Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140710_OR014_02 C20140710_OR014_02 TB424828.[MT7]-IRQLPSGNK[MT7].3y3_1.heavy 434.27 / 462.279 5856.0 21.171199798583984 50 20 10 10 10 6.775577292886702 14.758890007052889 0.0 3 0.9920334301885813 13.81776953426492 5856.0 39.82998888525662 1.0 - - - - - - - 242.77777777777777 11 9 GRIK1 glutamate receptor, ionotropic, kainate 1 3 1 C20140710_OR014_02 C20140710_OR014_02 TB424828.[MT7]-IRQLPSGNK[MT7].3b4_1.heavy 434.27 / 655.437 2360.0 21.171199798583984 50 20 10 10 10 6.775577292886702 14.758890007052889 0.0 3 0.9920334301885813 13.81776953426492 2360.0 22.088776444929117 0.0 - - - - - - - 145.66666666666666 4 3 GRIK1 glutamate receptor, ionotropic, kainate 1 5 1 C20140710_OR014_02 C20140710_OR014_02 TB424828.[MT7]-IRQLPSGNK[MT7].3y4_1.heavy 434.27 / 549.311 9352.0 21.171199798583984 50 20 10 10 10 6.775577292886702 14.758890007052889 0.0 3 0.9920334301885813 13.81776953426492 9352.0 206.6039540229885 0.0 - - - - - - - 192.0 18 5 GRIK1 glutamate receptor, ionotropic, kainate 1 7 1 C20140710_OR014_02 C20140710_OR014_02 TB424828.[MT7]-IRQLPSGNK[MT7].3y5_1.heavy 434.27 / 646.364 4894.0 21.171199798583984 50 20 10 10 10 6.775577292886702 14.758890007052889 0.0 3 0.9920334301885813 13.81776953426492 4894.0 62.37413091164342 0.0 - - - - - - - 130.75 9 4 GRIK1 glutamate receptor, ionotropic, kainate 1 9 2 C20140710_OR014_02 C20140710_OR014_02 TB433507.[MT7]-SK[MT7]EPAVGSR.2b3_1.heavy 609.856 / 633.381 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 11 2 C20140710_OR014_02 C20140710_OR014_02 TB433507.[MT7]-SK[MT7]EPAVGSR.2y6_1.heavy 609.856 / 586.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 13 2 C20140710_OR014_02 C20140710_OR014_02 TB433507.[MT7]-SK[MT7]EPAVGSR.2b5_1.heavy 609.856 / 801.471 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 15 2 C20140710_OR014_02 C20140710_OR014_02 TB433507.[MT7]-SK[MT7]EPAVGSR.2y7_1.heavy 609.856 / 715.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 17 3 C20140710_OR014_02 C20140710_OR014_02 TB424829.[MT7]-NIEEPQGVK[MT7].2b3_1.heavy 651.369 / 501.279 3380.0 22.986000061035156 43 13 10 10 10 1.3448685293187952 49.57084932569702 0.0 3 0.9005357745294509 3.8802676694955 3380.0 18.13658536585366 0.0 - - - - - - - 234.0 6 7 SLC26A4 solute carrier family 26, member 4 19 3 C20140710_OR014_02 C20140710_OR014_02 TB424829.[MT7]-NIEEPQGVK[MT7].2y8_1.heavy 651.369 / 1043.59 1127.0 22.986000061035156 43 13 10 10 10 1.3448685293187952 49.57084932569702 0.0 3 0.9005357745294509 3.8802676694955 1127.0 5.2854026601353885 1.0 - - - - - - - 179.0 2 4 SLC26A4 solute carrier family 26, member 4 21 3 C20140710_OR014_02 C20140710_OR014_02 TB424829.[MT7]-NIEEPQGVK[MT7].2y5_1.heavy 651.369 / 672.416 3278.0 22.986000061035156 43 13 10 10 10 1.3448685293187952 49.57084932569702 0.0 3 0.9005357745294509 3.8802676694955 3278.0 25.37787129578136 0.0 - - - - - - - 160.71428571428572 6 7 SLC26A4 solute carrier family 26, member 4 23 3 C20140710_OR014_02 C20140710_OR014_02 TB424829.[MT7]-NIEEPQGVK[MT7].2b4_1.heavy 651.369 / 630.321 3175.0 22.986000061035156 43 13 10 10 10 1.3448685293187952 49.57084932569702 0.0 3 0.9005357745294509 3.8802676694955 3175.0 16.23697068403909 0.0 - - - - - - - 255.875 6 8 SLC26A4 solute carrier family 26, member 4 25 4 C20140710_OR014_02 C20140710_OR014_02 TB433608.[MT7]-QVGC[CAM]DHDYVSLR.3y7_1.heavy 531.592 / 889.453 992.0 25.939899444580078 46 16 10 10 10 2.273881246410054 37.918029271363025 0.0 3 0.9641584856579337 6.499252920845096 992.0 3.1999999999999993 0.0 - - - - - - - 0.0 1 0 OVCH1 ovochymase 1 27 4 C20140710_OR014_02 C20140710_OR014_02 TB433608.[MT7]-QVGC[CAM]DHDYVSLR.3y6_1.heavy 531.592 / 752.394 4836.0 25.939899444580078 46 16 10 10 10 2.273881246410054 37.918029271363025 0.0 3 0.9641584856579337 6.499252920845096 4836.0 33.150000000000006 0.0 - - - - - - - 310.0 9 6 OVCH1 ovochymase 1 29 4 C20140710_OR014_02 C20140710_OR014_02 TB433608.[MT7]-QVGC[CAM]DHDYVSLR.3b5_1.heavy 531.592 / 704.315 1612.0 25.939899444580078 46 16 10 10 10 2.273881246410054 37.918029271363025 0.0 3 0.9641584856579337 6.499252920845096 1612.0 3.0645588235294117 1.0 - - - - - - - 248.0 4 7 OVCH1 ovochymase 1 31 4 C20140710_OR014_02 C20140710_OR014_02 TB433608.[MT7]-QVGC[CAM]DHDYVSLR.3y5_1.heavy 531.592 / 637.367 4216.0 25.939899444580078 46 16 10 10 10 2.273881246410054 37.918029271363025 0.0 3 0.9641584856579337 6.499252920845096 4216.0 43.010000000000005 0.0 - - - - - - - 148.8 8 5 OVCH1 ovochymase 1 33 5 C20140710_OR014_02 C20140710_OR014_02 TB433609.[MT7]-TLVPILEWLPK[MT7].3y3_1.heavy 533.004 / 501.352 3339.0 51.642523765563965 28 3 10 5 10 0.744386441187553 76.82187363548788 0.043300628662109375 3 0.5330616108657814 1.730479538646632 3339.0 37.55346590909091 1.0 - - - - - - - 263.3333333333333 6 3 SLC26A4 solute carrier family 26, member 4 35 5 C20140710_OR014_02 C20140710_OR014_02 TB433609.[MT7]-TLVPILEWLPK[MT7].3b6_1.heavy 533.004 / 781.53 1582.0 51.642523765563965 28 3 10 5 10 0.744386441187553 76.82187363548788 0.043300628662109375 3 0.5330616108657814 1.730479538646632 1582.0 -1.2 1.0 - - - - - - - 154.0 3 4 SLC26A4 solute carrier family 26, member 4 37 5 C20140710_OR014_02 C20140710_OR014_02 TB433609.[MT7]-TLVPILEWLPK[MT7].3b5_1.heavy 533.004 / 668.446 264.0 51.642523765563965 28 3 10 5 10 0.744386441187553 76.82187363548788 0.043300628662109375 3 0.5330616108657814 1.730479538646632 264.0 1.7999999999999998 1.0 - - - - - - - 0.0 0 0 SLC26A4 solute carrier family 26, member 4 39 5 C20140710_OR014_02 C20140710_OR014_02 TB433609.[MT7]-TLVPILEWLPK[MT7].3b7_1.heavy 533.004 / 910.573 1494.0 51.642523765563965 28 3 10 5 10 0.744386441187553 76.82187363548788 0.043300628662109375 3 0.5330616108657814 1.730479538646632 1494.0 -0.9274702534919813 2.0 - - - - - - - 176.0 3 3 SLC26A4 solute carrier family 26, member 4 41 6 C20140710_OR014_02 C20140710_OR014_02 TB424824.[MT7]-REMVAQQHR.2b8_1.heavy 649.847 / 1124.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC55908 hepatocellular carcinoma-associated gene TD26 43 6 C20140710_OR014_02 C20140710_OR014_02 TB424824.[MT7]-REMVAQQHR.2y8_1.heavy 649.847 / 998.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC55908 hepatocellular carcinoma-associated gene TD26 45 6 C20140710_OR014_02 C20140710_OR014_02 TB424824.[MT7]-REMVAQQHR.2b7_1.heavy 649.847 / 987.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC55908 hepatocellular carcinoma-associated gene TD26 47 6 C20140710_OR014_02 C20140710_OR014_02 TB424824.[MT7]-REMVAQQHR.2y7_1.heavy 649.847 / 869.441 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC55908 hepatocellular carcinoma-associated gene TD26 49 7 C20140710_OR014_02 C20140710_OR014_02 TB445782.[MT7]-INLFDSFEASR.2y8_1.heavy 721.873 / 958.427 2061.0 42.863399505615234 46 16 10 10 10 2.327442059040855 34.31950695105189 0.0 3 0.965492783298886 6.624461336294582 2061.0 12.468198347107437 0.0 - - - - - - - 201.88888888888889 4 9 GRIK1 glutamate receptor, ionotropic, kainate 1 51 7 C20140710_OR014_02 C20140710_OR014_02 TB445782.[MT7]-INLFDSFEASR.2y6_1.heavy 721.873 / 696.331 3515.0 42.863399505615234 46 16 10 10 10 2.327442059040855 34.31950695105189 0.0 3 0.965492783298886 6.624461336294582 3515.0 37.473966942148756 0.0 - - - - - - - 188.33333333333334 7 9 GRIK1 glutamate receptor, ionotropic, kainate 1 53 7 C20140710_OR014_02 C20140710_OR014_02 TB445782.[MT7]-INLFDSFEASR.2y10_1.heavy 721.873 / 1185.55 1939.0 42.863399505615234 46 16 10 10 10 2.327442059040855 34.31950695105189 0.0 3 0.965492783298886 6.624461336294582 1939.0 20.030991735537192 0.0 - - - - - - - 161.33333333333334 3 3 GRIK1 glutamate receptor, ionotropic, kainate 1 55 7 C20140710_OR014_02 C20140710_OR014_02 TB445782.[MT7]-INLFDSFEASR.2y7_1.heavy 721.873 / 811.358 1333.0 42.863399505615234 46 16 10 10 10 2.327442059040855 34.31950695105189 0.0 3 0.965492783298886 6.624461336294582 1333.0 12.481364090455 0.0 - - - - - - - 303.1666666666667 2 6 GRIK1 glutamate receptor, ionotropic, kainate 1 57 8 C20140710_OR014_02 C20140710_OR014_02 TB433503.[MT7]-GGC[CAM]GSC[CAM]GGSK[MT7].2y6_1.heavy 607.778 / 739.352 65.0 12.85290002822876 43 16 10 7 10 3.432742454413473 23.21070551738327 0.026800155639648438 3 0.9668537244053218 6.759865274591347 65.0 -1.1999999999999997 1.0 - - - - - - - 0.0 0 0 KRTAP5-1;KRTAP5-3;KRTAP5-4;KRTAP5-10;KRTAP5-5;KRTAP5-2;KRTAP5-6;KRTAP5-7 keratin associated protein 5-1;keratin associated protein 5-3;keratin associated protein 5-4;keratin associated protein 5-10;keratin associated protein 5-5;keratin associated protein 5-2;keratin associated protein 5-6;keratin associated protein 5-7 59 8 C20140710_OR014_02 C20140710_OR014_02 TB433503.[MT7]-GGC[CAM]GSC[CAM]GGSK[MT7].2y5_1.heavy 607.778 / 652.32 142.0 12.85290002822876 43 16 10 7 10 3.432742454413473 23.21070551738327 0.026800155639648438 3 0.9668537244053218 6.759865274591347 142.0 16.384615384615387 0.0 - - - - - - - 0.0 0 0 KRTAP5-1;KRTAP5-3;KRTAP5-4;KRTAP5-10;KRTAP5-5;KRTAP5-2;KRTAP5-6;KRTAP5-7 keratin associated protein 5-1;keratin associated protein 5-3;keratin associated protein 5-4;keratin associated protein 5-10;keratin associated protein 5-5;keratin associated protein 5-2;keratin associated protein 5-6;keratin associated protein 5-7 61 8 C20140710_OR014_02 C20140710_OR014_02 TB433503.[MT7]-GGC[CAM]GSC[CAM]GGSK[MT7].2y9_1.heavy 607.778 / 1013.43 181.0 12.85290002822876 43 16 10 7 10 3.432742454413473 23.21070551738327 0.026800155639648438 3 0.9668537244053218 6.759865274591347 181.0 20.316666666666666 1.0 - - - - - - - 0.0 0 0 KRTAP5-1;KRTAP5-3;KRTAP5-4;KRTAP5-10;KRTAP5-5;KRTAP5-2;KRTAP5-6;KRTAP5-7 keratin associated protein 5-1;keratin associated protein 5-3;keratin associated protein 5-4;keratin associated protein 5-10;keratin associated protein 5-5;keratin associated protein 5-2;keratin associated protein 5-6;keratin associated protein 5-7 63 8 C20140710_OR014_02 C20140710_OR014_02 TB433503.[MT7]-GGC[CAM]GSC[CAM]GGSK[MT7].2y7_1.heavy 607.778 / 796.374 226.0 12.85290002822876 43 16 10 7 10 3.432742454413473 23.21070551738327 0.026800155639648438 3 0.9668537244053218 6.759865274591347 226.0 41.036842105263155 0.0 - - - - - - - 0.0 0 0 KRTAP5-1;KRTAP5-3;KRTAP5-4;KRTAP5-10;KRTAP5-5;KRTAP5-2;KRTAP5-6;KRTAP5-7 keratin associated protein 5-1;keratin associated protein 5-3;keratin associated protein 5-4;keratin associated protein 5-10;keratin associated protein 5-5;keratin associated protein 5-2;keratin associated protein 5-6;keratin associated protein 5-7 65 9 C20140710_OR014_02 C20140710_OR014_02 TB424968.[MT7]-VVSIEQGGLLRPER.3y11_2.heavy 566.332 / 634.359 1914.0 32.96760177612305 38 20 0 10 8 12.741109531345264 7.848610025208814 0.0 4 0.9979892596625091 27.51766483202841 1914.0 6.9757271527374485 0.0 - - - - - - - 223.66666666666666 3 9 HSF4 heat shock transcription factor 4 67 9 C20140710_OR014_02 C20140710_OR014_02 TB424968.