 774.0 32.05080032348633 46 18 10 10 8 5.87809420725914 17.012316658093916 0.0 4 0.9844844347094158 9.894991762332328 774.0 0.5714285714285713 22.0 - - - - - - - 232.2 3 10 TUB;TULP1 tubby homolog (mouse);tubby like protein 1 717 91 C20140709_OR012_04 C20140709_OR012_04 TB434124.[MT7]-VFLLAGRK[MT7].2y6_1.heavy 596.394 / 801.543 1805.0 32.05080032348633 46 18 10 10 8 5.87809420725914 17.012316658093916 0.0 4 0.9844844347094158 9.894991762332328 1805.0 5.083850129198966 0.0 - - - - - - - 225.75 3 8 TUB;TULP1 tubby homolog (mouse);tubby like protein 1 719 91 C20140709_OR012_04 C20140709_OR012_04 TB434124.[MT7]-VFLLAGRK[MT7].2y7_1.heavy 596.394 / 948.611 3997.0 32.05080032348633 46 18 10 10 8 5.87809420725914 17.012316658093916 0.0 4 0.9844844347094158 9.894991762332328 3997.0 45.841562015503875 0.0 - - - - - - - 184.28571428571428 7 7 TUB;TULP1 tubby homolog (mouse);tubby like protein 1 721 92 C20140709_OR012_04 C20140709_OR012_04 TB434125.[MT7]-VQELLQGK[MT7].2y4_1.heavy 601.871 / 589.379 8145.0 31.77400016784668 39 13 6 10 10 1.2203298628568031 54.630037906799565 0.0 3 0.9290734918241166 4.606351957559425 8145.0 24.290944223297988 1.0 - - - - - - - 250.6 35 5 RNF112 ring finger protein 112 723 92 C20140709_OR012_04 C20140709_OR012_04 TB434125.[MT7]-VQELLQGK[MT7].2b3_1.heavy 601.871 / 501.279 9147.0 31.77400016784668 39 13 6 10 10 1.2203298628568031 54.630037906799565 0.0 3 0.9290734918241166 4.606351957559425 9147.0 15.418060314638936 1.0 - - - - - - - 271.6666666666667 18 6 RNF112 ring finger protein 112 725 92 C20140709_OR012_04 C20140709_OR012_04 TB434125.[MT7]-VQELLQGK[MT7].2b4_1.heavy 601.871 / 614.363 11027.0 31.77400016784668 39 13 6 10 10 1.2203298628568031 54.630037906799565 0.0 3 0.9290734918241166 4.606351957559425 11027.0 39.64466374834572 0.0 - - - - - - - 250.66666666666666 22 6 RNF112 ring finger protein 112 727 92 C20140709_OR012_04 C20140709_OR012_04 TB434125.[MT7]-VQELLQGK[MT7].2y7_1.heavy 601.871 / 959.564 12029.0 31.77400016784668 39 13 6 10 10 1.2203298628568031 54.630037906799565 0.0 3 0.9290734918241166 4.606351957559425 12029.0 125.85456421276595 0.0 - - - - - - - 219.375 24 8 RNF112 ring finger protein 112 729 93 C20140709_OR012_04 C20140709_OR012_04 TB416055.[MT7]-GALLLGPPGC[CAM]GK[MT7].2y8_1.heavy 714.418 / 929.5 2500.0 33.05147361755371 38 13 10 5 10 5.368871618833463 18.625887728290994 0.04109954833984375 3 0.9272630537113452 4.547959358274169 2500.0 9.569074778200253 0.0 - - - - - - - 175.66666666666666 5 3 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 731 93 C20140709_OR012_04 C20140709_OR012_04 TB416055.[MT7]-GALLLGPPGC[CAM]GK[MT7].2y5_1.heavy 714.418 / 662.341 1447.0 33.05147361755371 38 13 10 5 10 5.368871618833463 18.625887728290994 0.04109954833984375 3 0.9272630537113452 4.547959358274169 1447.0 0.1284148745709666 3.0 - - - - - - - 248.55555555555554 3 9 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 733 93 C20140709_OR012_04 C20140709_OR012_04 TB416055.[MT7]-GALLLGPPGC[CAM]GK[MT7].2y6_1.heavy 714.418 / 759.394 3815.0 33.05147361755371 38 13 10 5 10 5.368871618833463 18.625887728290994 0.04109954833984375 3 0.9272630537113452 4.547959358274169 3815.0 9.51137760011844 0.0 - - - - - - - 219.66666666666666 7 6 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 735 93 C20140709_OR012_04 C20140709_OR012_04 TB416055.[MT7]-GALLLGPPGC[CAM]GK[MT7].2y7_1.heavy 714.418 / 816.415 4473.0 33.05147361755371 38 13 10 5 10 5.368871618833463 18.625887728290994 0.04109954833984375 3 0.9272630537113452 4.547959358274169 4473.0 5.160306390090292 0.0 - - - - - - - 244.57142857142858 8 7 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 737 94 C20140709_OR012_04 C20140709_OR012_04 TB446512.[MT7]-SLAIELLDK[MT7].2y5_1.heavy 645.4 / 761.453 7344.0 40.76750183105469 45 15 10 10 10 1.6628246651010936 41.05166732534723 0.0 3 0.9536611571022648 5.7108175626016875 7344.0 13.588864302488286 1.0 - - - - - - - 198.8 15 5 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 739 94 C20140709_OR012_04 C20140709_OR012_04 TB446512.[MT7]-SLAIELLDK[MT7].2b4_1.heavy 645.4 / 529.347 7717.0 40.76750183105469 45 15 10 10 10 1.6628246651010936 41.05166732534723 0.0 3 0.9536611571022648 5.7108175626016875 7717.0 11.872506358768408 0.0 - - - - - - - 269.5 15 6 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 741 94 C20140709_OR012_04 C20140709_OR012_04 TB446512.[MT7]-SLAIELLDK[MT7].2y3_1.heavy 645.4 / 519.326 4854.0 40.76750183105469 45 15 10 10 10 1.6628246651010936 41.05166732534723 0.0 3 0.9536611571022648 5.7108175626016875 4854.0 6.687283362815762 0.0 - - - - - - - 234.88888888888889 9 9 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 743 94 C20140709_OR012_04 C20140709_OR012_04 TB446512.[MT7]-SLAIELLDK[MT7].2b5_1.heavy 645.4 / 658.389 5850.0 40.76750183105469 45 15 10 10 10 1.6628246651010936 41.05166732534723 0.0 3 0.9536611571022648 5.7108175626016875 5850.0 16.24578313253012 1.0 - - - - - - - 260.0 11 11 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 745 95 C20140709_OR012_04 C20140709_OR012_04 TB434099.[MT7]-ALFLMTK[MT7].2y4_1.heavy 556.343 / 636.387 11241.0 38.592201232910156 47 17 10 10 10 2.8284666366876943 27.866896233743255 0.0 3 0.9711052604864779 7.242719371984497 11241.0 48.678974358974365 0.0 - - - - - - - 312.0 22 9 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 747 95 C20140709_OR012_04 C20140709_OR012_04 TB434099.[MT7]-ALFLMTK[MT7].2y5_1.heavy 556.343 / 783.456 4801.0 38.592201232910156 47 17 10 10 10 2.8284666366876943 27.866896233743255 0.0 3 0.9711052604864779 7.242719371984497 4801.0 19.696410256410257 0.0 - - - - - - - 248.625 9 8 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 749 95 C20140709_OR012_04 C20140709_OR012_04 TB434099.[MT7]-ALFLMTK[MT7].2y3_1.heavy 556.343 / 523.303 7026.0 38.592201232910156 47 17 10 10 10 2.8284666366876943 27.866896233743255 0.0 3 0.9711052604864779 7.242719371984497 7026.0 9.020832874229008 1.0 - - - - - - - 265.90909090909093 16 11 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 751 95 C20140709_OR012_04 C20140709_OR012_04 TB434099.[MT7]-ALFLMTK[MT7].2y6_1.heavy 556.343 / 896.54 3513.0 38.592201232910156 47 17 10 10 10 2.8284666366876943 27.866896233743255 0.0 3 0.9711052604864779 7.242719371984497 3513.0 23.82051282051282 1.0 - - - - - - - 234.0 7 3 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 753 96 C20140709_OR012_04 C20140709_OR012_04 TB416306.[MT7]-DTPVC[CAM]LLAVLGEQHSGK[MT7].4y4_1.heavy 528.789 / 572.327 3596.0 41.85894966125488 27 9 4 6 8 0.6430818120047582 89.6344413038463 0.037097930908203125 4 0.8040973633685723 2.741466486706203 3596.0 24.394090232724242 1.0 - - - - - - - 251.25 13 8 RNF112 ring finger protein 112 755 96 C20140709_OR012_04 C20140709_OR012_04 TB416306.[MT7]-DTPVC[CAM]LLAVLGEQHSGK[MT7].4b5_1.heavy 528.789 / 717.336 952.0 41.85894966125488 27 9 4 6 8 0.6430818120047582 89.6344413038463 0.037097930908203125 4 0.8040973633685723 2.741466486706203 952.0 3.4827509794684337 0.0 - - - - - - - 0.0 1 0 RNF112 ring finger protein 112 757 96 C20140709_OR012_04 C20140709_OR012_04 TB416306.[MT7]-DTPVC[CAM]LLAVLGEQHSGK[MT7].4y7_1.heavy 528.789 / 886.45 952.0 41.85894966125488 27 9 4 6 8 0.6430818120047582 89.6344413038463 0.037097930908203125 4 0.8040973633685723 2.741466486706203 952.0 0.9002364066193854 0.0 - - - - - - - 0.0 1 0 RNF112 ring finger protein 112 759 96 C20140709_OR012_04 C20140709_OR012_04 TB416306.[MT7]-DTPVC[CAM]LLAVLGEQHSGK[MT7].4b6_1.heavy 528.789 / 830.42 1904.0 41.85894966125488 27 9 4 6 8 0.6430818120047582 89.6344413038463 0.037097930908203125 4 0.8040973633685723 2.741466486706203 1904.0 17.64792452830189 0.0 - - - - - - - 211.66666666666666 3 6 RNF112 ring finger protein 112 761 97 C20140709_OR012_04 C20140709_OR012_04 TB415814.[MT7]-SSLILAK[MT7].2y4_1.heavy 510.339 / 588.42 2261.0 29.560524940490723 30 15 6 5 4 2.2568624093520677 44.309302855865916 0.040500640869140625 7 0.959538811290625 6.114595418548164 2261.0 5.050833333333332 1.0 - - - - - - - 158.66666666666666 7 9 SIM1 single-minded homolog 1 (Drosophila) 763 97 C20140709_OR012_04 C20140709_OR012_04 TB415814.[MT7]-SSLILAK[MT7].2b4_1.heavy 510.339 / 545.341 2618.0 29.560524940490723 30 15 6 5 4 2.2568624093520677 44.309302855865916 0.040500640869140625 7 0.959538811290625 6.114595418548164 2618.0 13.75 0.0 - - - - - - - 238.0 5 10 SIM1 single-minded homolog 1 (Drosophila) 765 97 C20140709_OR012_04 C20140709_OR012_04 TB415814.[MT7]-SSLILAK[MT7].2y6_1.heavy 510.339 / 788.536 595.0 29.560524940490723 30 15 6 5 4 2.2568624093520677 44.309302855865916 0.040500640869140625 7 0.959538811290625 6.114595418548164 595.0 3.0 9.0 - - - - - - - 0.0 1 0 SIM1 single-minded homolog 1 (Drosophila) 767 97 C20140709_OR012_04 C20140709_OR012_04 TB415814.[MT7]-SSLILAK[MT7].2b5_1.heavy 510.339 / 658.426 595.0 29.560524940490723 30 15 6 5 4 2.2568624093520677 44.309302855865916 0.040500640869140625 7 0.959538811290625 6.114595418548164 595.0 2.333333333333333 9.0 - - - - - - - 0.0 1 0 SIM1 single-minded homolog 1 (Drosophila) 769 98 C20140709_OR012_04 C20140709_OR012_04 TB416307.[MT7]-DTPVC[CAM]LLAVLGEQHSGK[MT7].3b6_1.heavy 704.717 / 830.42 5064.0 41.85894966125488 39 13 10 6 10 1.6693822869335897 40.031178529136525 0.037097930908203125 3 0.9294551652185512 4.618947007562157 5064.0 33.74233438485804 0.0 - - - - - - - 202.5 10 12 RNF112 ring finger protein 112 771 98 C20140709_OR012_04 C20140709_OR012_04 TB416307.[MT7]-DTPVC[CAM]LLAVLGEQHSGK[MT7].3b5_1.heavy 704.717 / 717.336 2743.0 41.85894966125488 39 13 10 6 10 1.6693822869335897 40.031178529136525 0.037097930908203125 3 0.9294551652185512 4.618947007562157 2743.0 6.160277248124001 0.0 - - - - - - - 211.3 5 10 RNF112 ring finger protein 112 773 98 C20140709_OR012_04 C20140709_OR012_04 TB416307.[MT7]-DTPVC[CAM]LLAVLGEQHSGK[MT7].3y4_1.heavy 704.717 / 572.327 4431.0 41.85894966125488 39 13 10 6 10 1.6693822869335897 40.031178529136525 0.037097930908203125 3 0.9294551652185512 4.618947007562157 4431.0 24.500000000000004 0.0 - - - - - - - 223.64705882352942 8 17 RNF112 ring finger protein 112 775 98 C20140709_OR012_04 C20140709_OR012_04 TB416307.[MT7]-DTPVC[CAM]LLAVLGEQHSGK[MT7].3b7_1.heavy 704.717 / 943.504 2638.0 41.85894966125488 39 13 10 6 10 1.6693822869335897 40.031178529136525 0.037097930908203125 3 0.9294551652185512 4.618947007562157 2638.0 7.812086744219444 1.0 - - - - - - - 225.4 9 15 RNF112 ring finger protein 112 777 99 C20140709_OR012_04 C20140709_OR012_04 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 171839.0 38.1692008972168 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 171839.0 693.0358411226377 0.0 - - - - - - - 332.8 343 5 779 99 C20140709_OR012_04 C20140709_OR012_04 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 142349.0 38.1692008972168 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 142349.0 1321.0374754012528 0.0 - - - - - - - 194.0 284 4 781 99 C20140709_OR012_04 C20140709_OR012_04 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 200331.0 38.1692008972168 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 200331.0 550.1571259398496 0.0 - - - - - - - 222.0 400 2 783 100 C20140709_OR012_04 C20140709_OR012_04 TB416187.[MT7]-LLQHPFVTQHLTR.4y4_1.heavy 434.254 / 526.31 10791.0 30.506900787353516 44 14 10 10 10 2.699054486010736 37.050011594172105 0.0 3 0.9330186346001923 4.741665408332051 10791.0 25.129975766356566 0.0 - - - - - - - 271.0 21 7 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 785 100 C20140709_OR012_04 C20140709_OR012_04 TB416187.[MT7]-LLQHPFVTQHLTR.4b4_1.heavy 434.254 / 636.395 4625.0 30.506900787353516 44 14 10 10 10 2.699054486010736 37.050011594172105 0.0 3 0.9330186346001923 4.741665408332051 4625.0 74.58298319327731 0.0 - - - - - - - 304.85714285714283 9 7 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 787 100 C20140709_OR012_04 C20140709_OR012_04 TB416187.[MT7]-LLQHPFVTQHLTR.4y6_1.heavy 434.254 / 755.416 3913.0 30.506900787353516 44 14 10 10 10 2.699054486010736 37.050011594172105 0.0 3 0.9330186346001923 4.741665408332051 3913.0 41.900984798413745 0.0 - - - - - - - 277.0 7 3 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 789 100 C20140709_OR012_04 C20140709_OR012_04 TB416187.[MT7]-LLQHPFVTQHLTR.4b3_1.heavy 434.254 / 499.336 18380.0 30.506900787353516 44 14 10 10 10 2.699054486010736 37.050011594172105 0.0 3 0.9330186346001923 4.741665408332051 18380.0 200.92875082617317 0.0 - - - - - - - 198.0 36 3 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 791 101 C20140709_OR012_04 C20140709_OR012_04 TB415819.[MT7]-NEEYGLR.2b3_1.heavy 512.763 / 517.237 1971.0 22.96929931640625 47 18 9 10 10 3.6096534799240407 23.373860675558703 0.0 3 0.98153561022623 9.068268443712286 1971.0 8.605579847596074 1.0 - - - - - - - 287.44444444444446 3 9 TJP1 tight junction protein 1 (zona occludens 1) 793 101 C20140709_OR012_04 C20140709_OR012_04 TB415819.[MT7]-NEEYGLR.2y4_1.heavy 512.763 / 508.288 3327.0 22.96929931640625 47 18 9 10 10 3.6096534799240407 23.373860675558703 0.0 3 0.98153561022623 9.068268443712286 3327.0 6.974036785634883 2.0 - - - - - - - 246.16666666666666 8 6 TJP1 tight junction protein 1 (zona occludens 1) 795 101 C20140709_OR012_04 C20140709_OR012_04 TB415819.[MT7]-NEEYGLR.2y6_1.heavy 512.763 / 766.373 2587.0 22.96929931640625 47 18 9 10 10 3.6096534799240407 23.373860675558703 0.0 3 0.98153561022623 9.068268443712286 2587.0 14.706851184881018 0.0 - - - - - - - 287.3333333333333 5 3 TJP1 tight junction protein 1 (zona occludens 1) 797 101 C20140709_OR012_04 C20140709_OR012_04 TB415819.[MT7]-NEEYGLR.2b5_1.heavy 512.763 / 737.322 1971.0 22.96929931640625 47 18 9 10 10 3.6096534799240407 23.373860675558703 0.0 3 0.98153561022623 9.068268443712286 1971.0 11.930044773165784 1.0 - - - - - - - 287.3333333333333 3 3 TJP1 tight junction protein 1 (zona occludens 1) 799 102 C20140709_OR012_04 C20140709_OR012_04 TB416189.[MT7]-K[MT7]RDLFFNEIK[MT7].4b8_2.heavy 436.264 / 669.874 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 801 102 C20140709_OR012_04 C20140709_OR012_04 TB416189.[MT7]-K[MT7]RDLFFNEIK[MT7].4b7_2.heavy 436.264 / 605.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 803 102 C20140709_OR012_04 C20140709_OR012_04 TB416189.[MT7]-K[MT7]RDLFFNEIK[MT7].4b5_2.heavy 436.264 / 474.797 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 805 102 C20140709_OR012_04 C20140709_OR012_04 TB416189.[MT7]-K[MT7]RDLFFNEIK[MT7].4b6_2.heavy 436.264 / 548.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 807 103 C20140709_OR012_04 C20140709_OR012_04 TB416403.[MT7]-FLPPEDTPPPAQGEALLGGLELIK[MT7].3y7_1.heavy 930.856 / 873.553 4021.0 48.48040008544922 37 15 10 2 10 6.153075683086803 16.252034779106303 0.08139801025390625 3 0.9519823217625081 5.609297436431549 4021.0 18.89885473522182 0.0 - - - - - - - 206.55555555555554 8 9 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 809 103 C20140709_OR012_04 C20140709_OR012_04 TB416403.[MT7]-FLPPEDTPPPAQGEALLGGLELIK[MT7].3b6_1.heavy 930.856 / 843.437 1043.0 48.48040008544922 37 15 10 2 10 6.153075683086803 16.252034779106303 0.08139801025390625 3 0.9519823217625081 5.609297436431549 1043.0 3.553110082453349 1.0 - - - - - - - 212.71428571428572 2 14 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 811 103 C20140709_OR012_04 C20140709_OR012_04 TB416403.[MT7]-FLPPEDTPPPAQGEALLGGLELIK[MT7].3y3_1.heavy 930.856 / 517.383 1564.0 48.48040008544922 37 15 10 2 10 6.153075683086803 16.252034779106303 0.08139801025390625 3 0.9519823217625081 5.609297436431549 1564.0 5.6681879194630875 0.0 - - - - - - - 178.6 3 10 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 813 103 C20140709_OR012_04 C20140709_OR012_04 TB416403.[MT7]-FLPPEDTPPPAQGEALLGGLELIK[MT7].3b7_1.heavy 930.856 / 944.485 3798.0 48.48040008544922 37 15 10 2 10 6.153075683086803 16.252034779106303 0.08139801025390625 3 0.9519823217625081 5.609297436431549 3798.0 1.6835151931646317 0.0 - - - - - - - 256.55555555555554 7 9 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 815 104 C20140709_OR012_04 C20140709_OR012_04 TB415979.[MT7]-K[MT7]VEEDLK[MT7].2b3_1.heavy 646.893 / 645.417 868.0 20.928750038146973 41 20 10 5 6 9.78295855613554 10.221856652687483 0.04250144958496094 5 0.9909124266111651 12.936266819628639 868.0 11.206238532110092 0.0 - - - - - - - 0.0 1 0 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 817 104 C20140709_OR012_04 C20140709_OR012_04 TB415979.[MT7]-K[MT7]VEEDLK[MT7].2b4_1.heavy 646.893 / 774.46 217.0 20.928750038146973 41 20 10 5 6 9.78295855613554 10.221856652687483 0.04250144958496094 5 0.9909124266111651 12.936266819628639 217.0 2.9008715596330275 5.0 - - - - - - - 0.0 0 0 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 819 104 C20140709_OR012_04 C20140709_OR012_04 TB415979.[MT7]-K[MT7]VEEDLK[MT7].2y6_1.heavy 646.893 / 876.479 543.0 20.928750038146973 41 20 10 5 6 9.78295855613554 10.221856652687483 0.04250144958496094 5 0.9909124266111651 12.936266819628639 543.0 3.9853211009174307 6.0 - - - - - - - 0.0 1 0 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 821 104 C20140709_OR012_04 C20140709_OR012_04 TB415979.[MT7]-K[MT7]VEEDLK[MT7].2b5_1.heavy 646.893 / 889.487 2714.0 20.928750038146973 41 20 10 5 6 9.78295855613554 10.221856652687483 0.04250144958496094 5 0.9909124266111651 12.936266819628639 2714.0 28.244419429279002 0.0 - - - - - - - 109.0 5 4 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 823 105 C20140709_OR012_04 C20140709_OR012_04 TB415978.[MT7]-VPNMAVMIK[MT7].3y3_1.heavy 430.922 / 535.339 3820.0 36.62919998168945 41 11 10 10 10 4.988647138302995 20.04551479141444 0.0 3 0.8787690954469566 3.508062288505427 3820.0 30.846406320422066 0.0 - - - - - - - 191.0 7 4 C17orf53 chromosome 17 open reading frame 53 825 105 C20140709_OR012_04 C20140709_OR012_04 TB415978.[MT7]-VPNMAVMIK[MT7].3b4_1.heavy 430.922 / 586.314 3183.0 36.62919998168945 41 11 10 10 10 4.988647138302995 20.04551479141444 0.0 3 0.8787690954469566 3.508062288505427 3183.0 29.311390869854435 0.0 - - - - - - - 254.5 6 2 C17orf53 chromosome 17 open reading frame 53 827 105 C20140709_OR012_04 C20140709_OR012_04 TB415978.[MT7]-VPNMAVMIK[MT7].3b5_1.heavy 430.922 / 657.351 2801.0 36.62919998168945 41 11 10 10 10 4.988647138302995 20.04551479141444 0.0 3 0.8787690954469566 3.508062288505427 2801.0 35.28818897637796 0.0 - - - - - - - 190.75 5 4 C17orf53 chromosome 17 open reading frame 53 829 105 C20140709_OR012_04 C20140709_OR012_04 TB415978.[MT7]-VPNMAVMIK[MT7].3b3_1.heavy 430.922 / 455.273 1655.0 36.62919998168945 41 11 10 10 10 4.988647138302995 20.04551479141444 0.0 3 0.8787690954469566 3.508062288505427 1655.0 26.062992125984252 0.0 - - - - - - - 764.0 3 2 C17orf53 chromosome 17 open reading frame 53 831 106 C20140709_OR012_04 C20140709_OR012_04 TB434088.[MT7]-DGLLGAELR.2y8_1.heavy 544.315 / 828.494 2732.0 34.4906005859375 39 15 8 10 6 2.3439057792019544 33.310979451902575 0.0 6 0.9533351894263005 5.690679451932983 2732.0 18.91182738491096 0.0 - - - - - - - 260.0 5 7 GDF5 growth differentiation factor 5 833 106 C20140709_OR012_04 C20140709_OR012_04 TB434088.[MT7]-DGLLGAELR.2b6_1.heavy 544.315 / 671.385 1561.0 34.4906005859375 39 15 8 10 6 2.3439057792019544 33.310979451902575 0.0 6 0.9533351894263005 5.690679451932983 1561.0 4.4028205128205125 4.0 - - - - - - - 260.0 3 13 GDF5 growth differentiation factor 5 835 106 C20140709_OR012_04 C20140709_OR012_04 TB434088.[MT7]-DGLLGAELR.2y6_1.heavy 544.315 / 658.388 3123.0 34.4906005859375 39 15 8 10 6 2.3439057792019544 33.310979451902575 0.0 6 0.9533351894263005 5.690679451932983 3123.0 0.2400973774177553 2.0 - - - - - - - 260.0 10 12 GDF5 growth differentiation factor 5 837 106 C20140709_OR012_04 C20140709_OR012_04 TB434088.[MT7]-DGLLGAELR.2b7_1.heavy 544.315 / 800.427 1431.0 34.4906005859375 39 15 8 10 6 2.3439057792019544 33.310979451902575 0.0 6 0.9533351894263005 5.690679451932983 1431.0 18.933230769230768 2.0 - - - - - - - 178.75 2 8 GDF5 growth differentiation factor 5 839 107 C20140709_OR012_04 C20140709_OR012_04 TB416001.[MT7]-NRAEQLASVQYTLPK[MT7].3b5_1.heavy 669.381 / 743.392 1206.0 31.47944927215576 31 10 10 5 6 0.7905630364140419 64.33958265781848 0.04450035095214844 5 0.8292866091175786 2.9433861836503605 1206.0 10.969142961508606 3.0 - - - - - - - 274.1818181818182 4 11 TJP1 tight junction protein 1 (zona occludens 1) 841 107 C20140709_OR012_04 C20140709_OR012_04 TB416001.[MT7]-NRAEQLASVQYTLPK[MT7].3b8_1.heavy 669.381 / 1014.54 965.0 31.47944927215576 31 10 10 5 6 0.7905630364140419 64.33958265781848 0.04450035095214844 5 0.8292866091175786 2.9433861836503605 965.0 9.112649771955693 1.0 - - - - - - - 0.0 1 0 TJP1 tight junction protein 1 (zona occludens 1) 843 107 C20140709_OR012_04 C20140709_OR012_04 TB416001.[MT7]-NRAEQLASVQYTLPK[MT7].3b7_1.heavy 669.381 / 927.513 724.0 31.47944927215576 31 10 10 5 6 0.7905630364140419 64.33958265781848 0.04450035095214844 5 0.8292866091175786 2.9433861836503605 724.0 5.534245707189655 4.0 - - - - - - - 241.25 2 8 TJP1 tight junction protein 1 (zona occludens 1) 845 107 C20140709_OR012_04 C20140709_OR012_04 TB416001.[MT7]-NRAEQLASVQYTLPK[MT7].3b8_2.heavy 669.381 / 507.776 3015.0 31.47944927215576 31 10 10 5 6 0.7905630364140419 64.33958265781848 0.04450035095214844 5 0.8292866091175786 2.9433861836503605 3015.0 3.5531120331950206 1.0 - - - - - - - 263.1818181818182 6 11 TJP1 tight junction protein 1 (zona occludens 1) 847 108 C20140709_OR012_04 C20140709_OR012_04 TB434271.[MT7]-LLTGQQLAQEIK[MT7].2y5_1.heavy 815.492 / 732.437 4990.0 37.0452995300293 35 13 10 2 10 2.1836326569941606 45.79524842683621 0.0839996337890625 3 0.9026108863006395 3.922092729785141 4990.0 37.425 0.0 - - - - - - - 164.57142857142858 9 7 RNF112 ring finger protein 112 849 108 C20140709_OR012_04 C20140709_OR012_04 TB434271.[MT7]-LLTGQQLAQEIK[MT7].2b4_1.heavy 815.492 / 529.347 1663.0 37.0452995300293 35 13 10 2 10 2.1836326569941606 45.79524842683621 0.0839996337890625 3 0.9026108863006395 3.922092729785141 1663.0 18.994578124999997 1.0 - - - - - - - 179.2 3 5 RNF112 ring finger protein 112 851 108 C20140709_OR012_04 C20140709_OR012_04 TB434271.[MT7]-LLTGQQLAQEIK[MT7].2y9_1.heavy 815.492 / 1158.66 1024.0 37.0452995300293 35 13 10 2 10 2.1836326569941606 45.79524842683621 0.0839996337890625 3 0.9026108863006395 3.922092729785141 1024.0 2.2 2.0 - - - - - - - 192.0 2 8 RNF112 ring finger protein 112 853 108 C20140709_OR012_04 C20140709_OR012_04 TB434271.[MT7]-LLTGQQLAQEIK[MT7].2b6_1.heavy 815.492 / 785.464 2175.0 37.0452995300293 35 13 10 2 10 2.1836326569941606 45.79524842683621 0.0839996337890625 3 0.9026108863006395 3.922092729785141 2175.0 6.173828125 0.0 - - - - - - - 208.0 4 8 RNF112 ring finger protein 112 855 109 C20140709_OR012_04 C20140709_OR012_04 TB434132.[MT7]-RVTVTEVLR.2y8_1.heavy 608.878 / 916.546 1704.0 27.938899993896484 29 8 10 3 8 0.8945121472678053 73.37884618753338 0.07710075378417969 4 0.79810658296535 2.6990314975524803 1704.0 13.511894273127753 0.0 - - - - - - - 227.28571428571428 3 7 C17orf53 chromosome 17 open reading frame 53 857 109 C20140709_OR012_04 C20140709_OR012_04 TB434132.[MT7]-RVTVTEVLR.2b4_1.heavy 608.878 / 600.395 N/A 27.938899993896484 29 8 10 3 8 0.8945121472678053 73.37884618753338 0.07710075378417969 4 0.79810658296535 2.6990314975524803 6021.0 10.310351623121411 1.0 - - - - - - - 354.75 12 8 C17orf53 chromosome 17 open reading frame 53 859 109 C20140709_OR012_04 C20140709_OR012_04 TB434132.[MT7]-RVTVTEVLR.2b6_1.heavy 608.878 / 830.485 1136.0 27.938899993896484 29 8 10 3 8 0.8945121472678053 73.37884618753338 0.07710075378417969 4 0.79810658296535 2.6990314975524803 1136.0 0.0 1.0 - - - - - - - 277.6666666666667 2 9 C17orf53 chromosome 17 open reading frame 53 861 109 C20140709_OR012_04 C20140709_OR012_04 TB434132.[MT7]-RVTVTEVLR.2y7_1.heavy 608.878 / 817.478 795.0 27.938899993896484 29 8 10 3 8 0.8945121472678053 73.37884618753338 0.07710075378417969 4 0.79810658296535 2.6990314975524803 795.0 4.881578947368421 2.0 - - - - - - - 0.0 1 0 C17orf53 chromosome 17 open reading frame 53 863 110 C20140709_OR012_04 C20140709_OR012_04 TB434270.[MT7]-LLTGQQLAQEIK[MT7].3b6_1.heavy 543.997 / 785.464 17517.0 37.06629943847656 42 17 10 5 10 2.557199703085382 26.43423157492503 0.04199981689453125 3 0.9730603279834603 7.502161120898962 17517.0 176.9946875 0.0 - - - - - - - 128.0 35 3 RNF112 ring finger protein 112 865 110 C20140709_OR012_04 C20140709_OR012_04 TB434270.[MT7]-LLTGQQLAQEIK[MT7].3b4_1.heavy 543.997 / 529.347 9462.0 37.06629943847656 42 17 10 5 10 2.557199703085382 26.43423157492503 0.04199981689453125 3 0.9730603279834603 7.502161120898962 9462.0 41.18311582681018 0.0 - - - - - - - 675.5714285714286 18 7 RNF112 ring finger protein 112 867 110 C20140709_OR012_04 C20140709_OR012_04 TB434270.[MT7]-LLTGQQLAQEIK[MT7].3b5_1.heavy 543.997 / 657.405 16366.0 37.06629943847656 42 17 10 5 10 2.557199703085382 26.43423157492503 0.04199981689453125 3 0.9730603279834603 7.502161120898962 16366.0 83.6568483470266 0.0 - - - - - - - 213.33333333333334 32 6 RNF112 ring finger protein 112 869 110 C20140709_OR012_04 C20140709_OR012_04 TB434270.[MT7]-LLTGQQLAQEIK[MT7].3y5_1.heavy 543.997 / 732.437 19179.0 37.06629943847656 42 17 10 5 10 2.557199703085382 26.43423157492503 0.04199981689453125 3 0.9730603279834603 7.502161120898962 19179.0 114.87421875000001 0.0 - - - - - - - 341.3333333333333 38 3 RNF112 ring finger protein 112 871 111 C20140709_OR012_04 C20140709_OR012_04 TB434134.[MT7]-ERLQQQK[MT7].2b3_1.heavy 609.364 / 543.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 873 111 C20140709_OR012_04 C20140709_OR012_04 TB434134.[MT7]-ERLQQQK[MT7].2y5_1.heavy 609.364 / 788.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 875 111 C20140709_OR012_04 C20140709_OR012_04 TB434134.[MT7]-ERLQQQK[MT7].2b4_1.heavy 609.364 / 671.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 877 111 C20140709_OR012_04 C20140709_OR012_04 TB434134.[MT7]-ERLQQQK[MT7].2b6_1.heavy 609.364 / 927.513 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 879 112 C20140709_OR012_04 C20140709_OR012_04 TB434080.[MT7]-ALFLVFGR.2y5_1.heavy 533.83 / 591.361 11711.0 46.09659957885742 41 11 10 10 10 6.368645606226201 15.70192568137826 0.0 3 0.8599252145422785 3.25819788066171 11711.0 148.56349952762375 0.0 - - - - - - - 180.0 23 4 GDF5 growth differentiation factor 5 881 112 C20140709_OR012_04 C20140709_OR012_04 TB434080.[MT7]-ALFLVFGR.2b4_1.heavy 533.83 / 589.383 9369.0 46.09659957885742 41 11 10 10 10 6.368645606226201 15.70192568137826 0.0 3 0.8599252145422785 3.25819788066171 9369.0 156.09795 0.0 - - - - - - - 165.0 18 6 GDF5 growth differentiation factor 5 883 112 C20140709_OR012_04 C20140709_OR012_04 TB434080.[MT7]-ALFLVFGR.2y6_1.heavy 533.83 / 738.43 11801.0 46.09659957885742 41 11 10 10 10 6.368645606226201 15.70192568137826 0.0 3 0.8599252145422785 3.25819788066171 11801.0 124.56611111111113 0.0 - - - - - - - 216.0 23 5 GDF5 growth differentiation factor 5 885 112 C20140709_OR012_04 C20140709_OR012_04 TB434080.[MT7]-ALFLVFGR.2y7_1.heavy 533.83 / 851.514 2703.0 46.09659957885742 41 11 10 10 10 6.368645606226201 15.70192568137826 0.0 3 0.8599252145422785 3.25819788066171 2703.0 29.86187757691088 1.0 - - - - - - - 225.0 6 4 GDF5 growth differentiation factor 5 887 113 C20140709_OR012_04 C20140709_OR012_04 TB434082.[MT7]-ALQSLQLR.2y5_1.heavy 536.833 / 616.378 4378.0 32.09749984741211 48 20 10 10 8 33.270635286633215 3.005653458026271 0.0 4 0.997152166712687 23.12075269245172 4378.0 17.012953367875646 2.0 - - - - - - - 283.3 9 10 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 889 113 C20140709_OR012_04 C20140709_OR012_04 TB434082.[MT7]-ALQSLQLR.2b4_1.heavy 536.833 / 544.321 1674.0 32.09749984741211 48 20 10 10 8 33.270635286633215 3.005653458026271 0.0 4 0.997152166712687 23.12075269245172 1674.0 4.551102293064503 0.0 - - - - - - - 241.625 3 8 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 891 113 C20140709_OR012_04 C20140709_OR012_04 TB434082.[MT7]-ALQSLQLR.2y6_1.heavy 536.833 / 744.436 5409.0 32.09749984741211 48 20 10 10 8 33.270635286633215 3.005653458026271 0.0 4 0.997152166712687 23.12075269245172 5409.0 12.595342820181113 0.0 - - - - - - - 225.5 10 8 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 893 113 C20140709_OR012_04 C20140709_OR012_04 TB434082.[MT7]-ALQSLQLR.2y7_1.heavy 536.833 / 857.52 6954.0 32.09749984741211 48 20 10 10 8 33.270635286633215 3.005653458026271 0.0 4 0.997152166712687 23.12075269245172 6954.0 27.91709693646562 0.0 - - - - - - - 209.5 13 8 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 895 114 C20140709_OR012_04 C20140709_OR012_04 TB434084.[MT7]-LIMVWK[MT7].2b3_1.heavy 539.34 / 502.318 3582.0 40.964698791503906 50 20 10 10 10 6.421487411466988 15.572716037942836 0.0 3 0.9908892341571975 12.919765930753789 3582.0 12.121223103396677 0.0 - - - - - - - 235.33333333333334 7 6 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 897 114 C20140709_OR012_04 C20140709_OR012_04 TB434084.