[MT7]-VVSIEQGGLLRPER.3y12_2.heavy 566.332 / 677.875 5944.0 32.96760177612305 38 20 0 10 8 12.741109531345264 7.848610025208814 0.0 4 0.9979892596625091 27.51766483202841 5944.0 61.22014790064614 0.0 - - - - - - - 151.0 11 2 HSF4 heat shock transcription factor 4 69 9 C20140710_OR014_02 C20140710_OR014_02 TB424968.[MT7]-VVSIEQGGLLRPER.3y9_2.heavy 566.332 / 513.296 2518.0 32.96760177612305 38 20 0 10 8 12.741109531345264 7.848610025208814 0.0 4 0.9979892596625091 27.51766483202841 2518.0 5.206782464846982 2.0 - - - - - - - 259.0 5 7 HSF4 heat shock transcription factor 4 71 9 C20140710_OR014_02 C20140710_OR014_02 TB424968.[MT7]-VVSIEQGGLLRPER.3y13_2.heavy 566.332 / 727.41 9369.0 32.96760177612305 38 20 0 10 8 12.741109531345264 7.848610025208814 0.0 4 0.9979892596625091 27.51766483202841 9369.0 114.89690632140137 1.0 - - - - - - - 257.44444444444446 160 9 HSF4 heat shock transcription factor 4 73 10 C20140710_OR014_02 C20140710_OR014_02 TB433600.[MT7]-LAVSPVC[CAM]MEDK[MT7].2y8_1.heavy 768.904 / 1109.51 4656.0 32.23074913024902 39 13 10 6 10 1.220726471853358 50.1727968494577 0.037899017333984375 3 0.9154340514707437 4.21362106393093 4656.0 39.04 0.0 - - - - - - - 194.0 9 6 FAM150B family with sequence similarity 150, member B 75 10 C20140710_OR014_02 C20140710_OR014_02 TB433600.[MT7]-LAVSPVC[CAM]MEDK[MT7].2y5_1.heavy 768.904 / 826.356 1843.0 32.23074913024902 39 13 10 6 10 1.220726471853358 50.1727968494577 0.037899017333984375 3 0.9154340514707437 4.21362106393093 1843.0 3.3249999999999997 0.0 - - - - - - - 277.14285714285717 3 7 FAM150B family with sequence similarity 150, member B 77 10 C20140710_OR014_02 C20140710_OR014_02 TB433600.[MT7]-LAVSPVC[CAM]MEDK[MT7].2b4_1.heavy 768.904 / 515.331 5238.0 32.23074913024902 39 13 10 6 10 1.220726471853358 50.1727968494577 0.037899017333984375 3 0.9154340514707437 4.21362106393093 5238.0 57.42 0.0 - - - - - - - 194.0 10 8 FAM150B family with sequence similarity 150, member B 79 10 C20140710_OR014_02 C20140710_OR014_02 TB433600.[MT7]-LAVSPVC[CAM]MEDK[MT7].2y7_1.heavy 768.904 / 1022.48 6208.0 32.23074913024902 39 13 10 6 10 1.220726471853358 50.1727968494577 0.037899017333984375 3 0.9154340514707437 4.21362106393093 6208.0 122.88 0.0 - - - - - - - 194.0 12 5 FAM150B family with sequence similarity 150, member B 81 11 C20140710_OR014_02 C20140710_OR014_02 TB424965.[MT7]-ATVSDTC[CAM]EEVEPSLLEILPK[MT7].3b9_1.heavy 840.112 / 1137.48 4746.0 44.874698638916016 41 11 10 10 10 0.8300743407494492 72.69331150561118 0.0 3 0.8749474580414747 3.452890580714808 4746.0 5.416847539419785 1.0 - - - - - - - 208.71428571428572 9 7 MPL myeloproliferative leukemia virus oncogene 83 11 C20140710_OR014_02 C20140710_OR014_02 TB424965.[MT7]-ATVSDTC[CAM]EEVEPSLLEILPK[MT7].3y3_1.heavy 840.112 / 501.352 4381.0 44.874698638916016 41 11 10 10 10 0.8300743407494492 72.69331150561118 0.0 3 0.8749474580414747 3.452890580714808 4381.0 8.64493429161441 0.0 - - - - - - - 167.5 8 8 MPL myeloproliferative leukemia virus oncogene 85 11 C20140710_OR014_02 C20140710_OR014_02 TB424965.[MT7]-ATVSDTC[CAM]EEVEPSLLEILPK[MT7].3b6_1.heavy 840.112 / 719.369 1582.0 44.874698638916016 41 11 10 10 10 0.8300743407494492 72.69331150561118 0.0 3 0.8749474580414747 3.452890580714808 1582.0 4.970143737166324 0.0 - - - - - - - 304.375 3 8 MPL myeloproliferative leukemia virus oncogene 87 11 C20140710_OR014_02 C20140710_OR014_02 TB424965.[MT7]-ATVSDTC[CAM]EEVEPSLLEILPK[MT7].3b5_1.heavy 840.112 / 618.321 2677.0 44.874698638916016 41 11 10 10 10 0.8300743407494492 72.69331150561118 0.0 3 0.8749474580414747 3.452890580714808 2677.0 4.954988473423179 1.0 - - - - - - - 289.125 6 8 MPL myeloproliferative leukemia virus oncogene 89 12 C20140710_OR014_02 C20140710_OR014_02 TB433607.[MT7]-LFFPLHLWVK[MT7].2y4_1.heavy 794.486 / 689.447 1068.0 48.04397487640381 39 13 10 6 10 1.2664130381183134 52.93609178339433 0.039501190185546875 3 0.9163012739257511 4.2357098576188195 1068.0 3.0 1.0 - - - - - - - 316.6666666666667 2 3 MPL myeloproliferative leukemia virus oncogene 91 12 C20140710_OR014_02 C20140710_OR014_02 TB433607.[MT7]-LFFPLHLWVK[MT7].2b3_1.heavy 794.486 / 552.33 1898.0 48.04397487640381 39 13 10 6 10 1.2664130381183134 52.93609178339433 0.039501190185546875 3 0.9163012739257511 4.2357098576188195 1898.0 9.176884564352058 0.0 - - - - - - - 158.33333333333334 3 3 MPL myeloproliferative leukemia virus oncogene 93 12 C20140710_OR014_02 C20140710_OR014_02 TB433607.[MT7]-LFFPLHLWVK[MT7].2y3_1.heavy 794.486 / 576.363 1305.0 48.04397487640381 39 13 10 6 10 1.2664130381183134 52.93609178339433 0.039501190185546875 3 0.9163012739257511 4.2357098576188195 1305.0 2.055820009819199 2.0 - - - - - - - 197.66666666666666 3 3 MPL myeloproliferative leukemia virus oncogene 95 12 C20140710_OR014_02 C20140710_OR014_02 TB433607.[MT7]-LFFPLHLWVK[MT7].2y7_1.heavy 794.486 / 1036.64 2373.0 48.04397487640381 39 13 10 6 10 1.2664130381183134 52.93609178339433 0.039501190185546875 3 0.9163012739257511 4.2357098576188195 2373.0 11.13176966292135 0.0 - - - - - - - 119.0 4 2 MPL myeloproliferative leukemia virus oncogene 97 13 C20140710_OR014_02 C20140710_OR014_02 TB425085.[MT7]-FLENLTFLDLSSNQLMR.3y7_1.heavy 729.053 / 835.409 1431.0 51.19559860229492 42 12 10 10 10 1.0137018540480653 65.7655566086255 0.0 3 0.8861180834741349 3.6218011788795765 1431.0 3.442927374301676 0.0 - - - - - - - 253.33333333333334 2 6 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 99 13 C20140710_OR014_02 C20140710_OR014_02 TB425085.[MT7]-FLENLTFLDLSSNQLMR.3b4_1.heavy 729.053 / 648.347 1073.0 51.19559860229492 42 12 10 10 10 1.0137018540480653 65.7655566086255 0.0 3 0.8861180834741349 3.6218011788795765 1073.0 7.193296089385474 0.0 - - - - - - - 178.75 2 8 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 101 13 C20140710_OR014_02 C20140710_OR014_02 TB425085.[MT7]-FLENLTFLDLSSNQLMR.3b3_1.heavy 729.053 / 534.304 537.0 51.19559860229492 42 12 10 10 10 1.0137018540480653 65.7655566086255 0.0 3 0.8861180834741349 3.6218011788795765 537.0 5.79 5.0 - - - - - - - 223.5 2 6 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 103 13 C20140710_OR014_02 C20140710_OR014_02 TB425085.[MT7]-FLENLTFLDLSSNQLMR.3y9_1.heavy 729.053 / 1063.52 1878.0 51.19559860229492 42 12 10 10 10 1.0137018540480653 65.7655566086255 0.0 3 0.8861180834741349 3.6218011788795765 1878.0 14.014925373134329 0.0 - - - - - - - 89.0 3 1 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 105 14 C20140710_OR014_02 C20140710_OR014_02 TB424964.[MT7]-AFSQFLRPLIAK[MT7].3y10_2.heavy 560.346 / 658.912 2930.0 42.23720169067383 47 17 10 10 10 3.6379265454854464 21.61873744282224 0.0 3 0.9765754299846209 8.047762069266224 2930.0 18.496333770152074 0.0 - - - - - - - 261.6666666666667 5 6 CHD5 chromodomain helicase DNA binding protein 5 107 14 C20140710_OR014_02 C20140710_OR014_02 TB424964.[MT7]-AFSQFLRPLIAK[MT7].3b4_1.heavy 560.346 / 578.305 2407.0 42.23720169067383 47 17 10 10 10 3.6379265454854464 21.61873744282224 0.0 3 0.9765754299846209 8.047762069266224 2407.0 17.089037580934328 0.0 - - - - - - - 244.33333333333334 4 6 CHD5 chromodomain helicase DNA binding protein 5 109 14 C20140710_OR014_02 C20140710_OR014_02 TB424964.[MT7]-AFSQFLRPLIAK[MT7].3y11_2.heavy 560.346 / 732.446 5755.0 42.23720169067383 47 17 10 10 10 3.6379265454854464 21.61873744282224 0.0 3 0.9765754299846209 8.047762069266224 5755.0 44.057416267942585 0.0 - - - - - - - 230.0 11 5 CHD5 chromodomain helicase DNA binding protein 5 111 14 C20140710_OR014_02 C20140710_OR014_02 TB424964.[MT7]-AFSQFLRPLIAK[MT7].3y5_1.heavy 560.346 / 685.473 5546.0 42.23720169067383 47 17 10 10 10 3.6379265454854464 21.61873744282224 0.0 3 0.9765754299846209 8.047762069266224 5546.0 102.99714285714285 0.0 - - - - - - - 139.66666666666666 11 6 CHD5 chromodomain helicase DNA binding protein 5 113 15 C20140710_OR014_02 C20140710_OR014_02 TB425084.[MT7]-DRYPIWENC[CAM]EEEEK[MT7].4y4_1.heavy 547.008 / 678.343 1813.0 30.10235023498535 39 12 10 7 10 0.9983981772448042 58.04173979816079 0.02989959716796875 3 0.8968507868629337 3.8091111268967097 1813.0 18.00170502776858 1.0 - - - - - - - 165.26666666666668 3 15 MPL myeloproliferative leukemia virus oncogene 115 15 C20140710_OR014_02 C20140710_OR014_02 TB425084.[MT7]-DRYPIWENC[CAM]EEEEK[MT7].4b8_2.heavy 547.008 / 609.805 1336.0 30.10235023498535 39 12 10 7 10 0.9983981772448042 58.04173979816079 0.02989959716796875 3 0.8968507868629337 3.8091111268967097 1336.0 -0.18376065768887118 2.0 - - - - - - - 242.15384615384616 4 13 MPL myeloproliferative leukemia virus oncogene 117 15 C20140710_OR014_02 C20140710_OR014_02 TB425084.[MT7]-DRYPIWENC[CAM]EEEEK[MT7].4b7_2.heavy 547.008 / 552.783 2576.0 30.10235023498535 39 12 10 7 10 0.9983981772448042 58.04173979816079 0.02989959716796875 3 0.8968507868629337 3.8091111268967097 2576.0 4.018281073764944 0.0 - - - - - - - 228.8 5 10 MPL myeloproliferative leukemia virus oncogene 119 15 C20140710_OR014_02 C20140710_OR014_02 TB425084.[MT7]-DRYPIWENC[CAM]EEEEK[MT7].4b5_1.heavy 547.008 / 789.438 1431.0 30.10235023498535 39 12 10 7 10 0.9983981772448042 58.04173979816079 0.02989959716796875 3 0.8968507868629337 3.8091111268967097 1431.0 5.402466407937611 0.0 - - - - - - - 218.0 2 14 MPL myeloproliferative leukemia virus oncogene 121 16 C20140710_OR014_02 C20140710_OR014_02 TB424961.[MT7]-MSHGVGLQQNALK[MT7].2y8_1.heavy 835.966 / 1015.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - HOXD13 homeobox D13 123 16 C20140710_OR014_02 C20140710_OR014_02 TB424961.[MT7]-MSHGVGLQQNALK[MT7].2b4_1.heavy 835.966 / 557.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - HOXD13 homeobox D13 125 16 C20140710_OR014_02 C20140710_OR014_02 TB424961.[MT7]-MSHGVGLQQNALK[MT7].2y10_1.heavy 835.966 / 1171.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - HOXD13 homeobox D13 127 16 C20140710_OR014_02 C20140710_OR014_02 TB424961.[MT7]-MSHGVGLQQNALK[MT7].2b7_1.heavy 835.966 / 826.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - HOXD13 homeobox D13 129 17 C20140710_OR014_02 C20140710_OR014_02 TB425089.[MT7]-TNPGLQTPQFSRC[CAM]HFK[MT7].4y9_2.heavy 552.291 / 675.846 10078.0 28.215149402618408 42 17 10 5 10 3.665705304378937 27.27987977662665 0.04020118713378906 3 0.9749484919581222 7.780985306467619 10078.0 1.5000744232200445 1.0 - - - - - - - 237.33333333333334 20 6 MPL myeloproliferative leukemia virus oncogene 131 17 C20140710_OR014_02 C20140710_OR014_02 TB425089.[MT7]-TNPGLQTPQFSRC[CAM]HFK[MT7].4b4_1.heavy 552.291 / 514.274 13516.0 28.215149402618408 42 17 10 5 10 3.665705304378937 27.27987977662665 0.04020118713378906 3 0.9749484919581222 7.780985306467619 13516.0 38.75038884041934 0.0 - - - - - - - 304.85714285714283 27 7 MPL myeloproliferative leukemia virus oncogene 133 17 C20140710_OR014_02 C20140710_OR014_02 TB425089.[MT7]-TNPGLQTPQFSRC[CAM]HFK[MT7].4y7_2.heavy 552.291 / 563.291 4031.0 28.215149402618408 42 17 10 5 10 3.665705304378937 27.27987977662665 0.04020118713378906 3 0.9749484919581222 7.780985306467619 4031.0 16.837780789947416 0.0 - - - - - - - 340.875 8 8 MPL myeloproliferative leukemia virus oncogene 135 17 C20140710_OR014_02 C20140710_OR014_02 TB425089.[MT7]-TNPGLQTPQFSRC[CAM]HFK[MT7].4b6_1.heavy 552.291 / 755.417 1897.0 28.215149402618408 42 17 10 5 10 3.665705304378937 27.27987977662665 0.04020118713378906 3 0.9749484919581222 7.780985306467619 1897.0 -0.1881944444444444 4.0 - - - - - - - 269.6363636363636 4 11 MPL myeloproliferative leukemia virus oncogene 137 18 C20140710_OR014_02 C20140710_OR014_02 TB424813.[MT7]-DLLHIGTQAR.3y6_1.heavy 423.246 / 645.368 2890.0 29.824499130249023 50 20 10 10 10 5.6714516643688615 17.632170018877936 0.0 3 0.9943093198224026 16.352121777083926 2890.0 1.0339892665474057 0.0 - - - - - - - 139.625 5 8 OPLAH 5-oxoprolinase (ATP-hydrolysing) 139 18 C20140710_OR014_02 C20140710_OR014_02 TB424813.[MT7]-DLLHIGTQAR.3b4_1.heavy 423.246 / 623.363 1026.0 29.824499130249023 50 20 10 10 10 5.6714516643688615 17.632170018877936 0.0 3 0.9943093198224026 16.352121777083926 1026.0 4.412903225806452 1.0 - - - - - - - 186.28571428571428 2 7 OPLAH 5-oxoprolinase (ATP-hydrolysing) 141 18 C20140710_OR014_02 C20140710_OR014_02 TB424813.[MT7]-DLLHIGTQAR.3b3_1.heavy 423.246 / 486.304 8205.0 29.824499130249023 50 20 10 10 10 5.6714516643688615 17.632170018877936 0.0 3 0.9943093198224026 16.352121777083926 8205.0 34.79083201968549 0.0 - - - - - - - 228.8181818181818 16 11 OPLAH 5-oxoprolinase (ATP-hydrolysing) 143 18 C20140710_OR014_02 C20140710_OR014_02 TB424813.[MT7]-DLLHIGTQAR.3y5_1.heavy 423.246 / 532.284 9790.0 29.824499130249023 50 20 10 10 10 5.6714516643688615 17.632170018877936 0.0 3 0.9943093198224026 16.352121777083926 9790.0 114.70008999030873 0.0 - - - - - - - 205.0 19 10 OPLAH 5-oxoprolinase (ATP-hydrolysing) 145 19 C20140710_OR014_02 C20140710_OR014_02 TB424956.[MT7]-IIYHTSFDVM[OXI]K[MT7].3y6_1.heavy 553.3 / 886.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 147 19 C20140710_OR014_02 C20140710_OR014_02 TB424956.[MT7]-IIYHTSFDVM[OXI]K[MT7].3b3_1.heavy 553.3 / 534.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 149 19 C20140710_OR014_02 C20140710_OR014_02 TB424956.[MT7]-IIYHTSFDVM[OXI]K[MT7].3b4_2.heavy 553.3 / 336.203 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 151 19 C20140710_OR014_02 C20140710_OR014_02 TB424956.[MT7]-IIYHTSFDVM[OXI]K[MT7].3y9_2.heavy 553.3 / 644.312 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 153 20 C20140710_OR014_02 C20140710_OR014_02 TB424957.[MT7]-SLEELLLDANQLR.2y5_1.heavy 829.466 / 601.342 11301.0 47.4049015045166 43 18 10 5 10 4.436015062637575 22.54275483468304 0.042400360107421875 3 0.9878257273182778 11.173758198903814 11301.0 30.425769230769234 0.0 - - - - - - - 347.3333333333333 22 9 SCRIB;LRRC1 scribbled homolog (Drosophila);leucine rich repeat containing 1 155 20 C20140710_OR014_02 C20140710_OR014_02 TB424957.[MT7]-SLEELLLDANQLR.2y9_1.heavy 829.466 / 1055.62 3607.0 47.4049015045166 43 18 10 5 10 4.436015062637575 22.54275483468304 0.042400360107421875 3 0.9878257273182778 11.173758198903814 3607.0 27.45366666666667 1.0 - - - - - - - 180.0 7 4 SCRIB;LRRC1 scribbled homolog (Drosophila);leucine rich repeat containing 1 157 20 C20140710_OR014_02 C20140710_OR014_02 TB424957.[MT7]-SLEELLLDANQLR.2b4_1.heavy 829.466 / 603.311 10339.0 47.4049015045166 43 18 10 5 10 4.436015062637575 22.54275483468304 0.042400360107421875 3 0.9878257273182778 11.173758198903814 10339.0 25.726268172884996 0.0 - - - - - - - 288.4 20 5 SCRIB;LRRC1 scribbled homolog (Drosophila);leucine rich repeat containing 1 159 20 C20140710_OR014_02 C20140710_OR014_02 TB424957.[MT7]-SLEELLLDANQLR.2y10_1.heavy 829.466 / 1184.66 2164.0 47.4049015045166 43 18 10 5 10 4.436015062637575 22.54275483468304 0.042400360107421875 3 0.9878257273182778 11.173758198903814 2164.0 12.613342566943675 0.0 - - - - - - - 260.3333333333333 4 6 SCRIB;LRRC1 scribbled homolog (Drosophila);leucine rich repeat containing 1 161 21 C20140710_OR014_02 C20140710_OR014_02 TB433615.[MT7]-IIYHTSFDVMK[MT7].4b8_2.heavy 411.228 / 561.291 5164.0 34.38064956665039 28 5 10 5 8 0.5487142670815419 91.72103869680674 0.04689788818359375 4 0.6983219002116068 2.1878259227781194 5164.0 87.60357142857143 0.0 - - - - - - - 112.0 10 2 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 163 21 C20140710_OR014_02 C20140710_OR014_02 TB433615.[MT7]-IIYHTSFDVMK[MT7].4b4_2.heavy 411.228 / 336.203 2695.0 34.38064956665039 28 5 10 5 8 0.5487142670815419 91.72103869680674 0.04689788818359375 4 0.6983219002116068 2.1878259227781194 2695.0 36.040277777777774 0.0 - - - - - - - 225.0 5 1 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 165 21 C20140710_OR014_02 C20140710_OR014_02 TB433615.[MT7]-IIYHTSFDVMK[MT7].4b4_1.heavy 411.228 / 671.4 449.0 34.38064956665039 28 5 10 5 8 0.5487142670815419 91.72103869680674 0.04689788818359375 4 0.6983219002116068 2.1878259227781194 449.0 2.7949620837454665 3.0 - - - - - - - 0.0 0 0 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 167 21 C20140710_OR014_02 C20140710_OR014_02 TB433615.[MT7]-IIYHTSFDVMK[MT7].4b3_1.heavy 411.228 / 534.341 1684.0 34.38064956665039 28 5 10 5 8 0.5487142670815419 91.72103869680674 0.04689788818359375 4 0.6983219002116068 2.1878259227781194 1684.0 19.526380952380954 1.0 - - - - - - - 157.2 5 5 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 169 22 C20140710_OR014_02 C20140710_OR014_02 TB433616.[MT7]-GFLSAPVFAGTHSGR.3y7_1.heavy 549.962 / 685.338 23933.0 36.21130180358887 29 16 0 5 8 3.253396757016045 24.357078891477737 0.043399810791015625 4 0.966659961798797 6.7400832883486945 23933.0 86.77703406720202 1.0 - - - - - - - 219.5 583 6 HOXD13 homeobox D13 171 22 C20140710_OR014_02 C20140710_OR014_02 TB433616.[MT7]-GFLSAPVFAGTHSGR.3y6_1.heavy 549.962 / 614.3 33746.0 36.21130180358887 29 16 0 5 8 3.253396757016045 24.357078891477737 0.043399810791015625 4 0.966659961798797 6.7400832883486945 33746.0 65.33 0.0 - - - - - - - 311.2 67 10 HOXD13 homeobox D13 173 22 C20140710_OR014_02 C20140710_OR014_02 TB433616.[MT7]-GFLSAPVFAGTHSGR.3b5_1.heavy 549.962 / 620.352 44755.0 36.21130180358887 29 16 0 5 8 3.253396757016045 24.357078891477737 0.043399810791015625 4 0.966659961798797 6.7400832883486945 44755.0 70.92012678859113 0.0 - - - - - - - 279.3333333333333 89 12 HOXD13 homeobox D13 175 22 C20140710_OR014_02 C20140710_OR014_02 TB433616.[MT7]-GFLSAPVFAGTHSGR.3y8_1.heavy 549.962 / 832.406 18309.0 36.21130180358887 29 16 0 5 8 3.253396757016045 24.357078891477737 0.043399810791015625 4 0.966659961798797 6.7400832883486945 18309.0 93.17635983263598 0.0 - - - - - - - 239.42857142857142 36 7 HOXD13 homeobox D13 177 23 C20140710_OR014_02 C20140710_OR014_02 TB433617.[MT7]-SLEELLLDANQLR.3b4_1.heavy 553.313 / 603.311 9045.0 47.38370132446289 44 14 10 10 10 3.173446648202079 31.511479815378387 0.0 3 0.9496583174574498 5.477211708386003 9045.0 111.53256404101367 0.0 - - - - - - - 181.0 18 6 SCRIB;LRRC1 scribbled homolog (Drosophila);leucine rich repeat containing 1 179 23 C20140710_OR014_02 C20140710_OR014_02 TB433617.[MT7]-SLEELLLDANQLR.3b3_1.heavy 553.313 / 474.268 5789.0 47.38370132446289 44 14 10 10 10 3.173446648202079 31.511479815378387 0.0 3 0.9496583174574498 5.477211708386003 5789.0 91.47576859504133 0.0 - - - - - - - 145.0 11 5 SCRIB;LRRC1 scribbled homolog (Drosophila);leucine rich repeat containing 1 181 23 C20140710_OR014_02 C20140710_OR014_02 TB433617.[MT7]-SLEELLLDANQLR.3y4_1.heavy 553.313 / 530.305 3859.0 47.38370132446289 44 14 10 10 10 3.173446648202079 31.511479815378387 0.0 3 0.9496583174574498 5.477211708386003 3859.0 8.355205034038201 1.0 - - - - - - - 241.33333333333334 8 3 SCRIB;LRRC1 scribbled homolog (Drosophila);leucine rich repeat containing 1 183 23 C20140710_OR014_02 C20140710_OR014_02 TB433617.[MT7]-SLEELLLDANQLR.3y5_1.heavy 553.313 / 601.342 7477.0 47.38370132446289 44 14 10 10 10 3.173446648202079 31.511479815378387 0.0 3 0.9496583174574498 5.477211708386003 7477.0 64.45108985155301 0.0 - - - - - - - 271.25 14 4 SCRIB;LRRC1 scribbled homolog (Drosophila);leucine rich repeat containing 1 185 24 C20140710_OR014_02 C20140710_OR014_02 TB424951.[MT7]-FPFFTRPLLSK[MT7].3y10_2.heavy 547.664 / 675.407 25526.0 42.45759963989258 43 17 10 6 10 3.7694547671666916 26.52903567673394 0.03859710693359375 3 0.9778230784334264 8.271910877460387 25526.0 293.6608253504673 0.0 - - - - - - - 167.85714285714286 51 7 KCNK18 potassium channel, subfamily K, member 18 187 24 C20140710_OR014_02 C20140710_OR014_02 TB424951.[MT7]-FPFFTRPLLSK[MT7].3y8_1.heavy 547.664 / 1105.69 534.0 42.45759963989258 43 17 10 6 10 3.7694547671666916 26.52903567673394 0.03859710693359375 3 0.9778230784334264 8.271910877460387 534.0 9.981308411214954 0.0 - - - - - - - 0.0 1 0 KCNK18 potassium channel, subfamily K, member 18 189 24 C20140710_OR014_02 C20140710_OR014_02 TB424951.[MT7]-FPFFTRPLLSK[MT7].3y9_2.heavy 547.664 / 626.88 2670.0 42.45759963989258 43 17 10 6 10 3.7694547671666916 26.52903567673394 0.03859710693359375 3 0.9778230784334264 8.271910877460387 2670.0 14.158972482435598 0.0 - - - - - - - 320.5 5 2 KCNK18 potassium channel, subfamily K, member 18 191 24 C20140710_OR014_02 C20140710_OR014_02 TB424951.[MT7]-FPFFTRPLLSK[MT7].3y5_1.heavy 547.664 / 701.468 4913.0 42.45759963989258 43 17 10 6 10 3.7694547671666916 26.52903567673394 0.03859710693359375 3 0.9778230784334264 8.271910877460387 4913.0 45.92544370641952 0.0 - - - - - - - 192.4 9 10 KCNK18 potassium channel, subfamily K, member 18 193 25 C20140710_OR014_02 C20140710_OR014_02 TB425094.[MT7]-LLSEDPANYADAPTEGIRR.3y14_2.heavy 744.717 / 765.887 8991.0 33.47140121459961 48 18 10 10 10 5.765148355982254 17.34560740249367 0.0 3 0.9872318811281398 10.910275868800436 8991.0 118.6812 0.0 - - - - - - - 200.0 17 6 OPLAH 5-oxoprolinase (ATP-hydrolysing) 195 25 C20140710_OR014_02 C20140710_OR014_02 TB425094.[MT7]-LLSEDPANYADAPTEGIRR.3b5_1.heavy 744.717 / 702.379 9291.0 33.47140121459961 48 18 10 10 10 5.765148355982254 17.34560740249367 0.0 3 0.9872318811281398 10.910275868800436 9291.0 98.23737167381974 0.0 - - - - - - - 242.85714285714286 18 14 OPLAH 5-oxoprolinase (ATP-hydrolysing) 197 25 C20140710_OR014_02 C20140710_OR014_02 TB425094.[MT7]-LLSEDPANYADAPTEGIRR.3b8_1.heavy 744.717 / 984.512 1199.0 33.47140121459961 48 18 10 10 10 5.765148355982254 17.34560740249367 0.0 3 0.9872318811281398 10.910275868800436 1199.0 5.583791851322373 1.0 - - - - - - - 175.0 2 8 OPLAH 5-oxoprolinase (ATP-hydrolysing) 199 25 C20140710_OR014_02 C20140710_OR014_02 TB425094.[MT7]-LLSEDPANYADAPTEGIRR.3y8_1.heavy 744.717 / 899.506 3496.0 33.47140121459961 48 18 10 10 10 5.765148355982254 17.34560740249367 0.0 3 0.9872318811281398 10.910275868800436 3496.0 18.936666666666667 0.0 - - - - - - - 262.5 6 8 OPLAH 5-oxoprolinase (ATP-hydrolysing) 201 26 C20140710_OR014_02 C20140710_OR014_02 TB433610.[MT7]-ILYLFYEDIK[MT7].3y3_1.heavy 535.644 / 519.326 10997.0 49.77320098876953 33 3 10 10 10 0.614282620355678 82.37052512580559 0.0 3 0.5841879268132776 1.8431698888729422 10997.0 199.3848598130841 0.0 - - - - - - - 107.0 21 1 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 203 26 C20140710_OR014_02 C20140710_OR014_02 TB433610.