[MT7]-LIMVWK[MT7].2y4_1.heavy 539.34 / 707.403 5210.0 40.964698791503906 50 20 10 10 10 6.421487411466988 15.572716037942836 0.0 3 0.9908892341571975 12.919765930753789 5210.0 58.84681012979326 0.0 - - - - - - - 217.4 10 5 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 899 114 C20140709_OR012_04 C20140709_OR012_04 TB434084.[MT7]-LIMVWK[MT7].2y5_1.heavy 539.34 / 820.487 3256.0 40.964698791503906 50 20 10 10 10 6.421487411466988 15.572716037942836 0.0 3 0.9908892341571975 12.919765930753789 3256.0 13.72921658986175 0.0 - - - - - - - 232.71428571428572 6 7 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 901 114 C20140709_OR012_04 C20140709_OR012_04 TB434084.[MT7]-LIMVWK[MT7].2y3_1.heavy 539.34 / 576.363 3799.0 40.964698791503906 50 20 10 10 10 6.421487411466988 15.572716037942836 0.0 3 0.9908892341571975 12.919765930753789 3799.0 11.658744451669445 1.0 - - - - - - - 249.7 7 10 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 903 115 C20140709_OR012_04 C20140709_OR012_04 TB415810.[MT7]-LLLLQK[MT7].2y4_1.heavy 508.36 / 645.442 3399.0 37.525166829427086 35 20 0 5 10 4.96184165534149 20.15380718414273 0.040599822998046875 3 0.9925559712668199 14.29514525190555 3399.0 41.23930415263749 0.0 - - - - - - - 263.0 6 6 CHD4;NOS1AP chromodomain helicase DNA binding protein 4;nitric oxide synthase 1 (neuronal) adaptor protein 905 115 C20140709_OR012_04 C20140709_OR012_04 TB415810.[MT7]-LLLLQK[MT7].2y5_1.heavy 508.36 / 758.526 N/A 37.525166829427086 35 20 0 5 10 4.96184165534149 20.15380718414273 0.040599822998046875 3 0.9925559712668199 14.29514525190555 4371.0 29.137499539797897 1.0 - - - - - - - 151.5 34 4 CHD4;NOS1AP chromodomain helicase DNA binding protein 4;nitric oxide synthase 1 (neuronal) adaptor protein 907 115 C20140709_OR012_04 C20140709_OR012_04 TB415810.[MT7]-LLLLQK[MT7].2b4_1.heavy 508.36 / 597.446 1214.0 37.525166829427086 35 20 0 5 10 4.96184165534149 20.15380718414273 0.040599822998046875 3 0.9925559712668199 14.29514525190555 1214.0 13.427782199095331 0.0 - - - - - - - 242.57142857142858 2 7 CHD4;NOS1AP chromodomain helicase DNA binding protein 4;nitric oxide synthase 1 (neuronal) adaptor protein 909 115 C20140709_OR012_04 C20140709_OR012_04 TB415810.[MT7]-LLLLQK[MT7].2y3_1.heavy 508.36 / 532.357 4249.0 37.525166829427086 35 20 0 5 10 4.96184165534149 20.15380718414273 0.040599822998046875 3 0.9925559712668199 14.29514525190555 4249.0 16.436460905349797 0.0 - - - - - - - 329.57142857142856 8 7 CHD4;NOS1AP chromodomain helicase DNA binding protein 4;nitric oxide synthase 1 (neuronal) adaptor protein 911 116 C20140709_OR012_04 C20140709_OR012_04 TB415831.[MT7]-VALQAEK[MT7].2y4_1.heavy 523.826 / 619.353 12586.0 23.5049991607666 47 17 10 10 10 3.817243332059862 26.196915234648657 0.0 3 0.9784304624444367 8.387996097284079 12586.0 64.21875209154916 0.0 - - - - - - - 154.0 25 8 PCBD1;PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha;pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 913 116 C20140709_OR012_04 C20140709_OR012_04 TB415831.[MT7]-VALQAEK[MT7].2y5_1.heavy 523.826 / 732.437 10735.0 23.5049991607666 47 17 10 10 10 3.817243332059862 26.196915234648657 0.0 3 0.9784304624444367 8.387996097284079 10735.0 48.162432432432425 0.0 - - - - - - - 215.75 21 8 PCBD1;PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha;pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 915 116 C20140709_OR012_04 C20140709_OR012_04 TB415831.[MT7]-VALQAEK[MT7].2b4_1.heavy 523.826 / 556.357 11599.0 23.5049991607666 47 17 10 10 10 3.817243332059862 26.196915234648657 0.0 3 0.9784304624444367 8.387996097284079 11599.0 72.35826545573914 0.0 - - - - - - - 277.625 23 8 PCBD1;PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha;pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 917 116 C20140709_OR012_04 C20140709_OR012_04 TB415831.[MT7]-VALQAEK[MT7].2y6_1.heavy 523.826 / 803.474 20236.0 23.5049991607666 47 17 10 10 10 3.817243332059862 26.196915234648657 0.0 3 0.9784304624444367 8.387996097284079 20236.0 233.29914617688686 0.0 - - - - - - - 197.3 40 10 PCBD1;PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha;pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 919 117 C20140709_OR012_04 C20140709_OR012_04 TB415812.[MT7]-EQNLVK[MT7].2b3_1.heavy 509.81 / 516.253 1018.0 21.122499465942383 36 8 10 10 8 0.8528940860676394 77.70139674158794 0.0 4 0.797918129521527 2.697726907926489 1018.0 9.187116545232808 1.0 - - - - - - - 192.1 2 10 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 921 117 C20140709_OR012_04 C20140709_OR012_04 TB415812.[MT7]-EQNLVK[MT7].2y5_1.heavy 509.81 / 745.469 792.0 21.122499465942383 36 8 10 10 8 0.8528940860676394 77.70139674158794 0.0 4 0.797918129521527 2.697726907926489 792.0 8.060176991150442 5.0 - - - - - - - 193.71428571428572 3 7 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 923 117 C20140709_OR012_04 C20140709_OR012_04 TB415812.[MT7]-EQNLVK[MT7].2b4_1.heavy 509.81 / 629.338 2828.0 21.122499465942383 36 8 10 10 8 0.8528940860676394 77.70139674158794 0.0 4 0.797918129521527 2.697726907926489 2828.0 14.01118146154548 0.0 - - - - - - - 271.4 5 5 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 925 117 C20140709_OR012_04 C20140709_OR012_04 TB415812.[MT7]-EQNLVK[MT7].2b5_1.heavy 509.81 / 728.406 905.0 21.122499465942383 36 8 10 10 8 0.8528940860676394 77.70139674158794 0.0 4 0.797918129521527 2.697726907926489 905.0 8.569469026548672 1.0 - - - - - - - 282.6666666666667 2 6 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 927 118 C20140709_OR012_04 C20140709_OR012_04 TB434085.[MT7]-LAILYAK[MT7].2y4_1.heavy 540.357 / 638.399 12141.0 36.794898986816406 50 20 10 10 10 7.471078484863597 13.384948398360422 0.0 3 0.9964200023898281 20.62012776201447 12141.0 84.41789062500001 0.0 - - - - - - - 181.33333333333334 24 12 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 929 118 C20140709_OR012_04 C20140709_OR012_04 TB434085.[MT7]-LAILYAK[MT7].2y5_1.heavy 540.357 / 751.483 3962.0 36.794898986816406 50 20 10 10 10 7.471078484863597 13.384948398360422 0.0 3 0.9964200023898281 20.62012776201447 3962.0 17.792793733681464 0.0 - - - - - - - 306.6 7 5 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 931 118 C20140709_OR012_04 C20140709_OR012_04 TB434085.[MT7]-LAILYAK[MT7].2y3_1.heavy 540.357 / 525.315 13291.0 36.794898986816406 50 20 10 10 10 7.471078484863597 13.384948398360422 0.0 3 0.9964200023898281 20.62012776201447 13291.0 17.896433818719327 0.0 - - - - - - - 292.14285714285717 26 7 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 933 118 C20140709_OR012_04 C20140709_OR012_04 TB434085.[MT7]-LAILYAK[MT7].2y6_1.heavy 540.357 / 822.521 4984.0 36.794898986816406 50 20 10 10 10 7.471078484863597 13.384948398360422 0.0 3 0.9964200023898281 20.62012776201447 4984.0 30.984032634032637 1.0 - - - - - - - 179.2 12 5 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 935 119 C20140709_OR012_04 C20140709_OR012_04 TB415824.[MT7]-EMLTLSEYHER.3y6_1.heavy 517.925 / 820.358 5101.0 30.589500427246094 43 13 10 10 10 2.060706192503897 48.527053669156615 0.0 3 0.9148249943988415 4.198308998325984 5101.0 83.15915966386555 0.0 - - - - - - - 119.0 10 4 SPAG4 sperm associated antigen 4 937 119 C20140709_OR012_04 C20140709_OR012_04 TB415824.[MT7]-EMLTLSEYHER.3b4_1.heavy 517.925 / 619.324 4508.0 30.589500427246094 43 13 10 10 10 2.060706192503897 48.527053669156615 0.0 3 0.9148249943988415 4.198308998325984 4508.0 23.193725072174107 0.0 - - - - - - - 273.0 9 10 SPAG4 sperm associated antigen 4 939 119 C20140709_OR012_04 C20140709_OR012_04 TB415824.[MT7]-EMLTLSEYHER.3y4_1.heavy 517.925 / 604.284 4627.0 30.589500427246094 43 13 10 10 10 2.060706192503897 48.527053669156615 0.0 3 0.9148249943988415 4.198308998325984 4627.0 30.975873923607097 1.0 - - - - - - - 222.5 14 8 SPAG4 sperm associated antigen 4 941 119 C20140709_OR012_04 C20140709_OR012_04 TB415824.[MT7]-EMLTLSEYHER.3y5_1.heavy 517.925 / 733.326 4034.0 30.589500427246094 43 13 10 10 10 2.060706192503897 48.527053669156615 0.0 3 0.9148249943988415 4.198308998325984 4034.0 32.561486247112676 0.0 - - - - - - - 178.0 8 6 SPAG4 sperm associated antigen 4 943 120 C20140709_OR012_04 C20140709_OR012_04 TB415804.[MT7]-LIFLDSR.2b3_1.heavy 504.304 / 518.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - SIM1;SIM2 single-minded homolog 1 (Drosophila);single-minded homolog 2 (Drosophila) 945 120 C20140709_OR012_04 C20140709_OR012_04 TB415804.[MT7]-LIFLDSR.2y5_1.heavy 504.304 / 637.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - SIM1;SIM2 single-minded homolog 1 (Drosophila);single-minded homolog 2 (Drosophila) 947 120 C20140709_OR012_04 C20140709_OR012_04 TB415804.[MT7]-LIFLDSR.2y6_1.heavy 504.304 / 750.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - SIM1;SIM2 single-minded homolog 1 (Drosophila);single-minded homolog 2 (Drosophila) 949 120 C20140709_OR012_04 C20140709_OR012_04 TB415804.[MT7]-LIFLDSR.2b5_1.heavy 504.304 / 746.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - SIM1;SIM2 single-minded homolog 1 (Drosophila);single-minded homolog 2 (Drosophila) 951 121 C20140709_OR012_04 C20140709_OR012_04 TB415826.[MT7]-ITDFGLAR.2y5_1.heavy 518.799 / 563.33 15677.0 34.6828498840332 38 17 10 5 6 6.378422216661832 15.67785834853926 0.04270172119140625 6 0.9731244758123458 7.511149601630351 15677.0 53.21776485262347 0.0 - - - - - - - 210.875 31 8 ERBB2;ERBB4;MAP3K9;MAP3K10;MAP3K11;KIAA1804 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian);v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian);mitogen-activated protein kinase kinase kinase 9;mitogen-activated protein kinase kinase kinase 10;mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 4 953 121 C20140709_OR012_04 C20140709_OR012_04 TB415826.[MT7]-ITDFGLAR.2b4_1.heavy 518.799 / 621.336 648.0 34.6828498840332 38 17 10 5 6 6.378422216661832 15.67785834853926 0.04270172119140625 6 0.9731244758123458 7.511149601630351 648.0 2.652046332046332 9.0 - - - - - - - 259.25 3 8 ERBB2;ERBB4;MAP3K9;MAP3K10;MAP3K11;KIAA1804 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian);v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian);mitogen-activated protein kinase kinase kinase 9;mitogen-activated protein kinase kinase kinase 10;mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 4 955 121 C20140709_OR012_04 C20140709_OR012_04 TB415826.[MT7]-ITDFGLAR.2b6_1.heavy 518.799 / 791.442 777.0 34.6828498840332 38 17 10 5 6 6.378422216661832 15.67785834853926 0.04270172119140625 6 0.9731244758123458 7.511149601630351 777.0 2.1374421593830335 5.0 - - - - - - - 337.2 3 5 ERBB2;ERBB4;MAP3K9;MAP3K10;MAP3K11;KIAA1804 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian);v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian);mitogen-activated protein kinase kinase kinase 9;mitogen-activated protein kinase kinase kinase 10;mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 4 957 121 C20140709_OR012_04 C20140709_OR012_04 TB415826.[MT7]-ITDFGLAR.2y7_1.heavy 518.799 / 779.405 6737.0 34.6828498840332 38 17 10 5 6 6.378422216661832 15.67785834853926 0.04270172119140625 6 0.9731244758123458 7.511149601630351 6737.0 72.64434867834868 0.0 - - - - - - - 148.42857142857142 13 7 ERBB2;ERBB4;MAP3K9;MAP3K10;MAP3K11;KIAA1804 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian);v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian);mitogen-activated protein kinase kinase kinase 9;mitogen-activated protein kinase kinase kinase 10;mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 4 959 122 C20140709_OR012_04 C20140709_OR012_04 TB415808.[MT7]-IFSYIAR.2y4_1.heavy 507.299 / 522.304 999.0 37.528550148010254 36 11 10 5 10 3.8144778570011395 26.215907851308867 0.040599822998046875 3 0.8589122156262116 3.24619096515051 999.0 3.1008959999999997 0.0 - - - - - - - 0.0 1 0 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 961 122 C20140709_OR012_04 C20140709_OR012_04 TB415808.[MT7]-IFSYIAR.2y5_1.heavy 507.299 / 609.336 3498.0 37.528550148010254 36 11 10 5 10 3.8144778570011395 26.215907851308867 0.040599822998046875 3 0.8589122156262116 3.24619096515051 3498.0 8.195200000000002 1.0 - - - - - - - 208.33333333333334 6 3 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 963 122 C20140709_OR012_04 C20140709_OR012_04 TB415808.[MT7]-IFSYIAR.2b4_1.heavy 507.299 / 655.357 999.0 37.528550148010254 36 11 10 5 10 3.8144778570011395 26.215907851308867 0.040599822998046875 3 0.8589122156262116 3.24619096515051 999.0 0.20484429917989141 4.0 - - - - - - - 229.16666666666666 5 6 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 965 122 C20140709_OR012_04 C20140709_OR012_04 TB415808.[MT7]-IFSYIAR.2y6_1.heavy 507.299 / 756.404 5497.0 37.528550148010254 36 11 10 5 10 3.8144778570011395 26.215907851308867 0.040599822998046875 3 0.8589122156262116 3.24619096515051 5497.0 7.129333333333333 1.0 - - - - - - - 250.0 10 1 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 967 123 C20140709_OR012_04 C20140709_OR012_04 TB416178.[MT7]-RNPQEDFELIQR.2b8_1.heavy 844.945 / 1160.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 969 123 C20140709_OR012_04 C20140709_OR012_04 TB416178.[MT7]-RNPQEDFELIQR.2b8_2.heavy 844.945 / 580.776 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 971 123 C20140709_OR012_04 C20140709_OR012_04 TB416178.[MT7]-RNPQEDFELIQR.2b6_1.heavy 844.945 / 884.434 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 973 123 C20140709_OR012_04 C20140709_OR012_04 TB416178.[MT7]-RNPQEDFELIQR.2y6_1.heavy 844.945 / 805.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 975 124 C20140709_OR012_04 C20140709_OR012_04 TB416176.[MT7]-K[MT7]PVEAESVEGVVR.3y7_1.heavy 562.992 / 745.42 17538.0 26.405049324035645 44 18 10 6 10 7.240818810100314 13.81059278275389 0.03750038146972656 3 0.9877218793319708 11.126307474886413 17538.0 56.1457487091222 0.0 - - - - - - - 232.16666666666666 35 6 INTS4 integrator complex subunit 4 977 124 C20140709_OR012_04 C20140709_OR012_04 TB416176.[MT7]-K[MT7]PVEAESVEGVVR.3y8_1.heavy 562.992 / 874.463 7898.0 26.405049324035645 44 18 10 6 10 7.240818810100314 13.81059278275389 0.03750038146972656 3 0.9877218793319708 11.126307474886413 7898.0 93.95896551724138 0.0 - - - - - - - 198.85714285714286 15 7 INTS4 integrator complex subunit 4 979 124 C20140709_OR012_04 C20140709_OR012_04 TB416176.[MT7]-K[MT7]PVEAESVEGVVR.3y5_1.heavy 562.992 / 559.32 27294.0 26.405049324035645 44 18 10 6 10 7.240818810100314 13.81059278275389 0.03750038146972656 3 0.9877218793319708 11.126307474886413 27294.0 78.22811992518592 0.0 - - - - - - - 348.375 54 8 INTS4 integrator complex subunit 4 981 124 C20140709_OR012_04 C20140709_OR012_04 TB416176.[MT7]-K[MT7]PVEAESVEGVVR.3y9_1.heavy 562.992 / 945.5 8246.0 26.405049324035645 44 18 10 6 10 7.240818810100314 13.81059278275389 0.03750038146972656 3 0.9877218793319708 11.126307474886413 8246.0 90.99034482758621 0.0 - - - - - - - 265.2857142857143 16 7 INTS4 integrator complex subunit 4 983 125 C20140709_OR012_04 C20140709_OR012_04 TB416179.[MT7]-RNPQEDFELIQR.3b6_1.heavy 563.633 / 884.434 13024.0 31.015199661254883 45 15 10 10 10 2.6449185635074683 32.01576177119489 0.0 3 0.9595409170051855 6.1147556243516865 13024.0 78.13038478549313 0.0 - - - - - - - 193.875 26 8 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 985 125 C20140709_OR012_04 C20140709_OR012_04 TB416179.[MT7]-RNPQEDFELIQR.3y6_1.heavy 563.633 / 805.457 21389.0 31.015199661254883 45 15 10 10 10 2.6449185635074683 32.01576177119489 0.0 3 0.9595409170051855 6.1147556243516865 21389.0 134.60556017858397 0.0 - - - - - - - 238.71428571428572 42 7 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 987 125 C20140709_OR012_04 C20140709_OR012_04 TB416179.[MT7]-RNPQEDFELIQR.3y4_1.heavy 563.633 / 529.346 50783.0 31.015199661254883 45 15 10 10 10 2.6449185635074683 32.01576177119489 0.0 3 0.9595409170051855 6.1147556243516865 50783.0 132.4448173573586 0.0 - - - - - - - 293.09090909090907 101 11 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 989 125 C20140709_OR012_04 C20140709_OR012_04 TB416179.[MT7]-RNPQEDFELIQR.3y5_1.heavy 563.633 / 658.388 30231.0 31.015199661254883 45 15 10 10 10 2.6449185635074683 32.01576177119489 0.0 3 0.9595409170051855 6.1147556243516865 30231.0 141.10033300854016 0.0 - - - - - - - 258.6666666666667 60 6 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 991 126 C20140709_OR012_04 C20140709_OR012_04 TB434344.[MT7]-AAGWSELSERDAIYK[MT7].4y8_2.heavy 496.765 / 563.305 9419.0 32.93400001525879 39 14 10 5 10 3.274994052419586 30.534406597202633 0.043598175048828125 3 0.9434299931991876 5.164167817539324 9419.0 24.529496051984594 0.0 - - - - - - - 233.5 18 6 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 993 126 C20140709_OR012_04 C20140709_OR012_04 TB434344.[MT7]-AAGWSELSERDAIYK[MT7].4b11_2.heavy 496.765 / 673.826 1655.0 32.93400001525879 39 14 10 5 10 3.274994052419586 30.534406597202633 0.043598175048828125 3 0.9434299931991876 5.164167817539324 1655.0 12.509416629525083 1.0 - - - - - - - 254.66666666666666 11 3 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 995 126 C20140709_OR012_04 C20140709_OR012_04 TB434344.[MT7]-AAGWSELSERDAIYK[MT7].4y9_2.heavy 496.765 / 619.847 4837.0 32.93400001525879 39 14 10 5 10 3.274994052419586 30.534406597202633 0.043598175048828125 3 0.9434299931991876 5.164167817539324 4837.0 36.609450980392154 0.0 - - - - - - - 212.33333333333334 9 9 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 997 126 C20140709_OR012_04 C20140709_OR012_04 TB434344.[MT7]-AAGWSELSERDAIYK[MT7].4b4_1.heavy 496.765 / 530.284 2673.0 32.93400001525879 39 14 10 5 10 3.274994052419586 30.534406597202633 0.043598175048828125 3 0.9434299931991876 5.164167817539324 2673.0 15.99061060763631 0.0 - - - - - - - 229.2 5 5 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 999 127 C20140709_OR012_04 C20140709_OR012_04 TB434343.[MT7]-RQEPLMVQANADGRPR.4b5_1.heavy 496.267 / 768.448 1962.0 23.101025581359863 45 20 10 5 10 13.163342260857531 7.596854812273602 0.047901153564453125 3 0.9947271429031783 16.988238647988407 1962.0 14.15609756097561 1.0 - - - - - - - 172.0 3 5 TUB tubby homolog (mouse) 1001 127 C20140709_OR012_04 C20140709_OR012_04 TB434343.[MT7]-RQEPLMVQANADGRPR.4b4_2.heavy 496.267 / 328.186 3801.0 23.101025581359863 45 20 10 5 10 13.163342260857531 7.596854812273602 0.047901153564453125 3 0.9947271429031783 16.988238647988407 3801.0 41.20034093319194 0.0 - - - - - - - 123.0 7 3 TUB tubby homolog (mouse) 1003 127 C20140709_OR012_04 C20140709_OR012_04 TB434343.[MT7]-RQEPLMVQANADGRPR.4b3_1.heavy 496.267 / 558.312 1226.0 23.101025581359863 45 20 10 5 10 13.163342260857531 7.596854812273602 0.047901153564453125 3 0.9947271429031783 16.988238647988407 1226.0 11.317642276422763 1.0 - - - - - - - 272.55555555555554 2 9 TUB tubby homolog (mouse) 1005 127 C20140709_OR012_04 C20140709_OR012_04 TB434343.[MT7]-RQEPLMVQANADGRPR.4b6_1.heavy 496.267 / 899.489 368.0 23.101025581359863 45 20 10 5 10 13.163342260857531 7.596854812273602 0.047901153564453125 3 0.9947271429031783 16.988238647988407 368.0 2.9472206061510153 3.0 - - - - - - - 0.0 1 0 TUB tubby homolog (mouse) 1007 128 C20140709_OR012_04 C20140709_OR012_04 TB434280.[MT7]-LHQTIYNQAC[CAM]K[MT7].3y3_1.heavy 555.299 / 522.283 9976.0 23.113000869750977 48 18 10 10 10 4.317592880965785 23.16105356779989 0.0 3 0.9839696497959614 9.734395658578016 9976.0 30.026447368421053 0.0 - - - - - - - 260.7142857142857 19 7 INTS4 integrator complex subunit 4 1009 128 C20140709_OR012_04 C20140709_OR012_04 TB434280.[MT7]-LHQTIYNQAC[CAM]K[MT7].3b4_1.heavy 555.299 / 624.359 4988.0 23.113000869750977 48 18 10 10 10 4.317592880965785 23.16105356779989 0.0 3 0.9839696497959614 9.734395658578016 4988.0 28.101835881055592 0.0 - - - - - - - 203.0 9 9 INTS4 integrator complex subunit 4 1011 128 C20140709_OR012_04 C20140709_OR012_04 TB434280.[MT7]-LHQTIYNQAC[CAM]K[MT7].3y4_1.heavy 555.299 / 650.341 1947.0 23.113000869750977 48 18 10 10 10 4.317592880965785 23.16105356779989 0.0 3 0.9839696497959614 9.734395658578016 1947.0 14.66259259259259 0.0 - - - - - - - 218.8 3 5 INTS4 integrator complex subunit 4 1013 128 C20140709_OR012_04 C20140709_OR012_04 TB434280.[MT7]-LHQTIYNQAC[CAM]K[MT7].3b3_1.heavy 555.299 / 523.311 2920.0 23.113000869750977 48 18 10 10 10 4.317592880965785 23.16105356779989 0.0 3 0.9839696497959614 9.734395658578016 2920.0 10.174922322490003 0.0 - - - - - - - 311.1111111111111 5 9 INTS4 integrator complex subunit 4 1015 129 C20140709_OR012_04 C20140709_OR012_04 TB415963.[MT7]-SVEEELHQR.3y3_1.heavy 424.222 / 440.236 12629.0 22.825700759887695 42 12 10 10 10 2.841066197633732 35.19805349248392 0.0 3 0.8819579260249895 3.5561190163960004 12629.0 121.2535935856357 0.0 - - - - - - - 261.8 25 5 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1017 129 C20140709_OR012_04 C20140709_OR012_04 TB415963.[MT7]-SVEEELHQR.3b4_1.heavy 424.222 / 589.295 4885.0 22.825700759887695 42 12 10 10 10 2.841066197633732 35.19805349248392 0.0 3 0.8819579260249895 3.5561190163960004 4885.0 55.418067226890756 0.0 - - - - - - - 238.0 9 3 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1019 129 C20140709_OR012_04 C20140709_OR012_04 TB415963.[MT7]-SVEEELHQR.3b5_1.heavy 424.222 / 718.338 1072.0 22.825700759887695 42 12 10 10 10 2.841066197633732 35.19805349248392 0.0 3 0.8819579260249895 3.5561190163960004 1072.0 8.87986619108075 1.0 - - - - - - - 208.5 3 4 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1021 129 C20140709_OR012_04 C20140709_OR012_04 TB415963.[MT7]-SVEEELHQR.3b3_1.heavy 424.222 / 460.252 5004.0 22.825700759887695 42 12 10 10 10 2.841066197633732 35.19805349248392 0.0 3 0.8819579260249895 3.5561190163960004 5004.0 16.811767785156018 0.0 - - - - - - - 333.4 10 5 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1023 130 C20140709_OR012_04 C20140709_OR012_04 TB434079.[MT7]-FLQLGAK[MT7].2y5_1.heavy 532.839 / 660.416 3922.0 34.147098541259766 48 18 10 10 10 4.424208788866788 22.602911565033505 0.0 3 0.9892722892525184 11.904737607997347 3922.0 37.24876577348497 0.0 - - - - - - - 277.75 7 8 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1025 130 C20140709_OR012_04 C20140709_OR012_04 TB434079.[MT7]-FLQLGAK[MT7].2b4_1.heavy 532.839 / 646.404 2223.0 34.147098541259766 48 18 10 10 10 4.424208788866788 22.602911565033505 0.0 3 0.9892722892525184 11.904737607997347 2223.0 5.055336667806235 2.0 - - - - - - - 217.83333333333334 5 6 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1027 130 C20140709_OR012_04 C20140709_OR012_04 TB434079.[MT7]-FLQLGAK[MT7].2y6_1.heavy 532.839 / 773.5 6537.0 34.147098541259766 48 18 10 10 10 4.424208788866788 22.602911565033505 0.0 3 0.9892722892525184 11.904737607997347 6537.0 33.438677106400924 0.0 - - - - - - - 196.125 13 8 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1029 130 C20140709_OR012_04 C20140709_OR012_04 TB434079.[MT7]-FLQLGAK[MT7].2b5_1.heavy 532.839 / 703.426 1700.0 34.147098541259766 48 18 10 10 10 4.424208788866788 22.602911565033505 0.0 3 0.9892722892525184 11.904737607997347 1700.0 0.6966325006007793 0.0 - - - - - - - 246.77777777777777 3 9 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1031 131 C20140709_OR012_04 C20140709_OR012_04 TB434078.[MT7]-NLSGWMGR.2y5_1.heavy 532.775 / 606.282 1966.0 32.82429885864258 44 14 10 10 10 2.660883508004886 37.58150242171984 0.0 3 0.9381277429929678 4.935706384755638 1966.0 6.753435114503816 0.0 - - - - - - - 262.0 3 5 RNF112 ring finger protein 112 1033 131 C20140709_OR012_04 C20140709_OR012_04 TB434078.[MT7]-NLSGWMGR.2b4_1.heavy 532.775 / 516.29 1573.0 32.82429885864258 44 14 10 10 10 2.660883508004886 37.58150242171984 0.0 3 0.9381277429929678 4.935706384755638 1573.0 1.9383751363140673 5.0 - - - - - - - 240.16666666666666 3 6 RNF112 ring finger protein 112 1035 131 C20140709_OR012_04 C20140709_OR012_04 TB434078.[MT7]-NLSGWMGR.2y6_1.heavy 532.775 / 693.314 3538.0 32.82429885864258 44 14 10 10 10 2.660883508004886 37.58150242171984 0.0 3 0.9381277429929678 4.935706384755638 3538.0 35.425012722646315 0.0 - - - - - - - 196.5 7 6 RNF112 ring finger protein 112 1037 131 C20140709_OR012_04 C20140709_OR012_04 TB434078.[MT7]-NLSGWMGR.2y7_1.heavy 532.775 / 806.398 6815.0 32.82429885864258 44 14 10 10 10 2.660883508004886 37.58150242171984 0.0 3 0.9381277429929678 4.935706384755638 6815.0 48.64141221374045 0.0 - - - - - - - 240.16666666666666 13 6 RNF112 ring finger protein 112 1039 132 C20140709_OR012_04 C20140709_OR012_04 TB434147.[MT7]-AAGWSELSER.2y4_1.heavy 625.318 / 504.278 10926.0 29.998600006103516 50 20 10 10 10 11.749978605017017 8.510653794493031 0.0 3 0.997505113530504 24.702826130095634 10926.0 14.869704142011834 0.0 - - - - - - - 257.42857142857144 21 7 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1041 132 C20140709_OR012_04 C20140709_OR012_04 TB434147.[MT7]-AAGWSELSER.2y8_1.heavy 625.318 / 963.453 14081.0 29.998600006103516 50 20 10 10 10 11.749978605017017 8.510653794493031 0.0 3 0.997505113530504 24.702826130095634 14081.0 241.7446017699115 0.0 - - - - - - - 169.0 28 6 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1043 132 C20140709_OR012_04 C20140709_OR012_04 TB434147.[MT7]-AAGWSELSER.2y9_1.heavy 625.318 / 1034.49 32104.0 29.998600006103516 50 20 10 10 10 11.749978605017017 8.510653794493031 0.0 3 0.997505113530504 24.702826130095634 32104.0 128.13126385809312 0.0 - - - - - - - 225.5 64 6 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1045 132 C20140709_OR012_04 C20140709_OR012_04 TB434147.[MT7]-AAGWSELSER.2y6_1.heavy 625.318 / 720.352 9687.0 29.998600006103516 50 20 10 10 10 11.749978605017017 8.510653794493031 0.0 3 0.997505113530504 24.702826130095634 9687.0 34.384609531611225 0.0 - - - - - - - 257.57142857142856 19 7 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1047 133 C20140709_OR012_04 C20140709_OR012_04 TB434283.[MT7]-HRIMHSGDGPYK[MT7].4b8_2.heavy 422.225 / 539.77 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1049 133 C20140709_OR012_04 C20140709_OR012_04 TB434283.[MT7]-HRIMHSGDGPYK[MT7].4b11_2.heavy 422.225 / 698.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1051 133 C20140709_OR012_04 C20140709_OR012_04 TB434283.[MT7]-HRIMHSGDGPYK[MT7].4b4_1.heavy 422.225 / 682.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1053 133 C20140709_OR012_04 C20140709_OR012_04 TB434283.[MT7]-HRIMHSGDGPYK[MT7].4b5_1.heavy 422.225 / 819.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1055 134 C20140709_OR012_04 C20140709_OR012_04 TB415960.[MT7]-DRIPVSYK[MT7].3y3_1.heavy 422.587 / 541.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1057 134 C20140709_OR012_04 C20140709_OR012_04 TB415960.[MT7]-DRIPVSYK[MT7].3y4_1.heavy 422.587 / 640.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1059 134 C20140709_OR012_04 C20140709_OR012_04 TB415960.[MT7]-DRIPVSYK[MT7].3b4_2.heavy 422.587 / 313.691 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1061 134 C20140709_OR012_04 C20140709_OR012_04 TB415960.[MT7]-DRIPVSYK[MT7].3y5_1.heavy 422.587 / 737.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1063 135 C20140709_OR012_04 C20140709_OR012_04 TB434144.[MT7]-DVAGMHEAK[MT7].2y4_1.heavy 623.329 / 628.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1065 135 C20140709_OR012_04 C20140709_OR012_04 TB434144.[MT7]-DVAGMHEAK[MT7].2y6_1.heavy 623.329 / 816.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1067 135 C20140709_OR012_04 C20140709_OR012_04 TB434144.[MT7]-DVAGMHEAK[MT7].2b5_1.heavy 623.329 / 618.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1069 135 C20140709_OR012_04 C20140709_OR012_04 TB434144.[MT7]-DVAGMHEAK[MT7].2y7_1.heavy 623.329 / 887.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1071 136 C20140709_OR012_04 C20140709_OR012_04 TB434141.[MT7]-VLQDNLDK[MT7].2y4_1.heavy 616.858 / 633.369 4801.0 27.043749809265137 27 14 0 5 8 2.703722905072498 29.164289448925643 0.04089927673339844 4 0.9313735380859803 4.683829069967019 4801.0 45.94498599807473 0.0 - - - - - - - 210.6 9 10 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1073 136 C20140709_OR012_04 C20140709_OR012_04 TB434141.[MT7]-VLQDNLDK[MT7].2y3_1.heavy 616.858 / 519.326 1054.0 27.043749809265137 27 14 0 5 8 2.703722905072498 29.164289448925643 0.04089927673339844 4 0.9313735380859803 4.683829069967019 1054.0 0.35972696245733776 7.0 - - - - - - - 304.2 3 15 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1075 136 C20140709_OR012_04 C20140709_OR012_04 TB434141.[MT7]-VLQDNLDK[MT7].2y6_1.heavy 616.858 / 876.454 2576.0 27.043749809265137 27 14 0 5 8 2.703722905072498 29.164289448925643 0.04089927673339844 4 0.9313735380859803 4.683829069967019 2576.0 7.4051282051282055 0.0 - - - - - - - 248.625 5 8 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1077 136 C20140709_OR012_04 C20140709_OR012_04 TB434141.[MT7]-VLQDNLDK[MT7].2y7_1.heavy 616.858 / 989.538 4333.0 27.043749809265137 27 14 0 5 8 2.703722905072498 29.164289448925643 0.04089927673339844 4 0.9313735380859803 4.683829069967019 4333.0 48.63823361823361 1.0 - - - - - - - 234.0 60 6 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1079 137 C20140709_OR012_04 C20140709_OR012_04 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1468430.0 35.14649963378906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1468430.0 999.404360143421 0.0 - - - - - - - 129.0 2936 1 1081 137 C20140709_OR012_04 C20140709_OR012_04 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 279691.0 35.14649963378906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 279691.0 329.04297202268776 0.0 - - - - - - - 193.5 559 2 1083 137 C20140709_OR012_04 C20140709_OR012_04 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 441121.0 35.14649963378906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 441121.0 422.55953030745894 0.0 - - - - - - - 172.0 882 3 1085 138 C20140709_OR012_04 C20140709_OR012_04 TB415820.[MT7]-YQSNPK[MT7].2y4_1.heavy 512.787 / 589.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1087 138 C20140709_OR012_04 C20140709_OR012_04 TB415820.[MT7]-YQSNPK[MT7].2y5_1.heavy 512.787 / 717.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1089 138 C20140709_OR012_04 C20140709_OR012_04 TB415820.[MT7]-YQSNPK[MT7].2b4_1.heavy 512.787 / 637.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1091 138 C20140709_OR012_04 C20140709_OR012_04 TB415820.[MT7]-YQSNPK[MT7].2y3_1.heavy 512.787 / 502.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1093 139 C20140709_OR012_04 C20140709_OR012_04 TB416166.[MT7]-LLIQAEFPSLLK[MT7].2y8_1.heavy 830.518 / 1048.62 4140.0 46.97669982910156 46 16 10 10 10 3.448982923808197 28.994054829817753 0.0 3 0.9653550411517969 6.6112025222159785 4140.0 39.27302004777113 1.0 - - - - - - - 211.0 10 12 S100G S100 calcium binding protein G 1095 139 C20140709_OR012_04 C20140709_OR012_04 TB416166.[MT7]-LLIQAEFPSLLK[MT7].2y5_1.heavy 830.518 / 701.468 7435.0 46.97669982910156 46 16 10 10 10 3.448982923808197 28.994054829817753 0.0 3 0.9653550411517969 6.6112025222159785 7435.0 38.494822485207095 0.0 - - - - - - - 202.5 14 10 S100G S100 calcium binding protein G 1097 139 C20140709_OR012_04 C20140709_OR012_04 TB416166.[MT7]-LLIQAEFPSLLK[MT7].2b4_1.heavy 830.518 / 612.42 5069.0 46.97669982910156 46 16 10 10 10 3.448982923808197 28.994054829817753 0.0 3 0.9653550411517969 6.6112025222159785 5069.0 19.409678014900397 0.0 - - - - - - - 304.0 10 10 S100G S100 calcium binding protein G 1099 139 C20140709_OR012_04 C20140709_OR012_04 TB416166.[MT7]-LLIQAEFPSLLK[MT7].2y6_1.heavy 830.518 / 848.536 3717.0 46.97669982910156 46 16 10 10 10 3.448982923808197 28.994054829817753 0.0 3 0.9653550411517969 6.6112025222159785 3717.0 35.95119746474261 0.0 - - - - - - - 225.0 7 9 S100G S100 calcium binding protein G 1101 140 C20140709_OR012_04 C20140709_OR012_04 TB415959.[MT7]-K[MT7]SPEELK[MT7].2y5_1.heavy 631.888 / 759.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - S100G S100 calcium binding protein G 1103 140 C20140709_OR012_04 C20140709_OR012_04 TB415959.[MT7]-K[MT7]SPEELK[MT7].2y3_1.heavy 631.888 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - S100G S100 calcium binding protein G 1105 140 C20140709_OR012_04 C20140709_OR012_04 TB415959.[MT7]-K[MT7]SPEELK[MT7].2y6_1.heavy 631.888 / 846.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - S100G S100 calcium binding protein G 1107 140 C20140709_OR012_04 C20140709_OR012_04 TB415959.[MT7]-K[MT7]SPEELK[MT7].2b5_1.heavy 631.888 / 859.476 N/A N/A - - - - - - - - - 0.0 - - - - - - - S100G S100 calcium binding protein G 1109 141 C20140709_OR012_04 C20140709_OR012_04 TB415958.[MT7]-GVTDLDAVGK[MT7].2y4_1.heavy 631.863 / 518.342 13176.0 28.174224853515625 40 14 10 6 10 1.4088826204808131 48.24494720692572 0.03730010986328125 3 0.9410285658317717 5.056893656762409 13176.0 27.464040920716112 0.0 - - - - - - - 307.25 26 8 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1111 141 C20140709_OR012_04 C20140709_OR012_04 TB415958.[MT7]-GVTDLDAVGK[MT7].2b4_1.heavy 631.863 / 517.274 14739.0 28.174224853515625 40 14 10 6 10 1.4088826204808131 48.24494720692572 0.03730010986328125 3 0.9410285658317717 5.056893656762409 14739.0 37.41165527202696 0.0 - - - - - - - 335.0 29 7 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1113 141 C20140709_OR012_04 C20140709_OR012_04 TB415958.[MT7]-GVTDLDAVGK[MT7].2b6_1.heavy 631.863 / 745.385 7481.0 28.174224853515625 40 14 10 6 10 1.4088826204808131 48.24494720692572 0.03730010986328125 3 0.9410285658317717 5.056893656762409 7481.0 46.76328588196346 0.0 - - - - - - - 265.125 14 8 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1115 141 C20140709_OR012_04 C20140709_OR012_04 TB415958.[MT7]-GVTDLDAVGK[MT7].2b7_1.heavy 631.863 / 816.422 4690.0 28.174224853515625 40 14 10 6 10 1.4088826204808131 48.24494720692572 0.03730010986328125 3 0.9410285658317717 5.056893656762409 4690.0 26.90371184077206 0.0 - - - - - - - 234.6 9 10 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1117 142 C20140709_OR012_04 C20140709_OR012_04 TB416423.[MT7]-SDLLLAEPAEPAPAPAPQEEAEGLAAALGPR.3b4_1.heavy 1065.89 / 573.336 6039.0 44.47079849243164 43 13 10 10 10 1.576552736790364 50.71474245569473 0.0 3 0.9243436092667171 4.458232092595418 6039.0 40.27696944151739 0.0 - - - - - - - 170.25 12 4 ZXDA zinc finger, X-linked, duplicated A 1119 142 C20140709_OR012_04 C20140709_OR012_04 TB416423.[MT7]-SDLLLAEPAEPAPAPAPQEEAEGLAAALGPR.3b5_1.heavy 1065.89 / 686.42 5649.0 44.47079849243164 43 13 10 10 10 1.576552736790364 50.71474245569473 0.0 3 0.9243436092667171 4.458232092595418 5649.0 32.5249062170706 0.0 - - - - - - - 194.66666666666666 11 6 ZXDA zinc finger, X-linked, duplicated A 1121 142 C20140709_OR012_04 C20140709_OR012_04 TB416423.[MT7]-SDLLLAEPAEPAPAPAPQEEAEGLAAALGPR.3y12_1.heavy 1065.89 / 1154.62 3019.0 44.47079849243164 43 13 10 10 10 1.576552736790364 50.71474245569473 0.0 3 0.9243436092667171 4.458232092595418 3019.0 17.760086670179135 0.0 - - - - - - - 243.5 6 8 ZXDA zinc finger, X-linked, duplicated A 1123 142 C20140709_OR012_04 C20140709_OR012_04 TB416423.[MT7]-SDLLLAEPAEPAPAPAPQEEAEGLAAALGPR.3b7_1.heavy 1065.89 / 886.5 7986.0 44.47079849243164 43 13 10 10 10 1.576552736790364 50.71474245569473 0.0 3 0.9243436092667171 4.458232092595418 7986.0 107.62660358706397 0.0 - - - - - - - 162.0 15 3 ZXDA zinc finger, X-linked, duplicated A 1125 143 C20140709_OR012_04 C20140709_OR012_04 TB434357.[MT7]-EFSFHNFNQAFGFMSR.4y5_1.heavy 528.248 / 597.281 4350.0 43.737300872802734 43 15 8 10 10 2.646498115294456 37.785781679604085 0.0 3 0.9598535924430716 6.138683809902564 4350.0 25.12376237623762 0.0 - - - - - - - 240.0 8 8 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1127 143 C20140709_OR012_04 C20140709_OR012_04 TB434357.[MT7]-EFSFHNFNQAFGFMSR.4b4_1.heavy 528.248 / 655.321 1720.0 43.737300872802734 43 15 8 10 10 2.646498115294456 37.785781679604085 0.0 3 0.9598535924430716 6.138683809902564 1720.0 27.24752475247525 0.0 - - - - - - - 134.66666666666666 3 6 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1129 143 C20140709_OR012_04 C20140709_OR012_04 TB434357.[MT7]-EFSFHNFNQAFGFMSR.4y6_1.heavy 528.248 / 744.35 4046.0 43.737300872802734 43 15 8 10 10 2.646498115294456 37.785781679604085 0.0 3 0.9598535924430716 6.138683809902564 4046.0 30.84574257425743 0.0 - - - - - - - 202.0 8 5 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1131 143 C20140709_OR012_04 C20140709_OR012_04 TB434357.[MT7]-EFSFHNFNQAFGFMSR.4b3_1.heavy 528.248 / 508.252 1113.0 43.737300872802734 43 15 8 10 10 2.646498115294456 37.785781679604085 0.0 3 0.9598535924430716 6.138683809902564 1113.0 6.97920792079208 4.0 - - - - - - - 176.75 11 4 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1133 144 C20140709_OR012_04 C20140709_OR012_04 TB415950.[MT7]-AAGWSELSER.3b4_1.heavy 417.215 / 530.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1135 144 C20140709_OR012_04 C20140709_OR012_04 TB415950.[MT7]-AAGWSELSER.3b5_1.heavy 417.215 / 617.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1137 144 C20140709_OR012_04 C20140709_OR012_04 TB415950.[MT7]-AAGWSELSER.3y4_1.heavy 417.215 / 504.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1139 144 C20140709_OR012_04 C20140709_OR012_04 TB415950.[MT7]-AAGWSELSER.3y5_1.heavy 417.215 / 633.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1141 145 C20140709_OR012_04 C20140709_OR012_04 TB434359.[MT7]-NVFRPGGHSYGGGATNANAR.3y11_1.heavy 716.359 / 1051.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1143 145 C20140709_OR012_04 C20140709_OR012_04 TB434359.[MT7]-NVFRPGGHSYGGGATNANAR.3y12_1.heavy 716.359 / 1138.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1145 145 C20140709_OR012_04 C20140709_OR012_04 TB434359.[MT7]-NVFRPGGHSYGGGATNANAR.3y10_1.heavy 716.359 / 888.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1147 145 C20140709_OR012_04 C20140709_OR012_04 TB434359.[MT7]-NVFRPGGHSYGGGATNANAR.3y9_1.heavy 716.359 / 831.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1149 146 C20140709_OR012_04 C20140709_OR012_04 TB434250.[MT7]-ELPTC[CAM]SIC[CAM]LER.2y8_1.heavy 761.38 / 1038.47 2495.0 33.184898376464844 43 18 10 5 10 19.102044303137227 5.235041779458991 0.0410003662109375 3 0.9808889579226968 8.913044966587897 2495.0 27.773558180709955 0.0 - - - - - - - 262.6666666666667 4 3 RNF112 ring finger protein 112 1151 146 C20140709_OR012_04 C20140709_OR012_04 TB434250.[MT7]-ELPTC[CAM]SIC[CAM]LER.2y9_1.heavy 761.38 / 1135.52 18517.0 33.184898376464844 43 18 10 5 10 19.102044303137227 5.235041779458991 0.0410003662109375 3 0.9808889579226968 8.913044966587897 18517.0 172.28715989899283 0.0 - - - - - - - 180.5 37 8 RNF112 ring finger protein 112 1153 146 C20140709_OR012_04 C20140709_OR012_04 TB434250.[MT7]-ELPTC[CAM]SIC[CAM]LER.2y10_1.heavy 761.38 / 1248.61 919.0 33.184898376464844 43 18 10 5 10 19.102044303137227 5.235041779458991 0.0410003662109375 3 0.9808889579226968 8.913044966587897 919.0 5.752198508165556 2.0 - - - - - - - 236.4 2 5 RNF112 ring finger protein 112 1155 146 C20140709_OR012_04 C20140709_OR012_04 TB434250.[MT7]-ELPTC[CAM]SIC[CAM]LER.2y7_1.heavy 761.38 / 937.423 1970.0 33.184898376464844 43 18 10 5 10 19.102044303137227 5.235041779458991 0.0410003662109375 3 0.9808889579226968 8.913044966587897 1970.0 12.383003802281369 0.0 - - - - - - - 262.7142857142857 3 7 RNF112 ring finger protein 112 1157 147 C20140709_OR012_04 C20140709_OR012_04 TB416022.[MT7]-VHQLLLQNK[MT7].2b3_1.heavy 690.932 / 509.295 670.0 27.221399307250977 46 16 10 10 10 2.823964900182897 23.898642699607265 0.0 3 0.9633654065764161 6.428088327697511 670.0 3.905829596412556 2.0 - - - - - - - 0.0 1 0 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1159 147 C20140709_OR012_04 C20140709_OR012_04 TB416022.[MT7]-VHQLLLQNK[MT7].2y4_1.heavy 690.932 / 646.4 1564.0 27.221399307250977 46 16 10 10 10 2.823964900182897 23.898642699607265 0.0 3 0.9633654065764161 6.428088327697511 1564.0 4.083246852983405 0.0 - - - - - - - 300.6923076923077 3 13 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1161 147 C20140709_OR012_04 C20140709_OR012_04 TB416022.[MT7]-VHQLLLQNK[MT7].2y5_1.heavy 690.932 / 759.484 1228.0 27.221399307250977 46 16 10 10 10 2.823964900182897 23.898642699607265 0.0 3 0.9633654065764161 6.428088327697511 1228.0 1.466268656716418 1.0 - - - - - - - 198.66666666666666 2 9 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1163 147 C20140709_OR012_04 C20140709_OR012_04 TB416022.[MT7]-VHQLLLQNK[MT7].2b4_1.heavy 690.932 / 622.379 1787.0 27.221399307250977 46 16 10 10 10 2.823964900182897 23.898642699607265 0.0 3 0.9633654065764161 6.428088327697511 1787.0 5.006389004665083 0.0 - - - - - - - 198.55555555555554 3 9 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1165 148 C20140709_OR012_04 C20140709_OR012_04 TB434065.[MT7]-VTQASVK[MT7].2y4_1.heavy 510.818 / 548.352 917.0 19.23140001296997 28 16 0 6 6 2.138830815271147 46.75451619922666 0.03560066223144531 5 0.9614712459195581 6.267084199552291 917.0 6.294637853949329 1.0 - - - - - - - 0.0 1 0 TUB;TULP1;TULP3 tubby homolog (mouse);tubby like protein 1;tubby like protein 3 1167 148 C20140709_OR012_04 C20140709_OR012_04 TB434065.[MT7]-VTQASVK[MT7].2y5_1.heavy 510.818 / 676.411 642.0 19.23140001296997 28 16 0 6 6 2.138830815271147 46.75451619922666 0.03560066223144531 5 0.9614712459195581 6.267084199552291 642.0 4.323374068554396 2.0 - - - - - - - 189.85714285714286 2 14 TUB;TULP1;TULP3 tubby homolog (mouse);tubby like protein 1;tubby like protein 3 1169 148 C20140709_OR012_04 C20140709_OR012_04 TB434065.[MT7]-VTQASVK[MT7].2b4_1.heavy 510.818 / 544.321 917.0 19.23140001296997 28 16 0 6 6 2.138830815271147 46.75451619922666 0.03560066223144531 5 0.9614712459195581 6.267084199552291 917.0 4.660163934426229 3.0 - - - - - - - 160.25 3 4 TUB;TULP1;TULP3 tubby homolog (mouse);tubby like protein 1;tubby like protein 3 1171 148 C20140709_OR012_04 C20140709_OR012_04 TB434065.[MT7]-VTQASVK[MT7].2y6_1.heavy 510.818 / 777.459 1926.0 19.23140001296997 28 16 0 6 6 2.138830815271147 46.75451619922666 0.03560066223144531 5 0.9614712459195581 6.267084199552291 1926.0 24.65270848182466 1.0 - - - - - - - 171.875 13 8 TUB;TULP1;TULP3 tubby homolog (mouse);tubby like protein 1;tubby like protein 3 1173 149 C20140709_OR012_04 C20140709_OR012_04 TB415952.[MT7]-DAAEELSFAR.3b4_1.heavy 418.215 / 531.253 2169.0 32.09749984741211 40 16 8 10 6 2.0070720048266355 39.199406950445024 0.0 5 0.962192722960366 6.3269848536590985 2169.0 -0.3268131567758002 3.0 - - - - - - - 128.0 18 4 QRICH2 glutamine rich 2 1175 149 C20140709_OR012_04 C20140709_OR012_04 TB415952.[MT7]-DAAEELSFAR.3b5_1.heavy 418.215 / 660.296 2807.0 32.09749984741211 40 16 8 10 6 2.0070720048266355 39.199406950445024 0.0 5 0.962192722960366 6.3269848536590985 2807.0 42.587453124999996 1.0 - - - - - - - 207.5 20 8 QRICH2 glutamine rich 2 1177 149 C20140709_OR012_04 C20140709_OR012_04 TB415952.[MT7]-DAAEELSFAR.3y4_1.heavy 418.215 / 480.257 7783.0 32.09749984741211 40 16 8 10 6 2.0070720048266355 39.199406950445024 0.0 5 0.962192722960366 6.3269848536590985 7783.0 117.35304687499999 0.0 - - - - - - - 212.66666666666666 15 3 QRICH2 glutamine rich 2 1179 149 C20140709_OR012_04 C20140709_OR012_04 TB415952.[MT7]-DAAEELSFAR.3y5_1.heavy 418.215 / 593.341 1786.0 32.09749984741211 40 16 8 10 6 2.0070720048266355 39.199406950445024 0.0 5 0.962192722960366 6.3269848536590985 1786.0 19.98032781862745 0.0 - - - - - - - 255.5 3 2 QRICH2 glutamine rich 2 1181 150 C20140709_OR012_04 C20140709_OR012_04 TB434067.[MT7]-SASLETK[MT7].2y4_1.heavy 512.3 / 634.389 3299.0 21.85167407989502 29 18 0 5 6 4.934942796777337 20.263659401544217 0.044300079345703125 5 0.983326937898807 9.544417198343446 3299.0 17.697686286594763 1.0 - - - - - - - 222.66666666666666 8 9 TJP1 tight junction protein 1 (zona occludens 1) 1183 150 C20140709_OR012_04 C20140709_OR012_04 TB434067.[MT7]-SASLETK[MT7].2b4_1.heavy 512.3 / 503.295 7775.0 21.85167407989502 29 18 0 5 6 4.934942796777337 20.263659401544217 0.044300079345703125 5 0.983326937898807 9.544417198343446 7775.0 7.369224922734815 2.0 - - - - - - - 196.33333333333334 63 3 TJP1 tight junction protein 1 (zona occludens 1) 1185 150 C20140709_OR012_04 C20140709_OR012_04 TB434067.[MT7]-SASLETK[MT7].2y3_1.heavy 512.3 / 521.305 3416.0 21.85167407989502 29 18 0 5 6 4.934942796777337 20.263659401544217 0.044300079345703125 5 0.983326937898807 9.544417198343446 3416.0 30.396610169491524 0.0 - - - - - - - 147.5 6 4 TJP1 tight junction protein 1 (zona occludens 1) 1187 150 C20140709_OR012_04 C20140709_OR012_04 TB434067.[MT7]-SASLETK[MT7].2y6_1.heavy 512.3 / 792.458 2356.0 21.85167407989502 29 18 0 5 6 4.934942796777337 20.263659401544217 0.044300079345703125 5 0.983326937898807 9.544417198343446 2356.0 16.557441302155855 0.0 - - - - - - - 196.66666666666666 4 3 TJP1 tight junction protein 1 (zona occludens 1) 1189 151 C20140709_OR012_04 C20140709_OR012_04 TB416028.[MT7]-IMHSGDGPYK[MT7].3y3_1.heavy 464.911 / 551.331 2241.0 22.20039939880371 43 13 10 10 10 1.1094211745781637 55.27902662821643 0.0 3 0.9052194787538563 3.976595254783752 2241.0 9.305847457627118 0.0 - - - - - - - 354.0 4 4 ZNF625 zinc finger protein 625 1191 151 C20140709_OR012_04 C20140709_OR012_04 TB416028.[MT7]-IMHSGDGPYK[MT7].3b3_2.heavy 464.911 / 263.65 1062.0 22.20039939880371 43 13 10 10 10 1.1094211745781637 55.27902662821643 0.0 3 0.9052194787538563 3.976595254783752 1062.0 1.7999999999999998 0.0 - - - - - - - 236.0 2 3 ZNF625 zinc finger protein 625 1193 151 C20140709_OR012_04 C20140709_OR012_04 TB416028.[MT7]-IMHSGDGPYK[MT7].3b3_1.heavy 464.911 / 526.293 826.0 22.20039939880371 43 13 10 10 10 1.1094211745781637 55.27902662821643 0.0 3 0.9052194787538563 3.976595254783752 826.0 3.2199999999999998 5.0 - - - - - - - 0.0 1 0 ZNF625 zinc finger protein 625 1195 151 C20140709_OR012_04 C20140709_OR012_04 TB416028.[MT7]-IMHSGDGPYK[MT7].3y4_1.heavy 464.911 / 608.352 1298.0 22.20039939880371 43 13 10 10 10 1.1094211745781637 55.27902662821643 0.0 3 0.9052194787538563 3.976595254783752 1298.0 9.753250423968344 1.0 - - - - - - - 236.0 3 4 ZNF625 zinc finger protein 625 1197 152 C20140709_OR012_04 C20140709_OR012_04 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 16917.0 22.77869987487793 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 16917.0 173.6306460118655 0.0 - - - - - - - 221.8 33 5 1199 152 C20140709_OR012_04 C20140709_OR012_04 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 17411.0 22.77869987487793 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 17411.0 204.97654356341135 0.0 - - - - - - - 215.75 34 4 1201 152 C20140709_OR012_04 C20140709_OR012_04 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 46801.0 22.77869987487793 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 46801.0 441.7526995490603 0.0 - - - - - - - 185.0 93 2 1203 153 C20140709_OR012_04 C20140709_OR012_04 TB434255.[MT7]-IIGDYFSDQDPR.2y4_1.heavy 785.387 / 515.257 1280.0 36.982749938964844 40 17 10 5 8 6.740120127438511 14.836530819815463 0.04109954833984375 4 0.9757961921229309 7.916635384357208 1280.0 6.579999999999999 1.0 - - - - - - - 219.42857142857142 3 7 INTS4 integrator complex subunit 4 1205 153 C20140709_OR012_04 C20140709_OR012_04 TB434255.[MT7]-IIGDYFSDQDPR.2b4_1.heavy 785.387 / 543.326 6143.0 36.982749938964844 40 17 10 5 8 6.740120127438511 14.836530819815463 0.04109954833984375 4 0.9757961921229309 7.916635384357208 6143.0 16.077382812499998 0.0 - - - - - - - 237.71428571428572 12 7 INTS4 integrator complex subunit 4 1207 153 C20140709_OR012_04 C20140709_OR012_04 TB434255.[MT7]-IIGDYFSDQDPR.2y10_1.heavy 785.387 / 1199.5 896.0 36.982749938964844 40 17 10 5 8 6.740120127438511 14.836530819815463 0.04109954833984375 4 0.9757961921229309 7.916635384357208 896.0 2.3333333333333335 0.0 - - - - - - - 0.0 1 0 INTS4 integrator complex subunit 4 1209 153 C20140709_OR012_04 C20140709_OR012_04 TB434255.[MT7]-IIGDYFSDQDPR.2b5_1.heavy 785.387 / 706.389 640.0 36.982749938964844 40 17 10 5 8 6.740120127438511 14.836530819815463 0.04109954833984375 4 0.9757961921229309 7.916635384357208 640.0 2.2333333333333334 3.0 - - - - - - - 182.85714285714286 3 7 INTS4 integrator complex subunit 4 1211 154 C20140709_OR012_04 C20140709_OR012_04 TB416155.[MT7]-IVESDVGDSFYIR.2y4_1.heavy 822.424 / 598.335 125.0 37.922550201416016 35 14 10 5 6 2.534841159218527 30.81101405105147 0.042999267578125 6 0.9347010648086131 4.803051694717949 125.0 0.2909891534341104 25.0 - - - - - - - 0.0 1 0 TJP1 tight junction protein 1 (zona occludens 1) 1213 154 C20140709_OR012_04 C20140709_OR012_04 TB416155.[MT7]-IVESDVGDSFYIR.2y8_1.heavy 822.424 / 956.484 1504.0 37.922550201416016 35 14 10 5 6 2.534841159218527 30.81101405105147 0.042999267578125 6 0.9347010648086131 4.803051694717949 1504.0 5.812868923507566 0.0 - - - - - - - 219.375 3 8 TJP1 tight junction protein 1 (zona occludens 1) 1215 154 C20140709_OR012_04 C20140709_OR012_04 TB416155.[MT7]-IVESDVGDSFYIR.2y5_1.heavy 822.424 / 685.367 1002.0 37.922550201416016 35 14 10 5 6 2.534841159218527 30.81101405105147 0.042999267578125 6 0.9347010648086131 4.803051694717949 1002.0 2.4016063745019913 1.0 - - - - - - - 208.83333333333334 2 6 TJP1 tight junction protein 1 (zona occludens 1) 1217 154 C20140709_OR012_04 C20140709_OR012_04 TB416155.[MT7]-IVESDVGDSFYIR.2y10_1.heavy 822.424 / 1158.54 627.0 37.922550201416016 35 14 10 5 6 2.534841159218527 30.81101405105147 0.042999267578125 6 0.9347010648086131 4.803051694717949 627.0 3.1646904191743666 6.0 - - - - - - - 0.0 1 0 TJP1 tight junction protein 1 (zona occludens 1) 1219 155 C20140709_OR012_04 C20140709_OR012_04 TB416156.[MT7]-ARNVNTGELAAIK[MT7].4b8_1.heavy 411.996 / 986.514 N/A 27.143600463867188 50 20 10 10 10 9.762656000336513 10.243114168578003 0.0 3 0.9974822667563251 24.59044288933029 112.0 1.4277777777777776 5.0 - - - - - - - 0.0 0 0 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1221 155 C20140709_OR012_04 C20140709_OR012_04 TB416156.[MT7]-ARNVNTGELAAIK[MT7].4b8_2.heavy 411.996 / 493.76 17640.0 27.143600463867188 50 20 10 10 10 9.762656000336513 10.243114168578003 0.0 3 0.9974822667563251 24.59044288933029 17640.0 234.32500000000002 0.0 - - - - - - - 202.0 35 5 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1223 155 C20140709_OR012_04 C20140709_OR012_04 TB416156.[MT7]-ARNVNTGELAAIK[MT7].4y3_1.heavy 411.996 / 475.336 9438.0 27.143600463867188 50 20 10 10 10 9.762656000336513 10.243114168578003 0.0 3 0.9974822667563251 24.59044288933029 9438.0 34.26267260579064 0.0 - - - - - - - 236.88888888888889 18 9 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1225 155 C20140709_OR012_04 C20140709_OR012_04 TB416156.[MT7]-ARNVNTGELAAIK[MT7].4b9_2.heavy 411.996 / 550.302 8427.0 27.143600463867188 50 20 10 10 10 9.762656000336513 10.243114168578003 0.0 3 0.9974822667563251 24.59044288933029 8427.0 18.932637093805297 0.0 - - - - - - - 224.44444444444446 16 9 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1227 156 C20140709_OR012_04 C20140709_OR012_04 TB446707.[MT7]-DREQFLELVSRK[MT7].4b7_2.heavy 452.762 / 531.771 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 1229 156 C20140709_OR012_04 C20140709_OR012_04 TB446707.[MT7]-DREQFLELVSRK[MT7].4b5_1.heavy 452.762 / 820.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 1231 156 C20140709_OR012_04 C20140709_OR012_04 TB446707.[MT7]-DREQFLELVSRK[MT7].4y7_2.heavy 452.762 / 494.817 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 1233 156 C20140709_OR012_04 C20140709_OR012_04 TB446707.[MT7]-DREQFLELVSRK[MT7].4b3_1.heavy 452.762 / 545.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 1235 157 C20140709_OR012_04 C20140709_OR012_04 TB415849.[MT7]-QQDVATK[MT7].2y4_1.heavy 539.311 / 562.368 3037.0 16.00550079345703 44 14 10 10 10 2.4534823523173115 32.540739817076116 0.0 3 0.9403348171022725 5.0271114104743715 3037.0 27.771020188135093 0.0 - - - - - - - 137.92307692307693 6 13 RNF112 ring finger protein 112 1237 157 C20140709_OR012_04 C20140709_OR012_04 TB415849.[MT7]-QQDVATK[MT7].2b3_1.heavy 539.311 / 516.253 2838.0 16.00550079345703 44 14 10 10 10 2.4534823523173115 32.540739817076116 0.0 3 0.9403348171022725 5.0271114104743715 2838.0 37.94158389261745 1.0 - - - - - - - 178.0 5 14 RNF112 ring finger protein 112 1239 157 C20140709_OR012_04 C20140709_OR012_04 TB415849.[MT7]-QQDVATK[MT7].2b4_1.heavy 539.311 / 615.322 398.0 16.00550079345703 44 14 10 10 10 2.4534823523173115 32.540739817076116 0.0 3 0.9403348171022725 5.0271114104743715 398.0 12.0992 0.0 - - - - - - - 0.0 0 0 RNF112 ring finger protein 112 1241 157 C20140709_OR012_04 C20140709_OR012_04 TB415849.[MT7]-QQDVATK[MT7].2y6_1.heavy 539.311 / 805.454 2141.0 16.00550079345703 44 14 10 10 10 2.4534823523173115 32.540739817076116 0.0 3 0.9403348171022725 5.0271114104743715 2141.0 53.9532 0.0 - - - - - - - 137.25 4 8 RNF112 ring finger protein 112 1243 158 C20140709_OR012_04 C20140709_OR012_04 TB415945.[MT7]-THFEYEK[MT7].3y3_1.heavy 414.552 / 583.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1 tight junction protein 1 (zona occludens 1) 1245 158 C20140709_OR012_04 C20140709_OR012_04 TB415945.[MT7]-THFEYEK[MT7].3b4_1.heavy 414.552 / 659.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1 tight junction protein 1 (zona occludens 1) 1247 158 C20140709_OR012_04 C20140709_OR012_04 TB415945.[MT7]-THFEYEK[MT7].3b3_1.heavy 414.552 / 530.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1 tight junction protein 1 (zona occludens 1) 1249 158 C20140709_OR012_04 C20140709_OR012_04 TB415945.[MT7]-THFEYEK[MT7].3y4_1.heavy 414.552 / 712.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1 tight junction protein 1 (zona occludens 1) 1251 159 C20140709_OR012_04 C20140709_OR012_04 TB446798.[MT7]-SHQVLAQLLDTLLAIGTK[MT7].4b7_1.heavy 553.084 / 908.507 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 1253 159 C20140709_OR012_04 C20140709_OR012_04 TB446798.[MT7]-SHQVLAQLLDTLLAIGTK[MT7].4b4_1.heavy 553.084 / 596.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 1255 159 C20140709_OR012_04 C20140709_OR012_04 TB446798.[MT7]-SHQVLAQLLDTLLAIGTK[MT7].4b5_1.heavy 553.084 / 709.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 1257 159 C20140709_OR012_04 C20140709_OR012_04 TB446798.[MT7]-SHQVLAQLLDTLLAIGTK[MT7].4b6_1.heavy 553.084 / 780.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 1259 160 C20140709_OR012_04 C20140709_OR012_04 TB416410.[MT7]-ISNNITLREDQLDTVLAVLEDSSR.4y8_1.heavy 712.131 / 876.442 903.0 49.33809947967529 37 14 9 6 8 1.6358197491369115 43.4590795143327 0.034801483154296875 4 0.9420378888776307 5.101171201932077 903.0 6.9159999999999995 1.0 - - - - - - - 208.88888888888889 3 9 INTS4 integrator complex subunit 4 1261 160 C20140709_OR012_04 C20140709_OR012_04 TB416410.[MT7]-ISNNITLREDQLDTVLAVLEDSSR.4b4_1.heavy 712.131 / 573.311 1505.0 49.33809947967529 37 14 9 6 8 1.6358197491369115 43.4590795143327 0.034801483154296875 4 0.9420378888776307 5.101171201932077 1505.0 3.995575221238938 0.0 - - - - - - - 150.35714285714286 3 14 INTS4 integrator complex subunit 4 1263 160 C20140709_OR012_04 C20140709_OR012_04 TB416410.[MT7]-ISNNITLREDQLDTVLAVLEDSSR.4b13_2.heavy 712.131 / 828.937 677.0 49.33809947967529 37 14 9 6 8 1.6358197491369115 43.4590795143327 0.034801483154296875 4 0.9420378888776307 5.101171201932077 677.0 8.4364 1.0 - - - - - - - 0.0 1 0 INTS4 integrator complex subunit 4 1265 160 C20140709_OR012_04 C20140709_OR012_04 TB416410.[MT7]-ISNNITLREDQLDTVLAVLEDSSR.4y6_1.heavy 712.131 / 706.337 1430.0 49.33809947967529 37 14 9 6 8 1.6358197491369115 43.4590795143327 0.034801483154296875 4 0.9420378888776307 5.101171201932077 1430.0 22.88 0.0 - - - - - - - 195.4 2 10 INTS4 integrator complex subunit 4 1267 161 C20140709_OR012_04 C20140709_OR012_04 TB446793.[MT7]-ARAPC[CAM]IVYIDEIDAVGK[MT7].3b6_1.heavy 726.733 / 813.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1269 161 C20140709_OR012_04 C20140709_OR012_04 TB446793.[MT7]-ARAPC[CAM]IVYIDEIDAVGK[MT7].3y4_1.heavy 726.733 / 518.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1271 161 C20140709_OR012_04 C20140709_OR012_04 TB446793.[MT7]-ARAPC[CAM]IVYIDEIDAVGK[MT7].3y5_1.heavy 726.733 / 633.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1273 161 C20140709_OR012_04 C20140709_OR012_04 TB446793.[MT7]-ARAPC[CAM]IVYIDEIDAVGK[MT7].3b7_1.heavy 726.733 / 912.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1275 162 C20140709_OR012_04 C20140709_OR012_04 TB416298.[MT7]-LLPARGTLQGGGGGGIPAGGGR.3y6_1.heavy 688.391 / 514.273 4138.0 29.43160057067871 44 20 8 10 6 14.633714283518334 6.833535086347014 0.0 6 0.9954428273939362 18.27467083564055 4138.0 0.2823609689525759 1.0 - - - - - - - 287.5 11 4 ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 1277 162 C20140709_OR012_04 C20140709_OR012_04 TB416298.[MT7]-LLPARGTLQGGGGGGIPAGGGR.3y20_2.heavy 688.391 / 846.948 3333.0 29.43160057067871 44 20 8 10 6 14.633714283518334 6.833535086347014 0.0 6 0.9954428273939362 18.27467083564055 3333.0 2.8982608695652177 1.0 - - - - - - - 325.8333333333333 7 6 ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 1279 162 C20140709_OR012_04 C20140709_OR012_04 TB416298.[MT7]-LLPARGTLQGGGGGGIPAGGGR.3y13_1.heavy 688.391 / 969.486 1264.0 29.43160057067871 44 20 8 10 6 14.633714283518334 6.833535086347014 0.0 6 0.9954428273939362 18.27467083564055 1264.0 0.0 4.0 - - - - - - - 279.2857142857143 4 7 ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 1281 162 C20140709_OR012_04 C20140709_OR012_04 TB416298.[MT7]-LLPARGTLQGGGGGGIPAGGGR.3y21_2.heavy 688.391 / 903.49 1609.0 29.43160057067871 44 20 8 10 6 14.633714283518334 6.833535086347014 0.0 6 0.9954428273939362 18.27467083564055 1609.0 6.29608695652174 2.0 - - - - - - - 197.14285714285714 5 7 ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 1283 163 C20140709_OR012_04 C20140709_OR012_04 TB416299.[MT7]-LLPARGTLQGGGGGGIPAGGGR.4b15_2.heavy 516.545 / 718.908 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 1285 163 C20140709_OR012_04 C20140709_OR012_04 TB416299.