[MT7]-ILYLFYEDIK[MT7].3b4_1.heavy 535.644 / 647.425 4911.0 49.77320098876953 33 3 10 10 10 0.614282620355678 82.37052512580559 0.0 3 0.5841879268132776 1.8431698888729422 4911.0 59.64914369158878 0.0 - - - - - - - 277.4 9 5 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 205 26 C20140710_OR014_02 C20140710_OR014_02 TB433610.[MT7]-ILYLFYEDIK[MT7].3b5_1.heavy 535.644 / 794.493 5872.0 49.77320098876953 33 3 10 10 10 0.614282620355678 82.37052512580559 0.0 3 0.5841879268132776 1.8431698888729422 5872.0 31.562000000000005 0.0 - - - - - - - 277.6 11 5 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 207 26 C20140710_OR014_02 C20140710_OR014_02 TB433610.[MT7]-ILYLFYEDIK[MT7].3b3_1.heavy 535.644 / 534.341 1602.0 49.77320098876953 33 3 10 10 10 0.614282620355678 82.37052512580559 0.0 3 0.5841879268132776 1.8431698888729422 1602.0 -1.2 1.0 - - - - - - - 214.0 3 1 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 209 27 C20140710_OR014_02 C20140710_OR014_02 TB425092.[MT7]-AAAAPLGVLPAVGWGLAIRK[MT7].4y8_1.heavy 555.596 / 1044.64 1578.0 44.98129940032959 28 7 10 1 10 0.5592785877170273 82.23202446411892 0.095001220703125 3 0.7315324200138634 2.326393822402282 1578.0 0.3199341021416803 1.0 - - - - - - - 161.66666666666666 3 3 C15orf2 chromosome 15 open reading frame 2 211 27 C20140710_OR014_02 C20140710_OR014_02 TB425092.[MT7]-AAAAPLGVLPAVGWGLAIRK[MT7].4b7_1.heavy 555.596 / 696.416 3035.0 44.98129940032959 28 7 10 1 10 0.5592785877170273 82.23202446411892 0.095001220703125 3 0.7315324200138634 2.326393822402282 3035.0 20.24397017591462 0.0 - - - - - - - 303.25 6 4 C15orf2 chromosome 15 open reading frame 2 213 27 C20140710_OR014_02 C20140710_OR014_02 TB425092.[MT7]-AAAAPLGVLPAVGWGLAIRK[MT7].4y6_1.heavy 555.596 / 801.543 1335.0 44.98129940032959 28 7 10 1 10 0.5592785877170273 82.23202446411892 0.095001220703125 3 0.7315324200138634 2.326393822402282 1335.0 2.2705882352941176 1.0 - - - - - - - 303.5 2 4 C15orf2 chromosome 15 open reading frame 2 215 27 C20140710_OR014_02 C20140710_OR014_02 TB425092.[MT7]-AAAAPLGVLPAVGWGLAIRK[MT7].4y11_2.heavy 555.596 / 656.404 8983.0 44.98129940032959 28 7 10 1 10 0.5592785877170273 82.23202446411892 0.095001220703125 3 0.7315324200138634 2.326393822402282 8983.0 60.37475396825397 0.0 - - - - - - - 364.25 17 4 C15orf2 chromosome 15 open reading frame 2 217 28 C20140710_OR014_02 C20140710_OR014_02 TB425093.[MT7]-FNTC[CAM]PLPGALLQDPYFIQSPSTYSLSQR.3b6_1.heavy 1115.56 / 877.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 219 28 C20140710_OR014_02 C20140710_OR014_02 TB425093.[MT7]-FNTC[CAM]PLPGALLQDPYFIQSPSTYSLSQR.3b4_1.heavy 1115.56 / 667.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 221 28 C20140710_OR014_02 C20140710_OR014_02 TB425093.[MT7]-FNTC[CAM]PLPGALLQDPYFIQSPSTYSLSQR.3y10_1.heavy 1115.56 / 1125.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 223 28 C20140710_OR014_02 C20140710_OR014_02 TB425093.[MT7]-FNTC[CAM]PLPGALLQDPYFIQSPSTYSLSQR.3y9_1.heavy 1115.56 / 1038.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 225 29 C20140710_OR014_02 C20140710_OR014_02 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 106946.0 30.039000193277996 24 -3 10 7 10 null 0.0 0.0290985107421875 3 0.0 0.0 106946.0 732.007888376181 0.0 - - - - - - - 230.75 213 16 227 29 C20140710_OR014_02 C20140710_OR014_02 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 41098.0 30.039000193277996 24 -3 10 7 10 null 0.0 0.0290985107421875 3 0.0 0.0 41098.0 336.40290916186945 0.0 - - - - - - - 172.33333333333334 82 15 229 29 C20140710_OR014_02 C20140710_OR014_02 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 51996.0 30.039000193277996 24 -3 10 7 10 null 0.0 0.0290985107421875 3 0.0 0.0 51996.0 357.21210107668645 0.0 - - - - - - - 242.89473684210526 103 19 231 30 C20140710_OR014_02 C20140710_OR014_02 TB445799.[MT7]-LRESLTPDGSK[MT7].3b4_1.heavy 497.619 / 630.369 1104.0 24.09830093383789 46 16 10 10 10 2.760508268437399 36.22521299550591 0.0 3 0.9666505000861518 6.739121713758751 1104.0 12.120919860627179 1.0 - - - - - - - 245.4 2 5 C6orf204 chromosome 6 open reading frame 204 233 30 C20140710_OR014_02 C20140710_OR014_02 TB445799.[MT7]-LRESLTPDGSK[MT7].3b5_1.heavy 497.619 / 743.453 1717.0 24.09830093383789 46 16 10 10 10 2.760508268437399 36.22521299550591 0.0 3 0.9666505000861518 6.739121713758751 1717.0 13.097160558558885 1.0 - - - - - - - 172.0 3 5 C6orf204 chromosome 6 open reading frame 204 235 30 C20140710_OR014_02 C20140710_OR014_02 TB445799.[MT7]-LRESLTPDGSK[MT7].3y4_1.heavy 497.619 / 550.295 13612.0 24.09830093383789 46 16 10 10 10 2.760508268437399 36.22521299550591 0.0 3 0.9666505000861518 6.739121713758751 13612.0 90.27340709849156 0.0 - - - - - - - 270.0 27 5 C6orf204 chromosome 6 open reading frame 204 237 30 C20140710_OR014_02 C20140710_OR014_02 TB445799.[MT7]-LRESLTPDGSK[MT7].3y5_1.heavy 497.619 / 647.348 12018.0 24.09830093383789 46 16 10 10 10 2.760508268437399 36.22521299550591 0.0 3 0.9666505000861518 6.739121713758751 12018.0 77.13327284826974 0.0 - - - - - - - 262.7142857142857 24 7 C6orf204 chromosome 6 open reading frame 204 239 31 C20140710_OR014_02 C20140710_OR014_02 TB424847.[MT7]-IVYVARNPK[MT7].3y7_1.heavy 449.95 / 991.581 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 241 31 C20140710_OR014_02 C20140710_OR014_02 TB424847.[MT7]-IVYVARNPK[MT7].3y6_1.heavy 449.95 / 828.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 243 31 C20140710_OR014_02 C20140710_OR014_02 TB424847.[MT7]-IVYVARNPK[MT7].3b3_1.heavy 449.95 / 520.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 245 31 C20140710_OR014_02 C20140710_OR014_02 TB424847.[MT7]-IVYVARNPK[MT7].3y8_2.heavy 449.95 / 545.828 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 247 32 C20140710_OR014_02 C20140710_OR014_02 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 23597.0 16.332199096679688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 23597.0 142.30807682992324 0.0 - - - - - - - 195.7 47 10 249 32 C20140710_OR014_02 C20140710_OR014_02 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 28340.0 16.332199096679688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 28340.0 262.5868743748671 0.0 - - - - - - - 213.5 56 10 251 32 C20140710_OR014_02 C20140710_OR014_02 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 17550.0 16.332199096679688 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 17550.0 158.38953302840122 0.0 - - - - - - - 221.0 35 11 253 33 C20140710_OR014_02 C20140710_OR014_02 TB424849.[MT7]-NAQQPEPGDPR.2b4_1.heavy 676.837 / 586.307 2671.0 17.041200637817383 39 9 10 10 10 0.9122018767751635 70.73131064003275 0.0 3 0.8062911612921595 2.7574898949360316 2671.0 68.41508771929826 0.0 - - - - - - - 142.0 5 4 HSF4 heat shock transcription factor 4 255 33 C20140710_OR014_02 C20140710_OR014_02 TB424849.[MT7]-NAQQPEPGDPR.2b6_1.heavy 676.837 / 812.402 1762.0 17.041200637817383 39 9 10 10 10 0.9122018767751635 70.73131064003275 0.0 3 0.8062911612921595 2.7574898949360316 1762.0 20.729411764705883 0.0 - - - - - - - 113.66666666666667 3 3 HSF4 heat shock transcription factor 4 257 33 C20140710_OR014_02 C20140710_OR014_02 TB424849.[MT7]-NAQQPEPGDPR.2b9_1.heavy 676.837 / 1081.5 4376.0 17.041200637817383 39 9 10 10 10 0.9122018767751635 70.73131064003275 0.0 3 0.8062911612921595 2.7574898949360316 4376.0 48.77275541795666 0.0 - - - - - - - 76.0 8 6 HSF4 heat shock transcription factor 4 259 33 C20140710_OR014_02 C20140710_OR014_02 TB424849.[MT7]-NAQQPEPGDPR.2y7_1.heavy 676.837 / 767.368 1591.0 17.041200637817383 39 9 10 10 10 0.9122018767751635 70.73131064003275 0.0 3 0.8062911612921595 2.7574898949360316 1591.0 22.32982456140351 0.0 - - - - - - - 203.14285714285714 3 7 HSF4 heat shock transcription factor 4 261 34 C20140710_OR014_02 C20140710_OR014_02 TB424947.[MT7]-EELTLEHFQMDALGELSDGR.3b6_1.heavy 812.061 / 859.453 2142.0 43.61280059814453 48 18 10 10 10 9.693964718440247 10.315696714861774 0.0 3 0.9827265340346875 9.376602137619965 2142.0 2.021358620689655 0.0 - - - - - - - 244.57142857142858 4 7 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 263 34 C20140710_OR014_02 C20140710_OR014_02 TB424947.[MT7]-EELTLEHFQMDALGELSDGR.3b4_1.heavy 812.061 / 617.326 642.0 43.61280059814453 48 18 10 10 10 9.693964718440247 10.315696714861774 0.0 3 0.9827265340346875 9.376602137619965 642.0 1.6668049792531119 5.0 - - - - - - - 0.0 1 0 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 265 34 C20140710_OR014_02 C20140710_OR014_02 TB424947.[MT7]-EELTLEHFQMDALGELSDGR.3b3_1.heavy 812.061 / 516.279 1392.0 43.61280059814453 48 18 10 10 10 9.693964718440247 10.315696714861774 0.0 3 0.9827265340346875 9.376602137619965 1392.0 6.823022366656125 0.0 - - - - - - - 192.6 2 5 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 267 34 C20140710_OR014_02 C20140710_OR014_02 TB424947.[MT7]-EELTLEHFQMDALGELSDGR.3y9_1.heavy 812.061 / 917.469 1285.0 43.61280059814453 48 18 10 10 10 9.693964718440247 10.315696714861774 0.0 3 0.9827265340346875 9.376602137619965 1285.0 15.888364485981308 0.0 - - - - - - - 160.5 2 6 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 269 35 C20140710_OR014_02 C20140710_OR014_02 TB433625.[MT7]-SSPHASLGGFPVEK[MT7].3y3_1.heavy 567.645 / 519.326 10084.0 29.419400215148926 38 14 10 6 8 2.3204277541101663 38.65930431805266 0.03320121765136719 4 0.94473273656581 5.225256562178604 10084.0 30.56430151928321 1.0 - - - - - - - 273.75 30 12 HOXD13 homeobox D13 271 35 C20140710_OR014_02 C20140710_OR014_02 TB433625.[MT7]-SSPHASLGGFPVEK[MT7].3b4_1.heavy 567.645 / 553.285 10877.0 29.419400215148926 38 14 10 6 8 2.3204277541101663 38.65930431805266 0.03320121765136719 4 0.94473273656581 5.225256562178604 10877.0 90.05198955582988 0.0 - - - - - - - 273.8333333333333 21 12 HOXD13 homeobox D13 273 35 C20140710_OR014_02 C20140710_OR014_02 TB433625.[MT7]-SSPHASLGGFPVEK[MT7].3b5_1.heavy 567.645 / 624.322 4645.0 29.419400215148926 38 14 10 6 8 2.3204277541101663 38.65930431805266 0.03320121765136719 4 0.94473273656581 5.225256562178604 4645.0 18.825550660792953 0.0 - - - - - - - 169.8 9 10 HOXD13 homeobox D13 275 35 C20140710_OR014_02 C20140710_OR014_02 TB433625.[MT7]-SSPHASLGGFPVEK[MT7].3y4_1.heavy 567.645 / 616.379 36483.0 29.419400215148926 38 14 10 6 8 2.3204277541101663 38.65930431805266 0.03320121765136719 4 0.94473273656581 5.225256562178604 36483.0 81.08582362278244 0.0 - - - - - - - 226.58333333333334 72 12 HOXD13 homeobox D13 277 36 C20140710_OR014_02 C20140710_OR014_02 TB433623.[MT7]-QSYSPGYQDFSK[MT7].2y4_1.heavy 847.917 / 640.342 127.0 27.99970054626465 40 10 10 10 10 0.6602630639087606 79.53716002304861 0.0 3 0.827898262982508 2.931127896359877 127.0 -0.3999999999999999 10.0 - - - - - - - 0.0 0 0 C6orf204 chromosome 6 open reading frame 204 279 36 C20140710_OR014_02 C20140710_OR014_02 TB433623.[MT7]-QSYSPGYQDFSK[MT7].2y8_1.heavy 847.917 / 1085.54 2287.0 27.99970054626465 40 10 10 10 10 0.6602630639087606 79.53716002304861 0.0 3 0.827898262982508 2.931127896359877 2287.0 26.65165354330709 0.0 - - - - - - - 254.0 4 3 C6orf204 chromosome 6 open reading frame 204 281 36 C20140710_OR014_02 C20140710_OR014_02 TB433623.