[MT7]-LLPARGTLQGGGGGGIPAGGGR.4b10_1.heavy 516.545 / 1151.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 1287 163 C20140709_OR012_04 C20140709_OR012_04 TB416299.[MT7]-LLPARGTLQGGGGGGIPAGGGR.4b14_2.heavy 516.545 / 690.397 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 1289 163 C20140709_OR012_04 C20140709_OR012_04 TB416299.[MT7]-LLPARGTLQGGGGGGIPAGGGR.4y6_1.heavy 516.545 / 514.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 1291 164 C20140709_OR012_04 C20140709_OR012_04 TB416412.[MT7]-VQVVPESDVVEVYLHPGAVVFGRPR.4y10_2.heavy 723.902 / 528.309 5973.0 42.71615028381348 38 12 10 6 10 2.0905868030244172 47.83345989524648 0.037700653076171875 3 0.8958881086036524 3.79114338911924 5973.0 22.071809576587444 0.0 - - - - - - - 228.63636363636363 11 11 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1293 164 C20140709_OR012_04 C20140709_OR012_04 TB416412.[MT7]-VQVVPESDVVEVYLHPGAVVFGRPR.4y10_1.heavy 723.902 / 1055.61 2725.0 42.71615028381348 38 12 10 6 10 2.0905868030244172 47.83345989524648 0.037700653076171875 3 0.8958881086036524 3.79114338911924 2725.0 32.46527145890203 0.0 - - - - - - - 157.375 5 8 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1295 164 C20140709_OR012_04 C20140709_OR012_04 TB416412.[MT7]-VQVVPESDVVEVYLHPGAVVFGRPR.4b4_1.heavy 723.902 / 570.373 7231.0 42.71615028381348 38 12 10 6 10 2.0905868030244172 47.83345989524648 0.037700653076171875 3 0.8958881086036524 3.79114338911924 7231.0 54.360802547770696 0.0 - - - - - - - 227.16666666666666 14 12 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1297 164 C20140709_OR012_04 C20140709_OR012_04 TB416412.[MT7]-VQVVPESDVVEVYLHPGAVVFGRPR.4y14_2.heavy 723.902 / 784.446 3458.0 42.71615028381348 38 12 10 6 10 2.0905868030244172 47.83345989524648 0.037700653076171875 3 0.8958881086036524 3.79114338911924 3458.0 37.72242163882259 0.0 - - - - - - - 244.66666666666666 6 9 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1299 165 C20140709_OR012_04 C20140709_OR012_04 TB446795.[MT7]-SVPGLDGSGWEVFDIWK[MT7].3b9_1.heavy 727.38 / 914.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1301 165 C20140709_OR012_04 C20140709_OR012_04 TB446795.[MT7]-SVPGLDGSGWEVFDIWK[MT7].3y6_1.heavy 727.38 / 951.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1303 165 C20140709_OR012_04 C20140709_OR012_04 TB446795.[MT7]-SVPGLDGSGWEVFDIWK[MT7].3y3_1.heavy 727.38 / 590.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1305 165 C20140709_OR012_04 C20140709_OR012_04 TB446795.[MT7]-SVPGLDGSGWEVFDIWK[MT7].3y4_1.heavy 727.38 / 705.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1307 166 C20140709_OR012_04 C20140709_OR012_04 TB434058.[MT7]-LLNVLQR.2y4_1.heavy 500.325 / 515.33 8313.0 36.690799713134766 30 5 10 5 10 0.43808142349839313 108.40460276767703 0.04160308837890625 3 0.6823451674672883 2.128890509320523 8313.0 47.7348046875 0.0 - - - - - - - 298.6666666666667 16 3 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1309 166 C20140709_OR012_04 C20140709_OR012_04 TB434058.[MT7]-LLNVLQR.2y5_1.heavy 500.325 / 629.373 2814.0 36.690799713134766 30 5 10 5 10 0.43808142349839313 108.40460276767703 0.04160308837890625 3 0.6823451674672883 2.128890509320523 2814.0 15.043642899061034 0.0 - - - - - - - 277.3333333333333 5 6 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1311 166 C20140709_OR012_04 C20140709_OR012_04 TB434058.[MT7]-LLNVLQR.2b4_1.heavy 500.325 / 584.389 2814.0 36.690799713134766 30 5 10 5 10 0.43808142349839313 108.40460276767703 0.04160308837890625 3 0.6823451674672883 2.128890509320523 2814.0 21.10534377443315 0.0 - - - - - - - 128.0 5 2 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1313 166 C20140709_OR012_04 C20140709_OR012_04 TB434058.[MT7]-LLNVLQR.2y6_1.heavy 500.325 / 742.457 4604.0 36.690799713134766 30 5 10 5 10 0.43808142349839313 108.40460276767703 0.04160308837890625 3 0.6823451674672883 2.128890509320523 4604.0 68.340625 0.0 - - - - - - - 153.6 9 5 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1315 167 C20140709_OR012_04 C20140709_OR012_04 TB416013.[MT7]-SFTTVYNLK[MT7].2b4_1.heavy 680.889 / 581.305 919.0 34.261600494384766 34 13 8 5 8 1.0320845545717328 60.39884159546819 0.043498992919921875 4 0.9116157966974178 4.120246330093936 919.0 7.898051303909792 4.0 - - - - - - - 149.85714285714286 2 7 ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 1317 167 C20140709_OR012_04 C20140709_OR012_04 TB416013.[MT7]-SFTTVYNLK[MT7].2y3_1.heavy 680.889 / 518.342 2626.0 34.261600494384766 34 13 8 5 8 1.0320845545717328 60.39884159546819 0.043498992919921875 4 0.9116157966974178 4.120246330093936 2626.0 14.917378934975197 1.0 - - - - - - - 229.875 5 8 ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 1319 167 C20140709_OR012_04 C20140709_OR012_04 TB416013.[MT7]-SFTTVYNLK[MT7].2y6_1.heavy 680.889 / 881.521 1707.0 34.261600494384766 34 13 8 5 8 1.0320845545717328 60.39884159546819 0.043498992919921875 4 0.9116157966974178 4.120246330093936 1707.0 20.067022900763355 0.0 - - - - - - - 213.375 3 8 ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 1321 167 C20140709_OR012_04 C20140709_OR012_04 TB416013.[MT7]-SFTTVYNLK[MT7].2b5_1.heavy 680.889 / 680.374 N/A 34.261600494384766 34 13 8 5 8 1.0320845545717328 60.39884159546819 0.043498992919921875 4 0.9116157966974178 4.120246330093936 7746.0 4.919125468312682 4.0 - - - - - - - 131.0 21 1 ZXDB;ZXDA zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A 1323 168 C20140709_OR012_04 C20140709_OR012_04 TB434055.[MT7]-ERPPLAR.2y4_1.heavy 491.799 / 456.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1325 168 C20140709_OR012_04 C20140709_OR012_04 TB434055.[MT7]-ERPPLAR.2y5_1.heavy 491.799 / 553.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1327 168 C20140709_OR012_04 C20140709_OR012_04 TB434055.[MT7]-ERPPLAR.2b6_1.heavy 491.799 / 808.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1329 168 C20140709_OR012_04 C20140709_OR012_04 TB434055.[MT7]-ERPPLAR.2y6_1.heavy 491.799 / 709.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1331 169 C20140709_OR012_04 C20140709_OR012_04 TB416010.[MT7]-RVYEEFTK[MT7].3y3_1.heavy 453.922 / 539.331 3645.0 26.218700408935547 38 12 10 6 10 1.2314135348442372 54.42344556243199 0.0373992919921875 3 0.8897540242373437 3.6822042597855846 3645.0 21.714893617021275 0.0 - - - - - - - 251.85714285714286 7 7 INTS4 integrator complex subunit 4 1333 169 C20140709_OR012_04 C20140709_OR012_04 TB416010.[MT7]-RVYEEFTK[MT7].3b4_1.heavy 453.922 / 692.385 1411.0 26.218700408935547 38 12 10 6 10 1.2314135348442372 54.42344556243199 0.0373992919921875 3 0.8897540242373437 3.6822042597855846 1411.0 14.71760010818608 0.0 - - - - - - - 300.55555555555554 2 9 INTS4 integrator complex subunit 4 1335 169 C20140709_OR012_04 C20140709_OR012_04 TB416010.[MT7]-RVYEEFTK[MT7].3b5_1.heavy 453.922 / 821.427 1293.0 26.218700408935547 38 12 10 6 10 1.2314135348442372 54.42344556243199 0.0373992919921875 3 0.8897540242373437 3.6822042597855846 1293.0 21.25779661016949 0.0 - - - - - - - 118.0 2 4 INTS4 integrator complex subunit 4 1337 169 C20140709_OR012_04 C20140709_OR012_04 TB416010.[MT7]-RVYEEFTK[MT7].3b7_2.heavy 453.922 / 535.275 588.0 26.218700408935547 38 12 10 6 10 1.2314135348442372 54.42344556243199 0.0373992919921875 3 0.8897540242373437 3.6822042597855846 588.0 4.70705200089712 7.0 - - - - - - - 285.57142857142856 2 14 INTS4 integrator complex subunit 4 1339 170 C20140709_OR012_04 C20140709_OR012_04 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 99641.0 32.412200927734375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 99641.0 155.34110440127958 0.0 - - - - - - - 195.0 199 6 1341 170 C20140709_OR012_04 C20140709_OR012_04 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 99512.0 32.412200927734375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 99512.0 267.84676663635145 0.0 - - - - - - - 303.3333333333333 199 6 1343 170 C20140709_OR012_04 C20140709_OR012_04 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 203310.0 32.412200927734375 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 203310.0 32.88745888930113 1.0 - - - - - - - 227.5 425 8 1345 171 C20140709_OR012_04 C20140709_OR012_04 TB446592.[MT7]-LQALANALLEK[MT7].3b6_1.heavy 491.308 / 755.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1347 171 C20140709_OR012_04 C20140709_OR012_04 TB446592.[MT7]-LQALANALLEK[MT7].3y3_1.heavy 491.308 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1349 171 C20140709_OR012_04 C20140709_OR012_04 TB446592.[MT7]-LQALANALLEK[MT7].3b4_1.heavy 491.308 / 570.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1351 171 C20140709_OR012_04 C20140709_OR012_04 TB446592.[MT7]-LQALANALLEK[MT7].3b5_1.heavy 491.308 / 641.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1353 172 C20140709_OR012_04 C20140709_OR012_04 TB446593.[MT7]-AAATAGGQGGAARK[MT7].2y10_1.heavy 737.92 / 1016.57 735.0 14.711625337600708 43 17 10 6 10 4.792378915657465 20.866463558063842 0.03329944610595703 3 0.9701348251881649 7.12349321965703 735.0 52.5 0.0 - - - - - - - 0.0 1 0 TUB tubby homolog (mouse) 1355 172 C20140709_OR012_04 C20140709_OR012_04 TB446593.[MT7]-AAATAGGQGGAARK[MT7].2y12_1.heavy 737.92 / 1188.66 141.0 14.711625337600708 43 17 10 6 10 4.792378915657465 20.866463558063842 0.03329944610595703 3 0.9701348251881649 7.12349321965703 141.0 15.107142857142858 0.0 - - - - - - - 0.0 0 0 TUB tubby homolog (mouse) 1357 172 C20140709_OR012_04 C20140709_OR012_04 TB446593.[MT7]-AAATAGGQGGAARK[MT7].2y11_1.heavy 737.92 / 1117.62 438.0 14.711625337600708 43 17 10 6 10 4.792378915657465 20.866463558063842 0.03329944610595703 3 0.9701348251881649 7.12349321965703 438.0 34.831428571428575 0.0 - - - - - - - 0.0 0 0 TUB tubby homolog (mouse) 1359 172 C20140709_OR012_04 C20140709_OR012_04 TB446593.[MT7]-AAATAGGQGGAARK[MT7].2y9_1.heavy 737.92 / 945.535 438.0 14.711625337600708 43 17 10 6 10 4.792378915657465 20.866463558063842 0.03329944610595703 3 0.9701348251881649 7.12349321965703 438.0 39.00285714285714 0.0 - - - - - - - 0.0 0 0 TUB tubby homolog (mouse) 1361 173 C20140709_OR012_04 C20140709_OR012_04 TB434267.[MT7]-SLVALLVETQMK[MT7].2y4_1.heavy 810.486 / 651.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC1;SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1363 173 C20140709_OR012_04 C20140709_OR012_04 TB434267.[MT7]-SLVALLVETQMK[MT7].2b4_1.heavy 810.486 / 515.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC1;SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1365 173 C20140709_OR012_04 C20140709_OR012_04 TB434267.[MT7]-SLVALLVETQMK[MT7].2y6_1.heavy 810.486 / 879.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC1;SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1367 173 C20140709_OR012_04 C20140709_OR012_04 TB434267.[MT7]-SLVALLVETQMK[MT7].2b5_1.heavy 810.486 / 628.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - SMARCC1;SMARCC2 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 1369 174 C20140709_OR012_04 C20140709_OR012_04 TB416018.[MT7]-ILLEHYYK[MT7].3y3_1.heavy 456.271 / 617.341 5308.0 32.02750015258789 34 9 10 5 10 0.4987503577332992 94.05837203509728 0.046600341796875 3 0.8080027032663868 2.7701787637931905 5308.0 62.096839701361446 0.0 - - - - - - - 210.66666666666666 10 3 INTS4 integrator complex subunit 4 1371 174 C20140709_OR012_04 C20140709_OR012_04 TB416018.[MT7]-ILLEHYYK[MT7].3b4_1.heavy 456.271 / 613.404 885.0 32.02750015258789 34 9 10 5 10 0.4987503577332992 94.05837203509728 0.046600341796875 3 0.8080027032663868 2.7701787637931905 885.0 3.2980237154150194 1.0 - - - - - - - 0.0 1 0 INTS4 integrator complex subunit 4 1373 174 C20140709_OR012_04 C20140709_OR012_04 TB416018.[MT7]-ILLEHYYK[MT7].3y4_1.heavy 456.271 / 754.4 632.0 32.02750015258789 34 9 10 5 10 0.4987503577332992 94.05837203509728 0.046600341796875 3 0.8080027032663868 2.7701787637931905 632.0 7.513896731288035 1.0 - - - - - - - 0.0 1 0 INTS4 integrator complex subunit 4 1375 174 C20140709_OR012_04 C20140709_OR012_04 TB416018.[MT7]-ILLEHYYK[MT7].3b3_1.heavy 456.271 / 484.362 4044.0 32.02750015258789 34 9 10 5 10 0.4987503577332992 94.05837203509728 0.046600341796875 3 0.8080027032663868 2.7701787637931905 4044.0 23.41683794466403 0.0 - - - - - - - 252.71428571428572 8 7 INTS4 integrator complex subunit 4 1377 175 C20140709_OR012_04 C20140709_OR012_04 TB434173.[MT7]-SAEPGPGEPEGR.2y8_1.heavy 663.824 / 798.374 692.0 17.79977512359619 45 20 10 5 10 3.531235547257688 20.105149921368398 0.046100616455078125 3 0.9969579964167863 22.37032810289885 692.0 14.692463768115942 0.0 - - - - - - - 0.0 1 0 SPAG4 sperm associated antigen 4 1379 175 C20140709_OR012_04 C20140709_OR012_04 TB434173.[MT7]-SAEPGPGEPEGR.2y9_1.heavy 663.824 / 895.427 7470.0 17.79977512359619 45 20 10 5 10 3.531235547257688 20.105149921368398 0.046100616455078125 3 0.9969579964167863 22.37032810289885 7470.0 87.52995401337793 0.0 - - - - - - - 172.83333333333334 14 6 SPAG4 sperm associated antigen 4 1381 175 C20140709_OR012_04 C20140709_OR012_04 TB434173.[MT7]-SAEPGPGEPEGR.2y10_1.heavy 663.824 / 1024.47 899.0 17.79977512359619 45 20 10 5 10 3.531235547257688 20.105149921368398 0.046100616455078125 3 0.9969579964167863 22.37032810289885 899.0 4.452278512672299 1.0 - - - - - - - 0.0 1 0 SPAG4 sperm associated antigen 4 1383 175 C20140709_OR012_04 C20140709_OR012_04 TB434173.[MT7]-SAEPGPGEPEGR.2y7_1.heavy 663.824 / 741.353 830.0 17.79977512359619 45 20 10 5 10 3.531235547257688 20.105149921368398 0.046100616455078125 3 0.9969579964167863 22.37032810289885 830.0 11.828985507246378 1.0 - - - - - - - 0.0 1 0 SPAG4 sperm associated antigen 4 1385 176 C20140709_OR012_04 C20140709_OR012_04 TB446357.[MT7]-LALMYR.2y4_1.heavy 455.769 / 582.307 1294.0 34.265225410461426 38 17 10 5 6 1.5494269027361351 48.22478648195843 0.043498992919921875 6 0.9729513123280732 7.486958995457319 1294.0 10.015515848073989 4.0 - - - - - - - 240.14285714285714 6 7 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1387 176 C20140709_OR012_04 C20140709_OR012_04 TB446357.[MT7]-LALMYR.2y5_1.heavy 455.769 / 653.344 5951.0 34.265225410461426 38 17 10 5 6 1.5494269027361351 48.22478648195843 0.043498992919921875 6 0.9729513123280732 7.486958995457319 5951.0 28.527989690721647 0.0 - - - - - - - 310.4 11 5 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1389 176 C20140709_OR012_04 C20140709_OR012_04 TB446357.[MT7]-LALMYR.2b4_1.heavy 455.769 / 573.355 2329.0 34.265225410461426 38 17 10 5 6 1.5494269027361351 48.22478648195843 0.043498992919921875 6 0.9729513123280732 7.486958995457319 2329.0 8.992277992277993 0.0 - - - - - - - 212.35714285714286 4 14 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1391 176 C20140709_OR012_04 C20140709_OR012_04 TB446357.[MT7]-LALMYR.2y3_1.heavy 455.769 / 469.223 906.0 34.265225410461426 38 17 10 5 6 1.5494269027361351 48.22478648195843 0.043498992919921875 6 0.9729513123280732 7.486958995457319 906.0 1.949034749034749 4.0 - - - - - - - 258.6666666666667 2 3 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1393 177 C20140709_OR012_04 C20140709_OR012_04 TB446494.[MT7]-AFSDLPYFR.2y8_1.heavy 630.331 / 1044.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1395 177 C20140709_OR012_04 C20140709_OR012_04 TB446494.[MT7]-AFSDLPYFR.2y5_1.heavy 630.331 / 695.388 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1397 177 C20140709_OR012_04 C20140709_OR012_04 TB446494.[MT7]-AFSDLPYFR.2b4_1.heavy 630.331 / 565.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1399 177 C20140709_OR012_04 C20140709_OR012_04 TB446494.[MT7]-AFSDLPYFR.2b5_1.heavy 630.331 / 678.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1401 178 C20140709_OR012_04 C20140709_OR012_04 TB434425.[MT7]-DEDQDY[MT7]IVDHSIAIYLLNPDGLFTDYYGR.4y4_1.heavy 927.954 / 558.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1403 178 C20140709_OR012_04 C20140709_OR012_04 TB434425.[MT7]-DEDQDY[MT7]IVDHSIAIYLLNPDGLFTDYYGR.4y9_1.heavy 927.954 / 1091.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1405 178 C20140709_OR012_04 C20140709_OR012_04 TB434425.[MT7]-DEDQDY[MT7]IVDHSIAIYLLNPDGLFTDYYGR.4b5_1.heavy 927.954 / 747.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1407 178 C20140709_OR012_04 C20140709_OR012_04 TB434425.[MT7]-DEDQDY[MT7]IVDHSIAIYLLNPDGLFTDYYGR.4b3_1.heavy 927.954 / 504.206 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1409 179 C20140709_OR012_04 C20140709_OR012_04 TB434045.[MT7]-ENDPSVR.2b3_1.heavy 480.747 / 503.222 5992.0 15.832224607467651 34 17 10 5 2 7.237771503435123 13.816407433218766 0.04069995880126953 15 0.9774332363569692 8.199882157601868 5992.0 43.08697874265039 0.0 - - - - - - - 180.33333333333334 11 12 INTS4 integrator complex subunit 4 1411 179 C20140709_OR012_04 C20140709_OR012_04 TB434045.[MT7]-ENDPSVR.2y4_1.heavy 480.747 / 458.272 7502.0 15.832224607467651 34 17 10 5 2 7.237771503435123 13.816407433218766 0.04069995880126953 15 0.9774332363569692 8.199882157601868 7502.0 146.1617097472924 0.0 - - - - - - - 171.91666666666666 15 12 INTS4 integrator complex subunit 4 1413 179 C20140709_OR012_04 C20140709_OR012_04 TB434045.[MT7]-ENDPSVR.2y5_1.heavy 480.747 / 573.299 101.0 15.832224607467651 34 17 10 5 2 7.237771503435123 13.816407433218766 0.04069995880126953 15 0.9774332363569692 8.199882157601868 101.0 2.8280000000000003 21.0 - - - - - - - 0.0 1 0 INTS4 integrator complex subunit 4 1415 179 C20140709_OR012_04 C20140709_OR012_04 TB434045.[MT7]-ENDPSVR.2y3_1.heavy 480.747 / 361.219 201.0 15.832224607467651 34 17 10 5 2 7.237771503435123 13.816407433218766 0.04069995880126953 15 0.9774332363569692 8.199882157601868 201.0 1.3407613636363633 20.0 - - - - - - - 132.0625 2 16 INTS4 integrator complex subunit 4 1417 180 C20140709_OR012_04 C20140709_OR012_04 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 241423.0 26.68000030517578 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 241423.0 136.52449907198525 0.0 - - - - - - - 3760.0 482 8 1419 180 C20140709_OR012_04 C20140709_OR012_04 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 333006.0 26.68000030517578 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 333006.0 344.03382413542033 0.0 - - - - - - - 1342.0 666 1 1421 180 C20140709_OR012_04 C20140709_OR012_04 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 389587.0 26.68000030517578 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 389587.0 570.4128781189703 0.0 - - - - - - - 2758.6666666666665 779 3 1423 181 C20140709_OR012_04 C20140709_OR012_04 TB446495.[MT7]-GLTWDPVGK[MT7].3y3_1.heavy 420.911 / 447.305 6676.0 34.89082622528076 36 11 10 5 10 0.7178847007066458 79.82261344527235 0.043300628662109375 3 0.8609332205095744 3.2702744683818876 6676.0 -4.076946564885496 0.0 - - - - - - - 174.66666666666666 13 3 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1425 181 C20140709_OR012_04 C20140709_OR012_04 TB446495.[MT7]-GLTWDPVGK[MT7].3b4_1.heavy 420.911 / 602.342 916.0 34.89082622528076 36 11 10 5 10 0.7178847007066458 79.82261344527235 0.043300628662109375 3 0.8609332205095744 3.2702744683818876 916.0 10.48854961832061 1.0 - - - - - - - 196.5 6 2 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1427 181 C20140709_OR012_04 C20140709_OR012_04 TB446495.[MT7]-GLTWDPVGK[MT7].3b5_1.heavy 420.911 / 717.369 3534.0 34.89082622528076 36 11 10 5 10 0.7178847007066458 79.82261344527235 0.043300628662109375 3 0.8609332205095744 3.2702744683818876 3534.0 22.076259541984733 0.0 - - - - - - - 196.5 7 2 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1429 181 C20140709_OR012_04 C20140709_OR012_04 TB446495.[MT7]-GLTWDPVGK[MT7].3y4_1.heavy 420.911 / 544.357 7723.0 34.89082622528076 36 11 10 5 10 0.7178847007066458 79.82261344527235 0.043300628662109375 3 0.8609332205095744 3.2702744683818876 7723.0 93.73717557251908 0.0 - - - - - - - 157.2 15 5 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1431 182 C20140709_OR012_04 C20140709_OR012_04 TB446617.[MT7]-LELGLGPQPMAPR.2y8_1.heavy 761.93 / 853.435 9536.0 37.41630172729492 48 18 10 10 10 14.931632253928738 6.697191459003987 0.0 3 0.9898763974977562 12.255407607786687 9536.0 58.948232232667664 1.0 - - - - - - - 202.71428571428572 20 7 RNF112 ring finger protein 112 1433 182 C20140709_OR012_04 C20140709_OR012_04 TB446617.[MT7]-LELGLGPQPMAPR.2b4_1.heavy 761.93 / 557.341 8634.0 37.41630172729492 48 18 10 10 10 14.931632253928738 6.697191459003987 0.0 3 0.9898763974977562 12.255407607786687 8634.0 47.418835132084 0.0 - - - - - - - 236.5 17 6 RNF112 ring finger protein 112 1435 182 C20140709_OR012_04 C20140709_OR012_04 TB446617.[MT7]-LELGLGPQPMAPR.2y10_1.heavy 761.93 / 1023.54 12628.0 37.41630172729492 48 18 10 10 10 14.931632253928738 6.697191459003987 0.0 3 0.9898763974977562 12.255407607786687 12628.0 52.0496865520728 0.0 - - - - - - - 225.75 25 4 RNF112 ring finger protein 112 1437 182 C20140709_OR012_04 C20140709_OR012_04 TB446617.[MT7]-LELGLGPQPMAPR.2y11_1.heavy 761.93 / 1136.62 4897.0 37.41630172729492 48 18 10 10 10 14.931632253928738 6.697191459003987 0.0 3 0.9898763974977562 12.255407607786687 4897.0 42.831360922528766 1.0 - - - - - - - 236.5 14 6 RNF112 ring finger protein 112 1439 183 C20140709_OR012_04 C20140709_OR012_04 TB415909.[MT7]-VYYNAGPK[MT7].2y4_1.heavy 600.337 / 516.326 1114.0 23.85669994354248 35 10 10 5 10 0.8913349168000185 70.32336934622228 0.04440116882324219 3 0.8480799223133788 3.1253360970860045 1114.0 3.393548387096774 4.0 - - - - - - - 297.2 2 5 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1441 183 C20140709_OR012_04 C20140709_OR012_04 TB415909.[MT7]-VYYNAGPK[MT7].2y5_1.heavy 600.337 / 630.369 1362.0 23.85669994354248 35 10 10 5 10 0.8913349168000185 70.32336934622228 0.04440116882324219 3 0.8480799223133788 3.1253360970860045 1362.0 9.885483870967743 0.0 - - - - - - - 268.3333333333333 2 6 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1443 183 C20140709_OR012_04 C20140709_OR012_04 TB415909.[MT7]-VYYNAGPK[MT7].2b4_1.heavy 600.337 / 684.347 743.0 23.85669994354248 35 10 10 5 10 0.8913349168000185 70.32336934622228 0.04440116882324219 3 0.8480799223133788 3.1253360970860045 743.0 1.2537665720177618 6.0 - - - - - - - 223.0 2 5 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1445 183 C20140709_OR012_04 C20140709_OR012_04 TB415909.[MT7]-VYYNAGPK[MT7].2b5_1.heavy 600.337 / 755.385 866.0 23.85669994354248 35 10 10 5 10 0.8913349168000185 70.32336934622228 0.04440116882324219 3 0.8480799223133788 3.1253360970860045 866.0 4.59843665768194 0.0 - - - - - - - 0.0 1 0 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1447 184 C20140709_OR012_04 C20140709_OR012_04 TB434424.[MT7]-SHQVLAQLLDTLLAIGTK[MT7]LPENQAIQMR.4b7_1.heavy 848.235 / 908.507 1207.0 54.715301513671875 50 20 10 10 10 8.897340616015553 11.239313443839183 0.0 3 0.9948400619028224 17.173278094777228 1207.0 14.00630621725808 0.0 - - - - - - - 81.44444444444444 2 27 INTS4 integrator complex subunit 4 1449 184 C20140709_OR012_04 C20140709_OR012_04 TB434424.[MT7]-SHQVLAQLLDTLLAIGTK[MT7]LPENQAIQMR.4y9_1.heavy 848.235 / 1086.54 3704.0 54.715301513671875 50 20 10 10 10 8.897340616015553 11.239313443839183 0.0 3 0.9948400619028224 17.173278094777228 3704.0 7.358940397350993 0.0 - - - - - - - 108.59375 7 32 INTS4 integrator complex subunit 4 1451 184 C20140709_OR012_04 C20140709_OR012_04 TB434424.[MT7]-SHQVLAQLLDTLLAIGTK[MT7]LPENQAIQMR.4b4_1.heavy 848.235 / 596.327 1525.0 54.715301513671875 50 20 10 10 10 8.897340616015553 11.239313443839183 0.0 3 0.9948400619028224 17.173278094777228 1525.0 4.317674320623551 0.0 - - - - - - - 60.03333333333333 3 30 INTS4 integrator complex subunit 4 1453 184 C20140709_OR012_04 C20140709_OR012_04 TB434424.[MT7]-SHQVLAQLLDTLLAIGTK[MT7]LPENQAIQMR.4b5_1.heavy 848.235 / 709.411 1626.0 54.715301513671875 50 20 10 10 10 8.897340616015553 11.239313443839183 0.0 3 0.9948400619028224 17.173278094777228 1626.0 0.0 0.0 - - - - - - - 63.47826086956522 3 23 INTS4 integrator complex subunit 4 1455 185 C20140709_OR012_04 C20140709_OR012_04 TB446614.[MT7]-ENSEFYELAK[MT7].3b5_1.heavy 506.596 / 751.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - SIM1 single-minded homolog 1 (Drosophila) 1457 185 C20140709_OR012_04 C20140709_OR012_04 TB446614.[MT7]-ENSEFYELAK[MT7].3b5_2.heavy 506.596 / 376.173 N/A N/A - - - - - - - - - 0.0 - - - - - - - SIM1 single-minded homolog 1 (Drosophila) 1459 185 C20140709_OR012_04 C20140709_OR012_04 TB446614.[MT7]-ENSEFYELAK[MT7].3y5_1.heavy 506.596 / 767.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - SIM1 single-minded homolog 1 (Drosophila) 1461 186 C20140709_OR012_04 C20140709_OR012_04 TB415729.[MT7]-LLAALR.2b3_1.heavy 400.777 / 442.315 767.0 35.41047477722168 43 18 10 5 10 13.93913172577043 7.1740479943325095 0.04650115966796875 3 0.9894796220260932 12.021681465297933 767.0 7.889713541666667 3.0 - - - - - - - 256.0 3 3 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1463 186 C20140709_OR012_04 C20140709_OR012_04 TB415729.[MT7]-LLAALR.2y4_1.heavy 400.777 / 430.277 1534.0 35.41047477722168 43 18 10 5 10 13.93913172577043 7.1740479943325095 0.04650115966796875 3 0.9894796220260932 12.021681465297933 1534.0 23.36953125 0.0 - - - - - - - 128.0 3 5 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1465 186 C20140709_OR012_04 C20140709_OR012_04 TB415729.[MT7]-LLAALR.2y5_1.heavy 400.777 / 543.361 2429.0 35.41047477722168 43 18 10 5 10 13.93913172577043 7.1740479943325095 0.04650115966796875 3 0.9894796220260932 12.021681465297933 2429.0 19.92724743150685 0.0 - - - - - - - 384.0 4 1 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1467 186 C20140709_OR012_04 C20140709_OR012_04 TB415729.[MT7]-LLAALR.2b4_1.heavy 400.777 / 513.352 1534.0 35.41047477722168 43 18 10 5 10 13.93913172577043 7.1740479943325095 0.04650115966796875 3 0.9894796220260932 12.021681465297933 1534.0 12.104968945618154 0.0 - - - - - - - 192.0 3 4 PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 1469 187 C20140709_OR012_04 C20140709_OR012_04 TB446712.[MT7]-DQLAAEAAARLEAQAR.3y6_1.heavy 609.998 / 687.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1471 187 C20140709_OR012_04 C20140709_OR012_04 TB446712.[MT7]-DQLAAEAAARLEAQAR.3b4_1.heavy 609.998 / 572.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1473 187 C20140709_OR012_04 C20140709_OR012_04 TB446712.[MT7]-DQLAAEAAARLEAQAR.3b5_1.heavy 609.998 / 643.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1475 187 C20140709_OR012_04 C20140709_OR012_04 TB446712.[MT7]-DQLAAEAAARLEAQAR.3b3_1.heavy 609.998 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1477 188 C20140709_OR012_04 C20140709_OR012_04 TB415904.[MT7]-YIASQADDR.2y8_1.heavy 591.797 / 875.422 5715.0 22.02039909362793 47 17 10 10 10 5.384424639647079 18.57208647023695 0.0 3 0.9716398700709022 7.3109951479263176 5715.0 25.641178632688067 0.0 - - - - - - - 214.0 11 6 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1479 188 C20140709_OR012_04 C20140709_OR012_04 TB415904.[MT7]-YIASQADDR.2y6_1.heavy 591.797 / 691.301 3732.0 22.02039909362793 47 17 10 10 10 5.384424639647079 18.57208647023695 0.0 3 0.9716398700709022 7.3109951479263176 3732.0 41.708175824175825 0.0 - - - - - - - 244.0 7 11 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1481 188 C20140709_OR012_04 C20140709_OR012_04 TB415904.[MT7]-YIASQADDR.2b7_1.heavy 591.797 / 893.448 3032.0 22.02039909362793 47 17 10 10 10 5.384424639647079 18.57208647023695 0.0 3 0.9716398700709022 7.3109951479263176 3032.0 15.35095223021371 0.0 - - - - - - - 218.75 6 8 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1483 188 C20140709_OR012_04 C20140709_OR012_04 TB415904.[MT7]-YIASQADDR.2y7_1.heavy 591.797 / 762.338 5715.0 22.02039909362793 47 17 10 10 10 5.384424639647079 18.57208647023695 0.0 3 0.9716398700709022 7.3109951479263176 5715.0 27.75857142857143 0.0 - - - - - - - 285.3333333333333 11 9 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1485 189 C20140709_OR012_04 C20140709_OR012_04 TB415902.[MT7]-LLGLTGSTK[MT7].2y4_1.heavy 589.373 / 536.316 19870.0 32.82429885864258 47 17 10 10 10 2.834732296482193 30.06211854598256 0.0 3 0.9764395254659132 8.024425768291884 19870.0 74.46338117040514 0.0 - - - - - - - 279.875 39 8 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1487 189 C20140709_OR012_04 C20140709_OR012_04 TB415902.[MT7]-LLGLTGSTK[MT7].2y8_1.heavy 589.373 / 920.553 28424.0 32.82429885864258 47 17 10 10 10 2.834732296482193 30.06211854598256 0.0 3 0.9764395254659132 8.024425768291884 28424.0 43.79841302988566 0.0 - - - - - - - 292.44444444444446 56 9 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1489 189 C20140709_OR012_04 C20140709_OR012_04 TB415902.[MT7]-LLGLTGSTK[MT7].2y5_1.heavy 589.373 / 637.364 28161.0 32.82429885864258 47 17 10 10 10 2.834732296482193 30.06211854598256 0.0 3 0.9764395254659132 8.024425768291884 28161.0 209.12813547124185 0.0 - - - - - - - 225.85714285714286 56 7 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1491 189 C20140709_OR012_04 C20140709_OR012_04 TB415902.[MT7]-LLGLTGSTK[MT7].2y7_1.heavy 589.373 / 807.469 25660.0 32.82429885864258 47 17 10 10 10 2.834732296482193 30.06211854598256 0.0 3 0.9764395254659132 8.024425768291884 25660.0 187.23019011406842 0.0 - - - - - - - 237.0 51 5 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1493 190 C20140709_OR012_04 C20140709_OR012_04 TB446368.[MT7]-GQLPGGK[MT7].2y4_1.heavy 472.792 / 502.311 34008.0 19.620800018310547 50 20 10 10 10 12.999838358650221 7.692403339266061 0.0 3 0.9989386885133215 37.87935015643529 34008.0 281.29938177698654 0.0 - - - - - - - 186.0 68 13 GDF5 growth differentiation factor 5 1495 190 C20140709_OR012_04 C20140709_OR012_04 TB446368.[MT7]-GQLPGGK[MT7].2y5_1.heavy 472.792 / 615.395 3001.0 19.620800018310547 50 20 10 10 10 12.999838358650221 7.692403339266061 0.0 3 0.9989386885133215 37.87935015643529 3001.0 14.282457074340526 0.0 - - - - - - - 220.28571428571428 6 14 GDF5 growth differentiation factor 5 1497 190 C20140709_OR012_04 C20140709_OR012_04 TB446368.[MT7]-GQLPGGK[MT7].2y6_1.heavy 472.792 / 743.453 667.0 19.620800018310547 50 20 10 10 10 12.999838358650221 7.692403339266061 0.0 3 0.9989386885133215 37.87935015643529 667.0 3.9940119760479043 0.0 - - - - - - - 0.0 1 0 GDF5 growth differentiation factor 5 1499 190 C20140709_OR012_04 C20140709_OR012_04 TB446368.[MT7]-GQLPGGK[MT7].2b5_1.heavy 472.792 / 597.348 333.0 19.620800018310547 50 20 10 10 10 12.999838358650221 7.692403339266061 0.0 3 0.9989386885133215 37.87935015643529 333.0 0.718705035971223 14.0 - - - - - - - 0.0 1 0 GDF5 growth differentiation factor 5 1501 191 C20140709_OR012_04 C20140709_OR012_04 TB415911.[MT7]-VQELLQGK[MT7].3y3_1.heavy 401.583 / 476.295 11176.0 31.796950340270996 38 13 10 5 10 1.924308876802888 51.96670929780431 0.04590034484863281 3 0.9196258520237751 4.323659687906777 11176.0 122.12817302219692 0.0 - - - - - - - 251.2 22 5 RNF112 ring finger protein 112 1503 191 C20140709_OR012_04 C20140709_OR012_04 TB415911.[MT7]-VQELLQGK[MT7].3b4_1.heavy 401.583 / 614.363 14944.0 31.796950340270996 38 13 10 5 10 1.924308876802888 51.96670929780431 0.04590034484863281 3 0.9196258520237751 4.323659687906777 14944.0 92.03414332061674 0.0 - - - - - - - 209.44444444444446 29 9 RNF112 ring finger protein 112 1505 191 C20140709_OR012_04 C20140709_OR012_04 TB415911.[MT7]-VQELLQGK[MT7].3y4_1.heavy 401.583 / 589.379 1507.0 31.796950340270996 38 13 10 5 10 1.924308876802888 51.96670929780431 0.04590034484863281 3 0.9196258520237751 4.323659687906777 1507.0 10.973670582291271 0.0 - - - - - - - 293.3333333333333 3 3 RNF112 ring finger protein 112 1507 191 C20140709_OR012_04 C20140709_OR012_04 TB415911.[MT7]-VQELLQGK[MT7].3b3_1.heavy 401.583 / 501.279 15320.0 31.796950340270996 38 13 10 5 10 1.924308876802888 51.96670929780431 0.04590034484863281 3 0.9196258520237751 4.323659687906777 15320.0 151.49487130841712 0.0 - - - - - - - 188.75 30 4 RNF112 ring finger protein 112 1509 192 C20140709_OR012_04 C20140709_OR012_04 TB446369.[MT7]-VLDDEGR.2y4_1.heavy 474.249 / 476.21 3238.0 21.530899047851562 38 20 2 10 6 6.490863393411191 15.40627092868862 0.0 5 0.9910491772323105 13.034861375177758 3238.0 11.492901234567903 1.0 - - - - - - - 169.71428571428572 7 7 TUB tubby homolog (mouse) 1511 192 C20140709_OR012_04 C20140709_OR012_04 TB446369.[MT7]-VLDDEGR.2y5_1.heavy 474.249 / 591.237 1403.0 21.530899047851562 38 20 2 10 6 6.490863393411191 15.40627092868862 0.0 5 0.9910491772323105 13.034861375177758 1403.0 4.034033533777561 2.0 - - - - - - - 216.0 4 7 TUB tubby homolog (mouse) 1513 192 C20140709_OR012_04 C20140709_OR012_04 TB446369.[MT7]-VLDDEGR.2b4_1.heavy 474.249 / 587.316 2806.0 21.530899047851562 38 20 2 10 6 6.490863393411191 15.40627092868862 0.0 5 0.9910491772323105 13.034861375177758 2806.0 7.650028592668839 2.0 - - - - - - - 183.6 17 10 TUB tubby homolog (mouse) 1515 192 C20140709_OR012_04 C20140709_OR012_04 TB446369.[MT7]-VLDDEGR.2y6_1.heavy 474.249 / 704.321 4317.0 21.530899047851562 38 20 2 10 6 6.490863393411191 15.40627092868862 0.0 5 0.9910491772323105 13.034861375177758 4317.0 9.727890844828769 0.0 - - - - - - - 216.0 8 5 TUB tubby homolog (mouse) 1517 193 C20140709_OR012_04 C20140709_OR012_04 TB446620.[MT7]-VVQPQEEIATK[MT7].3y6_1.heavy 510.631 / 834.469 2577.0 26.52310085296631 41 17 10 6 8 2.89652350260825 27.309008718591514 0.036800384521484375 4 0.9753957941652431 7.851690894526177 2577.0 8.045409174931374 0.0 - - - - - - - 245.5 5 4 INTS4 integrator complex subunit 4 1519 193 C20140709_OR012_04 C20140709_OR012_04 TB446620.[MT7]-VVQPQEEIATK[MT7].3b5_1.heavy 510.631 / 696.416 4418.0 26.52310085296631 41 17 10 6 8 2.89652350260825 27.309008718591514 0.036800384521484375 4 0.9753957941652431 7.851690894526177 4418.0 60.77443902439025 0.0 - - - - - - - 184.16666666666666 8 6 INTS4 integrator complex subunit 4 1521 193 C20140709_OR012_04 C20140709_OR012_04 TB446620.[MT7]-VVQPQEEIATK[MT7].3y4_1.heavy 510.631 / 576.384 9449.0 26.52310085296631 41 17 10 6 8 2.89652350260825 27.309008718591514 0.036800384521484375 4 0.9753957941652431 7.851690894526177 9449.0 55.11438829544037 1.0 - - - - - - - 291.25 18 8 INTS4 integrator complex subunit 4 1523 193 C20140709_OR012_04 C20140709_OR012_04 TB446620.[MT7]-VVQPQEEIATK[MT7].3b7_1.heavy 510.631 / 954.501 3559.0 26.52310085296631 41 17 10 6 8 2.89652350260825 27.309008718591514 0.036800384521484375 4 0.9753957941652431 7.851690894526177 3559.0 23.242448979591835 0.0 - - - - - - - 196.2 7 5 INTS4 integrator complex subunit 4 1525 194 C20140709_OR012_04 C20140709_OR012_04 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 233632.0 37.827598571777344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 233632.0 99.18916600566375 0.0 - - - - - - - 228.57142857142858 467 7 1527 194 C20140709_OR012_04 C20140709_OR012_04 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 451008.0 37.827598571777344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 451008.0 61.0655692017753 1.0 - - - - - - - 369.5 962 8 1529 194 C20140709_OR012_04 C20140709_OR012_04 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 526582.0 37.827598571777344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 526582.0 224.39736268937148 0.0 - - - - - - - 200.0 1053 8 1531 195 C20140709_OR012_04 C20140709_OR012_04 TB434039.[MT7]-AVTVVK[MT7].2y4_1.heavy 452.807 / 590.399 6791.0 22.334199905395508 42 20 2 10 10 23.71305865500784 4.217085676498401 0.0 3 0.9995173397060875 56.17254665775131 6791.0 43.972692097419895 1.0 - - - - - - - 271.4 13 5 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1533 195 C20140709_OR012_04 C20140709_OR012_04 TB434039.[MT7]-AVTVVK[MT7].2y5_1.heavy 452.807 / 689.468 4569.0 22.334199905395508 42 20 2 10 10 23.71305865500784 4.217085676498401 0.0 3 0.9995173397060875 56.17254665775131 4569.0 20.977704344020133 0.0 - - - - - - - 271.6 9 5 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1535 195 C20140709_OR012_04 C20140709_OR012_04 TB434039.[MT7]-AVTVVK[MT7].2b4_1.heavy 452.807 / 515.331 1976.0 22.334199905395508 42 20 2 10 10 23.71305865500784 4.217085676498401 0.0 3 0.9995173397060875 56.17254665775131 1976.0 4.272432432432431 1.0 - - - - - - - 257.90909090909093 34 11 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1537 195 C20140709_OR012_04 C20140709_OR012_04 TB434039.[MT7]-AVTVVK[MT7].2y3_1.heavy 452.807 / 489.352 3951.0 22.334199905395508 42 20 2 10 10 23.71305865500784 4.217085676498401 0.0 3 0.9995173397060875 56.17254665775131 3951.0 25.113643724696356 0.0 - - - - - - - 308.5 7 4 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1539 196 C20140709_OR012_04 C20140709_OR012_04 TB434189.[MT7]-THTAFPGTDK[MT7].3y3_1.heavy 454.913 / 507.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF503 zinc finger protein 503 1541 196 C20140709_OR012_04 C20140709_OR012_04 TB434189.[MT7]-THTAFPGTDK[MT7].3b4_1.heavy 454.913 / 555.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF503 zinc finger protein 503 1543 196 C20140709_OR012_04 C20140709_OR012_04 TB434189.[MT7]-THTAFPGTDK[MT7].3y4_1.heavy 454.913 / 564.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF503 zinc finger protein 503 1545 196 C20140709_OR012_04 C20140709_OR012_04 TB434189.[MT7]-THTAFPGTDK[MT7].3y5_1.heavy 454.913 / 661.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF503 zinc finger protein 503 1547 197 C20140709_OR012_04 C20140709_OR012_04 TB446629.[MT7]-DIAMLYQGLEK[MT7].3y3_1.heavy 523.625 / 533.341 1021.0 39.97110080718994 43 20 10 5 8 8.148391353472755 12.272360968202772 0.042400360107421875 4 0.9933543926328137 15.130532898799272 1021.0 -1.5953124999999995 5.0 - - - - - - - 213.0 4 3 QRICH2 glutamine rich 2 1549 197 C20140709_OR012_04 C20140709_OR012_04 TB446629.[MT7]-DIAMLYQGLEK[MT7].3b5_1.heavy 523.625 / 688.382 2424.0 39.97110080718994 43 20 10 5 8 8.148391353472755 12.272360968202772 0.042400360107421875 4 0.9933543926328137 15.130532898799272 2424.0 -3.7874999999999996 0.0 - - - - - - - 298.0 4 3 QRICH2 glutamine rich 2 1551 197 C20140709_OR012_04 C20140709_OR012_04 TB446629.[MT7]-DIAMLYQGLEK[MT7].3y4_1.heavy 523.625 / 590.363 3318.0 39.97110080718994 43 20 10 5 8 8.148391353472755 12.272360968202772 0.042400360107421875 4 0.9933543926328137 15.130532898799272 3318.0 -0.13011764705882278 0.0 - - - - - - - 191.5 6 2 QRICH2 glutamine rich 2 1553 197 C20140709_OR012_04 C20140709_OR012_04 TB446629.[MT7]-DIAMLYQGLEK[MT7].3y5_1.heavy 523.625 / 718.422 383.0 39.97110080718994 43 20 10 5 8 8.148391353472755 12.272360968202772 0.042400360107421875 4 0.9933543926328137 15.130532898799272 383.0 -0.09011764705882364 10.0 - - - - - - - 0.0 1 0 QRICH2 glutamine rich 2 1555 198 C20140709_OR012_04 C20140709_OR012_04 TB415919.[MT7]-GLVQPGVDQR.2y8_1.heavy 606.844 / 898.474 3182.0 24.055500030517578 43 13 10 10 10 1.9762954628455145 38.950912100948315 0.0 3 0.9220714325556885 4.3919007038490685 3182.0 28.247302776848443 0.0 - - - - - - - 183.33333333333334 6 6 QRICH2 glutamine rich 2 1557 198 C20140709_OR012_04 C20140709_OR012_04 TB415919.[MT7]-GLVQPGVDQR.2b4_1.heavy 606.844 / 542.342 17136.0 24.055500030517578 43 13 10 10 10 1.9762954628455145 38.950912100948315 0.0 3 0.9220714325556885 4.3919007038490685 17136.0 37.35512593601089 0.0 - - - - - - - 227.14285714285714 34 7 QRICH2 glutamine rich 2 1559 198 C20140709_OR012_04 C20140709_OR012_04 TB415919.[MT7]-GLVQPGVDQR.2y6_1.heavy 606.844 / 671.347 12607.0 24.055500030517578 43 13 10 10 10 1.9762954628455145 38.950912100948315 0.0 3 0.9220714325556885 4.3919007038490685 12607.0 137.68756421137266 0.0 - - - - - - - 297.2857142857143 25 7 QRICH2 glutamine rich 2 1561 198 C20140709_OR012_04 C20140709_OR012_04 TB415919.[MT7]-GLVQPGVDQR.2y7_1.heavy 606.844 / 799.406 5630.0 24.055500030517578 43 13 10 10 10 1.9762954628455145 38.950912100948315 0.0 3 0.9220714325556885 4.3919007038490685 5630.0 22.081071011510872 0.0 - - - - - - - 305.8333333333333 11 6 QRICH2 glutamine rich 2 1563 199 C20140709_OR012_04 C20140709_OR012_04 TB446726.[MT7]-LEAGLANTITSFIDK[MT7].3y3_1.heavy 627.691 / 519.326 969.0 43.78340148925781 35 16 10 3 6 2.354880276911603 35.642183344335244 0.07360076904296875 5 0.9636319102289219 6.451742931870654 969.0 3.876 5.0 - - - - - - - 0.0 1 0 GDF5 growth differentiation factor 5 1565 199 C20140709_OR012_04 C20140709_OR012_04 TB446726.[MT7]-LEAGLANTITSFIDK[MT7].3y6_1.heavy 627.691 / 854.474 872.0 43.78340148925781 35 16 10 3 6 2.354880276911603 35.642183344335244 0.07360076904296875 5 0.9636319102289219 6.451742931870654 872.0 2.022680412371134 2.0 - - - - - - - 161.66666666666666 2 9 GDF5 growth differentiation factor 5 1567 199 C20140709_OR012_04 C20140709_OR012_04 TB446726.[MT7]-LEAGLANTITSFIDK[MT7].3b6_1.heavy 627.691 / 699.416 582.0 43.78340148925781 35 16 10 3 6 2.354880276911603 35.642183344335244 0.07360076904296875 5 0.9636319102289219 6.451742931870654 582.0 -0.5 11.0 - - - - - - - 0.0 1 0 GDF5 growth differentiation factor 5 1569 199 C20140709_OR012_04 C20140709_OR012_04 TB446726.[MT7]-LEAGLANTITSFIDK[MT7].3b4_1.heavy 627.691 / 515.295 1260.0 43.78340148925781 35 16 10 3 6 2.354880276911603 35.642183344335244 0.07360076904296875 5 0.9636319102289219 6.451742931870654 1260.0 7.308586631193881 1.0 - - - - - - - 206.125 2 8 GDF5 growth differentiation factor 5 1571 200 C20140709_OR012_04 C20140709_OR012_04 TB446729.[MT7]-GPNTLDDLFQELDK[MT7].2y8_1.heavy 946.996 / 1151.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - S100G S100 calcium binding protein G 1573 200 C20140709_OR012_04 C20140709_OR012_04 TB446729.[MT7]-GPNTLDDLFQELDK[MT7].2y3_1.heavy 946.996 / 519.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - S100G S100 calcium binding protein G 1575 200 C20140709_OR012_04 C20140709_OR012_04 TB446729.[MT7]-GPNTLDDLFQELDK[MT7].2b6_1.heavy 946.996 / 742.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - S100G S100 calcium binding protein G 1577 200 C20140709_OR012_04 C20140709_OR012_04 TB446729.[MT7]-GPNTLDDLFQELDK[MT7].2b7_1.heavy 946.996 / 857.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - S100G S100 calcium binding protein G 1579 201 C20140709_OR012_04 C20140709_OR012_04 TB415915.[MT7]-TVEEVTVER.2y8_1.heavy 603.328 / 960.5 1213.0 24.858699798583984 47 17 10 10 10 3.002201973826136 33.30888490242236 0.0 3 0.9775751049912249 8.225877148997455 1213.0 6.991220096775653 0.0 - - - - - - - 315.4 2 5 TJP1 tight junction protein 1 (zona occludens 1) 1581 201 C20140709_OR012_04 C20140709_OR012_04 TB415915.[MT7]-TVEEVTVER.2y6_1.heavy 603.328 / 732.389 849.0 24.858699798583984 47 17 10 10 10 3.002201973826136 33.30888490242236 0.0 3 0.9775751049912249 8.225877148997455 849.0 8.196969498168187 5.0 - - - - - - - 0.0 1 0 TJP1 tight junction protein 1 (zona occludens 1) 1583 201 C20140709_OR012_04 C20140709_OR012_04 TB415915.[MT7]-TVEEVTVER.2b5_1.heavy 603.328 / 702.379 971.0 24.858699798583984 47 17 10 10 10 3.002201973826136 33.30888490242236 0.0 3 0.9775751049912249 8.225877148997455 971.0 9.516875851421306 2.0 - - - - - - - 0.0 1 0 TJP1 tight junction protein 1 (zona occludens 1) 1585 201 C20140709_OR012_04 C20140709_OR012_04 TB415915.[MT7]-TVEEVTVER.2y7_1.heavy 603.328 / 861.431 971.0 24.858699798583984 47 17 10 10 10 3.002201973826136 33.30888490242236 0.0 3 0.9775751049912249 8.225877148997455 971.0 10.451632004359276 0.0 - - - - - - - 0.0 1 0 TJP1 tight junction protein 1 (zona occludens 1) 1587 202 C20140709_OR012_04 C20140709_OR012_04 TB446470.[MT7]-RVTVTEVLR.3b6_1.heavy 406.255 / 830.485 119.0 27.938825130462646 27 14 4 3 6 2.923948612657771 26.445201684472508 0.07710075378417969 6 0.935533863692025 4.8343196879228 119.0 0.0 6.0 - - - - - - - 0.0 0 0 C17orf53 chromosome 17 open reading frame 53 1589 202 C20140709_OR012_04 C20140709_OR012_04 TB446470.[MT7]-RVTVTEVLR.3b3_1.heavy 406.255 / 501.327 2509.0 27.938825130462646 27 14 4 3 6 2.923948612657771 26.445201684472508 0.07710075378417969 6 0.935533863692025 4.8343196879228 2509.0 -4.205027932960894 3.0 - - - - - - - 253.5 29 8 C17orf53 chromosome 17 open reading frame 53 1591 202 C20140709_OR012_04 C20140709_OR012_04 TB446470.[MT7]-RVTVTEVLR.3y4_1.heavy 406.255 / 516.314 7884.0 27.938825130462646 27 14 4 3 6 2.923948612657771 26.445201684472508 0.07710075378417969 6 0.935533863692025 4.8343196879228 7884.0 -6.625210084033611 0.0 - - - - - - - 179.0 15 2 C17orf53 chromosome 17 open reading frame 53 1593 202 C20140709_OR012_04 C20140709_OR012_04 TB446470.[MT7]-RVTVTEVLR.3y5_1.heavy 406.255 / 617.362 5615.0 27.938825130462646 27 14 4 3 6 2.923948612657771 26.445201684472508 0.07710075378417969 6 0.935533863692025 4.8343196879228 5615.0 -2.3493723849372365 0.0 - - - - - - - 209.0 11 4 C17orf53 chromosome 17 open reading frame 53 1595 203 C20140709_OR012_04 C20140709_OR012_04 TB434196.[MT7]-VHQLLLQNK[MT7].3y3_1.heavy 460.957 / 533.316 3284.0 27.191925048828125 44 18 10 6 10 21.191946477839593 4.718773714560385 0.03929901123046875 3 0.9853475836309343 10.183006599196776 3284.0 13.438398325776072 0.0 - - - - - - - 234.58333333333334 6 12 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1597 203 C20140709_OR012_04 C20140709_OR012_04 TB434196.[MT7]-VHQLLLQNK[MT7].3b4_1.heavy 460.957 / 622.379 2932.0 27.191925048828125 44 18 10 6 10 21.191946477839593 4.718773714560385 0.03929901123046875 3 0.9853475836309343 10.183006599196776 2932.0 12.46411914893617 1.0 - - - - - - - 281.6 5 5 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1599 203 C20140709_OR012_04 C20140709_OR012_04 TB434196.[MT7]-VHQLLLQNK[MT7].3y4_1.heavy 460.957 / 646.4 3870.0 27.191925048828125 44 18 10 6 10 21.191946477839593 4.718773714560385 0.03929901123046875 3 0.9853475836309343 10.183006599196776 3870.0 31.28936170212766 0.0 - - - - - - - 234.5 7 8 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1601 203 C20140709_OR012_04 C20140709_OR012_04 TB434196.[MT7]-VHQLLLQNK[MT7].3b3_1.heavy 460.957 / 509.295 7506.0 27.191925048828125 44 18 10 6 10 21.191946477839593 4.718773714560385 0.03929901123046875 3 0.9853475836309343 10.183006599196776 7506.0 29.29952288985084 1.0 - - - - - - - 264.0 18 4 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1603 204 C20140709_OR012_04 C20140709_OR012_04 TB434296.[MT7]-LLQHPFVTQHLTR.2b4_1.heavy 867.5 / 636.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1605 204 C20140709_OR012_04 C20140709_OR012_04 TB434296.[MT7]-LLQHPFVTQHLTR.2y9_1.heavy 867.5 / 1098.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1607 204 C20140709_OR012_04 C20140709_OR012_04 TB434296.[MT7]-LLQHPFVTQHLTR.2y10_1.heavy 867.5 / 1235.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1609 204 C20140709_OR012_04 C20140709_OR012_04 TB434296.[MT7]-LLQHPFVTQHLTR.2y7_1.heavy 867.5 / 854.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1611 205 C20140709_OR012_04 C20140709_OR012_04 TB434295.[MT7]-FLREWVESMGGK[MT7].3y6_1.heavy 576.311 / 752.373 2118.0 41.547550201416016 41 15 10 6 10 5.872278911085249 17.02916389261203 0.03330230712890625 3 0.9563513850619532 5.885517355639108 2118.0 7.598206278026907 0.0 - - - - - - - 212.63636363636363 4 11 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1613 205 C20140709_OR012_04 C20140709_OR012_04 TB434295.[MT7]-FLREWVESMGGK[MT7].3b5_1.heavy 576.311 / 876.485 892.0 41.547550201416016 41 15 10 6 10 5.872278911085249 17.02916389261203 0.03330230712890625 3 0.9563513850619532 5.885517355639108 892.0 13.821981981981981 0.0 - - - - - - - 0.0 1 0 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1615 205 C20140709_OR012_04 C20140709_OR012_04 TB434295.[MT7]-FLREWVESMGGK[MT7].3y4_1.heavy 576.311 / 536.298 3010.0 41.547550201416016 41 15 10 6 10 5.872278911085249 17.02916389261203 0.03330230712890625 3 0.9563513850619532 5.885517355639108 3010.0 34.51656364885065 0.0 - - - - - - - 185.55555555555554 6 9 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1617 205 C20140709_OR012_04 C20140709_OR012_04 TB434295.[MT7]-FLREWVESMGGK[MT7].3y5_1.heavy 576.311 / 623.33 2787.0 41.547550201416016 41 15 10 6 10 5.872278911085249 17.02916389261203 0.03330230712890625 3 0.9563513850619532 5.885517355639108 2787.0 4.876818075693779 0.0 - - - - - - - 233.0 5 11 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1619 206 C20140709_OR012_04 C20140709_OR012_04 TB434197.[MT7]-LLSDDYEQVR.2y8_1.heavy 691.358 / 1011.44 2780.0 31.980850219726562 42 17 10 5 10 10.383567932653513 9.630601027372013 0.04669952392578125 3 0.9701749627212097 7.128308993860233 2780.0 30.957782796913232 0.0 - - - - - - - 252.6 5 5 INTS4 integrator complex subunit 4 1621 206 C20140709_OR012_04 C20140709_OR012_04 TB434197.[MT7]-LLSDDYEQVR.2y5_1.heavy 691.358 / 694.352 2148.0 31.980850219726562 42 17 10 5 10 10.383567932653513 9.630601027372013 0.04669952392578125 3 0.9701749627212097 7.128308993860233 2148.0 18.04474733006659 1.0 - - - - - - - 270.7142857142857 4 7 INTS4 integrator complex subunit 4 1623 206 C20140709_OR012_04 C20140709_OR012_04 TB434197.[MT7]-LLSDDYEQVR.2y9_1.heavy 691.358 / 1124.52 3539.0 31.980850219726562 42 17 10 5 10 10.383567932653513 9.630601027372013 0.04669952392578125 3 0.9701749627212097 7.128308993860233 3539.0 1.6675461741424797 1.0 - - - - - - - 198.42857142857142 7 7 INTS4 integrator complex subunit 4 1625 206 C20140709_OR012_04 C20140709_OR012_04 TB434197.[MT7]-LLSDDYEQVR.2y6_1.heavy 691.358 / 809.379 2654.0 31.980850219726562 42 17 10 5 10 10.383567932653513 9.630601027372013 0.04669952392578125 3 0.9701749627212097 7.128308993860233 2654.0 33.680523809523805 0.0 - - - - - - - 126.0 5 4 INTS4 integrator complex subunit 4 1627 207 C20140709_OR012_04 C20140709_OR012_04 TB434024.[MT7]-LEAQAR.2b3_1.heavy 416.244 / 458.273 1095.0 18.21109962463379 50 20 10 10 10 4.49767560189169 22.233706663490963 0.0 3 0.9917091494965314 13.544479325915347 1095.0 13.025409373235462 0.0 - - - - - - - 200.76923076923077 2 13 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1629 207 C20140709_OR012_04 C20140709_OR012_04 TB434024.[MT7]-LEAQAR.2y4_1.heavy 416.244 / 445.252 3200.0 18.21109962463379 50 20 10 10 10 4.49767560189169 22.233706663490963 0.0 3 0.9917091494965314 13.544479325915347 3200.0 22.283100892071868 0.0 - - - - - - - 154.16666666666666 6 6 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1631 207 C20140709_OR012_04 C20140709_OR012_04 TB434024.[MT7]-LEAQAR.2y5_1.heavy 416.244 / 574.294 5389.0 18.21109962463379 50 20 10 10 10 4.49767560189169 22.233706663490963 0.0 3 0.9917091494965314 13.544479325915347 5389.0 36.47063788836631 0.0 - - - - - - - 210.5 10 6 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1633 207 C20140709_OR012_04 C20140709_OR012_04 TB434024.[MT7]-LEAQAR.2b4_1.heavy 416.244 / 586.332 1010.0 18.21109962463379 50 20 10 10 10 4.49767560189169 22.233706663490963 0.0 3 0.9917091494965314 13.544479325915347 1010.0 8.003199698851873 4.0 - - - - - - - 218.8 11 10 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1635 208 C20140709_OR012_04 C20140709_OR012_04 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 124944.0 40.55870056152344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 124944.0 319.25058271510096 0.0 - - - - - - - 763.6666666666666 249 9 1637 208 C20140709_OR012_04 C20140709_OR012_04 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 208646.0 40.55870056152344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 208646.0 994.0328816593781 0.0 - - - - - - - 776.0 417 8 1639 208 C20140709_OR012_04 C20140709_OR012_04 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 241573.0 40.55870056152344 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 241573.0 702.0478914661408 0.0 - - - - - - - 744.2857142857143 483 7 1641 209 C20140709_OR012_04 C20140709_OR012_04 TB416393.[MT7]-TAGFSPDC[CAM]IMDDAINILQNEK[MT7].4b7_1.heavy 660.828 / 820.396 1018.0 52.65127468109131 43 17 10 6 10 4.147814686925115 19.181299799647714 0.034900665283203125 3 0.9746542274012489 7.735493333478642 1018.0 18.11964623611682 0.0 - - - - - - - 136.16666666666666 2 12 INTS4 integrator complex subunit 4 1643 209 C20140709_OR012_04 C20140709_OR012_04 TB416393.[MT7]-TAGFSPDC[CAM]IMDDAINILQNEK[MT7].4b4_1.heavy 660.828 / 521.284 1593.0 52.65127468109131 43 17 10 6 10 4.147814686925115 19.181299799647714 0.034900665283203125 3 0.9746542274012489 7.735493333478642 1593.0 3.0151224251846096 0.0 - - - - - - - 159.1 3 10 INTS4 integrator complex subunit 4 1645 209 C20140709_OR012_04 C20140709_OR012_04 TB416393.[MT7]-TAGFSPDC[CAM]IMDDAINILQNEK[MT7].4b5_1.heavy 660.828 / 608.316 2478.0 52.65127468109131 43 17 10 6 10 4.147814686925115 19.181299799647714 0.034900665283203125 3 0.9746542274012489 7.735493333478642 2478.0 18.049817400644464 0.0 - - - - - - - 123.8 4 10 INTS4 integrator complex subunit 4 1647 209 C20140709_OR012_04 C20140709_OR012_04 TB416393.[MT7]-TAGFSPDC[CAM]IMDDAINILQNEK[MT7].4y3_1.heavy 660.828 / 534.3 1770.0 52.65127468109131 43 17 10 6 10 4.147814686925115 19.181299799647714 0.034900665283203125 3 0.9746542274012489 7.735493333478642 1770.0 18.102272727272727 0.0 - - - - - - - 204.4375 3 16 INTS4 integrator complex subunit 4 1649 210 C20140709_OR012_04 C20140709_OR012_04 TB416392.[MT7]-TAGFSPDC[CAM]IMDDAINILQNEK[MT7].3b9_1.heavy 880.768 / 1093.51 2168.0 52.66835021972656 43 17 10 6 10 8.034356620167733 12.446547337590337 0.0334014892578125 3 0.9742732472668607 7.6777572787993025 2168.0 6.866968325791856 1.0 - - - - - - - 210.16666666666666 5 12 INTS4 integrator complex subunit 4 1651 210 C20140709_OR012_04 C20140709_OR012_04 TB416392.[MT7]-TAGFSPDC[CAM]IMDDAINILQNEK[MT7].3y7_1.heavy 880.768 / 1002.57 4336.0 52.66835021972656 43 17 10 6 10 8.034356620167733 12.446547337590337 0.0334014892578125 3 0.9742732472668607 7.6777572787993025 4336.0 115.17012840267077 0.0 - - - - - - - 111.93333333333334 8 15 INTS4 integrator complex subunit 4 1653 210 C20140709_OR012_04 C20140709_OR012_04 TB416392.[MT7]-TAGFSPDC[CAM]IMDDAINILQNEK[MT7].3b5_1.heavy 880.768 / 608.316 6504.0 52.66835021972656 43 17 10 6 10 8.034356620167733 12.446547337590337 0.0334014892578125 3 0.9742732472668607 7.6777572787993025 6504.0 45.81747680036813 0.0 - - - - - - - 210.92307692307693 13 13 INTS4 integrator complex subunit 4 1655 210 C20140709_OR012_04 C20140709_OR012_04 TB416392.[MT7]-TAGFSPDC[CAM]IMDDAINILQNEK[MT7].3y5_1.heavy 880.768 / 775.443 3894.0 52.66835021972656 43 17 10 6 10 8.034356620167733 12.446547337590337 0.0334014892578125 3 0.9742732472668607 7.6777572787993025 3894.0 43.99218192627824 0.0 - - - - - - - 169.33333333333334 7 12 INTS4 integrator complex subunit 4 1657 211 C20140709_OR012_04 C20140709_OR012_04 TB415926.[MT7]-NEHETLLAR.3y6_1.heavy 409.559 / 702.414 1829.0 22.0664005279541 41 15 8 10 8 2.51761574412233 39.720120210346536 0.0 4 0.9569813257272157 5.9287690659955565 1829.0 17.990163934426228 0.0 - - - - - - - 183.0 3 2 TUB tubby homolog (mouse) 1659 211 C20140709_OR012_04 C20140709_OR012_04 TB415926.[MT7]-NEHETLLAR.3b3_1.heavy 409.559 / 525.254 3293.0 22.0664005279541 41 15 8 10 8 2.51761574412233 39.720120210346536 0.0 4 0.9569813257272157 5.9287690659955565 3293.0 31.377971311475406 1.0 - - - - - - - 244.0 20 5 TUB tubby homolog (mouse) 1661 211 C20140709_OR012_04 C20140709_OR012_04 TB415926.[MT7]-NEHETLLAR.3y4_1.heavy 409.559 / 472.324 7562.0 22.0664005279541 41 15 8 10 8 2.51761574412233 39.720120210346536 0.0 4 0.9569813257272157 5.9287690659955565 7562.0 88.3266393442623 0.0 - - - - - - - 219.6 15 5 TUB tubby homolog (mouse) 1663 211 C20140709_OR012_04 C20140709_OR012_04 TB415926.[MT7]-NEHETLLAR.3y5_1.heavy 409.559 / 573.372 6220.0 22.0664005279541 41 15 8 10 8 2.51761574412233 39.720120210346536 0.0 4 0.9569813257272157 5.9287690659955565 6220.0 25.491803278688522 0.0 - - - - - - - 195.2 12 5 TUB tubby homolog (mouse) 1665 212 C20140709_OR012_04 C20140709_OR012_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 88816.0 35.74100112915039 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 88816.0 310.5138589009382 0.0 - - - - - - - 188.75 177 4 1667 212 C20140709_OR012_04 C20140709_OR012_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 23399.0 35.74100112915039 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 23399.0 89.87778336394379 2.0 - - - - - - - 220.5 85 4 1669 212 C20140709_OR012_04 C20140709_OR012_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 27676.0 35.74100112915039 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 27676.0 146.13761904761904 0.0 - - - - - - - 220.5 55 4 1671 213 C20140709_OR012_04 C20140709_OR012_04 TB446738.[MT7]-ATSPADALQYLLQFAR.2y8_1.heavy 955.019 / 1038.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 1673 213 C20140709_OR012_04 C20140709_OR012_04 TB446738.[MT7]-ATSPADALQYLLQFAR.2b6_1.heavy 955.019 / 687.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 1675 213 C20140709_OR012_04 C20140709_OR012_04 TB446738.[MT7]-ATSPADALQYLLQFAR.2b7_1.heavy 955.019 / 758.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 1677 213 C20140709_OR012_04 C20140709_OR012_04 TB446738.[MT7]-ATSPADALQYLLQFAR.2y10_1.heavy 955.019 / 1222.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - INTS4 integrator complex subunit 4 1679 214 C20140709_OR012_04 C20140709_OR012_04 TB416399.[MT7]-LC[CAM]ALTTMLSSYQILSTSQELK[MT7].4y5_1.heavy 669.611 / 748.432 562.0 51.102149963378906 23 11 0 6 6 1.3575600945745923 60.24682937131694 0.0334014892578125 6 0.859589588271547 3.2542054906413154 562.0 0.07201017811704835 5.0 - - - - - - - 0.0 1 0 RNF112 ring finger protein 112 1681 214 C20140709_OR012_04 C20140709_OR012_04 TB416399.[MT7]-LC[CAM]ALTTMLSSYQILSTSQELK[MT7].4b4_1.heavy 669.611 / 602.345 1461.0 51.102149963378906 23 11 0 6 6 1.3575600945745923 60.24682937131694 0.0334014892578125 6 0.859589588271547 3.2542054906413154 1461.0 1.3015590200445435 3.0 - - - - - - - 207.3846153846154 34 13 RNF112 ring finger protein 112 1683 214 C20140709_OR012_04 C20140709_OR012_04 TB416399.