[MT7]-QSYSPGYQDFSK[MT7].2b4_1.heavy 847.917 / 610.295 2795.0 27.99970054626465 40 10 10 10 10 0.6602630639087606 79.53716002304861 0.0 3 0.827898262982508 2.931127896359877 2795.0 6.9691601049868765 0.0 - - - - - - - 254.0 5 2 C6orf204 chromosome 6 open reading frame 204 283 36 C20140710_OR014_02 C20140710_OR014_02 TB433623.[MT7]-QSYSPGYQDFSK[MT7].2y3_1.heavy 847.917 / 525.315 1016.0 27.99970054626465 40 10 10 10 10 0.6602630639087606 79.53716002304861 0.0 3 0.827898262982508 2.931127896359877 1016.0 5.6 0.0 - - - - - - - 254.0 2 1 C6orf204 chromosome 6 open reading frame 204 285 37 C20140710_OR014_02 C20140710_OR014_02 TB424833.[MT7]-QQITHLHER.2y8_1.heavy 653.361 / 1033.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf204 chromosome 6 open reading frame 204 287 37 C20140710_OR014_02 C20140710_OR014_02 TB424833.[MT7]-QQITHLHER.2y5_1.heavy 653.361 / 691.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf204 chromosome 6 open reading frame 204 289 37 C20140710_OR014_02 C20140710_OR014_02 TB424833.[MT7]-QQITHLHER.2y6_1.heavy 653.361 / 792.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf204 chromosome 6 open reading frame 204 291 37 C20140710_OR014_02 C20140710_OR014_02 TB424833.[MT7]-QQITHLHER.2y7_1.heavy 653.361 / 905.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf204 chromosome 6 open reading frame 204 293 38 C20140710_OR014_02 C20140710_OR014_02 TB445594.[MT7]-TVDSSGSLYVR.3y6_1.heavy 443.237 / 694.388 1235.0 26.78380012512207 42 20 2 10 10 6.38951642736688 15.650636654080879 0.0 3 0.9934256328420165 15.212380194845705 1235.0 17.917459677419355 0.0 - - - - - - - 229.71428571428572 2 7 RDH8 retinol dehydrogenase 8 (all-trans) 295 38 C20140710_OR014_02 C20140710_OR014_02 TB445594.[MT7]-TVDSSGSLYVR.3b4_1.heavy 443.237 / 547.284 741.0 26.78380012512207 42 20 2 10 10 6.38951642736688 15.650636654080879 0.0 3 0.9934256328420165 15.212380194845705 741.0 0.8398058252427183 4.0 - - - - - - - 247.25 2 8 RDH8 retinol dehydrogenase 8 (all-trans) 297 38 C20140710_OR014_02 C20140710_OR014_02 TB445594.[MT7]-TVDSSGSLYVR.3y4_1.heavy 443.237 / 550.335 1112.0 26.78380012512207 42 20 2 10 10 6.38951642736688 15.650636654080879 0.0 3 0.9934256328420165 15.212380194845705 1112.0 11.041214574898783 0.0 - - - - - - - 192.44444444444446 2 9 RDH8 retinol dehydrogenase 8 (all-trans) 299 38 C20140710_OR014_02 C20140710_OR014_02 TB445594.[MT7]-TVDSSGSLYVR.3b3_1.heavy 443.237 / 460.252 1853.0 26.78380012512207 42 20 2 10 10 6.38951642736688 15.650636654080879 0.0 3 0.9934256328420165 15.212380194845705 1853.0 13.080142353402117 0.0 - - - - - - - 185.66666666666666 8 6 RDH8 retinol dehydrogenase 8 (all-trans) 301 39 C20140710_OR014_02 C20140710_OR014_02 TB424836.[MT7]-EVLPQYFK[MT7].2y4_1.heavy 656.381 / 729.405 1216.0 35.18440055847168 40 15 10 5 10 0.9027501476041018 66.41091817007218 0.04720306396484375 3 0.951760128602764 5.596258808922925 1216.0 2.7327629531147077 3.0 - - - - - - - 290.15384615384613 2 13 HSF4 heat shock transcription factor 4 303 39 C20140710_OR014_02 C20140710_OR014_02 TB424836.[MT7]-EVLPQYFK[MT7].2y5_1.heavy 656.381 / 826.458 24934.0 35.18440055847168 40 15 10 5 10 0.9027501476041018 66.41091817007218 0.04720306396484375 3 0.951760128602764 5.596258808922925 24934.0 96.32038356164384 0.0 - - - - - - - 243.28571428571428 49 7 HSF4 heat shock transcription factor 4 305 39 C20140710_OR014_02 C20140710_OR014_02 TB424836.[MT7]-EVLPQYFK[MT7].2y3_1.heavy 656.381 / 601.347 3041.0 35.18440055847168 40 15 10 5 10 0.9027501476041018 66.41091817007218 0.04720306396484375 3 0.951760128602764 5.596258808922925 3041.0 0.011930296923283623 2.0 - - - - - - - 243.4 9 5 HSF4 heat shock transcription factor 4 307 39 C20140710_OR014_02 C20140710_OR014_02 TB424836.[MT7]-EVLPQYFK[MT7].2y6_1.heavy 656.381 / 939.542 6203.0 35.18440055847168 40 15 10 5 10 0.9027501476041018 66.41091817007218 0.04720306396484375 3 0.951760128602764 5.596258808922925 6203.0 25.49681209444845 0.0 - - - - - - - 208.71428571428572 12 7 HSF4 heat shock transcription factor 4 309 40 C20140710_OR014_02 C20140710_OR014_02 TB424837.[MT7]-SSNITDSLANR.3y6_1.heavy 441.232 / 675.342 636.0 25.84077501296997 25 10 2 5 8 0.8226956539233448 69.6469420689708 0.04450035095214844 4 0.841790630181514 3.060883257199856 636.0 9.760346456692913 1.0 - - - - - - - 0.0 1 0 GRIK1 glutamate receptor, ionotropic, kainate 1 311 40 C20140710_OR014_02 C20140710_OR014_02 TB424837.[MT7]-SSNITDSLANR.3b4_1.heavy 441.232 / 546.3 1400.0 25.84077501296997 25 10 2 5 8 0.8226956539233448 69.6469420689708 0.04450035095214844 4 0.841790630181514 3.060883257199856 1400.0 10.974901960784313 0.0 - - - - - - - 203.8 2 5 GRIK1 glutamate receptor, ionotropic, kainate 1 313 40 C20140710_OR014_02 C20140710_OR014_02 TB424837.[MT7]-SSNITDSLANR.3y4_1.heavy 441.232 / 473.283 764.0 25.84077501296997 25 10 2 5 8 0.8226956539233448 69.6469420689708 0.04450035095214844 4 0.841790630181514 3.060883257199856 764.0 5.303058823529412 2.0 - - - - - - - 0.0 1 0 GRIK1 glutamate receptor, ionotropic, kainate 1 315 40 C20140710_OR014_02 C20140710_OR014_02 TB424837.[MT7]-SSNITDSLANR.3y5_1.heavy 441.232 / 560.315 509.0 25.84077501296997 25 10 2 5 8 0.8226956539233448 69.6469420689708 0.04450035095214844 4 0.841790630181514 3.060883257199856 509.0 1.0391884816753927 15.0 - - - - - - - 276.0 6 6 GRIK1 glutamate receptor, ionotropic, kainate 1 317 41 C20140710_OR014_02 C20140710_OR014_02 TB424838.[MT7]-GPVGTEEELPR.2y4_1.heavy 664.352 / 514.298 252.0 26.683499813079834 43 18 10 5 10 3.260078465394439 30.67410832637764 0.04319953918457031 3 0.9821056698725386 9.212020475481527 252.0 0.3999999999999999 17.0 - - - - - - - 0.0 1 0 CHD5 chromodomain helicase DNA binding protein 5 319 41 C20140710_OR014_02 C20140710_OR014_02 TB424838.[MT7]-GPVGTEEELPR.2y8_1.heavy 664.352 / 930.453 1262.0 26.683499813079834 43 18 10 5 10 3.260078465394439 30.67410832637764 0.04319953918457031 3 0.9821056698725386 9.212020475481527 1262.0 10.182583716005116 2.0 - - - - - - - 126.0 3 1 CHD5 chromodomain helicase DNA binding protein 5 321 41 C20140710_OR014_02 C20140710_OR014_02 TB424838.[MT7]-GPVGTEEELPR.2y9_1.heavy 664.352 / 1029.52 631.0 26.683499813079834 43 18 10 5 10 3.260078465394439 30.67410832637764 0.04319953918457031 3 0.9821056698725386 9.212020475481527 631.0 4.05233237006324 1.0 - - - - - - - 0.0 1 0 CHD5 chromodomain helicase DNA binding protein 5 323 41 C20140710_OR014_02 C20140710_OR014_02 TB424838.[MT7]-GPVGTEEELPR.2y10_1.heavy 664.352 / 1126.57 883.0 26.683499813079834 43 18 10 5 10 3.260078465394439 30.67410832637764 0.04319953918457031 3 0.9821056698725386 9.212020475481527 883.0 8.40952380952381 0.0 - - - - - - - 0.0 1 0 CHD5 chromodomain helicase DNA binding protein 5 325 42 C20140710_OR014_02 C20140710_OR014_02 TB424839.[MT7]-TVDSSGSLYVR.2y8_1.heavy 664.352 / 868.452 4540.0 26.79497528076172 31 14 4 5 8 2.1021938243457634 42.52690611379509 0.04470062255859375 4 0.9333727970073348 4.754394914464161 4540.0 66.4390243902439 0.0 - - - - - - - 123.0 9 4 RDH8 retinol dehydrogenase 8 (all-trans) 327 42 C20140710_OR014_02 C20140710_OR014_02 TB424839.[MT7]-TVDSSGSLYVR.2y9_1.heavy 664.352 / 983.479 3804.0 26.79497528076172 31 14 4 5 8 2.1021938243457634 42.52690611379509 0.04470062255859375 4 0.9333727970073348 4.754394914464161 3804.0 20.539743566992016 0.0 - - - - - - - 192.85714285714286 7 7 RDH8 retinol dehydrogenase 8 (all-trans) 329 42 C20140710_OR014_02 C20140710_OR014_02 TB424839.[MT7]-TVDSSGSLYVR.2y10_1.heavy 664.352 / 1082.55 3436.0 26.79497528076172 31 14 4 5 8 2.1021938243457634 42.52690611379509 0.04470062255859375 4 0.9333727970073348 4.754394914464161 3436.0 30.36473071179691 2.0 - - - - - - - 163.66666666666666 16 6 RDH8 retinol dehydrogenase 8 (all-trans) 331 42 C20140710_OR014_02 C20140710_OR014_02 TB424839.[MT7]-TVDSSGSLYVR.2y7_1.heavy 664.352 / 781.42 2331.0 26.79497528076172 31 14 4 5 8 2.1021938243457634 42.52690611379509 0.04470062255859375 4 0.9333727970073348 4.754394914464161 2331.0 1.5829147480740278 0.0 - - - - - - - 276.0 4 8 RDH8 retinol dehydrogenase 8 (all-trans) 333 43 C20140710_OR014_02 C20140710_OR014_02 TB445598.[MT7]-FSAGPK[MT7].2y4_1.heavy 447.768 / 516.326 2718.0 21.374399185180664 48 18 10 10 10 3.7474653874138344 20.889991836649823 0.0 3 0.9817462632602558 9.12060466760593 2718.0 4.677142857142856 1.0 - - - - - - - 209.25 5 4 KIR2DS2;LOC100287457;KIR2DL3 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 335 43 C20140710_OR014_02 C20140710_OR014_02 TB445598.[MT7]-FSAGPK[MT7].2y5_1.heavy 447.768 / 603.358 6900.0 21.374399185180664 48 18 10 10 10 3.7474653874138344 20.889991836649823 0.0 3 0.9817462632602558 9.12060466760593 6900.0 95.4272043745728 0.0 - - - - - - - 194.42857142857142 13 7 KIR2DS2;LOC100287457;KIR2DL3 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 337 43 C20140710_OR014_02 C20140710_OR014_02 TB445598.[MT7]-FSAGPK[MT7].2b4_1.heavy 447.768 / 507.268 1150.0 21.374399185180664 48 18 10 10 10 3.7474653874138344 20.889991836649823 0.0 3 0.9817462632602558 9.12060466760593 1150.0 14.063519866545345 0.0 - - - - - - - 209.28571428571428 2 7 KIR2DS2;LOC100287457;KIR2DL3 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 339 43 C20140710_OR014_02 C20140710_OR014_02 TB445598.[MT7]-FSAGPK[MT7].2y3_1.heavy 447.768 / 445.289 4600.0 21.374399185180664 48 18 10 10 10 3.7474653874138344 20.889991836649823 0.0 3 0.9817462632602558 9.12060466760593 4600.0 46.754613807245384 0.0 - - - - - - - 196.375 9 8 KIR2DS2;LOC100287457;KIR2DL3 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 341 44 C20140710_OR014_02 C20140710_OR014_02 TB424936.[MT7]-LFFPLHLWVK[MT7].3y3_1.heavy 529.993 / 576.363 11969.0 48.03409957885742 46 16 10 10 10 2.697307432394796 29.583949506468528 0.0 3 0.9680769097823073 6.888866207619719 11969.0 119.69 0.0 - - - - - - - 342.0 23 2 MPL myeloproliferative leukemia virus oncogene 343 44 C20140710_OR014_02 C20140710_OR014_02 TB424936.[MT7]-LFFPLHLWVK[MT7].3b5_1.heavy 529.993 / 762.467 9119.0 48.03409957885742 46 16 10 10 10 2.697307432394796 29.583949506468528 0.0 3 0.9680769097823073 6.888866207619719 9119.0 114.38745614035088 0.0 - - - - - - - 133.0 18 6 MPL myeloproliferative leukemia virus oncogene 345 44 C20140710_OR014_02 C20140710_OR014_02 TB424936.[MT7]-LFFPLHLWVK[MT7].3y4_1.heavy 529.993 / 689.447 6953.0 48.03409957885742 46 16 10 10 10 2.697307432394796 29.583949506468528 0.0 3 0.9680769097823073 6.888866207619719 6953.0 58.856535087719294 0.0 - - - - - - - 182.4 13 5 MPL myeloproliferative leukemia virus oncogene 347 44 C20140710_OR014_02 C20140710_OR014_02 TB424936.[MT7]-LFFPLHLWVK[MT7].3b3_1.heavy 529.993 / 552.33 9119.0 48.03409957885742 46 16 10 10 10 2.697307432394796 29.583949506468528 0.0 3 0.9680769097823073 6.888866207619719 9119.0 118.38701754385966 0.0 - - - - - - - 247.0 18 6 MPL myeloproliferative leukemia virus oncogene 349 45 C20140710_OR014_02 C20140710_OR014_02 TB433767.