[MT7]-LC[CAM]ALTTMLSSYQILSTSQELK[MT7].4y3_1.heavy 669.611 / 533.341 2191.0 51.102149963378906 23 11 0 6 6 1.3575600945745923 60.24682937131694 0.0334014892578125 6 0.859589588271547 3.2542054906413154 2191.0 10.996458648608185 0.0 - - - - - - - 202.3 4 10 RNF112 ring finger protein 112 1685 214 C20140709_OR012_04 C20140709_OR012_04 TB416399.[MT7]-LC[CAM]ALTTMLSSYQILSTSQELK[MT7].4b6_1.heavy 669.611 / 804.441 449.0 51.102149963378906 23 11 0 6 6 1.3575600945745923 60.24682937131694 0.0334014892578125 6 0.859589588271547 3.2542054906413154 449.0 3.7683928571428567 3.0 - - - - - - - 0.0 1 0 RNF112 ring finger protein 112 1687 215 C20140709_OR012_04 C20140709_OR012_04 TB446481.[MT7]-SAEQISDSVR.2b8_1.heavy 618.321 / 962.455 N/A 23.065099716186523 42 14 10 10 8 2.251328677856791 35.36733067341472 0.0 4 0.9454643453072152 5.260516140526071 226.0 1.0266666666666664 15.0 - - - - - - - 0.0 1 0 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1689 215 C20140709_OR012_04 C20140709_OR012_04 TB446481.[MT7]-SAEQISDSVR.2b4_1.heavy 618.321 / 560.28 1468.0 23.065099716186523 42 14 10 10 8 2.251328677856791 35.36733067341472 0.0 4 0.9454643453072152 5.260516140526071 1468.0 5.716106194690266 0.0 - - - - - - - 324.875 2 8 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1691 215 C20140709_OR012_04 C20140709_OR012_04 TB446481.[MT7]-SAEQISDSVR.2y9_1.heavy 618.321 / 1004.5 2598.0 23.065099716186523 42 14 10 10 8 2.251328677856791 35.36733067341472 0.0 4 0.9454643453072152 5.260516140526071 2598.0 19.542477876106197 0.0 - - - - - - - 169.5 5 8 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1693 215 C20140709_OR012_04 C20140709_OR012_04 TB446481.[MT7]-SAEQISDSVR.2y7_1.heavy 618.321 / 804.421 791.0 23.065099716186523 42 14 10 10 8 2.251328677856791 35.36733067341472 0.0 4 0.9454643453072152 5.260516140526071 791.0 11.2 1.0 - - - - - - - 0.0 1 0 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1695 216 C20140709_OR012_04 C20140709_OR012_04 TB446741.[MT7]-LLTPTFEGINGLLLK[MT7].3y6_1.heavy 639.727 / 801.531 554.0 47.499850273132324 42 17 10 5 10 6.3288446751546035 15.800672181539541 0.045398712158203125 3 0.972301742648058 7.398242861548505 554.0 3.2862872628726283 2.0 - - - - - - - 0.0 1 0 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1697 216 C20140709_OR012_04 C20140709_OR012_04 TB446741.[MT7]-LLTPTFEGINGLLLK[MT7].3y3_1.heavy 639.727 / 517.383 3230.0 47.499850273132324 42 17 10 5 10 6.3288446751546035 15.800672181539541 0.045398712158203125 3 0.972301742648058 7.398242861548505 3230.0 42.09789501590668 0.0 - - - - - - - 194.77777777777777 6 9 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1699 216 C20140709_OR012_04 C20140709_OR012_04 TB446741.[MT7]-LLTPTFEGINGLLLK[MT7].3b5_1.heavy 639.727 / 670.426 1384.0 47.499850273132324 42 17 10 5 10 6.3288446751546035 15.800672181539541 0.045398712158203125 3 0.972301742648058 7.398242861548505 1384.0 13.854080102805739 1.0 - - - - - - - 169.0 4 6 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1701 216 C20140709_OR012_04 C20140709_OR012_04 TB446741.[MT7]-LLTPTFEGINGLLLK[MT7].3b8_1.heavy 639.727 / 1003.56 2953.0 47.499850273132324 42 17 10 5 10 6.3288446751546035 15.800672181539541 0.045398712158203125 3 0.972301742648058 7.398242861548505 2953.0 44.867555816686256 0.0 - - - - - - - 184.6 5 5 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1703 217 C20140709_OR012_04 C20140709_OR012_04 TB446389.[MT7]-AALPLTK[MT7].2y4_1.heavy 501.333 / 602.399 21511.0 28.220849990844727 42 20 10 6 6 4.982831805395732 20.068909388375005 0.03730010986328125 5 0.9985626475678975 32.54832939175224 21511.0 39.67068089944857 0.0 - - - - - - - 250.71428571428572 43 7 SIM1 single-minded homolog 1 (Drosophila) 1705 217 C20140709_OR012_04 C20140709_OR012_04 TB446389.[MT7]-AALPLTK[MT7].2y5_1.heavy 501.333 / 715.483 2221.0 28.220849990844727 42 20 10 6 6 4.982831805395732 20.068909388375005 0.03730010986328125 5 0.9985626475678975 32.54832939175224 2221.0 12.14905982905983 1.0 - - - - - - - 214.5 9 6 SIM1 single-minded homolog 1 (Drosophila) 1707 217 C20140709_OR012_04 C20140709_OR012_04 TB446389.[MT7]-AALPLTK[MT7].2y3_1.heavy 501.333 / 505.347 2221.0 28.220849990844727 42 20 10 6 6 4.982831805395732 20.068909388375005 0.03730010986328125 5 0.9985626475678975 32.54832939175224 2221.0 12.338888888888889 1.0 - - - - - - - 252.0 30 13 SIM1 single-minded homolog 1 (Drosophila) 1709 217 C20140709_OR012_04 C20140709_OR012_04 TB446389.[MT7]-AALPLTK[MT7].2y6_1.heavy 501.333 / 786.521 1871.0 28.220849990844727 42 20 10 6 6 4.982831805395732 20.068909388375005 0.03730010986328125 5 0.9985626475678975 32.54832939175224 1871.0 18.214264957264955 0.0 - - - - - - - 167.14285714285714 3 7 SIM1 single-minded homolog 1 (Drosophila) 1711 218 C20140709_OR012_04 C20140709_OR012_04 TB446602.[MT7]-GGTGQTGGLTQPK[MT7].2b8_1.heavy 745.414 / 760.371 867.0 20.036399841308594 35 15 2 10 8 2.011033741802655 39.661323565695604 0.0 4 0.9546057875142254 5.77039322473678 867.0 8.346176078257002 0.0 - - - - - - - 0.0 1 0 GDF5 growth differentiation factor 5 1713 218 C20140709_OR012_04 C20140709_OR012_04 TB446602.[MT7]-GGTGQTGGLTQPK[MT7].2b5_1.heavy 745.414 / 545.28 1128.0 20.036399841308594 35 15 2 10 8 2.011033741802655 39.661323565695604 0.0 4 0.9546057875142254 5.77039322473678 1128.0 6.718616593209354 1.0 - - - - - - - 108.5 5 4 GDF5 growth differentiation factor 5 1715 218 C20140709_OR012_04 C20140709_OR012_04 TB446602.[MT7]-GGTGQTGGLTQPK[MT7].2b9_1.heavy 745.414 / 873.455 867.0 20.036399841308594 35 15 2 10 8 2.011033741802655 39.661323565695604 0.0 4 0.9546057875142254 5.77039322473678 867.0 12.966671087533156 0.0 - - - - - - - 0.0 1 0 GDF5 growth differentiation factor 5 1717 218 C20140709_OR012_04 C20140709_OR012_04 TB446602.[MT7]-GGTGQTGGLTQPK[MT7].2y7_1.heavy 745.414 / 844.501 1128.0 20.036399841308594 35 15 2 10 8 2.011033741802655 39.661323565695604 0.0 4 0.9546057875142254 5.77039322473678 1128.0 0.0 0.0 - - - - - - - 231.33333333333334 2 3 GDF5 growth differentiation factor 5 1719 219 C20140709_OR012_04 C20140709_OR012_04 TB416198.[MT7]-RPLVVIHELFDK[MT7].4b4_1.heavy 439.27 / 610.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1721 219 C20140709_OR012_04 C20140709_OR012_04 TB416198.[MT7]-RPLVVIHELFDK[MT7].4b5_1.heavy 439.27 / 709.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1723 219 C20140709_OR012_04 C20140709_OR012_04 TB416198.[MT7]-RPLVVIHELFDK[MT7].4y3_1.heavy 439.27 / 553.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1725 219 C20140709_OR012_04 C20140709_OR012_04 TB416198.[MT7]-RPLVVIHELFDK[MT7].4b6_1.heavy 439.27 / 822.568 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1727 220 C20140709_OR012_04 C20140709_OR012_04 TB415934.[MT7]-VLQDNLDK[MT7].3y3_1.heavy 411.574 / 519.326 112.0 25.75007438659668 21 8 8 3 2 0.7488482718304869 81.74034329126346 0.07889938354492188 14 0.7901986506327815 2.6457881931703064 112.0 1.0333333333333334 35.0 - - - - - - - 208.0 6 7 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1729 220 C20140709_OR012_04 C20140709_OR012_04 TB415934.[MT7]-VLQDNLDK[MT7].3b4_1.heavy 411.574 / 600.347 2461.0 25.75007438659668 21 8 8 3 2 0.7488482718304869 81.74034329126346 0.07889938354492188 14 0.7901986506327815 2.6457881931703064 2461.0 21.742495535714284 1.0 - - - - - - - 196.0 6 8 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1731 220 C20140709_OR012_04 C20140709_OR012_04 TB415934.[MT7]-VLQDNLDK[MT7].3b5_1.heavy 411.574 / 714.39 1007.0 25.75007438659668 21 8 8 3 2 0.7488482718304869 81.74034329126346 0.07889938354492188 14 0.7901986506327815 2.6457881931703064 1007.0 4.045982142857143 2.0 - - - - - - - 317.3333333333333 2 6 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1733 220 C20140709_OR012_04 C20140709_OR012_04 TB415934.[MT7]-VLQDNLDK[MT7].3b3_1.heavy 411.574 / 485.32 559.0 25.75007438659668 21 8 8 3 2 0.7488482718304869 81.74034329126346 0.07889938354492188 14 0.7901986506327815 2.6457881931703064 559.0 4.536869059441056 12.0 - - - - - - - 156.8 3 5 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1735 221 C20140709_OR012_04 C20140709_OR012_04 TB415936.[MT7]-EISQDSLAAR.2y8_1.heavy 617.331 / 847.427 5522.0 24.461999893188477 45 15 10 10 10 2.420739854409902 28.306294008009665 0.0 3 0.95553878332652 5.831084217740397 5522.0 11.843637698031078 1.0 - - - - - - - 245.42857142857142 13 7 TJP1 tight junction protein 1 (zona occludens 1) 1737 221 C20140709_OR012_04 C20140709_OR012_04 TB415936.[MT7]-EISQDSLAAR.2y5_1.heavy 617.331 / 517.309 4908.0 24.461999893188477 45 15 10 10 10 2.420739854409902 28.306294008009665 0.0 3 0.95553878332652 5.831084217740397 4908.0 24.766456078083408 1.0 - - - - - - - 220.9 9 10 TJP1 tight junction protein 1 (zona occludens 1) 1739 221 C20140709_OR012_04 C20140709_OR012_04 TB415936.[MT7]-EISQDSLAAR.2y9_1.heavy 617.331 / 960.511 6995.0 24.461999893188477 45 15 10 10 10 2.420739854409902 28.306294008009665 0.0 3 0.95553878332652 5.831084217740397 6995.0 15.62855831908173 0.0 - - - - - - - 267.72727272727275 13 11 TJP1 tight junction protein 1 (zona occludens 1) 1741 221 C20140709_OR012_04 C20140709_OR012_04 TB415936.[MT7]-EISQDSLAAR.2b5_1.heavy 617.331 / 717.354 4540.0 24.461999893188477 45 15 10 10 10 2.420739854409902 28.306294008009665 0.0 3 0.95553878332652 5.831084217740397 4540.0 8.613824629121627 0.0 - - - - - - - 337.5 9 4 TJP1 tight junction protein 1 (zona occludens 1) 1743 222 C20140709_OR012_04 C20140709_OR012_04 TB416199.[MT7]-RPLVVIHELFDK[MT7].3y3_1.heavy 585.357 / 553.31 N/A 38.7674674987793 41 20 8 5 8 13.9273478541907 7.180117926753031 0.04039764404296875 4 0.9986605296735835 33.71687627545201 7133.0 8.128925320841233 1.0 - - - - - - - 289.92857142857144 16 14 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1745 222 C20140709_OR012_04 C20140709_OR012_04 TB416199.[MT7]-RPLVVIHELFDK[MT7].3b6_1.heavy 585.357 / 822.568 6764.0 38.7674674987793 41 20 8 5 8 13.9273478541907 7.180117926753031 0.04039764404296875 4 0.9986605296735835 33.71687627545201 6764.0 58.153902439024385 0.0 - - - - - - - 246.0 13 7 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1747 222 C20140709_OR012_04 C20140709_OR012_04 TB416199.[MT7]-RPLVVIHELFDK[MT7].3b4_1.heavy 585.357 / 610.416 3566.0 38.7674674987793 41 20 8 5 8 13.9273478541907 7.180117926753031 0.04039764404296875 4 0.9986605296735835 33.71687627545201 3566.0 41.74829268292683 1.0 - - - - - - - 210.85714285714286 7 7 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1749 222 C20140709_OR012_04 C20140709_OR012_04 TB416199.[MT7]-RPLVVIHELFDK[MT7].3b5_1.heavy 585.357 / 709.484 6026.0 38.7674674987793 41 20 8 5 8 13.9273478541907 7.180117926753031 0.04039764404296875 4 0.9986605296735835 33.71687627545201 6026.0 15.929356562137048 1.0 - - - - - - - 246.0 18 8 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1751 223 C20140709_OR012_04 C20140709_OR012_04 TB416196.[MT7]-ALMC[CAM]LSLYLIHK[MT7].4y4_1.heavy 438.255 / 654.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1753 223 C20140709_OR012_04 C20140709_OR012_04 TB416196.[MT7]-ALMC[CAM]LSLYLIHK[MT7].4y5_1.heavy 438.255 / 817.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1755 223 C20140709_OR012_04 C20140709_OR012_04 TB416196.[MT7]-ALMC[CAM]LSLYLIHK[MT7].4y3_1.heavy 438.255 / 541.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1757 223 C20140709_OR012_04 C20140709_OR012_04 TB416196.[MT7]-ALMC[CAM]LSLYLIHK[MT7].4b3_1.heavy 438.255 / 460.271 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1759 224 C20140709_OR012_04 C20140709_OR012_04 TB416195.[MT7]-ALMC[CAM]LSLYLIHK[MT7].3y3_1.heavy 584.005 / 541.358 7827.0 45.02280044555664 43 13 10 10 10 1.7880012202502673 44.20136187515006 0.0 3 0.9133077432129387 4.160865003362596 7827.0 114.78150632979006 0.0 - - - - - - - 193.35714285714286 15 14 ZNF625 zinc finger protein 625 1761 224 C20140709_OR012_04 C20140709_OR012_04 TB416195.[MT7]-ALMC[CAM]LSLYLIHK[MT7].3b6_1.heavy 584.005 / 820.418 2512.0 45.02280044555664 43 13 10 10 10 1.7880012202502673 44.20136187515006 0.0 3 0.9133077432129387 4.160865003362596 2512.0 48.16824742268041 0.0 - - - - - - - 181.5 5 8 ZNF625 zinc finger protein 625 1763 224 C20140709_OR012_04 C20140709_OR012_04 TB416195.[MT7]-ALMC[CAM]LSLYLIHK[MT7].3b4_1.heavy 584.005 / 620.302 5411.0 45.02280044555664 43 13 10 10 10 1.7880012202502673 44.20136187515006 0.0 3 0.9133077432129387 4.160865003362596 5411.0 21.446324690367994 0.0 - - - - - - - 215.84615384615384 10 13 ZNF625 zinc finger protein 625 1765 224 C20140709_OR012_04 C20140709_OR012_04 TB416195.[MT7]-ALMC[CAM]LSLYLIHK[MT7].3b5_1.heavy 584.005 / 733.386 3575.0 45.02280044555664 43 13 10 10 10 1.7880012202502673 44.20136187515006 0.0 3 0.9133077432129387 4.160865003362596 3575.0 51.67432295283372 0.0 - - - - - - - 116.2 7 5 ZNF625 zinc finger protein 625 1767 225 C20140709_OR012_04 C20140709_OR012_04 TB446652.[MT7]-TFITVSALFSHNR.3b4_1.heavy 546.302 / 607.357 2567.0 38.7135009765625 19 7 0 10 2 0.8154002102811292 72.35325712887254 0.0 11 0.726092555292736 2.302015798233194 2567.0 24.39893526434007 3.0 - - - - - - - 244.28571428571428 6 7 ZXDB;ZXDA;ZXDC zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A;ZXD family zinc finger C 1769 225 C20140709_OR012_04 C20140709_OR012_04 TB446652.[MT7]-TFITVSALFSHNR.3y4_1.heavy 546.302 / 513.253 978.0 38.7135009765625 19 7 0 10 2 0.8154002102811292 72.35325712887254 0.0 11 0.726092555292736 2.302015798233194 978.0 9.294647786661901 9.0 - - - - - - - 195.4 2 10 ZXDB;ZXDA;ZXDC zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A;ZXD family zinc finger C 1771 225 C20140709_OR012_04 C20140709_OR012_04 TB446652.[MT7]-TFITVSALFSHNR.3b3_1.heavy 546.302 / 506.31 1344.0 38.7135009765625 19 7 0 10 2 0.8154002102811292 72.35325712887254 0.0 11 0.726092555292736 2.302015798233194 1344.0 3.1664130611589165 7.0 - - - - - - - 322.09090909090907 18 11 ZXDB;ZXDA;ZXDC zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A;ZXD family zinc finger C 1773 225 C20140709_OR012_04 C20140709_OR012_04 TB446652.[MT7]-TFITVSALFSHNR.3y5_1.heavy 546.302 / 660.321 611.0 38.7135009765625 19 7 0 10 2 0.8154002102811292 72.35325712887254 0.0 11 0.726092555292736 2.302015798233194 611.0 2.862161023441091 12.0 - - - - - - - 0.0 1 0 ZXDB;ZXDA;ZXDC zinc finger, X-linked, duplicated B;zinc finger, X-linked, duplicated A;ZXD family zinc finger C 1775 226 C20140709_OR012_04 C20140709_OR012_04 TB446458.[MT7]-FTFDVEK[MT7].2y4_1.heavy 587.323 / 634.353 6255.0 34.880001068115234 48 18 10 10 10 3.415149182416496 29.281297729208376 0.0 3 0.9804243248238508 8.80628975472712 6255.0 12.12149769350258 0.0 - - - - - - - 296.27272727272725 12 11 SPAG4 sperm associated antigen 4 1777 226 C20140709_OR012_04 C20140709_OR012_04 TB446458.[MT7]-FTFDVEK[MT7].2b4_1.heavy 587.323 / 655.321 6515.0 34.880001068115234 48 18 10 10 10 3.415149182416496 29.281297729208376 0.0 3 0.9804243248238508 8.80628975472712 6515.0 35.59316007383384 1.0 - - - - - - - 260.6666666666667 13 6 SPAG4 sperm associated antigen 4 1779 226 C20140709_OR012_04 C20140709_OR012_04 TB446458.[MT7]-FTFDVEK[MT7].2y3_1.heavy 587.323 / 519.326 14203.0 34.880001068115234 48 18 10 10 10 3.415149182416496 29.281297729208376 0.0 3 0.9804243248238508 8.80628975472712 14203.0 31.210690911881606 0.0 - - - - - - - 236.9090909090909 28 11 SPAG4 sperm associated antigen 4 1781 226 C20140709_OR012_04 C20140709_OR012_04 TB446458.[MT7]-FTFDVEK[MT7].2y6_1.heavy 587.323 / 882.469 9773.0 34.880001068115234 48 18 10 10 10 3.415149182416496 29.281297729208376 0.0 3 0.9804243248238508 8.80628975472712 9773.0 60.81514066496163 0.0 - - - - - - - 217.22222222222223 19 9 SPAG4 sperm associated antigen 4 1783 227 C20140709_OR012_04 C20140709_OR012_04 TB416092.[MT7]-QHRK[MT7]PGPLK[MT7].3y3_1.heavy 498.319 / 501.352 896.0 15.618200302124023 45 20 10 5 10 14.553366624493988 6.8712623395122465 0.04080009460449219 3 0.996687151796891 21.435895567537333 896.0 19.79569512893983 0.0 - - - - - - - 0.0 1 0 TUB tubby homolog (mouse) 1785 227 C20140709_OR012_04 C20140709_OR012_04 TB416092.[MT7]-QHRK[MT7]PGPLK[MT7].3y4_1.heavy 498.319 / 558.373 996.0 15.618200302124023 45 20 10 5 10 14.553366624493988 6.8712623395122465 0.04080009460449219 3 0.996687151796891 21.435895567537333 996.0 11.672320916905445 0.0 - - - - - - - 0.0 1 0 TUB tubby homolog (mouse) 1787 227 C20140709_OR012_04 C20140709_OR012_04 TB416092.[MT7]-QHRK[MT7]PGPLK[MT7].3y8_2.heavy 498.319 / 610.895 1195.0 15.618200302124023 45 20 10 5 10 14.553366624493988 6.8712623395122465 0.04080009460449219 3 0.996687151796891 21.435895567537333 1195.0 23.932080536912753 0.0 - - - - - - - 163.71428571428572 2 7 TUB tubby homolog (mouse) 1789 227 C20140709_OR012_04 C20140709_OR012_04 TB416092.[MT7]-QHRK[MT7]PGPLK[MT7].3y5_1.heavy 498.319 / 655.426 1693.0 15.618200302124023 45 20 10 5 10 14.553366624493988 6.8712623395122465 0.04080009460449219 3 0.996687151796891 21.435895567537333 1693.0 33.497214285714286 0.0 - - - - - - - 205.375 3 8 TUB tubby homolog (mouse) 1791 228 C20140709_OR012_04 C20140709_OR012_04 TB416090.[MT7]-TNMDFVGHRK[MT7].3b4_1.heavy 498.269 / 606.267 2618.0 22.311750411987305 45 20 10 5 10 13.909137260891713 7.189518524716106 0.04489898681640625 3 0.9986138736832585 33.14444772457943 2618.0 7.7 0.0 - - - - - - - 264.44444444444446 5 9 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1793 228 C20140709_OR012_04 C20140709_OR012_04 TB416090.[MT7]-TNMDFVGHRK[MT7].3y4_1.heavy 498.269 / 641.396 1547.0 22.311750411987305 45 20 10 5 10 13.909137260891713 7.189518524716106 0.04489898681640625 3 0.9986138736832585 33.14444772457943 1547.0 18.005000000000003 0.0 - - - - - - - 178.5 3 6 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1795 228 C20140709_OR012_04 C20140709_OR012_04 TB416090.[MT7]-TNMDFVGHRK[MT7].3y8_2.heavy 498.269 / 567.304 952.0 22.311750411987305 45 20 10 5 10 13.909137260891713 7.189518524716106 0.04489898681640625 3 0.9986138736832585 33.14444772457943 952.0 10.586666666666666 2.0 - - - - - - - 0.0 1 0 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1797 228 C20140709_OR012_04 C20140709_OR012_04 TB416090.[MT7]-TNMDFVGHRK[MT7].3y9_2.heavy 498.269 / 624.325 1904.0 22.311750411987305 45 20 10 5 10 13.909137260891713 7.189518524716106 0.04489898681640625 3 0.9986138736832585 33.14444772457943 1904.0 24.799999999999997 0.0 - - - - - - - 214.2 3 5 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 1799 229 C20140709_OR012_04 C20140709_OR012_04 TB446851.[MT7]-QFGMAPGIGPISFPEAQEGLMGIGR.3b4_1.heavy 902.128 / 608.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1801 229 C20140709_OR012_04 C20140709_OR012_04 TB446851.[MT7]-QFGMAPGIGPISFPEAQEGLMGIGR.3b5_1.heavy 902.128 / 679.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1803 229 C20140709_OR012_04 C20140709_OR012_04 TB446851.[MT7]-QFGMAPGIGPISFPEAQEGLMGIGR.3b7_1.heavy 902.128 / 833.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1805 229 C20140709_OR012_04 C20140709_OR012_04 TB446851.[MT7]-QFGMAPGIGPISFPEAQEGLMGIGR.3y10_1.heavy 902.128 / 1031.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1807 230 C20140709_OR012_04 C20140709_OR012_04 TB446462.[MT7]-TLSDADRK[MT7].2y4_1.heavy 597.34 / 633.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1809 230 C20140709_OR012_04 C20140709_OR012_04 TB446462.[MT7]-TLSDADRK[MT7].2b4_1.heavy 597.34 / 561.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1811 230 C20140709_OR012_04 C20140709_OR012_04 TB446462.[MT7]-TLSDADRK[MT7].2y6_1.heavy 597.34 / 835.439 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1813 230 C20140709_OR012_04 C20140709_OR012_04 TB446462.[MT7]-TLSDADRK[MT7].2y7_1.heavy 597.34 / 948.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1815 231 C20140709_OR012_04 C20140709_OR012_04 TB416078.[MT7]-IQFLLAQMVK[MT7].3y3_1.heavy 493.638 / 521.324 646.0 47.5225248336792 33 8 10 5 10 0.4672044666942852 100.15630503773829 0.045299530029296875 3 0.779149510911313 2.5761756626151953 646.0 6.377940006121824 0.0 - - - - - - - 0.0 1 0 QRICH2 glutamine rich 2 1817 231 C20140709_OR012_04 C20140709_OR012_04 TB416078.[MT7]-IQFLLAQMVK[MT7].3b4_1.heavy 493.638 / 646.404 889.0 47.5225248336792 33 8 10 5 10 0.4672044666942852 100.15630503773829 0.045299530029296875 3 0.779149510911313 2.5761756626151953 889.0 14.267901234567901 0.0 - - - - - - - 0.0 1 0 QRICH2 glutamine rich 2 1819 231 C20140709_OR012_04 C20140709_OR012_04 TB416078.[MT7]-IQFLLAQMVK[MT7].3b5_1.heavy 493.638 / 759.489 162.0 47.5225248336792 33 8 10 5 10 0.4672044666942852 100.15630503773829 0.045299530029296875 3 0.779149510911313 2.5761756626151953 162.0 4.0 0.0 - - - - - - - 0.0 0 0 QRICH2 glutamine rich 2 1821 231 C20140709_OR012_04 C20140709_OR012_04 TB416078.[MT7]-IQFLLAQMVK[MT7].3b3_1.heavy 493.638 / 533.32 242.0 47.5225248336792 33 8 10 5 10 0.4672044666942852 100.15630503773829 0.045299530029296875 3 0.779149510911313 2.5761756626151953 242.0 1.7925925925925925 1.0 - - - - - - - 0.0 0 0 QRICH2 glutamine rich 2 1823 232 C20140709_OR012_04 C20140709_OR012_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 174300.0 44.08656565348307 23 -3 10 6 10 null 0.0 0.03800201416015625 3 0.0 0.0 174300.0 635.4723249697618 0.0 - - - - - - - 227.16666666666666 348 6 1825 232 C20140709_OR012_04 C20140709_OR012_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 256192.0 44.08656565348307 23 -3 10 6 10 null 0.0 0.03800201416015625 3 0.0 0.0 256192.0 480.8901781471151 0.0 - - - - - - - 723.4285714285714 512 7 1827 232 C20140709_OR012_04 C20140709_OR012_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 196501.0 44.08656565348307 23 -3 10 6 10 null 0.0 0.03800201416015625 3 0.0 0.0 196501.0 813.1515769655261 0.0 - - - - - - - 264.14285714285717 393 7 1829 233 C20140709_OR012_04 C20140709_OR012_04 TB446660.[MT7]-LLIQAEFPSLLK[MT7].3b4_1.heavy 554.014 / 612.42 8464.0 47.02130126953125 44 14 10 10 10 19.535370841135375 5.118919974092906 0.0 3 0.9479178596162168 5.3841206298786135 8464.0 68.91901931858096 0.0 - - - - - - - 340.5 16 2 S100G S100 calcium binding protein G 1831 233 C20140709_OR012_04 C20140709_OR012_04 TB446660.[MT7]-LLIQAEFPSLLK[MT7].3b5_1.heavy 554.014 / 683.457 16734.0 47.02130126953125 44 14 10 10 10 19.535370841135375 5.118919974092906 0.0 3 0.9479178596162168 5.3841206298786135 16734.0 204.7567858373307 0.0 - - - - - - - 291.75 33 4 S100G S100 calcium binding protein G 1833 233 C20140709_OR012_04 C20140709_OR012_04 TB446660.[MT7]-LLIQAEFPSLLK[MT7].3y4_1.heavy 554.014 / 604.415 18290.0 47.02130126953125 44 14 10 10 10 19.535370841135375 5.118919974092906 0.0 3 0.9479178596162168 5.3841206298786135 18290.0 -9.403598971722367 0.0 - - - - - - - 227.0 36 9 S100G S100 calcium binding protein G 1835 233 C20140709_OR012_04 C20140709_OR012_04 TB446660.[MT7]-LLIQAEFPSLLK[MT7].3y5_1.heavy 554.014 / 701.468 20722.0 47.02130126953125 44 14 10 10 10 19.535370841135375 5.118919974092906 0.0 3 0.9479178596162168 5.3841206298786135 20722.0 232.38357823753705 0.0 - - - - - - - 97.0 41 4 S100G S100 calcium binding protein G 1837 234 C20140709_OR012_04 C20140709_OR012_04 TB416073.[MT7]-LTQSSTFYSQR.2y8_1.heavy 731.376 / 975.453 2340.0 28.118274688720703 31 5 10 6 10 11.548315712499402 8.659271402821476 0.03730010986328125 3 0.6972981099666535 2.183913036001777 2340.0 8.75748502994012 0.0 - - - - - - - 194.75 4 8 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1839 234 C20140709_OR012_04 C20140709_OR012_04 TB416073.[MT7]-LTQSSTFYSQR.2y9_1.heavy 731.376 / 1103.51 1783.0 28.118274688720703 31 5 10 6 10 11.548315712499402 8.659271402821476 0.03730010986328125 3 0.6972981099666535 2.183913036001777 1783.0 14.980970491449531 0.0 - - - - - - - 178.0 3 5 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1841 234 C20140709_OR012_04 C20140709_OR012_04 TB416073.[MT7]-LTQSSTFYSQR.2y10_1.heavy 731.376 / 1204.56 557.0 28.118274688720703 31 5 10 6 10 11.548315712499402 8.659271402821476 0.03730010986328125 3 0.6972981099666535 2.183913036001777 557.0 1.5008982035928145 1.0 - - - - - - - 0.0 1 0 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1843 234 C20140709_OR012_04 C20140709_OR012_04 TB416073.[MT7]-LTQSSTFYSQR.2y7_1.heavy 731.376 / 888.421 1448.0 28.118274688720703 31 5 10 6 10 11.548315712499402 8.659271402821476 0.03730010986328125 3 0.6972981099666535 2.183913036001777 1448.0 8.362850299401199 0.0 - - - - - - - 286.42857142857144 2 7 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1845 235 C20140709_OR012_04 C20140709_OR012_04 TB446867.[MT7]-QLEAEPGLPPVQPVFITVDPERDDVEAMAR.4b8_1.heavy 866.448 / 982.533 6434.0 43.352901458740234 43 13 10 10 10 1.5515253368445536 43.77453613014403 0.0 3 0.9268830228988667 4.535977171364197 6434.0 -2.318558558558559 0.0 - - - - - - - 203.5 12 6 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1847 235 C20140709_OR012_04 C20140709_OR012_04 TB446867.[MT7]-QLEAEPGLPPVQPVFITVDPERDDVEAMAR.4y11_2.heavy 866.448 / 644.801 17082.0 43.352901458740234 43 13 10 10 10 1.5515253368445536 43.77453613014403 0.0 3 0.9268830228988667 4.535977171364197 17082.0 -3.0778378378378406 0.0 - - - - - - - 222.0 34 4 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1849 235 C20140709_OR012_04 C20140709_OR012_04 TB446867.[MT7]-QLEAEPGLPPVQPVFITVDPERDDVEAMAR.4b5_1.heavy 866.448 / 715.374 14753.0 43.352901458740234 43 13 10 10 10 1.5515253368445536 43.77453613014403 0.0 3 0.9268830228988667 4.535977171364197 14753.0 41.6451051051051 1.0 - - - - - - - 310.8 29 5 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1851 235 C20140709_OR012_04 C20140709_OR012_04 TB446867.[MT7]-QLEAEPGLPPVQPVFITVDPERDDVEAMAR.4b3_1.heavy 866.448 / 515.295 8652.0 43.352901458740234 43 13 10 10 10 1.5515253368445536 43.77453613014403 0.0 3 0.9268830228988667 4.535977171364197 8652.0 0.0 0.0 - - - - - - - 249.75 17 8 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 1853 236 C20140709_OR012_04 C20140709_OR012_04 TB416074.[MT7]-GLVRPGMDQSGLAQPGADQR.3b11_2.heavy 733.047 / 621.823 3265.0 27.260700225830078 46 16 10 10 10 11.400309387595849 8.771691767313385 0.0 3 0.962037758879717 6.313975399938359 3265.0 24.17087442472058 0.0 - - - - - - - 113.0 6 1 QRICH2 glutamine rich 2 1855 236 C20140709_OR012_04 C20140709_OR012_04 TB416074.[MT7]-GLVRPGMDQSGLAQPGADQR.3y6_1.heavy 733.047 / 643.316 5067.0 27.260700225830078 46 16 10 10 10 11.400309387595849 8.771691767313385 0.0 3 0.962037758879717 6.313975399938359 5067.0 55.762907964601766 0.0 - - - - - - - 450.0 10 1 QRICH2 glutamine rich 2 1857 236 C20140709_OR012_04 C20140709_OR012_04 TB416074.[MT7]-GLVRPGMDQSGLAQPGADQR.3y8_1.heavy 733.047 / 842.411 1689.0 27.260700225830078 46 16 10 10 10 11.400309387595849 8.771691767313385 0.0 3 0.962037758879717 6.313975399938359 1689.0 0.0 0.0 - - - - - - - 292.8 3 5 QRICH2 glutamine rich 2 1859 236 C20140709_OR012_04 C20140709_OR012_04 TB416074.[MT7]-GLVRPGMDQSGLAQPGADQR.3b8_1.heavy 733.047 / 970.526 901.0 27.260700225830078 46 16 10 10 10 11.400309387595849 8.771691767313385 0.0 3 0.962037758879717 6.313975399938359 901.0 13.554867256637168 0.0 - - - - - - - 0.0 1 0 QRICH2 glutamine rich 2 1861 237 C20140709_OR012_04 C20140709_OR012_04 TB446760.[MT7]-SQGQQLQQLQAELDK[MT7].3b6_1.heavy 668.032 / 786.423 9354.0 35.46870040893555 46 16 10 10 10 2.5508129086536018 39.20318877984003 0.0 3 0.9611564615451943 6.24147252376471 9354.0 -3.5976923076923057 0.0 - - - - - - - 260.0 18 4 SPAG4 sperm associated antigen 4 1863 237 C20140709_OR012_04 C20140709_OR012_04 TB446760.[MT7]-SQGQQLQQLQAELDK[MT7].3b4_1.heavy 668.032 / 545.28 13381.0 35.46870040893555 46 16 10 10 10 2.5508129086536018 39.20318877984003 0.0 3 0.9611564615451943 6.24147252376471 13381.0 -1.2866346153846173 0.0 - - - - - - - 156.0 26 5 SPAG4 sperm associated antigen 4 1865 237 C20140709_OR012_04 C20140709_OR012_04 TB446760.[MT7]-SQGQQLQQLQAELDK[MT7].3b5_1.heavy 668.032 / 673.339 14810.0 35.46870040893555 46 16 10 10 10 2.5508129086536018 39.20318877984003 0.0 3 0.9611564615451943 6.24147252376471 14810.0 -1.629262926292629 0.0 - - - - - - - 227.5 29 4 SPAG4 sperm associated antigen 4 1867 237 C20140709_OR012_04 C20140709_OR012_04 TB446760.[MT7]-SQGQQLQQLQAELDK[MT7].3y5_1.heavy 668.032 / 719.406 12471.0 35.46870040893555 46 16 10 10 10 2.5508129086536018 39.20318877984003 0.0 3 0.9611564615451943 6.24147252376471 12471.0 0.0 0.0 - - - - - - - 390.0 24 1 SPAG4 sperm associated antigen 4 1869 238 C20140709_OR012_04 C20140709_OR012_04 TB416209.[MT7]-LLPLPSAITSQLDK[MT7].3y3_1.heavy 595.364 / 519.326 26729.0 44.807098388671875 47 17 10 10 10 1.913784490418065 41.19330656968924 0.0 3 0.9724098560105914 7.4127913516818715 26729.0 57.08728073868261 0.0 - - - - - - - 242.77777777777777 53 9 SIM1;SIM2 single-minded homolog 1 (Drosophila);single-minded homolog 2 (Drosophila) 1871 238 C20140709_OR012_04 C20140709_OR012_04 TB416209.[MT7]-LLPLPSAITSQLDK[MT7].3y6_1.heavy 595.364 / 835.464 18929.0 44.807098388671875 47 17 10 10 10 1.913784490418065 41.19330656968924 0.0 3 0.9724098560105914 7.4127913516818715 18929.0 226.429155129505 0.0 - - - - - - - 171.0 37 5 SIM1;SIM2 single-minded homolog 1 (Drosophila);single-minded homolog 2 (Drosophila) 1873 238 C20140709_OR012_04 C20140709_OR012_04 TB416209.