[MT7]-EQGDPAPGVQGYSVLNSLVGPAC[CAM]IFLRPSIAATQLDR.4y10_1.heavy 1011.03 / 1071.58 1050.0 51.48000144958496 33 10 10 5 8 0.7983211980810504 76.60510326798938 0.043399810791015625 4 0.8466454399338212 3.110290472482473 1050.0 3.074587495019715 1.0 - - - - - - - 286.0 3 5 CABP2 calcium binding protein 2 351 45 C20140710_OR014_02 C20140710_OR014_02 TB433767.[MT7]-EQGDPAPGVQGYSVLNSLVGPAC[CAM]IFLRPSIAATQLDR.4b6_1.heavy 1011.03 / 742.349 6393.0 51.48000144958496 33 10 10 5 8 0.7983211980810504 76.60510326798938 0.043399810791015625 4 0.8466454399338212 3.110290472482473 6393.0 -0.33529720279720365 0.0 - - - - - - - 171.6 12 5 CABP2 calcium binding protein 2 353 45 C20140710_OR014_02 C20140710_OR014_02 TB433767.[MT7]-EQGDPAPGVQGYSVLNSLVGPAC[CAM]IFLRPSIAATQLDR.4y18_2.heavy 1011.03 / 993.533 5152.0 51.48000144958496 33 10 10 5 8 0.7983211980810504 76.60510326798938 0.043399810791015625 4 0.8466454399338212 3.110290472482473 5152.0 7.611115991954316 1.0 - - - - - - - 413.6666666666667 10 3 CABP2 calcium binding protein 2 355 45 C20140710_OR014_02 C20140710_OR014_02 TB433767.[MT7]-EQGDPAPGVQGYSVLNSLVGPAC[CAM]IFLRPSIAATQLDR.4b4_1.heavy 1011.03 / 574.259 4485.0 51.48000144958496 33 10 10 5 8 0.7983211980810504 76.60510326798938 0.043399810791015625 4 0.8466454399338212 3.110290472482473 4485.0 0.9379916276672359 2.0 - - - - - - - 158.83333333333334 9 6 CABP2 calcium binding protein 2 357 46 C20140710_OR014_02 C20140710_OR014_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 145247.0 19.113499959309895 23 -3 10 6 10 null 0.0 0.03660011291503906 3 0.0 0.0 145247.0 1862.6691442611443 0.0 - - - - - - - 266.1818181818182 290 11 359 46 C20140710_OR014_02 C20140710_OR014_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 90587.0 19.113499959309895 23 -3 10 6 10 null 0.0 0.03660011291503906 3 0.0 0.0 90587.0 723.3002711065271 0.0 - - - - - - - 238.8 181 10 361 46 C20140710_OR014_02 C20140710_OR014_02 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 116953.0 19.113499959309895 23 -3 10 6 10 null 0.0 0.03660011291503906 3 0.0 0.0 116953.0 1890.9933116883117 0.0 - - - - - - - 213.88888888888889 233 9 363 47 C20140710_OR014_02 C20140710_OR014_02 TB424935.[MT7]-DQPLDSSHIASIR.3y6_1.heavy 528.282 / 696.415 3201.0 27.70840072631836 50 20 10 10 10 9.073171378404382 11.02150459077806 0.0 3 0.992223469813032 13.985809052365141 3201.0 21.417395818517992 0.0 - - - - - - - 222.5 6 8 OPLAH 5-oxoprolinase (ATP-hydrolysing) 365 47 C20140710_OR014_02 C20140710_OR014_02 TB424935.[MT7]-DQPLDSSHIASIR.3b5_1.heavy 528.282 / 713.359 4980.0 27.70840072631836 50 20 10 10 10 9.073171378404382 11.02150459077806 0.0 3 0.992223469813032 13.985809052365141 4980.0 45.29493316313868 0.0 - - - - - - - 213.6 9 5 OPLAH 5-oxoprolinase (ATP-hydrolysing) 367 47 C20140710_OR014_02 C20140710_OR014_02 TB424935.[MT7]-DQPLDSSHIASIR.3y5_1.heavy 528.282 / 559.356 15532.0 27.70840072631836 50 20 10 10 10 9.073171378404382 11.02150459077806 0.0 3 0.992223469813032 13.985809052365141 15532.0 40.95231658319768 0.0 - - - - - - - 296.5 31 6 OPLAH 5-oxoprolinase (ATP-hydrolysing) 369 47 C20140710_OR014_02 C20140710_OR014_02 TB424935.[MT7]-DQPLDSSHIASIR.3y9_1.heavy 528.282 / 985.506 2608.0 27.70840072631836 50 20 10 10 10 9.073171378404382 11.02150459077806 0.0 3 0.992223469813032 13.985809052365141 2608.0 32.03984824309471 0.0 - - - - - - - 266.75 5 4 OPLAH 5-oxoprolinase (ATP-hydrolysing) 371 48 C20140710_OR014_02 C20140710_OR014_02 TB433631.[MT7]-YVC[CAM]QFPDQEEVR.2y8_1.heavy 857.405 / 1019.48 2506.0 31.00547456741333 35 14 10 3 8 1.067580400006879 57.68340168417054 0.05669975280761719 4 0.9324895012713632 4.722833220397947 2506.0 -0.5523713353695276 1.0 - - - - - - - 199.0 5 7 MPL myeloproliferative leukemia virus oncogene 373 48 C20140710_OR014_02 C20140710_OR014_02 TB433631.[MT7]-YVC[CAM]QFPDQEEVR.2y5_1.heavy 857.405 / 660.331 2692.0 31.00547456741333 35 14 10 3 8 1.067580400006879 57.68340168417054 0.05669975280761719 4 0.9324895012713632 4.722833220397947 2692.0 7.576447854032758 0.0 - - - - - - - 206.33333333333334 5 9 MPL myeloproliferative leukemia virus oncogene 375 48 C20140710_OR014_02 C20140710_OR014_02 TB433631.[MT7]-YVC[CAM]QFPDQEEVR.2b4_1.heavy 857.405 / 695.33 1299.0 31.00547456741333 35 14 10 3 8 1.067580400006879 57.68340168417054 0.05669975280761719 4 0.9324895012713632 4.722833220397947 1299.0 13.829268631813123 1.0 - - - - - - - 172.57142857142858 2 7 MPL myeloproliferative leukemia virus oncogene 377 48 C20140710_OR014_02 C20140710_OR014_02 TB433631.[MT7]-YVC[CAM]QFPDQEEVR.2y7_1.heavy 857.405 / 872.411 1856.0 31.00547456741333 35 14 10 3 8 1.067580400006879 57.68340168417054 0.05669975280761719 4 0.9324895012713632 4.722833220397947 1856.0 0.5738641686182668 1.0 - - - - - - - 223.0 4 5 MPL myeloproliferative leukemia virus oncogene 379 49 C20140710_OR014_02 C20140710_OR014_02 TB433761.[MT7]-VSELMDFITQNLFTGLDRGQPLSK[MT7].4y4_1.heavy 750.154 / 588.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 381 49 C20140710_OR014_02 C20140710_OR014_02 TB433761.[MT7]-VSELMDFITQNLFTGLDRGQPLSK[MT7].4b7_1.heavy 750.154 / 966.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 383 49 C20140710_OR014_02 C20140710_OR014_02 TB433761.[MT7]-VSELMDFITQNLFTGLDRGQPLSK[MT7].4b4_1.heavy 750.154 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 385 49 C20140710_OR014_02 C20140710_OR014_02 TB433761.[MT7]-VSELMDFITQNLFTGLDRGQPLSK[MT7].4b6_1.heavy 750.154 / 819.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 387 50 C20140710_OR014_02 C20140710_OR014_02 TB425074.[MT7]-LLNLGLQC[CAM]LSC[CAM]GC[CAM]LPTR.3b6_1.heavy 707.036 / 768.51 720.0 44.215200424194336 36 11 10 5 10 0.8935379571378314 69.14419045246899 0.044597625732421875 3 0.8673619209695694 3.3504777234733694 720.0 2.7 3.0 - - - - - - - 0.0 1 0 RDH8 retinol dehydrogenase 8 (all-trans) 389 50 C20140710_OR014_02 C20140710_OR014_02 TB425074.[MT7]-LLNLGLQC[CAM]LSC[CAM]GC[CAM]LPTR.3y6_1.heavy 707.036 / 703.356 1680.0 44.215200424194336 36 11 10 5 10 0.8935379571378314 69.14419045246899 0.044597625732421875 3 0.8673619209695694 3.3504777234733694 1680.0 4.74 0.0 - - - - - - - 260.0 3 6 RDH8 retinol dehydrogenase 8 (all-trans) 391 50 C20140710_OR014_02 C20140710_OR014_02 TB425074.[MT7]-LLNLGLQC[CAM]LSC[CAM]GC[CAM]LPTR.3b5_1.heavy 707.036 / 655.426 1080.0 44.215200424194336 36 11 10 5 10 0.8935379571378314 69.14419045246899 0.044597625732421875 3 0.8673619209695694 3.3504777234733694 1080.0 8.841 2.0 - - - - - - - 216.0 2 10 RDH8 retinol dehydrogenase 8 (all-trans) 393 50 C20140710_OR014_02 C20140710_OR014_02 TB425074.[MT7]-LLNLGLQC[CAM]LSC[CAM]GC[CAM]LPTR.3y8_1.heavy 707.036 / 950.418 3961.0 44.215200424194336 36 11 10 5 10 0.8935379571378314 69.14419045246899 0.044597625732421875 3 0.8673619209695694 3.3504777234733694 3961.0 7.922 0.0 - - - - - - - 320.0 7 6 RDH8 retinol dehydrogenase 8 (all-trans) 395 51 C20140710_OR014_02 C20140710_OR014_02 TB424830.[MT7]-NIEEPQGVK[MT7].3y3_1.heavy 434.582 / 447.305 8604.0 22.986000061035156 48 18 10 10 10 3.9682665636856784 25.199920014224347 0.0 3 0.9857291454297799 10.318570683582683 8604.0 53.52977198697069 1.0 - - - - - - - 232.63636363636363 17 11 SLC26A4 solute carrier family 26, member 4 397 51 C20140710_OR014_02 C20140710_OR014_02 TB424830.[MT7]-NIEEPQGVK[MT7].3b4_1.heavy 434.582 / 630.321 4814.0 22.986000061035156 48 18 10 10 10 3.9682665636856784 25.199920014224347 0.0 3 0.9857291454297799 10.318570683582683 4814.0 39.70686657101865 0.0 - - - - - - - 307.3333333333333 9 3 SLC26A4 solute carrier family 26, member 4 399 51 C20140710_OR014_02 C20140710_OR014_02 TB424830.[MT7]-NIEEPQGVK[MT7].3y4_1.heavy 434.582 / 575.363 512.0 22.986000061035156 48 18 10 10 10 3.9682665636856784 25.199920014224347 0.0 3 0.9857291454297799 10.318570683582683 512.0 2.8689474116006233 6.0 - - - - - - - 184.2 2 10 SLC26A4 solute carrier family 26, member 4 401 51 C20140710_OR014_02 C20140710_OR014_02 TB424830.[MT7]-NIEEPQGVK[MT7].3b3_1.heavy 434.582 / 501.279 7682.0 22.986000061035156 48 18 10 10 10 3.9682665636856784 25.199920014224347 0.0 3 0.9857291454297799 10.318570683582683 7682.0 48.27891082317073 0.0 - - - - - - - 163.8 15 5 SLC26A4 solute carrier family 26, member 4 403 52 C20140710_OR014_02 C20140710_OR014_02 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 154239.0 38.105201721191406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 154239.0 875.306325 0.0 - - - - - - - 244.44444444444446 308 9 405 52 C20140710_OR014_02 C20140710_OR014_02 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 106095.0 38.105201721191406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 106095.0 559.9786488222699 0.0 - - - - - - - 171.42857142857142 212 7 407 52 C20140710_OR014_02 C20140710_OR014_02 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 165149.0 38.105201721191406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 165149.0 357.5444766891703 0.0 - - - - - - - 200.0 330 4 409 53 C20140710_OR014_02 C20140710_OR014_02 TB445885.[MT7]-GGGNQVSLLNIMMDLK[MT7].3b6_1.heavy 660.028 / 657.344 629.0 51.20667362213135 43 18 10 5 10 12.318154270327545 8.118099335781492 0.044300079345703125 3 0.9877891173937988 11.156961193581568 629.0 0.9515175565175562 0.0 - - - - - - - 0.0 1 0 CHD3;CHD5 chromodomain helicase DNA binding protein 3;chromodomain helicase DNA binding protein 5 411 53 C20140710_OR014_02 C20140710_OR014_02 TB445885.[MT7]-GGGNQVSLLNIMMDLK[MT7].3b5_1.heavy 660.028 / 558.275 2012.0 51.20667362213135 43 18 10 5 10 12.318154270327545 8.118099335781492 0.044300079345703125 3 0.9877891173937988 11.156961193581568 2012.0 14.42731746031746 0.0 - - - - - - - 141.625 4 8 CHD3;CHD5 chromodomain helicase DNA binding protein 3;chromodomain helicase DNA binding protein 5 413 53 C20140710_OR014_02 C20140710_OR014_02 TB445885.[MT7]-GGGNQVSLLNIMMDLK[MT7].3b7_1.heavy 660.028 / 744.376 377.0 51.20667362213135 43 18 10 5 10 12.318154270327545 8.118099335781492 0.044300079345703125 3 0.9877891173937988 11.156961193581568 377.0 0.44012738853503175 3.0 - - - - - - - 0.0 0 0 CHD3;CHD5 chromodomain helicase DNA binding protein 3;chromodomain helicase DNA binding protein 5 415 53 C20140710_OR014_02 C20140710_OR014_02 TB445885.[MT7]-GGGNQVSLLNIMMDLK[MT7].3y5_1.heavy 660.028 / 781.407 1069.0 51.20667362213135 43 18 10 5 10 12.318154270327545 8.118099335781492 0.044300079345703125 3 0.9877891173937988 11.156961193581568 1069.0 5.65758494379184 0.0 - - - - - - - 157.16666666666666 2 6 CHD3;CHD5 chromodomain helicase DNA binding protein 3;chromodomain helicase DNA binding protein 5 417 54 C20140710_OR014_02 C20140710_OR014_02 TB445743.[MT7]-SSNITDSLANR.2b8_1.heavy 661.345 / 962.491 254.0 25.84077501296997 38 13 10 5 10 3.9063185187170797 25.5995509636122 0.04450035095214844 3 0.9067477718167865 4.0095775922209285 254.0 0.77 17.0 - - - - - - - 0.0 1 0 GRIK1 glutamate receptor, ionotropic, kainate 1 419 54 C20140710_OR014_02 C20140710_OR014_02 TB445743.[MT7]-SSNITDSLANR.2y5_1.heavy 661.345 / 560.315 3176.0 25.84077501296997 38 13 10 5 10 3.9063185187170797 25.5995509636122 0.04450035095214844 3 0.9067477718167865 4.0095775922209285 3176.0 23.05732283464567 1.0 - - - - - - - 222.25 6 4 GRIK1 glutamate receptor, ionotropic, kainate 1 421 54 C20140710_OR014_02 C20140710_OR014_02 TB445743.[MT7]-SSNITDSLANR.2y10_1.heavy 661.345 / 1090.55 2286.0 25.84077501296997 38 13 10 5 10 3.9063185187170797 25.5995509636122 0.04450035095214844 3 0.9067477718167865 4.0095775922209285 2286.0 23.381999999999998 0.0 - - - - - - - 199.57142857142858 4 7 GRIK1 glutamate receptor, ionotropic, kainate 1 423 54 C20140710_OR014_02 C20140710_OR014_02 TB445743.[MT7]-SSNITDSLANR.2y7_1.heavy 661.345 / 776.39 2286.0 25.84077501296997 38 13 10 5 10 3.9063185187170797 25.5995509636122 0.04450035095214844 3 0.9067477718167865 4.0095775922209285 2286.0 18.0 0.0 - - - - - - - 190.5 4 2 GRIK1 glutamate receptor, ionotropic, kainate 1 425 55 C20140710_OR014_02 C20140710_OR014_02 TB445742.[MT7]-EVLPQYFK[MT7].3y3_1.heavy 437.923 / 601.347 5801.0 35.13719844818115 45 20 10 5 10 6.002118538915113 16.660783913487165 0.047199249267578125 3 0.9905108413423477 12.65914844650926 5801.0 59.01017241379311 0.0 - - - - - - - 193.33333333333334 11 3 HSF4 heat shock transcription factor 4 427 55 C20140710_OR014_02 C20140710_OR014_02 TB445742.[MT7]-EVLPQYFK[MT7].3b4_1.heavy 437.923 / 583.357 464.0 35.13719844818115 45 20 10 5 10 6.002118538915113 16.660783913487165 0.047199249267578125 3 0.9905108413423477 12.65914844650926 464.0 0.871111111111111 6.0 - - - - - - - 193.33333333333334 2 6 HSF4 heat shock transcription factor 4 429 55 C20140710_OR014_02 C20140710_OR014_02 TB445742.[MT7]-EVLPQYFK[MT7].3b5_1.heavy 437.923 / 711.416 1856.0 35.13719844818115 45 20 10 5 10 6.002118538915113 16.660783913487165 0.047199249267578125 3 0.9905108413423477 12.65914844650926 1856.0 15.84 1.0 - - - - - - - 116.0 4 1 HSF4 heat shock transcription factor 4 431 55 C20140710_OR014_02 C20140710_OR014_02 TB445742.[MT7]-EVLPQYFK[MT7].3b3_1.heavy 437.923 / 486.304 11254.0 35.13719844818115 45 20 10 5 10 6.002118538915113 16.660783913487165 0.047199249267578125 3 0.9905108413423477 12.65914844650926 11254.0 41.329344827586205 0.0 - - - - - - - 377.0 22 4 HSF4 heat shock transcription factor 4 433 56 C20140710_OR014_02 C20140710_OR014_02 TB445740.[MT7]-QQITHLHER.3y3_1.heavy 435.91 / 441.22 5170.0 17.173799514770508 47 17 10 10 10 3.936977548096508 19.729462206262045 0.0 3 0.9738428348996754 7.614051340770912 5170.0 107.70833333333334 0.0 - - - - - - - 323.0 10 2 C6orf204 chromosome 6 open reading frame 204 435 56 C20140710_OR014_02 C20140710_OR014_02 TB445740.[MT7]-QQITHLHER.3b3_1.heavy 435.91 / 514.311 1795.0 17.173799514770508 47 17 10 10 10 3.936977548096508 19.729462206262045 0.0 3 0.9738428348996754 7.614051340770912 1795.0 33.65625 0.0 - - - - - - - 161.625 3 8 C6orf204 chromosome 6 open reading frame 204 437 56 C20140710_OR014_02 C20140710_OR014_02 TB445740.[MT7]-QQITHLHER.3y4_1.heavy 435.91 / 554.305 3446.0 17.173799514770508 47 17 10 10 10 3.936977548096508 19.729462206262045 0.0 3 0.9738428348996754 7.614051340770912 3446.0 54.31679586563308 0.0 - - - - - - - 131.83333333333334 6 6 C6orf204 chromosome 6 open reading frame 204 439 56 C20140710_OR014_02 C20140710_OR014_02 TB445740.[MT7]-QQITHLHER.3y5_1.heavy 435.91 / 691.363 862.0 17.173799514770508 47 17 10 10 10 3.936977548096508 19.729462206262045 0.0 3 0.9738428348996754 7.614051340770912 862.0 17.958333333333332 2.0 - - - - - - - 0.0 1 0 C6orf204 chromosome 6 open reading frame 204 441 57 C20140710_OR014_02 C20140710_OR014_02 TB445611.[MT7]-DAAQELR.2y5_1.heavy 473.757 / 616.341 7076.0 23.29159927368164 35 5 10 10 10 1.1088834756603017 72.33506793400956 0.0 3 0.6711914752344267 2.090261250006819 7076.0 48.697912093407965 0.0 - - - - - - - 239.28571428571428 14 7 LOC55908 hepatocellular carcinoma-associated gene TD26 443 57 C20140710_OR014_02 C20140710_OR014_02 TB445611.[MT7]-DAAQELR.2b4_1.heavy 473.757 / 530.269 17133.0 23.29159927368164 35 5 10 10 10 1.1088834756603017 72.33506793400956 0.0 3 0.6711914752344267 2.090261250006819 17133.0 110.48157618532149 0.0 - - - - - - - 239.28571428571428 34 7 LOC55908 hepatocellular carcinoma-associated gene TD26 445 57 C20140710_OR014_02 C20140710_OR014_02 TB445611.[MT7]-DAAQELR.2y6_1.heavy 473.757 / 687.378 2793.0 23.29159927368164 35 5 10 10 10 1.1088834756603017 72.33506793400956 0.0 3 0.6711914752344267 2.090261250006819 2793.0 15.240867070794543 1.0 - - - - - - - 220.875 5 8 LOC55908 hepatocellular carcinoma-associated gene TD26 447 57 C20140710_OR014_02 C20140710_OR014_02 TB445611.[MT7]-DAAQELR.2b5_1.heavy 473.757 / 659.312 3352.0 23.29159927368164 35 5 10 10 10 1.1088834756603017 72.33506793400956 0.0 3 0.6711914752344267 2.090261250006819 3352.0 50.28 0.0 - - - - - - - 232.5 6 6 LOC55908 hepatocellular carcinoma-associated gene TD26 449 58 C20140710_OR014_02 C20140710_OR014_02 TB424867.[MT7]-SNDLARVPLK[MT7].3b4_1.heavy 467.62 / 574.295 2991.0 26.872400283813477 42 16 10 10 6 5.1831469470528 19.293298264842985 0.0 5 0.9694394097232886 7.041565548560688 2991.0 20.38736658080908 1.0 - - - - - - - 227.3 5 10 C6orf15 chromosome 6 open reading frame 15 451 58 C20140710_OR014_02 C20140710_OR014_02 TB424867.[MT7]-SNDLARVPLK[MT7].3b5_1.heavy 467.62 / 645.332 957.0 26.872400283813477 42 16 10 10 6 5.1831469470528 19.293298264842985 0.0 5 0.9694394097232886 7.041565548560688 957.0 0.6664345403899722 5.0 - - - - - - - 179.66666666666666 3 6 C6orf15 chromosome 6 open reading frame 15 453 58 C20140710_OR014_02 C20140710_OR014_02 TB424867.[MT7]-SNDLARVPLK[MT7].3y7_2.heavy 467.62 / 470.825 4666.0 26.872400283813477 42 16 10 10 6 5.1831469470528 19.293298264842985 0.0 5 0.9694394097232886 7.041565548560688 4666.0 51.880547818013 1.0 - - - - - - - 199.5 9 6 C6orf15 chromosome 6 open reading frame 15 455 58 C20140710_OR014_02 C20140710_OR014_02 TB424867.[MT7]-SNDLARVPLK[MT7].3y4_1.heavy 467.62 / 600.42 1436.0 26.872400283813477 42 16 10 10 6 5.1831469470528 19.293298264842985 0.0 5 0.9694394097232886 7.041565548560688 1436.0 4.599582463465553 2.0 - - - - - - - 239.33333333333334 5 3 C6orf15 chromosome 6 open reading frame 15 457 59 C20140710_OR014_02 C20140710_OR014_02 TB424864.[MT7]-TIELLGQEVSR.2y8_1.heavy 694.897 / 901.51 23504.0 36.44990158081055 45 15 10 10 10 4.756602939695965 21.023407096996806 0.0 3 0.9594600101289382 6.108609068306854 23504.0 80.39783972821056 0.0 - - - - - - - 282.4 47 5 LOC55908 hepatocellular carcinoma-associated gene TD26 459 59 C20140710_OR014_02 C20140710_OR014_02 TB424864.[MT7]-TIELLGQEVSR.2y6_1.heavy 694.897 / 675.342 36901.0 36.44990158081055 45 15 10 10 10 4.756602939695965 21.023407096996806 0.0 3 0.9594600101289382 6.108609068306854 36901.0 339.8471649837721 0.0 - - - - - - - 201.71428571428572 73 7 LOC55908 hepatocellular carcinoma-associated gene TD26 461 59 C20140710_OR014_02 C20140710_OR014_02 TB424864.[MT7]-TIELLGQEVSR.2y10_1.heavy 694.897 / 1143.64 13985.0 36.44990158081055 45 15 10 10 10 4.756602939695965 21.023407096996806 0.0 3 0.9594600101289382 6.108609068306854 13985.0 46.50998619477262 0.0 - - - - - - - 264.625 27 8 LOC55908 hepatocellular carcinoma-associated gene TD26 463 59 C20140710_OR014_02 C20140710_OR014_02 TB424864.[MT7]-TIELLGQEVSR.2y7_1.heavy 694.897 / 788.426 27029.0 36.44990158081055 45 15 10 10 10 4.756602939695965 21.023407096996806 0.0 3 0.9594600101289382 6.108609068306854 27029.0 189.17432720149478 0.0 - - - - - - - 268.85714285714283 54 7 LOC55908 hepatocellular carcinoma-associated gene TD26 465 60 C20140710_OR014_02 C20140710_OR014_02 TB424685.[MT7]-TNPLEGR.2y6_1.heavy 465.76 / 685.363 1828.0 22.28144931793213 44 20 8 6 10 163.62494446859137 0.6111537597447161 0.03989982604980469 3 0.9999431117188282 163.6247156396863 1828.0 16.749162561576355 0.0 - - - - - - - 203.125 3 8 C6orf204 chromosome 6 open reading frame 204 467 60 C20140710_OR014_02 C20140710_OR014_02 TB424685.[MT7]-TNPLEGR.2b3_1.heavy 465.76 / 457.253 N/A 22.28144931793213 44 20 8 6 10 163.62494446859137 0.6111537597447161 0.03989982604980469 3 0.9999431117188282 163.6247156396863 305.0 0.6507389162561577 29.0 - - - - - - - 237.16666666666666 4 12 C6orf204 chromosome 6 open reading frame 204 469 60 C20140710_OR014_02 C20140710_OR014_02 TB424685.[MT7]-TNPLEGR.2b5_1.heavy 465.76 / 699.379 N/A 22.28144931793213 44 20 8 6 10 163.62494446859137 0.6111537597447161 0.03989982604980469 3 0.9999431117188282 163.6247156396863 305.0 1.6517241379310343 6.0 - - - - - - - 0.0 1 0 C6orf204 chromosome 6 open reading frame 204 471 60 C20140710_OR014_02 C20140710_OR014_02 TB424685.[MT7]-TNPLEGR.2y5_1.heavy 465.76 / 571.32 1422.0 22.28144931793213 44 20 8 6 10 163.62494446859137 0.6111537597447161 0.03989982604980469 3 0.9999431117188282 163.6247156396863 1422.0 15.901723019916627 1.0 - - - - - - - 127.25 3 4 C6orf204 chromosome 6 open reading frame 204 473 61 C20140710_OR014_02 C20140710_OR014_02 TB445617.[MT7]-SHALEK[MT7].2y4_1.heavy 486.789 / 604.379 940.0 16.374099731445312 32 14 4 10 4 1.8028548769258197 55.467581600642944 0.0 8 0.9487843057974523 5.429872428003937 940.0 7.248756218905472 0.0 - - - - - - - 0.0 1 0 KCNK18;ZNF101 potassium channel, subfamily K, member 18;zinc finger protein 101 475 61 C20140710_OR014_02 C20140710_OR014_02 TB445617.[MT7]-SHALEK[MT7].2y5_1.heavy 486.789 / 741.438 201.0 16.374099731445312 32 14 4 10 4 1.8028548769258197 55.467581600642944 0.0 8 0.9487843057974523 5.429872428003937 201.0 5.97 4.0 - - - - - - - 0.0 0 0 KCNK18;ZNF101 potassium channel, subfamily K, member 18;zinc finger protein 101 477 61 C20140710_OR014_02 C20140710_OR014_02 TB445617.[MT7]-SHALEK[MT7].2b4_1.heavy 486.789 / 553.321 403.0 16.374099731445312 32 14 4 10 4 1.8028548769258197 55.467581600642944 0.0 8 0.9487843057974523 5.429872428003937 403.0 3.608955223880597 6.0 - - - - - - - 0.0 1 0 KCNK18;ZNF101 potassium channel, subfamily K, member 18;zinc finger protein 101 479 61 C20140710_OR014_02 C20140710_OR014_02 TB445617.[MT7]-SHALEK[MT7].2y3_1.heavy 486.789 / 533.341 403.0 16.374099731445312 32 14 4 10 4 1.8028548769258197 55.467581600642944 0.0 8 0.9487843057974523 5.429872428003937 403.0 6.6971539623312015 5.0 - - - - - - - 188.0 3 10 KCNK18;ZNF101 potassium channel, subfamily K, member 18;zinc finger protein 101 481 62 C20140710_OR014_02 C20140710_OR014_02 TB445887.[MT7]-RAQTLDRHAFLELK[MT7].4y3_1.heavy 497.293 / 533.341 5042.0 29.02995014190674 33 7 10 6 10 1.9391004639013283 34.39470802899399 0.037799835205078125 3 0.7341417035754919 2.3383466391487326 5042.0 65.24859234700926 0.0 - - - - - - - 190.25 10 8 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 483 62 C20140710_OR014_02 C20140710_OR014_02 TB445887.[MT7]-RAQTLDRHAFLELK[MT7].4b10_2.heavy 497.293 / 670.869 5137.0 29.02995014190674 33 7 10 6 10 1.9391004639013283 34.39470802899399 0.037799835205078125 3 0.7341417035754919 2.3383466391487326 5137.0 42.89845614035087 0.0 - - - - - - - 211.22222222222223 10 9 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 485 62 C20140710_OR014_02 C20140710_OR014_02 TB445887.