[MT7]-LLPLPSAITSQLDK[MT7].3b4_1.heavy 595.364 / 581.414 39285.0 44.807098388671875 47 17 10 10 10 1.913784490418065 41.19330656968924 0.0 3 0.9724098560105914 7.4127913516818715 39285.0 253.51842750483917 0.0 - - - - - - - 221.66666666666666 78 9 SIM1;SIM2 single-minded homolog 1 (Drosophila);single-minded homolog 2 (Drosophila) 1875 238 C20140709_OR012_04 C20140709_OR012_04 TB416209.[MT7]-LLPLPSAITSQLDK[MT7].3y5_1.heavy 595.364 / 734.417 14649.0 44.807098388671875 47 17 10 10 10 1.913784490418065 41.19330656968924 0.0 3 0.9724098560105914 7.4127913516818715 14649.0 198.918 0.0 - - - - - - - 138.1818181818182 29 11 SIM1;SIM2 single-minded homolog 1 (Drosophila);single-minded homolog 2 (Drosophila) 1877 239 C20140709_OR012_04 C20140709_OR012_04 TB415777.[MT7]-VLAGTAK[MT7].2y6_1.heavy 474.31 / 704.442 1084.0 23.456199645996094 19 2 10 1 6 0.2856201051871321 145.24578046758563 0.09759902954101562 5 0.4159178949355185 1.52851756771226 1084.0 5.525096952908587 4.0 - - - - - - - 276.9 12 10 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1879 239 C20140709_OR012_04 C20140709_OR012_04 TB415777.[MT7]-VLAGTAK[MT7].2y4_1.heavy 474.31 / 520.321 10961.0 23.456199645996094 19 2 10 1 6 0.2856201051871321 145.24578046758563 0.09759902954101562 5 0.4159178949355185 1.52851756771226 10961.0 73.79502919506672 0.0 - - - - - - - 210.5 21 4 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1881 239 C20140709_OR012_04 C20140709_OR012_04 TB415777.[MT7]-VLAGTAK[MT7].2y5_1.heavy 474.31 / 591.358 1686.0 23.456199645996094 19 2 10 1 6 0.2856201051871321 145.24578046758563 0.09759902954101562 5 0.4159178949355185 1.52851756771226 1686.0 16.41109958506224 3.0 - - - - - - - 223.42857142857142 5 7 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1883 239 C20140709_OR012_04 C20140709_OR012_04 TB415777.[MT7]-VLAGTAK[MT7].2y3_1.heavy 474.31 / 463.3 27705.0 23.456199645996094 19 2 10 1 6 0.2856201051871321 145.24578046758563 0.09759902954101562 5 0.4159178949355185 1.52851756771226 27705.0 111.99803278123241 0.0 - - - - - - - 391.25 55 4 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1885 240 C20140709_OR012_04 C20140709_OR012_04 TB415775.[MT7]-LQLGVLR.2y5_1.heavy 471.814 / 557.377 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 1887 240 C20140709_OR012_04 C20140709_OR012_04 TB415775.[MT7]-LQLGVLR.2b4_1.heavy 471.814 / 556.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 1889 240 C20140709_OR012_04 C20140709_OR012_04 TB415775.[MT7]-LQLGVLR.2y6_1.heavy 471.814 / 685.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 1891 240 C20140709_OR012_04 C20140709_OR012_04 TB415775.[MT7]-LQLGVLR.2b5_1.heavy 471.814 / 655.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - QRICH2 glutamine rich 2 1893 241 C20140709_OR012_04 C20140709_OR012_04 TB416203.[MT7]-LRAAEDELNIEAK[MT7].4b7_1.heavy 440.75 / 929.481 N/A 30.839799880981445 40 10 10 10 10 0.7128332772937455 72.09419395094281 0.0 3 0.8406867757365963 3.049962594874269 0.0 0.0 5.0 - - - - - - - 0.0 0 0 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1895 241 C20140709_OR012_04 C20140709_OR012_04 TB416203.[MT7]-LRAAEDELNIEAK[MT7].4b7_2.heavy 440.75 / 465.244 8124.0 30.839799880981445 40 10 10 10 10 0.7128332772937455 72.09419395094281 0.0 3 0.8406867757365963 3.049962594874269 8124.0 43.26662889518414 0.0 - - - - - - - 274.6666666666667 16 6 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1897 241 C20140709_OR012_04 C20140709_OR012_04 TB416203.[MT7]-LRAAEDELNIEAK[MT7].4b9_2.heavy 440.75 / 578.808 3650.0 30.839799880981445 40 10 10 10 10 0.7128332772937455 72.09419395094281 0.0 3 0.8406867757365963 3.049962594874269 3650.0 22.65235804309527 0.0 - - - - - - - 282.6 7 5 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1899 241 C20140709_OR012_04 C20140709_OR012_04 TB416203.[MT7]-LRAAEDELNIEAK[MT7].4b6_1.heavy 440.75 / 800.438 2943.0 30.839799880981445 40 10 10 10 10 0.7128332772937455 72.09419395094281 0.0 3 0.8406867757365963 3.049962594874269 2943.0 49.88135593220339 0.0 - - - - - - - 196.33333333333334 5 3 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1901 242 C20140709_OR012_04 C20140709_OR012_04 TB416389.[MT7]-GPQGALQTPIVTNHLVQLVTAASR.3b6_1.heavy 872.497 / 668.385 2045.0 44.32749938964844 39 14 10 5 10 1.8882124725802893 41.962946449132865 0.04039764404296875 3 0.9358981023920899 4.8481856956241876 2045.0 13.847168430474385 0.0 - - - - - - - 254.76923076923077 4 13 C17orf53 chromosome 17 open reading frame 53 1903 242 C20140709_OR012_04 C20140709_OR012_04 TB416389.[MT7]-GPQGALQTPIVTNHLVQLVTAASR.3b5_1.heavy 872.497 / 555.301 3117.0 44.32749938964844 39 14 10 5 10 1.8882124725802893 41.962946449132865 0.04039764404296875 3 0.9358981023920899 4.8481856956241876 3117.0 6.272402464065708 0.0 - - - - - - - 265.54545454545456 6 11 C17orf53 chromosome 17 open reading frame 53 1905 242 C20140709_OR012_04 C20140709_OR012_04 TB416389.[MT7]-GPQGALQTPIVTNHLVQLVTAASR.3b7_1.heavy 872.497 / 796.443 2337.0 44.32749938964844 39 14 10 5 10 1.8882124725802893 41.962946449132865 0.04039764404296875 3 0.9358981023920899 4.8481856956241876 2337.0 1.8006849315068494 1.0 - - - - - - - 221.27272727272728 4 11 C17orf53 chromosome 17 open reading frame 53 1907 242 C20140709_OR012_04 C20140709_OR012_04 TB416389.[MT7]-GPQGALQTPIVTNHLVQLVTAASR.3y9_1.heavy 872.497 / 944.552 5552.0 44.32749938964844 39 14 10 5 10 1.8882124725802893 41.962946449132865 0.04039764404296875 3 0.9358981023920899 4.8481856956241876 5552.0 65.14629522216812 0.0 - - - - - - - 204.4 11 10 C17orf53 chromosome 17 open reading frame 53 1909 243 C20140709_OR012_04 C20140709_OR012_04 TB416201.[MT7]-VAAIEALNDGELQK[MT7].3y3_1.heavy 587 / 532.357 25842.0 35.91709899902344 47 17 10 10 10 2.9547244880691212 33.844103030177564 0.0 3 0.9741679612626256 7.662026966369926 25842.0 120.54223293167288 0.0 - - - - - - - 752.8571428571429 51 7 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1911 243 C20140709_OR012_04 C20140709_OR012_04 TB416201.[MT7]-VAAIEALNDGELQK[MT7].3b6_1.heavy 587 / 699.416 26742.0 35.91709899902344 47 17 10 10 10 2.9547244880691212 33.844103030177564 0.0 3 0.9741679612626256 7.662026966369926 26742.0 94.51789329486942 0.0 - - - - - - - 220.71428571428572 53 7 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1913 243 C20140709_OR012_04 C20140709_OR012_04 TB416201.[MT7]-VAAIEALNDGELQK[MT7].3b5_1.heavy 587 / 628.379 34071.0 35.91709899902344 47 17 10 10 10 2.9547244880691212 33.844103030177564 0.0 3 0.9741679612626256 7.662026966369926 34071.0 250.56105058365762 0.0 - - - - - - - 231.6 68 10 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1915 243 C20140709_OR012_04 C20140709_OR012_04 TB416201.[MT7]-VAAIEALNDGELQK[MT7].3y5_1.heavy 587 / 718.422 10928.0 35.91709899902344 47 17 10 10 10 2.9547244880691212 33.844103030177564 0.0 3 0.9741679612626256 7.662026966369926 10928.0 22.00895800933126 0.0 - - - - - - - 300.1666666666667 21 6 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1917 244 C20140709_OR012_04 C20140709_OR012_04 TB416108.[MT7]-VVQPQEEIATK[MT7].2b3_1.heavy 765.443 / 471.305 8356.0 26.523075580596924 40 17 10 3 10 3.3746037748593865 23.222061851163044 0.07349967956542969 3 0.9726665937829461 7.4476844555863995 8356.0 47.01772594752187 0.0 - - - - - - - 286.0 16 4 INTS4 integrator complex subunit 4 1919 244 C20140709_OR012_04 C20140709_OR012_04 TB416108.[MT7]-VVQPQEEIATK[MT7].2y4_1.heavy 765.443 / 576.384 1602.0 26.523075580596924 40 17 10 3 10 3.3746037748593865 23.222061851163044 0.07349967956542969 3 0.9726665937829461 7.4476844555863995 1602.0 4.670553935860059 1.0 - - - - - - - 305.0 3 3 INTS4 integrator complex subunit 4 1921 244 C20140709_OR012_04 C20140709_OR012_04 TB416108.[MT7]-VVQPQEEIATK[MT7].2y8_1.heavy 765.443 / 1059.58 8241.0 26.523075580596924 40 17 10 3 10 3.3746037748593865 23.222061851163044 0.07349967956542969 3 0.9726665937829461 7.4476844555863995 8241.0 89.5736128586773 0.0 - - - - - - - 209.5 16 6 INTS4 integrator complex subunit 4 1923 244 C20140709_OR012_04 C20140709_OR012_04 TB416108.[MT7]-VVQPQEEIATK[MT7].2y6_1.heavy 765.443 / 834.469 1030.0 26.523075580596924 40 17 10 3 10 3.3746037748593865 23.222061851163044 0.07349967956542969 3 0.9726665937829461 7.4476844555863995 1030.0 3.36011814582352 0.0 - - - - - - - 324.1666666666667 2 6 INTS4 integrator complex subunit 4 1925 245 C20140709_OR012_04 C20140709_OR012_04 TB416200.[MT7]-QRYVFDISALEK[MT7].4b5_1.heavy 440.001 / 838.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1927 245 C20140709_OR012_04 C20140709_OR012_04 TB416200.[MT7]-QRYVFDISALEK[MT7].4y3_1.heavy 440.001 / 533.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1929 245 C20140709_OR012_04 C20140709_OR012_04 TB416200.[MT7]-QRYVFDISALEK[MT7].4b6_1.heavy 440.001 / 953.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1931 245 C20140709_OR012_04 C20140709_OR012_04 TB416200.[MT7]-QRYVFDISALEK[MT7].4b6_2.heavy 440.001 / 477.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - GDF5 growth differentiation factor 5 1933 246 C20140709_OR012_04 C20140709_OR012_04 TB416105.[MT7]-LELGLGPQPMAPR.3b6_1.heavy 508.289 / 727.447 11468.0 37.45759963989258 50 20 10 10 10 15.911943907020369 6.284587262520444 0.0 3 0.9990471457324659 39.977408422293244 11468.0 51.806508417905334 0.0 - - - - - - - 311.75 22 4 RNF112 ring finger protein 112 1935 246 C20140709_OR012_04 C20140709_OR012_04 TB416105.[MT7]-LELGLGPQPMAPR.3b4_1.heavy 508.289 / 557.341 27173.0 37.45759963989258 50 20 10 10 10 15.911943907020369 6.284587262520444 0.0 3 0.9990471457324659 39.977408422293244 27173.0 79.8914679626633 0.0 - - - - - - - 291.1666666666667 54 6 RNF112 ring finger protein 112 1937 246 C20140709_OR012_04 C20140709_OR012_04 TB416105.[MT7]-LELGLGPQPMAPR.3b3_1.heavy 508.289 / 500.32 7977.0 37.45759963989258 50 20 10 10 10 15.911943907020369 6.284587262520444 0.0 3 0.9990471457324659 39.977408422293244 7977.0 35.80167643837382 0.0 - - - - - - - 285.14285714285717 15 7 RNF112 ring finger protein 112 1939 246 C20140709_OR012_04 C20140709_OR012_04 TB416105.[MT7]-LELGLGPQPMAPR.3y5_1.heavy 508.289 / 571.302 41507.0 37.45759963989258 50 20 10 10 10 15.911943907020369 6.284587262520444 0.0 3 0.9990471457324659 39.977408422293244 41507.0 436.04635041711225 0.0 - - - - - - - 218.25 83 4 RNF112 ring finger protein 112 1941 247 C20140709_OR012_04 C20140709_OR012_04 TB446861.[MT7]-QHLVQNPVRLWQLLGGTFYFNTSR.4y5_1.heavy 755.41 / 624.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1943 247 C20140709_OR012_04 C20140709_OR012_04 TB446861.[MT7]-QHLVQNPVRLWQLLGGTFYFNTSR.4y10_1.heavy 755.41 / 1149.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1945 247 C20140709_OR012_04 C20140709_OR012_04 TB446861.[MT7]-QHLVQNPVRLWQLLGGTFYFNTSR.4y6_1.heavy 755.41 / 787.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1947 247 C20140709_OR012_04 C20140709_OR012_04 TB446861.[MT7]-QHLVQNPVRLWQLLGGTFYFNTSR.4b3_1.heavy 755.41 / 523.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1949 248 C20140709_OR012_04 C20140709_OR012_04 TB416102.[MT7]-ENSEFYELAK[MT7].2y8_1.heavy 759.39 / 1130.58 525.0 34.640098571777344 30 15 6 5 4 3.3032748370451563 30.272988150586933 0.0428009033203125 9 0.9541333477597309 5.740368086643084 525.0 4.346763209100434 6.0 - - - - - - - 196.66666666666666 2 6 SIM1 single-minded homolog 1 (Drosophila) 1951 248 C20140709_OR012_04 C20140709_OR012_04 TB416102.[MT7]-ENSEFYELAK[MT7].2y5_1.heavy 759.39 / 767.442 656.0 34.640098571777344 30 15 6 5 4 3.3032748370451563 30.272988150586933 0.0428009033203125 9 0.9541333477597309 5.740368086643084 656.0 3.502801565466734 7.0 - - - - - - - 0.0 1 0 SIM1 single-minded homolog 1 (Drosophila) 1953 248 C20140709_OR012_04 C20140709_OR012_04 TB416102.[MT7]-ENSEFYELAK[MT7].2y9_1.heavy 759.39 / 1244.63 131.0 34.640098571777344 30 15 6 5 4 3.3032748370451563 30.272988150586933 0.0428009033203125 9 0.9541333477597309 5.740368086643084 131.0 -0.040243902439024315 26.0 - - - - - - - 0.0 1 0 SIM1 single-minded homolog 1 (Drosophila) 1955 248 C20140709_OR012_04 C20140709_OR012_04 TB416102.[MT7]-ENSEFYELAK[MT7].2b5_1.heavy 759.39 / 751.338 1574.0 34.640098571777344 30 15 6 5 4 3.3032748370451563 30.272988150586933 0.0428009033203125 9 0.9541333477597309 5.740368086643084 1574.0 5.114964095580042 4.0 - - - - - - - 306.3333333333333 4 3 SIM1 single-minded homolog 1 (Drosophila) 1957 249 C20140709_OR012_04 C20140709_OR012_04 TB416386.[MT7]-SIFIPQEMHSTEDENQGTIK[MT7].4y4_1.heavy 648.827 / 562.368 14054.0 33.30620002746582 41 16 10 5 10 2.9494178267597015 26.29141840357206 0.040203094482421875 3 0.9624827026003345 6.351544769312896 14054.0 119.39936838842173 0.0 - - - - - - - 284.5 28 6 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1959 249 C20140709_OR012_04 C20140709_OR012_04 TB416386.[MT7]-SIFIPQEMHSTEDENQGTIK[MT7].4b19_2.heavy 648.827 / 1151.54 1576.0 33.30620002746582 41 16 10 5 10 2.9494178267597015 26.29141840357206 0.040203094482421875 3 0.9624827026003345 6.351544769312896 1576.0 0.5486808707860047 9.0 - - - - - - - 262.6666666666667 9 12 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1961 249 C20140709_OR012_04 C20140709_OR012_04 TB416386.[MT7]-SIFIPQEMHSTEDENQGTIK[MT7].4b4_1.heavy 648.827 / 605.378 13791.0 33.30620002746582 41 16 10 5 10 2.9494178267597015 26.29141840357206 0.040203094482421875 3 0.9624827026003345 6.351544769312896 13791.0 13.83064531993747 0.0 - - - - - - - 262.6666666666667 27 6 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1963 249 C20140709_OR012_04 C20140709_OR012_04 TB416386.[MT7]-SIFIPQEMHSTEDENQGTIK[MT7].4y3_1.heavy 648.827 / 505.347 4466.0 33.30620002746582 41 16 10 5 10 2.9494178267597015 26.29141840357206 0.040203094482421875 3 0.9624827026003345 6.351544769312896 4466.0 32.932142441973106 0.0 - - - - - - - 262.7142857142857 8 7 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 1965 250 C20140709_OR012_04 C20140709_OR012_04 TB446860.[MT7]-AVATEAQVPFLAMAGPEFVEVIGGLGAAR.3b6_1.heavy 1005.87 / 687.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1967 250 C20140709_OR012_04 C20140709_OR012_04 TB446860.[MT7]-AVATEAQVPFLAMAGPEFVEVIGGLGAAR.3b5_1.heavy 1005.87 / 616.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1969 250 C20140709_OR012_04 C20140709_OR012_04 TB446860.[MT7]-AVATEAQVPFLAMAGPEFVEVIGGLGAAR.3y12_1.heavy 1005.87 / 1188.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1971 250 C20140709_OR012_04 C20140709_OR012_04 TB446860.[MT7]-AVATEAQVPFLAMAGPEFVEVIGGLGAAR.3b7_1.heavy 1005.87 / 815.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 1973 251 C20140709_OR012_04 C20140709_OR012_04 TB434202.[MT7]-AIDLFTDAIK[MT7].2y5_1.heavy 697.91 / 691.411 6064.0 42.05014991760254 43 17 10 6 10 3.469614136351735 28.821648768456136 0.039302825927734375 3 0.971901553374462 7.345122071909415 6064.0 53.709714285714284 1.0 - - - - - - - 220.88888888888889 12 9 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1975 251 C20140709_OR012_04 C20140709_OR012_04 TB434202.[MT7]-AIDLFTDAIK[MT7].2b4_1.heavy 697.91 / 557.341 6168.0 42.05014991760254 43 17 10 6 10 3.469614136351735 28.821648768456136 0.039302825927734375 3 0.971901553374462 7.345122071909415 6168.0 26.44271770334928 0.0 - - - - - - - 178.0 12 10 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1977 251 C20140709_OR012_04 C20140709_OR012_04 TB434202.[MT7]-AIDLFTDAIK[MT7].2y6_1.heavy 697.91 / 838.479 5646.0 42.05014991760254 43 17 10 6 10 3.469614136351735 28.821648768456136 0.039302825927734375 3 0.971901553374462 7.345122071909415 5646.0 21.611483253588517 0.0 - - - - - - - 255.66666666666666 11 9 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1979 251 C20140709_OR012_04 C20140709_OR012_04 TB434202.[MT7]-AIDLFTDAIK[MT7].2y7_1.heavy 697.91 / 951.563 3555.0 42.05014991760254 43 17 10 6 10 3.469614136351735 28.821648768456136 0.039302825927734375 3 0.971901553374462 7.345122071909415 3555.0 20.945063694267514 0.0 - - - - - - - 209.28571428571428 7 14 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 1981 252 C20140709_OR012_04 C20140709_OR012_04 TB434407.[MT7]-FLPPEDTPPPAQGEALLGGLELIK[MT7].4y4_1.heavy 698.394 / 646.426 2569.0 48.500749588012695 32 11 10 5 6 0.9158311785063808 65.32979052125906 0.040699005126953125 5 0.8527982580016313 3.1763517213452896 2569.0 2.058316736309082 0.0 - - - - - - - 246.5 5 14 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1983 252 C20140709_OR012_04 C20140709_OR012_04 TB434407.[MT7]-FLPPEDTPPPAQGEALLGGLELIK[MT7].4y7_1.heavy 698.394 / 873.553 1124.0 48.500749588012695 32 11 10 5 6 0.9158311785063808 65.32979052125906 0.040699005126953125 5 0.8527982580016313 3.1763517213452896 1124.0 0.2580053736218119 2.0 - - - - - - - 189.72727272727272 4 11 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1985 252 C20140709_OR012_04 C20140709_OR012_04 TB434407.[MT7]-FLPPEDTPPPAQGEALLGGLELIK[MT7].4y3_1.heavy 698.394 / 517.383 2890.0 48.500749588012695 32 11 10 5 6 0.9158311785063808 65.32979052125906 0.040699005126953125 5 0.8527982580016313 3.1763517213452896 2890.0 8.887132071706521 0.0 - - - - - - - 192.6 5 15 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1987 252 C20140709_OR012_04 C20140709_OR012_04 TB434407.[MT7]-FLPPEDTPPPAQGEALLGGLELIK[MT7].4b6_1.heavy 698.394 / 843.437 803.0 48.500749588012695 32 11 10 5 6 0.9158311785063808 65.32979052125906 0.040699005126953125 5 0.8527982580016313 3.1763517213452896 803.0 3.454121715076072 2.0 - - - - - - - 204.36363636363637 2 11 NOS1AP nitric oxide synthase 1 (neuronal) adaptor protein 1989 253 C20140709_OR012_04 C20140709_OR012_04 TB446833.[MT7]-SFLLNHLLQGLPGLESGEGGRPR.4y12_2.heavy 648.61 / 606.31 635.0 39.21872520446777 30 18 6 5 1 8.26361229490606 12.101245367191659 0.04669952392578125 19 0.9842205290266516 9.811680843578543 635.0 1.3580670798725598 19.0 - - - - - - - 238.16666666666666 4 12 RNF112 ring finger protein 112 1991 253 C20140709_OR012_04 C20140709_OR012_04 TB446833.[MT7]-SFLLNHLLQGLPGLESGEGGRPR.4b4_1.heavy 648.61 / 605.378 423.0 39.21872520446777 30 18 6 5 1 8.26361229490606 12.101245367191659 0.04669952392578125 19 0.9842205290266516 9.811680843578543 423.0 0.9338592612831913 37.0 - - - - - - - 238.16666666666666 2 12 RNF112 ring finger protein 112 1993 253 C20140709_OR012_04 C20140709_OR012_04 TB446833.[MT7]-SFLLNHLLQGLPGLESGEGGRPR.4b5_1.heavy 648.61 / 719.421 1482.0 39.21872520446777 30 18 6 5 1 8.26361229490606 12.101245367191659 0.04669952392578125 19 0.9842205290266516 9.811680843578543 1482.0 2.381616592258912 0.0 - - - - - - - 181.5 2 14 RNF112 ring finger protein 112 1995 253 C20140709_OR012_04 C20140709_OR012_04 TB446833.[MT7]-SFLLNHLLQGLPGLESGEGGRPR.4y14_2.heavy 648.61 / 691.363 529.0 39.21872520446777 30 18 6 5 1 8.26361229490606 12.101245367191659 0.04669952392578125 19 0.9842205290266516 9.811680843578543 529.0 -0.3999999999999999 24.0 - - - - - - - 211.63636363636363 2 11 RNF112 ring finger protein 112 1997 254 C20140709_OR012_04 C20140709_OR012_04 TB446433.[MT7]-AFSHSGSLR.2y8_1.heavy 553.297 / 890.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 1999 254 C20140709_OR012_04 C20140709_OR012_04 TB446433.[MT7]-AFSHSGSLR.2y5_1.heavy 553.297 / 519.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 2001 254 C20140709_OR012_04 C20140709_OR012_04 TB446433.[MT7]-AFSHSGSLR.2y6_1.heavy 553.297 / 656.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 2003 254 C20140709_OR012_04 C20140709_OR012_04 TB446433.[MT7]-AFSHSGSLR.2y7_1.heavy 553.297 / 743.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF625 zinc finger protein 625 2005 255 C20140709_OR012_04 C20140709_OR012_04 TB434203.[MT7]-AIDLFTDAIK[MT7].3y3_1.heavy 465.609 / 475.336 5353.0 42.05014991760254 33 7 10 6 10 14.398021734638133 6.945398600102426 0.039302825927734375 3 0.7135457753177205 2.2484110443063092 5353.0 66.2752380952381 0.0 - - - - - - - 236.25 10 4 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 2007 255 C20140709_OR012_04 C20140709_OR012_04 TB434203.[MT7]-AIDLFTDAIK[MT7].3b4_1.heavy 465.609 / 557.341 1155.0 42.05014991760254 33 7 10 6 10 14.398021734638133 6.945398600102426 0.039302825927734375 3 0.7135457753177205 2.2484110443063092 1155.0 0.0 0.0 - - - - - - - 315.0 2 1 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 2009 255 C20140709_OR012_04 C20140709_OR012_04 TB434203.[MT7]-AIDLFTDAIK[MT7].3b5_1.heavy 465.609 / 704.41 1679.0 42.05014991760254 33 7 10 6 10 14.398021734638133 6.945398600102426 0.039302825927734375 3 0.7135457753177205 2.2484110443063092 1679.0 7.995238095238095 0.0 - - - - - - - 210.0 3 2 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 2011 255 C20140709_OR012_04 C20140709_OR012_04 TB434203.[MT7]-AIDLFTDAIK[MT7].3y5_1.heavy 465.609 / 691.411 1679.0 42.05014991760254 33 7 10 6 10 14.398021734638133 6.945398600102426 0.039302825927734375 3 0.7135457753177205 2.2484110443063092 1679.0 23.186190476190475 0.0 - - - - - - - 105.0 3 2 ST13 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) 2013 256 C20140709_OR012_04 C20140709_OR012_04 TB446333.[MT7]-GLGFDR.2y4_1.heavy 404.725 / 494.236 3542.0 26.200000762939453 45 17 10 10 8 3.077985525468251 32.488781760852206 0.0 4 0.9735102888444043 7.565896111315848 3542.0 16.030245901639343 1.0 - - - - - - - 226.57142857142858 16 7 GDF5 growth differentiation factor 5 2015 256 C20140709_OR012_04 C20140709_OR012_04 TB446333.[MT7]-GLGFDR.2y5_1.heavy 404.725 / 607.32 4886.0 26.200000762939453 45 17 10 10 8 3.077985525468251 32.488781760852206 0.0 4 0.9735102888444043 7.565896111315848 4886.0 10.715613747954173 0.0 - - - - - - - 292.8 9 5 GDF5 growth differentiation factor 5 2017 256 C20140709_OR012_04 C20140709_OR012_04 TB446333.[MT7]-GLGFDR.2b4_1.heavy 404.725 / 519.305 3542.0 26.200000762939453 45 17 10 10 8 3.077985525468251 32.488781760852206 0.0 4 0.9735102888444043 7.565896111315848 3542.0 17.516448087431694 0.0 - - - - - - - 223.66666666666666 7 6 GDF5 growth differentiation factor 5 2019 256 C20140709_OR012_04 C20140709_OR012_04 TB446333.[MT7]-GLGFDR.2b5_1.heavy 404.725 / 634.332 8183.0 26.200000762939453 45 17 10 10 8 3.077985525468251 32.488781760852206 0.0 4 0.9735102888444043 7.565896111315848 8183.0 92.56180327868852 0.0 - - - - - - - 264.5 16 6 GDF5 growth differentiation factor 5 2021 257 C20140709_OR012_04 C20140709_OR012_04 TB415740.[MT7]-GDSVGLR.2y4_1.heavy 424.241 / 444.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1;TJP2 tight junction protein 1 (zona occludens 1);tight junction protein 2 (zona occludens 2) 2023 257 C20140709_OR012_04 C20140709_OR012_04 TB415740.[MT7]-GDSVGLR.2y5_1.heavy 424.241 / 531.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1;TJP2 tight junction protein 1 (zona occludens 1);tight junction protein 2 (zona occludens 2) 2025 257 C20140709_OR012_04 C20140709_OR012_04 TB415740.[MT7]-GDSVGLR.2y6_1.heavy 424.241 / 646.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1;TJP2 tight junction protein 1 (zona occludens 1);tight junction protein 2 (zona occludens 2) 2027 257 C20140709_OR012_04 C20140709_OR012_04 TB415740.[MT7]-GDSVGLR.2b5_1.heavy 424.241 / 560.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1;TJP2 tight junction protein 1 (zona occludens 1);tight junction protein 2 (zona occludens 2) 2029 258 C20140709_OR012_04 C20140709_OR012_04 TB446331.[MT7]-DAILAR.2b3_1.heavy 401.749 / 444.258 4577.0 23.945499420166016 31 20 2 5 4 7.578335880338531 13.195509090517232 0.044399261474609375 9 0.9927717905937701 14.5072488854548 4577.0 14.234343561840394 2.0 - - - - - - - 297.0 38 5 RNF112 ring finger protein 112 2031 258 C20140709_OR012_04 C20140709_OR012_04 TB446331.[MT7]-DAILAR.2y5_1.heavy 401.749 / 543.361 8287.0 23.945499420166016 31 20 2 5 4 7.578335880338531 13.195509090517232 0.044399261474609375 9 0.9927717905937701 14.5072488854548 8287.0 27.4744204851752 1.0 - - - - - - - 173.2 19 5 RNF112 ring finger protein 112 2033 258 C20140709_OR012_04 C20140709_OR012_04 TB446331.[MT7]-DAILAR.2b4_1.heavy 401.749 / 557.341 2598.0 23.945499420166016 31 20 2 5 4 7.578335880338531 13.195509090517232 0.044399261474609375 9 0.9927717905937701 14.5072488854548 2598.0 8.614574898785424 3.0 - - - - - - - 321.6 26 5 RNF112 ring finger protein 112 2035 258 C20140709_OR012_04 C20140709_OR012_04 TB446331.[MT7]-DAILAR.2y3_1.heavy 401.749 / 359.24 2226.0 23.945499420166016 31 20 2 5 4 7.578335880338531 13.195509090517232 0.044399261474609375 9 0.9927717905937701 14.5072488854548 2226.0 9.600000000000001 1.0 - - - - - - - 278.25 7 4 RNF112 ring finger protein 112 2037 259 C20140709_OR012_04 C20140709_OR012_04 TB434301.[MT7]-QRYVFDISALEK[MT7].3y3_1.heavy 586.333 / 533.341 14237.0 38.08300018310547 44 14 10 10 10 2.317377829301578 34.353137384789676 0.0 3 0.9347443203961987 4.8046610591256895 14237.0 60.197708926833585 0.0 - - - - - - - 254.0 28 8 GDF5 growth differentiation factor 5 2039 259 C20140709_OR012_04 C20140709_OR012_04 TB434301.[MT7]-QRYVFDISALEK[MT7].3b6_1.heavy 586.333 / 953.496 12585.0 38.08300018310547 44 14 10 10 10 2.317377829301578 34.353137384789676 0.0 3 0.9347443203961987 4.8046610591256895 12585.0 130.87078740157483 0.0 - - - - - - - 181.42857142857142 25 7 GDF5 growth differentiation factor 5 2041 259 C20140709_OR012_04 C20140709_OR012_04 TB434301.[MT7]-QRYVFDISALEK[MT7].3y4_1.heavy 586.333 / 604.379 10805.0 38.08300018310547 44 14 10 10 10 2.317377829301578 34.353137384789676 0.0 3 0.9347443203961987 4.8046610591256895 10805.0 55.95532424602585 0.0 - - - - - - - 279.4 21 5 GDF5 growth differentiation factor 5 2043 259 C20140709_OR012_04 C20140709_OR012_04 TB434301.[MT7]-QRYVFDISALEK[MT7].3b8_2.heavy 586.333 / 577.31 9661.0 38.08300018310547 44 14 10 10 10 2.317377829301578 34.353137384789676 0.0 3 0.9347443203961987 4.8046610591256895 9661.0 12.455649070693319 1.0 - - - - - - - 232.83333333333334 19 6 GDF5 growth differentiation factor 5 2045 260 C20140709_OR012_04 C20140709_OR012_04 TB446772.[MT7]-VAVFLVDTGDAMSPELSR.3y6_1.heavy 684.358 / 688.362 3744.0 44.30730056762695 44 14 10 10 10 4.3139313717322025 18.4884771900513 0.0 3 0.9491752961580449 5.450899194898122 3744.0 -0.004998664886515236 0.0 - - - - - - - 160.5 7 4 RNF112 ring finger protein 112 2047 260 C20140709_OR012_04 C20140709_OR012_04 TB446772.[MT7]-VAVFLVDTGDAMSPELSR.3b4_1.heavy 684.358 / 561.352 6739.0 44.30730056762695 44 14 10 10 10 4.3139313717322025 18.4884771900513 0.0 3 0.9491752961580449 5.450899194898122 6739.0 -3.1490654205607527 0.0 - - - - - - - 267.5 13 6 RNF112 ring finger protein 112 2049 260 C20140709_OR012_04 C20140709_OR012_04 TB446772.[MT7]-VAVFLVDTGDAMSPELSR.3b5_1.heavy 684.358 / 674.436 2139.0 44.30730056762695 44 14 10 10 10 4.3139313717322025 18.4884771900513 0.0 3 0.9491752961580449 5.450899194898122 2139.0 -0.3118134641694579 2.0 - - - - - - - 294.25 6 4 RNF112 ring finger protein 112 2051 260 C20140709_OR012_04 C20140709_OR012_04 TB446772.[MT7]-VAVFLVDTGDAMSPELSR.3y5_1.heavy 684.358 / 601.33 3958.0 44.30730056762695 44 14 10 10 10 4.3139313717322025 18.4884771900513 0.0 3 0.9491752961580449 5.450899194898122 3958.0 -0.9247663551401875 0.0 - - - - - - - 214.0 7 8 RNF112 ring finger protein 112 2053 261 C20140709_OR012_04 C20140709_OR012_04 TB415743.[MT7]-QVAQASHSYR.3b4_1.heavy 430.894 / 571.332 956.0 16.577199935913086 43 13 10 10 10 1.129526550312608 52.86267851717463 0.0 3 0.921591800231966 4.378267023764852 956.0 4.397410768809619 0.0 - - - - - - - 0.0 1 0 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2055 261 C20140709_OR012_04 C20140709_OR012_04 TB415743.[MT7]-QVAQASHSYR.3y4_1.heavy 430.894 / 562.273 1631.0 16.577199935913086 43 13 10 10 10 1.129526550312608 52.86267851717463 0.0 3 0.921591800231966 4.378267023764852 1631.0 28.930122967479676 1.0 - - - - - - - 168.6 3 5 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2057 261 C20140709_OR012_04 C20140709_OR012_04 TB415743.[MT7]-QVAQASHSYR.3b3_1.heavy 430.894 / 443.273 1406.0 16.577199935913086 43 13 10 10 10 1.129526550312608 52.86267851717463 0.0 3 0.921591800231966 4.378267023764852 1406.0 14.813214285714285 0.0 - - - - - - - 84.1 2 10 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2059 261 C20140709_OR012_04 C20140709_OR012_04 TB415743.[MT7]-QVAQASHSYR.3y5_1.heavy 430.894 / 649.305 900.0 16.577199935913086 43 13 10 10 10 1.129526550312608 52.86267851717463 0.0 3 0.921591800231966 4.378267023764852 900.0 16.307142857142857 0.0 - - - - - - - 0.0 1 0 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2061 262 C20140709_OR012_04 C20140709_OR012_04 TB415746.[MT7]-ESAAINQILGR.3y6_1.heavy 439.253 / 700.41 1417.0 35.663225173950195 41 18 10 5 8 5.909624107408515 16.921550031352492 0.04450225830078125 4 0.9869454871750633 10.789676947951953 1417.0 8.979683295176125 2.0 - - - - - - - 300.6666666666667 3 3 LEF1;TCF7;TCF7L2;TCF7L1 lymphoid enhancer-binding factor 1;transcription factor 7 (T-cell specific, HMG-box);transcription factor 7-like 2 (T-cell specific, HMG-box);transcription factor 7-like 1 (T-cell specific, HMG-box) 2063 262 C20140709_OR012_04 C20140709_OR012_04 TB415746.[MT7]-ESAAINQILGR.3b4_1.heavy 439.253 / 503.258 5024.0 35.663225173950195 41 18 10 5 8 5.909624107408515 16.921550031352492 0.04450225830078125 4 0.9869454871750633 10.789676947951953 5024.0 49.222063381130255 0.0 - - - - - - - 193.25 10 4 LEF1;TCF7;TCF7L2;TCF7L1 lymphoid enhancer-binding factor 1;transcription factor 7 (T-cell specific, HMG-box);transcription factor 7-like 2 (T-cell specific, HMG-box);transcription factor 7-like 1 (T-cell specific, HMG-box) 2065 262 C20140709_OR012_04 C20140709_OR012_04 TB415746.[MT7]-ESAAINQILGR.3b5_1.heavy 439.253 / 616.342 515.0 35.663225173950195 41 18 10 5 8 5.909624107408515 16.921550031352492 0.04450225830078125 4 0.9869454871750633 10.789676947951953 515.0 1.197674418604651 4.0 - - - - - - - 0.0 1 0 LEF1;TCF7;TCF7L2;TCF7L1 lymphoid enhancer-binding factor 1;transcription factor 7 (T-cell specific, HMG-box);transcription factor 7-like 2 (T-cell specific, HMG-box);transcription factor 7-like 1 (T-cell specific, HMG-box) 2067 262 C20140709_OR012_04 C20140709_OR012_04 TB415746.[MT7]-ESAAINQILGR.3y4_1.heavy 439.253 / 458.309 1803.0 35.663225173950195 41 18 10 5 8 5.909624107408515 16.921550031352492 0.04450225830078125 4 0.9869454871750633 10.789676947951953 1803.0 13.951690600843577 1.0 - - - - - - - 129.0 3 3 LEF1;TCF7;TCF7L2;TCF7L1 lymphoid enhancer-binding factor 1;transcription factor 7 (T-cell specific, HMG-box);transcription factor 7-like 2 (T-cell specific, HMG-box);transcription factor 7-like 1 (T-cell specific, HMG-box) 2069 263 C20140709_OR012_04 C20140709_OR012_04 TB434305.[MT7]-LRAAEDELNIEAK[MT7].2b6_1.heavy 880.493 / 800.438 811.0 30.829225063323975 34 9 10 5 10 0.7817402804076325 80.36284654585631 0.04229927062988281 3 0.8196838065728638 2.8614885666438283 811.0 6.991379310344827 0.0 - - - - - - - 0.0 1 0 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 2071 263 C20140709_OR012_04 C20140709_OR012_04 TB434305.[MT7]-LRAAEDELNIEAK[MT7].2b7_1.heavy 880.493 / 929.481 695.0 30.829225063323975 34 9 10 5 10 0.7817402804076325 80.36284654585631 0.04229927062988281 3 0.8196838065728638 2.8614885666438283 695.0 8.97209051724138 0.0 - - - - - - - 0.0 1 0 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 2073 263 C20140709_OR012_04 C20140709_OR012_04 TB434305.[MT7]-LRAAEDELNIEAK[MT7].2b5_1.heavy 880.493 / 685.411 811.0 30.829225063323975 34 9 10 5 10 0.7817402804076325 80.36284654585631 0.04229927062988281 3 0.8196838065728638 2.8614885666438283 811.0 7.762040560654924 2.0 - - - - - - - 0.0 1 0 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 2075 263 C20140709_OR012_04 C20140709_OR012_04 TB434305.[MT7]-LRAAEDELNIEAK[MT7].2b9_1.heavy 880.493 / 1156.61 1390.0 30.829225063323975 34 9 10 5 10 0.7817402804076325 80.36284654585631 0.04229927062988281 3 0.8196838065728638 2.8614885666438283 1390.0 9.398290750997557 0.0 - - - - - - - 188.5 2 8 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 2077 264 C20140709_OR012_04 C20140709_OR012_04 TB415747.[MT7]-ASSLSK[MT7].2y4_1.heavy 440.771 / 578.363 767.0 17.92109966278076 26 17 2 5 2 4.6195022260589855 21.647354001886157 0.04400062561035156 12 0.9777147605308428 8.251708389667542 767.0 3.957843137254902 3.0 - - - - - - - 230.14285714285714 2 7 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2079 264 C20140709_OR012_04 C20140709_OR012_04 TB415747.[MT7]-ASSLSK[MT7].2y5_1.heavy 440.771 / 665.395 1227.0 17.92109966278076 26 17 2 5 2 4.6195022260589855 21.647354001886157 0.04400062561035156 12 0.9777147605308428 8.251708389667542 1227.0 14.351973516679399 0.0 - - - - - - - 142.42857142857142 2 7 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2081 264 C20140709_OR012_04 C20140709_OR012_04 TB415747.[MT7]-ASSLSK[MT7].2y3_2.heavy 440.771 / 246.169 614.0 17.92109966278076 26 17 2 5 2 4.6195022260589855 21.647354001886157 0.04400062561035156 12 0.9777147605308428 8.251708389667542 614.0 0.6286778398510241 16.0 - - - - - - - 291.7 6 10 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2083 264 C20140709_OR012_04 C20140709_OR012_04 TB415747.[MT7]-ASSLSK[MT7].2y3_1.heavy 440.771 / 491.331 384.0 17.92109966278076 26 17 2 5 2 4.6195022260589855 21.647354001886157 0.04400062561035156 12 0.9777147605308428 8.251708389667542 384.0 1.5858150403625548 11.0 - - - - - - - 0.0 1 0 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2085 265 C20140709_OR012_04 C20140709_OR012_04 TB416219.[MT7]-QAAVGQGDFHLLDHR.3y6_1.heavy 603.315 / 790.432 700.0 30.25629997253418 44 14 10 10 10 2.4774795243359553 27.61531743495278 0.0 3 0.9352370189070633 4.823105559026678 700.0 1.9004291845493562 4.0 - - - - - - - 0.0 1 0 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2087 265 C20140709_OR012_04 C20140709_OR012_04 TB416219.[MT7]-QAAVGQGDFHLLDHR.3b4_1.heavy 603.315 / 514.311 2915.0 30.25629997253418 44 14 10 10 10 2.4774795243359553 27.61531743495278 0.0 3 0.9352370189070633 4.823105559026678 2915.0 9.852325315216554 3.0 - - - - - - - 254.45454545454547 7 11 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2089 265 C20140709_OR012_04 C20140709_OR012_04 TB416219.[MT7]-QAAVGQGDFHLLDHR.3b8_1.heavy 603.315 / 871.439 4664.0 30.25629997253418 44 14 10 10 10 2.4774795243359553 27.61531743495278 0.0 3 0.9352370189070633 4.823105559026678 4664.0 71.75384615384615 0.0 - - - - - - - 233.33333333333334 9 6 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2091 265 C20140709_OR012_04 C20140709_OR012_04 TB416219.[MT7]-QAAVGQGDFHLLDHR.3y5_1.heavy 603.315 / 653.373 3148.0 30.25629997253418 44 14 10 10 10 2.4774795243359553 27.61531743495278 0.0 3 0.9352370189070633 4.823105559026678 3148.0 38.79888925571329 0.0 - - - - - - - 186.7 6 10 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2093 266 C20140709_OR012_04 C20140709_OR012_04 TB416357.[MT7]-LAGGNDVGIFVAGVLEDSPAAK[MT7].4b8_1.heavy 597.831 / 828.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1 tight junction protein 1 (zona occludens 1) 2095 266 C20140709_OR012_04 C20140709_OR012_04 TB416357.[MT7]-LAGGNDVGIFVAGVLEDSPAAK[MT7].4y4_1.heavy 597.831 / 530.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1 tight junction protein 1 (zona occludens 1) 2097 266 C20140709_OR012_04 C20140709_OR012_04 TB416357.[MT7]-LAGGNDVGIFVAGVLEDSPAAK[MT7].4b9_1.heavy 597.831 / 941.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1 tight junction protein 1 (zona occludens 1) 2099 266 C20140709_OR012_04 C20140709_OR012_04 TB416357.[MT7]-LAGGNDVGIFVAGVLEDSPAAK[MT7].4b6_1.heavy 597.831 / 672.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - TJP1 tight junction protein 1 (zona occludens 1) 2101 267 C20140709_OR012_04 C20140709_OR012_04 TB446638.[MT7]-RQQQQQLDQK[MT7].3y3_1.heavy 529.965 / 534.3 3010.0 16.218900680541992 44 14 10 10 10 1.8370470445619753 43.4759200504443 0.0 3 0.9440649846075473 5.193678326117186 3010.0 26.652910340627308 0.0 - - - - - - - 137.11111111111111 6 9 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2103 267 C20140709_OR012_04 C20140709_OR012_04 TB446638.[MT7]-RQQQQQLDQK[MT7].3b4_1.heavy 529.965 / 685.386 834.0 16.218900680541992 44 14 10 10 10 1.8370470445619753 43.4759200504443 0.0 3 0.9440649846075473 5.193678326117186 834.0 15.918881435994333 0.0 - - - - - - - 0.0 1 0 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2105 267 C20140709_OR012_04 C20140709_OR012_04 TB446638.[MT7]-RQQQQQLDQK[MT7].3b3_1.heavy 529.965 / 557.328 762.0 16.218900680541992 44 14 10 10 10 1.8370470445619753 43.4759200504443 0.0 3 0.9440649846075473 5.193678326117186 762.0 15.82608018097273 0.0 - - - - - - - 0.0 1 0 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2107 267 C20140709_OR012_04 C20140709_OR012_04 TB446638.[MT7]-RQQQQQLDQK[MT7].3y4_1.heavy 529.965 / 647.385 1596.0 16.218900680541992 44 14 10 10 10 1.8370470445619753 43.4759200504443 0.0 3 0.9440649846075473 5.193678326117186 1596.0 21.847621268183893 0.0 - - - - - - - 75.38461538461539 3 13 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2109 268 C20140709_OR012_04 C20140709_OR012_04 TB416353.[MT7]-LEPGEDFAVVQQEIIMMK[MT7].3y3_1.heavy 789.084 / 553.296 17082.0 48.216875076293945 39 13 10 6 10 1.17445412944565 50.79039923018483 0.03910064697265625 3 0.92741730825192 4.552849643478781 17082.0 100.2836964809384 0.0 - - - - - - - 231.3 34 10 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 2111 268 C20140709_OR012_04 C20140709_OR012_04 TB416353.[MT7]-LEPGEDFAVVQQEIIMMK[MT7].3b6_1.heavy 789.084 / 785.38 13781.0 48.216875076293945 39 13 10 6 10 1.17445412944565 50.79039923018483 0.03910064697265625 3 0.92741730825192 4.552849643478781 13781.0 79.30339090909091 0.0 - - - - - - - 238.55555555555554 27 9 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 2113 268 C20140709_OR012_04 C20140709_OR012_04 TB416353.[MT7]-LEPGEDFAVVQQEIIMMK[MT7].3b8_1.heavy 789.084 / 1003.49 19475.0 48.216875076293945 39 13 10 6 10 1.17445412944565 50.79039923018483 0.03910064697265625 3 0.92741730825192 4.552849643478781 19475.0 117.48298509286411 0.0 - - - - - - - 159.0 38 13 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 2115 268 C20140709_OR012_04 C20140709_OR012_04 TB416353.[MT7]-LEPGEDFAVVQQEIIMMK[MT7].3b7_1.heavy 789.084 / 932.448 6024.0 48.216875076293945 39 13 10 6 10 1.17445412944565 50.79039923018483 0.03910064697265625 3 0.92741730825192 4.552849643478781 6024.0 28.00503631961259 0.0 - - - - - - - 256.2 12 10 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 2117 269 C20140709_OR012_04 C20140709_OR012_04 TB416351.[MT7]-VLASMELEEPGMELEC[CAM]GVSSEAIPILPAQQR.3b9_1.heavy 1176.59 / 1146.58 2808.0 46.798301696777344 46 16 10 10 10 3.8615010584850564 25.896665179015123 0.0 3 0.9681181518288852 6.893344424623765 2808.0 27.92486187845304 0.0 - - - - - - - 201.22222222222223 5 9 C17orf53 chromosome 17 open reading frame 53 2119 269 C20140709_OR012_04 C20140709_OR012_04 TB416351.[MT7]-VLASMELEEPGMELEC[CAM]GVSSEAIPILPAQQR.3b6_1.heavy 1176.59 / 775.414 1902.0 46.798301696777344 46 16 10 10 10 3.8615010584850564 25.896665179015123 0.0 3 0.9681181518288852 6.893344424623765 1902.0 19.440331491712705 0.0 - - - - - - - 136.0 3 4 C17orf53 chromosome 17 open reading frame 53 2121 269 C20140709_OR012_04 C20140709_OR012_04 TB416351.[MT7]-VLASMELEEPGMELEC[CAM]GVSSEAIPILPAQQR.3y8_1.heavy 1176.59 / 922.547 4166.0 46.798301696777344 46 16 10 10 10 3.8615010584850564 25.896665179015123 0.0 3 0.9681181518288852 6.893344424623765 4166.0 55.910041891809854 0.0 - - - - - - - 206.0 8 11 C17orf53 chromosome 17 open reading frame 53 2123 269 C20140709_OR012_04 C20140709_OR012_04 TB416351.[MT7]-VLASMELEEPGMELEC[CAM]GVSSEAIPILPAQQR.3y5_1.heavy 1176.59 / 599.326 3079.0 46.798301696777344 46 16 10 10 10 3.8615010584850564 25.896665179015123 0.0 3 0.9681181518288852 6.893344424623765 3079.0 33.86004363283775 0.0 - - - - - - - 155.57142857142858 6 7 C17orf53 chromosome 17 open reading frame 53 2125 270 C20140709_OR012_04 C20140709_OR012_04 TB416211.[MT7]-K[MT7]PLNAFMLYMK[MT7].4b4_1.heavy 447.762 / 741.486 N/A N/A - - - - - - - - - 0.0 - - - - - - - LEF1;TCF7;TCF7L2;TCF7L1 lymphoid enhancer-binding factor 1;transcription factor 7 (T-cell specific, HMG-box);transcription factor 7-like 2 (T-cell specific, HMG-box);transcription factor 7-like 1 (T-cell specific, HMG-box) 2127 270 C20140709_OR012_04 C20140709_OR012_04 TB416211.[MT7]-K[MT7]PLNAFMLYMK[MT7].4b5_1.heavy 447.762 / 812.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - LEF1;TCF7;TCF7L2;TCF7L1 lymphoid enhancer-binding factor 1;transcription factor 7 (T-cell specific, HMG-box);transcription factor 7-like 2 (T-cell specific, HMG-box);transcription factor 7-like 1 (T-cell specific, HMG-box) 2129 270 C20140709_OR012_04 C20140709_OR012_04 TB416211.[MT7]-K[MT7]PLNAFMLYMK[MT7].4y3_1.heavy 447.762 / 585.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - LEF1;TCF7;TCF7L2;TCF7L1 lymphoid enhancer-binding factor 1;transcription factor 7 (T-cell specific, HMG-box);transcription factor 7-like 2 (T-cell specific, HMG-box);transcription factor 7-like 1 (T-cell specific, HMG-box) 2131 270 C20140709_OR012_04 C20140709_OR012_04 TB416211.[MT7]-K[MT7]PLNAFMLYMK[MT7].4b6_1.heavy 447.762 / 959.592 N/A N/A - - - - - - - - - 0.0 - - - - - - - LEF1;TCF7;TCF7L2;TCF7L1 lymphoid enhancer-binding factor 1;transcription factor 7 (T-cell specific, HMG-box);transcription factor 7-like 2 (T-cell specific, HMG-box);transcription factor 7-like 1 (T-cell specific, HMG-box) 2133 271 C20140709_OR012_04 C20140709_OR012_04 TB416352.[MT7]-SLEDIMVSAPQTPTHGALAK[MT7].4y5_1.heavy 589.321 / 603.395 6963.0 35.89525032043457 45 20 10 5 10 12.557844253912283 7.963150201424573 0.043697357177734375 3 0.9928578689139009 14.594514078861257 6963.0 19.431627906976743 0.0 - - - - - - - 258.0 13 9 C17orf53 chromosome 17 open reading frame 53 2135 271 C20140709_OR012_04 C20140709_OR012_04 TB416352.[MT7]-SLEDIMVSAPQTPTHGALAK[MT7].4y8_1.heavy 589.321 / 938.554 7737.0 35.89525032043457 45 20 10 5 10 12.557844253912283 7.963150201424573 0.043697357177734375 3 0.9928578689139009 14.594514078861257 7737.0 51.87988372093023 0.0 - - - - - - - 229.33333333333334 15 9 C17orf53 chromosome 17 open reading frame 53 2137 271 C20140709_OR012_04 C20140709_OR012_04 TB416352.[MT7]-SLEDIMVSAPQTPTHGALAK[MT7].4b5_1.heavy 589.321 / 702.379 18052.0 35.89525032043457 45 20 10 5 10 12.557844253912283 7.963150201424573 0.043697357177734375 3 0.9928578689139009 14.594514078861257 18052.0 62.17244739756368 0.0 - - - - - - - 186.33333333333334 36 9 C17orf53 chromosome 17 open reading frame 53 2139 271 C20140709_OR012_04 C20140709_OR012_04 TB416352.[MT7]-SLEDIMVSAPQTPTHGALAK[MT7].4b6_1.heavy 589.321 / 833.419 8252.0 35.89525032043457 45 20 10 5 10 12.557844253912283 7.963150201424573 0.043697357177734375 3 0.9928578689139009 14.594514078861257 8252.0 28.74644665928387 0.0 - - - - - - - 239.57142857142858 16 7 C17orf53 chromosome 17 open reading frame 53 2141 272 C20140709_OR012_04 C20140709_OR012_04 TB434402.[MT7]-SLAIMTEAQLSTAVIENPEMLK[MT7].3b4_1.heavy 893.151 / 529.347 2689.0 47.08679962158203 42 17 10 5 10 4.352255053926442 22.976594606923076 0.04360198974609375 3 0.9780608639768861 8.316783428675558 2689.0 2.9266166314038915 1.0 - - - - - - - 224.2 5 10 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2143 272 C20140709_OR012_04 C20140709_OR012_04 TB434402.[MT7]-SLAIMTEAQLSTAVIENPEMLK[MT7].3b5_1.heavy 893.151 / 660.387 2420.0 47.08679962158203 42 17 10 5 10 4.352255053926442 22.976594606923076 0.04360198974609375 3 0.9780608639768861 8.316783428675558 2420.0 11.225332023477915 0.0 - - - - - - - 231.66666666666666 4 12 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2145 272 C20140709_OR012_04 C20140709_OR012_04 TB434402.[MT7]-SLAIMTEAQLSTAVIENPEMLK[MT7].3b8_1.heavy 893.151 / 961.515 1344.0 47.08679962158203 42 17 10 5 10 4.352255053926442 22.976594606923076 0.04360198974609375 3 0.9780608639768861 8.316783428675558 1344.0 5.806703910614526 1.0 - - - - - - - 159.33333333333334 2 9 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2147 272 C20140709_OR012_04 C20140709_OR012_04 TB434402.[MT7]-SLAIMTEAQLSTAVIENPEMLK[MT7].3b7_1.heavy 893.151 / 890.477 1255.0 47.08679962158203 42 17 10 5 10 4.352255053926442 22.976594606923076 0.04360198974609375 3 0.9780608639768861 8.316783428675558 1255.0 3.9073768749384308 1.0 - - - - - - - 153.85714285714286 2 7 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2149 273 C20140709_OR012_04 C20140709_OR012_04 TB446848.[MT7]-SLAIMTEAQLSTAVIENPEMLK[MT7].4b7_1.heavy 670.115 / 890.477 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2151 273 C20140709_OR012_04 C20140709_OR012_04 TB446848.[MT7]-SLAIMTEAQLSTAVIENPEMLK[MT7].4b4_1.heavy 670.115 / 529.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2153 273 C20140709_OR012_04 C20140709_OR012_04 TB446848.[MT7]-SLAIMTEAQLSTAVIENPEMLK[MT7].4b5_1.heavy 670.115 / 660.387 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2155 273 C20140709_OR012_04 C20140709_OR012_04 TB446848.[MT7]-SLAIMTEAQLSTAVIENPEMLK[MT7].4y3_1.heavy 670.115 / 535.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2157 274 C20140709_OR012_04 C20140709_OR012_04 TB446785.[MT7]-LMPVSLSVQSPAALTAEK[MT7].3b4_1.heavy 710.741 / 585.355 1837.0 40.68360137939453 46 16 10 10 10 2.279798070666892 29.779711216055457 0.0 3 0.9624160321249998 6.34587299284716 1837.0 5.337934990628879 0.0 - - - - - - - 244.69230769230768 3 13 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2159 274 C20140709_OR012_04 C20140709_OR012_04 TB446785.[MT7]-LMPVSLSVQSPAALTAEK[MT7].3b5_1.heavy 710.741 / 672.387 2082.0 40.68360137939453 46 16 10 10 10 2.279798070666892 29.779711216055457 0.0 3 0.9624160321249998 6.34587299284716 2082.0 3.440641971074144 1.0 - - - - - - - 258.22222222222223 4 9 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2161 274 C20140709_OR012_04 C20140709_OR012_04 TB446785.[MT7]-LMPVSLSVQSPAALTAEK[MT7].3y4_1.heavy 710.741 / 592.342 1347.0 40.68360137939453 46 16 10 10 10 2.279798070666892 29.779711216055457 0.0 3 0.9624160321249998 6.34587299284716 1347.0 -0.3158732557726027 3.0 - - - - - - - 271.8888888888889 3 9 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2163 274 C20140709_OR012_04 C20140709_OR012_04 TB446785.[MT7]-LMPVSLSVQSPAALTAEK[MT7].3y8_1.heavy 710.741 / 944.553 1715.0 40.68360137939453 46 16 10 10 10 2.279798070666892 29.779711216055457 0.0 3 0.9624160321249998 6.34587299284716 1715.0 9.24 1.0 - - - - - - - 244.73333333333332 3 15 HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) 2165 275 C20140709_OR012_04 C20140709_OR012_04 TB415752.[MT7]-RTEALR.2b3_1.heavy 445.27 / 531.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2167 275 C20140709_OR012_04 C20140709_OR012_04 TB415752.[MT7]-RTEALR.2y5_1.heavy 445.27 / 589.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2169 275 C20140709_OR012_04 C20140709_OR012_04 TB415752.[MT7]-RTEALR.2b4_1.heavy 445.27 / 602.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2171 275 C20140709_OR012_04 C20140709_OR012_04 TB415752.[MT7]-RTEALR.2b5_1.heavy 445.27 / 715.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2173 276 C20140709_OR012_04 C20140709_OR012_04 TB415751.[MT7]-IETLIR.2b3_1.heavy 444.785 / 488.284 1578.0 32.80209922790527 40 17 10 5 8 7.10384879668337 14.076876192337847 0.044399261474609375 4 0.9752339251164414 7.825883294395893 1578.0 0.9589467943823898 1.0 - - - - - - - 307.1666666666667 3 6 SIM1 single-minded homolog 1 (Drosophila) 2175 276 C20140709_OR012_04 C20140709_OR012_04 TB415751.[MT7]-IETLIR.2y4_1.heavy 444.785 / 502.335 2104.0 32.80209922790527 40 17 10 5 8 7.10384879668337 14.076876192337847 0.044399261474609375 4 0.9752339251164414 7.825883294395893 2104.0 7.683969620253164 0.0 - - - - - - - 296.25 4 4 SIM1 single-minded homolog 1 (Drosophila) 2177 276 C20140709_OR012_04 C20140709_OR012_04 TB415751.[MT7]-IETLIR.2y5_1.heavy 444.785 / 631.377 3419.0 32.80209922790527 40 17 10 5 8 7.10384879668337 14.076876192337847 0.044399261474609375 4 0.9752339251164414 7.825883294395893 3419.0 5.663416508949445 0.0 - - - - - - - 197.5 6 4 SIM1 single-minded homolog 1 (Drosophila) 2179 276 C20140709_OR012_04 C20140709_OR012_04 TB415751.[MT7]-IETLIR.2b4_1.heavy 444.785 / 601.368 1578.0 32.80209922790527 40 17 10 5 8 7.10384879668337 14.076876192337847 0.044399261474609375 4 0.9752339251164414 7.825883294395893 1578.0 3.0 1.0 - - - - - - - 285.1666666666667 4 6 SIM1 single-minded homolog 1 (Drosophila) 2181 277 C20140709_OR012_04 C20140709_OR012_04 TB446344.[MT7]-LVQVVR.2y4_1.heavy 429.288 / 501.314 16063.0 27.757549285888672 44 18 10 6 10 4.759481665586352 21.01069129503209 0.03820037841796875 3 0.9878949345037867 11.205718944057526 16063.0 124.55631355932204 0.0 - - - - - - - 224.2 32 10 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2183 277 C20140709_OR012_04 C20140709_OR012_04 TB446344.[MT7]-LVQVVR.2b3_1.heavy 429.288 / 485.32 18190.0 27.757549285888672 44 18 10 6 10 4.759481665586352 21.01069129503209 0.03820037841796875 3 0.9878949345037867 11.205718944057526 18190.0 94.7672968826178 0.0 - - - - - - - 332.54545454545456 36 11 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2185 277 C20140709_OR012_04 C20140709_OR012_04 TB446344.[MT7]-LVQVVR.2y5_1.heavy 429.288 / 600.383 31536.0 27.757549285888672 44 18 10 6 10 4.759481665586352 21.01069129503209 0.03820037841796875 3 0.9878949345037867 11.205718944057526 31536.0 73.65769248292551 0.0 - - - - - - - 283.2 63 10 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2187 277 C20140709_OR012_04 C20140709_OR012_04 TB446344.[MT7]-LVQVVR.2b4_1.heavy 429.288 / 584.389 13465.0 27.757549285888672 44 18 10 6 10 4.759481665586352 21.01069129503209 0.03820037841796875 3 0.9878949345037867 11.205718944057526 13465.0 61.12713800223694 0.0 - - - - - - - 236.0 26 6 SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2189 278 C20140709_OR012_04 C20140709_OR012_04 TB446781.[MT7]-EFSFHNFNQAFGFMSR.3y7_1.heavy 703.996 / 815.387 N/A N/A - - - - - - - - - 0.0 - - - - - - - PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 2191 278 C20140709_OR012_04 C20140709_OR012_04 TB446781.[MT7]-EFSFHNFNQAFGFMSR.3y6_1.heavy 703.996 / 744.35 N/A N/A - - - - - - - - - 0.0 - - - - - - - PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 2193 278 C20140709_OR012_04 C20140709_OR012_04 TB446781.[MT7]-EFSFHNFNQAFGFMSR.3b4_1.heavy 703.996 / 655.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 2195 278 C20140709_OR012_04 C20140709_OR012_04 TB446781.[MT7]-EFSFHNFNQAFGFMSR.3b3_1.heavy 703.996 / 508.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 2197 279 C20140709_OR012_04 C20140709_OR012_04 TB446345.[MT7]-MIAPQR.2y4_1.heavy 430.251 / 471.267 1310.0 21.596799850463867 41 20 6 5 10 5.17457707853021 19.325250833523977 0.044399261474609375 3 0.9917301370010011 13.56167901788992 1310.0 12.686593976655939 0.0 - - - - - - - 199.83333333333334 2 6 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 2199 279 C20140709_OR012_04 C20140709_OR012_04 TB446345.[MT7]-MIAPQR.2b3_1.heavy 430.251 / 460.271 3274.0 21.596799850463867 41 20 6 5 10 5.17457707853021 19.325250833523977 0.044399261474609375 3 0.9917301370010011 13.56167901788992 3274.0 38.597155963302754 0.0 - - - - - - - 200.0 6 6 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 2201 279 C20140709_OR012_04 C20140709_OR012_04 TB446345.[MT7]-MIAPQR.2y5_1.heavy 430.251 / 584.352 4256.0 21.596799850463867 41 20 6 5 10 5.17457707853021 19.325250833523977 0.044399261474609375 3 0.9917301370010011 13.56167901788992 4256.0 69.11119266055046 0.0 - - - - - - - 261.8 8 5 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 2203 279 C20140709_OR012_04 C20140709_OR012_04 TB446345.[MT7]-MIAPQR.2b5_1.heavy 430.251 / 685.382 437.0 21.596799850463867 41 20 6 5 10 5.17457707853021 19.325250833523977 0.044399261474609375 3 0.9917301370010011 13.56167901788992 437.0 5.612844036697247 3.0 - - - - - - - 218.125 12 8 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 2205 280 C20140709_OR012_04 C20140709_OR012_04 TB416225.[MT7]-TSNYLISVDPTDLSR.2y9_1.heavy 912.977 / 989.49 5109.0 38.1260986328125 43 13 10 10 10 1.9464766229566741 51.374878496152306 0.0 3 0.9287545424477034 4.595904170355167 5109.0 4.646069735707708 1.0 - - - - - - - 228.5 11 6 TUB tubby homolog (mouse) 2207 280 C20140709_OR012_04 C20140709_OR012_04 TB416225.[MT7]-TSNYLISVDPTDLSR.2b4_1.heavy 912.977 / 610.295 5732.0 38.1260986328125 43 13 10 10 10 1.9464766229566741 51.374878496152306 0.0 3 0.9287545424477034 4.595904170355167 5732.0 7.778240282344359 0.0 - - - - - - - 228.5 11 6 TUB tubby homolog (mouse) 2209 280 C20140709_OR012_04 C20140709_OR012_04 TB416225.[MT7]-TSNYLISVDPTDLSR.2y6_1.heavy 912.977 / 688.362 9719.0 38.1260986328125 43 13 10 10 10 1.9464766229566741 51.374878496152306 0.0 3 0.9287545424477034 4.595904170355167 9719.0 30.589159591818316 0.0 - - - - - - - 373.7142857142857 19 7 TUB tubby homolog (mouse) 2211 280 C20140709_OR012_04 C20140709_OR012_04 TB416225.[MT7]-TSNYLISVDPTDLSR.2b5_1.heavy 912.977 / 723.379 4860.0 38.1260986328125 43 13 10 10 10 1.9464766229566741 51.374878496152306 0.0 3 0.9287545424477034 4.595904170355167 4860.0 35.913253012048195 0.0 - - - - - - - 218.125 9 8 TUB tubby homolog (mouse) 2213 281 C20140709_OR012_04 C20140709_OR012_04 TB416369.[MT7]-EVINYEDIEALIGPPPHGPK[MT7].4y5_1.heavy 619.839 / 679.401 2854.0 44.121399879455566 43 17 10 6 10 4.380561071761199 22.82812597788875 0.037998199462890625 3 0.9780488667452697 8.314501999333809 2854.0 0.12391713608070581 2.0 - - - - - - - 255.73333333333332 8 15 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 2215 281 C20140709_OR012_04 C20140709_OR012_04 TB416369.[MT7]-EVINYEDIEALIGPPPHGPK[MT7].4b7_1.heavy 619.839 / 1007.48 8956.0 44.121399879455566 43 17 10 6 10 4.380561071761199 22.82812597788875 0.037998199462890625 3 0.9780488667452697 8.314501999333809 8956.0 6.434281567489115 0.0 - - - - - - - 229.5 17 6 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 2217 281 C20140709_OR012_04 C20140709_OR012_04 TB416369.[MT7]-EVINYEDIEALIGPPPHGPK[MT7].4b4_1.heavy 619.839 / 600.347 6004.0 44.121399879455566 43 17 10 6 10 4.380561071761199 22.82812597788875 0.037998199462890625 3 0.9780488667452697 8.314501999333809 6004.0 2.680655980159046 0.0 - - - - - - - 317.1111111111111 12 9 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 2219 281 C20140709_OR012_04 C20140709_OR012_04 TB416369.[MT7]-EVINYEDIEALIGPPPHGPK[MT7].4y6_1.heavy 619.839 / 776.453 4134.0 44.121399879455566 43 17 10 6 10 4.380561071761199 22.82812597788875 0.037998199462890625 3 0.9780488667452697 8.314501999333809 4134.0 4.9902160101651845 0.0 - - - - - - - 306.22222222222223 8 9 SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) 2221 282 C20140709_OR012_04 C20140709_OR012_04 TB446646.[MT7]-VLLQRVDELEK[MT7].3y10_2.heavy 543.997 / 693.907 13763.0 33.97990036010742 33 11 4 10 8 1.33709167624363 44.00545563677686 0.0 4 0.8770257521481537 3.482577679830841 13763.0 -2.2608624229979455 0.0 - - - - - - - 292.4 27 5 QRICH2 glutamine rich 2 2223 282 C20140709_OR012_04 C20140709_OR012_04 TB446646.[MT7]-VLLQRVDELEK[MT7].3y3_1.heavy 543.997 / 533.341 6333.0 33.97990036010742 33 11 4 10 8 1.33709167624363 44.00545563677686 0.0 4 0.8770257521481537 3.482577679830841 6333.0 -1.5572950819672151 1.0 - - - - - - - 261.14285714285717 47 7 QRICH2 glutamine rich 2 2225 282 C20140709_OR012_04 C20140709_OR012_04 TB446646.[MT7]-VLLQRVDELEK[MT7].3y4_1.heavy 543.997 / 662.384 8160.0 33.97990036010742 33 11 4 10 8 1.33709167624363 44.00545563677686 0.0 4 0.8770257521481537 3.482577679830841 8160.0 -1.3377049180327845 0.0 - - - - - - - 183.0 16 4 QRICH2 glutamine rich 2 2227 282 C20140709_OR012_04 C20140709_OR012_04 TB446646.[MT7]-VLLQRVDELEK[MT7].3y5_1.heavy 543.997 / 777.411 2070.0 33.97990036010742 33 11 4 10 8 1.33709167624363 44.00545563677686 0.0 4 0.8770257521481537 3.482577679830841 2070.0 -0.3402739726027404 0.0 - - - - - - - 213.25 4 4 QRICH2 glutamine rich 2 2229 283 C20140709_OR012_04 C20140709_OR012_04 TB416220.[MT7]-QAAVGQGDFHLLDHR.4y4_1.heavy 452.738 / 540.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2231 283 C20140709_OR012_04 C20140709_OR012_04 TB416220.[MT7]-QAAVGQGDFHLLDHR.4y5_1.heavy 452.738 / 653.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2233 283 C20140709_OR012_04 C20140709_OR012_04 TB416220.[MT7]-QAAVGQGDFHLLDHR.4b4_1.heavy 452.738 / 514.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2235 283 C20140709_OR012_04 C20140709_OR012_04 TB416220.[MT7]-QAAVGQGDFHLLDHR.4y6_1.heavy 452.738 / 790.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) 2237 284 C20140709_OR012_04 C20140709_OR012_04 TB416360.[MT7]-NFQIIHGNDPDYIVMQFGR.3y6_1.heavy 803.403 / 737.376 4158.0 41.58085060119629 41 15 10 6 10 1.7663195059842658 45.13986915342808 0.033298492431640625 3 0.959146462265841 6.0849609475346496 4158.0 30.131549699298365 0.0 - - - - - - - 182.11111111111111 8 9 TUB tubby homolog (mouse) 2239 284 C20140709_OR012_04 C20140709_OR012_04 TB416360.[MT7]-NFQIIHGNDPDYIVMQFGR.3b4_1.heavy 803.403 / 647.363 8097.0 41.58085060119629 41 15 10 6 10 1.7663195059842658 45.13986915342808 0.033298492431640625 3 0.959146462265841 6.0849609475346496 8097.0 100.14826567801934 0.0 - - - - - - - 163.9 16 10 TUB tubby homolog (mouse) 2241 284 C20140709_OR012_04 C20140709_OR012_04 TB416360.[MT7]-NFQIIHGNDPDYIVMQFGR.3b3_1.heavy 803.403 / 534.279 8535.0 41.58085060119629 41 15 10 6 10 1.7663195059842658 45.13986915342808 0.033298492431640625 3 0.959146462265841 6.0849609475346496 8535.0 49.897756129323085 0.0 - - - - - - - 218.75 17 8 TUB tubby homolog (mouse) 2243 284 C20140709_OR012_04 C20140709_OR012_04 TB416360.[MT7]-NFQIIHGNDPDYIVMQFGR.3y10_1.heavy 803.403 / 1225.6 4705.0 41.58085060119629 41 15 10 6 10 1.7663195059842658 45.13986915342808 0.033298492431640625 3 0.959146462265841 6.0849609475346496 4705.0 41.87018348623853 0.0 - - - - - - - 170.0 9 9 TUB tubby homolog (mouse)