[MT7]-RAQTLDRHAFLELK[MT7].4b9_2.heavy 497.293 / 597.335 6660.0 29.02995014190674 33 7 10 6 10 1.9391004639013283 34.39470802899399 0.037799835205078125 3 0.7341417035754919 2.3383466391487326 6660.0 33.037795275590554 0.0 - - - - - - - 249.625 13 8 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 487 62 C20140710_OR014_02 C20140710_OR014_02 TB445887.[MT7]-RAQTLDRHAFLELK[MT7].4b6_1.heavy 497.293 / 829.465 1617.0 29.02995014190674 33 7 10 6 10 1.9391004639013283 34.39470802899399 0.037799835205078125 3 0.7341417035754919 2.3383466391487326 1617.0 23.31884210526316 0.0 - - - - - - - 166.25 3 4 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 489 63 C20140710_OR014_02 C20140710_OR014_02 TB445897.[MT7]-VLFVDSVGLPAPPSIIK[MT7].4y4_1.heavy 510.814 / 604.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPL myeloproliferative leukemia virus oncogene 491 63 C20140710_OR014_02 C20140710_OR014_02 TB445897.[MT7]-VLFVDSVGLPAPPSIIK[MT7].4y5_1.heavy 510.814 / 701.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPL myeloproliferative leukemia virus oncogene 493 63 C20140710_OR014_02 C20140710_OR014_02 TB445897.[MT7]-VLFVDSVGLPAPPSIIK[MT7].4b5_1.heavy 510.814 / 718.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPL myeloproliferative leukemia virus oncogene 495 63 C20140710_OR014_02 C20140710_OR014_02 TB445897.[MT7]-VLFVDSVGLPAPPSIIK[MT7].4b3_1.heavy 510.814 / 504.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - MPL myeloproliferative leukemia virus oncogene 497 64 C20140710_OR014_02 C20140710_OR014_02 TB445752.[MT7]-DISEEILNK[MT7].3b6_1.heavy 450.257 / 831.422 1319.0 32.946250915527344 37 14 10 5 8 2.0603664285212813 38.39453923027092 0.04270172119140625 4 0.9410166230812387 5.0563765358578925 1319.0 10.387411539798402 1.0 - - - - - - - 120.0 2 1 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 499 64 C20140710_OR014_02 C20140710_OR014_02 TB445752.[MT7]-DISEEILNK[MT7].3y3_1.heavy 450.257 / 518.342 14746.0 32.946250915527344 37 14 10 5 8 2.0603664285212813 38.39453923027092 0.04270172119140625 4 0.9410166230812387 5.0563765358578925 14746.0 105.67966666666668 0.0 - - - - - - - 222.85714285714286 29 7 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 501 64 C20140710_OR014_02 C20140710_OR014_02 TB445752.[MT7]-DISEEILNK[MT7].3b4_1.heavy 450.257 / 589.295 6114.0 32.946250915527344 37 14 10 5 8 2.0603664285212813 38.39453923027092 0.04270172119140625 4 0.9410166230812387 5.0563765358578925 6114.0 59.102000000000004 1.0 - - - - - - - 240.0 15 3 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 503 64 C20140710_OR014_02 C20140710_OR014_02 TB445752.[MT7]-DISEEILNK[MT7].3b5_1.heavy 450.257 / 718.338 11989.0 32.946250915527344 37 14 10 5 8 2.0603664285212813 38.39453923027092 0.04270172119140625 4 0.9410166230812387 5.0563765358578925 11989.0 122.88725 0.0 - - - - - - - 330.0 23 4 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 505 65 C20140710_OR014_02 C20140710_OR014_02 TB445753.[MT7]-DLYLPASRK[MT7].3y6_1.heavy 450.938 / 815.522 746.0 26.73900032043457 46 16 10 10 10 2.7829890215547337 35.93258874738011 0.0 3 0.9631388040406359 6.408177011205059 746.0 3.206305624914143 0.0 - - - - - - - 0.0 1 0 RDH8 retinol dehydrogenase 8 (all-trans) 507 65 C20140710_OR014_02 C20140710_OR014_02 TB445753.[MT7]-DLYLPASRK[MT7].3b4_1.heavy 450.938 / 649.368 1740.0 26.73900032043457 46 16 10 10 10 2.7829890215547337 35.93258874738011 0.0 3 0.9631388040406359 6.408177011205059 1740.0 18.21375825884182 0.0 - - - - - - - 124.0 3 3 RDH8 retinol dehydrogenase 8 (all-trans) 509 65 C20140710_OR014_02 C20140710_OR014_02 TB445753.[MT7]-DLYLPASRK[MT7].3b3_1.heavy 450.938 / 536.284 2858.0 26.73900032043457 46 16 10 10 10 2.7829890215547337 35.93258874738011 0.0 3 0.9631388040406359 6.408177011205059 2858.0 12.627210447672631 0.0 - - - - - - - 348.2 5 5 RDH8 retinol dehydrogenase 8 (all-trans) 511 65 C20140710_OR014_02 C20140710_OR014_02 TB445753.[MT7]-DLYLPASRK[MT7].3y5_1.heavy 450.938 / 702.438 3604.0 26.73900032043457 46 16 10 10 10 2.7829890215547337 35.93258874738011 0.0 3 0.9631388040406359 6.408177011205059 3604.0 37.725508485555125 0.0 - - - - - - - 248.5 7 4 RDH8 retinol dehydrogenase 8 (all-trans) 513 66 C20140710_OR014_02 C20140710_OR014_02 TB424858.[MT7]-NDEMQETPNR.2b3_1.heavy 689.313 / 503.222 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPANXN5 SPANX family, member N5 515 66 C20140710_OR014_02 C20140710_OR014_02 TB424858.[MT7]-NDEMQETPNR.2y8_1.heavy 689.313 / 1004.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPANXN5 SPANX family, member N5 517 66 C20140710_OR014_02 C20140710_OR014_02 TB424858.[MT7]-NDEMQETPNR.2b4_1.heavy 689.313 / 634.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPANXN5 SPANX family, member N5 519 66 C20140710_OR014_02 C20140710_OR014_02 TB424858.[MT7]-NDEMQETPNR.2y7_1.heavy 689.313 / 875.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - SPANXN5 SPANX family, member N5 521 67 C20140710_OR014_02 C20140710_OR014_02 TB424679.[MT7]-ISVGELR.2y5_1.heavy 459.28 / 573.336 2881.0 30.08015012741089 47 20 10 7 10 9.943253205245908 10.057070652413994 0.029001235961914062 3 0.9964061576185266 20.580347592494245 2881.0 40.891612903225806 0.0 - - - - - - - 186.0 5 13 CABP2 calcium binding protein 2 523 67 C20140710_OR014_02 C20140710_OR014_02 TB424679.[MT7]-ISVGELR.2b4_1.heavy 459.28 / 501.315 2788.0 30.08015012741089 47 20 10 7 10 9.943253205245908 10.057070652413994 0.029001235961914062 3 0.9964061576185266 20.580347592494245 2788.0 17.487455197132615 0.0 - - - - - - - 232.5 5 8 CABP2 calcium binding protein 2 525 67 C20140710_OR014_02 C20140710_OR014_02 TB424679.[MT7]-ISVGELR.2y6_1.heavy 459.28 / 660.367 16914.0 30.08015012741089 47 20 10 7 10 9.943253205245908 10.057070652413994 0.029001235961914062 3 0.9964061576185266 20.580347592494245 16914.0 105.48516129032258 0.0 - - - - - - - 165.33333333333334 33 9 CABP2 calcium binding protein 2 527 67 C20140710_OR014_02 C20140710_OR014_02 TB424679.[MT7]-ISVGELR.2b5_1.heavy 459.28 / 630.358 6041.0 30.08015012741089 47 20 10 7 10 9.943253205245908 10.057070652413994 0.029001235961914062 3 0.9964061576185266 20.580347592494245 6041.0 82.17059139784946 0.0 - - - - - - - 158.1 12 10 CABP2 calcium binding protein 2 529 68 C20140710_OR014_02 C20140710_OR014_02 TB424677.[MT7]-ADAGPEGR.2y5_1.heavy 458.734 / 515.257 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHDC1 AT hook, DNA binding motif, containing 1 531 68 C20140710_OR014_02 C20140710_OR014_02 TB424677.[MT7]-ADAGPEGR.2b6_1.heavy 458.734 / 685.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHDC1 AT hook, DNA binding motif, containing 1 533 68 C20140710_OR014_02 C20140710_OR014_02 TB424677.[MT7]-ADAGPEGR.2y6_1.heavy 458.734 / 586.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHDC1 AT hook, DNA binding motif, containing 1 535 68 C20140710_OR014_02 C20140710_OR014_02 TB424677.[MT7]-ADAGPEGR.2y7_1.heavy 458.734 / 701.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHDC1 AT hook, DNA binding motif, containing 1 537 69 C20140710_OR014_02 C20140710_OR014_02 TB445602.[MT7]-VALLVTR.2y4_1.heavy 458.309 / 488.319 4094.0 32.77674865722656 30 5 10 5 10 6.670890284617227 14.99050287644447 0.0420989990234375 3 0.6650066213199194 2.0696577834377754 4094.0 3.8851720047449585 0.0 - - - - - - - 361.0 8 1 OPLAH 5-oxoprolinase (ATP-hydrolysing) 539 69 C20140710_OR014_02 C20140710_OR014_02 TB445602.[MT7]-VALLVTR.2y5_1.heavy 458.309 / 601.403 3733.0 32.77674865722656 30 5 10 5 10 6.670890284617227 14.99050287644447 0.0420989990234375 3 0.6650066213199194 2.0696577834377754 3733.0 4.646887966804979 0.0 - - - - - - - 264.8 7 5 OPLAH 5-oxoprolinase (ATP-hydrolysing) 541 69 C20140710_OR014_02 C20140710_OR014_02 TB445602.[MT7]-VALLVTR.2b4_1.heavy 458.309 / 541.383 4816.0 32.77674865722656 30 5 10 5 10 6.670890284617227 14.99050287644447 0.0420989990234375 3 0.6650066213199194 2.0696577834377754 4816.0 4.600955347871236 0.0 - - - - - - - 160.33333333333334 9 3 OPLAH 5-oxoprolinase (ATP-hydrolysing) 543 69 C20140710_OR014_02 C20140710_OR014_02 TB445602.[MT7]-VALLVTR.2y6_1.heavy 458.309 / 672.44 2769.0 32.77674865722656 30 5 10 5 10 6.670890284617227 14.99050287644447 0.0420989990234375 3 0.6650066213199194 2.0696577834377754 2769.0 13.645 1.0 - - - - - - - 180.5 5 2 OPLAH 5-oxoprolinase (ATP-hydrolysing) 545 70 C20140710_OR014_02 C20140710_OR014_02 TB424852.[MT7]-AQTGPPRVDK[MT7].3y3_1.heavy 452.933 / 505.31 438.0 18.900175094604492 39 14 10 5 10 2.4569329653737406 32.58381252683896 0.04109954833984375 3 0.9305081725847965 4.654229998427727 438.0 6.18 7.0 - - - - - - - 212.91666666666666 2 12 OPLAH 5-oxoprolinase (ATP-hydrolysing) 547 70 C20140710_OR014_02 C20140710_OR014_02 TB424852.[MT7]-AQTGPPRVDK[MT7].3y8_2.heavy 452.933 / 507.297 1096.0 18.900175094604492 39 14 10 5 10 2.4569329653737406 32.58381252683896 0.04109954833984375 3 0.9305081725847965 4.654229998427727 1096.0 9.608767123287672 0.0 - - - - - - - 200.75 2 8 OPLAH 5-oxoprolinase (ATP-hydrolysing) 549 70 C20140710_OR014_02 C20140710_OR014_02 TB424852.[MT7]-AQTGPPRVDK[MT7].3y9_2.heavy 452.933 / 571.326 2046.0 18.900175094604492 39 14 10 5 10 2.4569329653737406 32.58381252683896 0.04109954833984375 3 0.9305081725847965 4.654229998427727 2046.0 41.20027397260274 0.0 - - - - - - - 182.5 4 6 OPLAH 5-oxoprolinase (ATP-hydrolysing) 551 70 C20140710_OR014_02 C20140710_OR014_02 TB424852.[MT7]-AQTGPPRVDK[MT7].3b4_1.heavy 452.933 / 502.274 1973.0 18.900175094604492 39 14 10 5 10 2.4569329653737406 32.58381252683896 0.04109954833984375 3 0.9305081725847965 4.654229998427727 1973.0 4.3243835616438355 1.0 - - - - - - - 158.16666666666666 3 12 OPLAH 5-oxoprolinase (ATP-hydrolysing) 553 71 C20140710_OR014_02 C20140710_OR014_02 TB424678.[MT7]-LVPDGK[MT7].2y4_1.heavy 458.789 / 560.316 7715.0 24.355600357055664 46 18 10 10 8 4.730024455915263 21.141539738751717 0.0 4 0.9843054674599573 9.838265350097203 7715.0 22.937846258692574 0.0 - - - - - - - 124.0 15 2 GRIK1 glutamate receptor, ionotropic, kainate 1 555 71 C20140710_OR014_02 C20140710_OR014_02 TB424678.[MT7]-LVPDGK[MT7].2y5_1.heavy 458.789 / 659.385 1618.0 24.355600357055664 46 18 10 10 8 4.730024455915263 21.141539738751717 0.0 4 0.9843054674599573 9.838265350097203 1618.0 4.786366559485531 2.0 - - - - - - - 348.2 3 5 GRIK1 glutamate receptor, ionotropic, kainate 1 557 71 C20140710_OR014_02 C20140710_OR014_02 TB424678.[MT7]-LVPDGK[MT7].2b4_1.heavy 458.789 / 569.341 1244.0 24.355600357055664 46 18 10 10 8 4.730024455915263 21.141539738751717 0.0 4 0.9843054674599573 9.838265350097203 1244.0 4.733772911126184 0.0 - - - - - - - 248.5 2 4 GRIK1 glutamate receptor, ionotropic, kainate 1 559 71 C20140710_OR014_02 C20140710_OR014_02 TB424678.[MT7]-LVPDGK[MT7].2y3_1.heavy 458.789 / 463.263 747.0 24.355600357055664 46 18 10 10 8 4.730024455915263 21.141539738751717 0.0 4 0.9843054674599573 9.838265350097203 747.0 1.815132536944069 2.0 - - - - - - - 0.0 1 0 GRIK1 glutamate receptor, ionotropic, kainate 1 561 72 C20140710_OR014_02 C20140710_OR014_02 TB445608.[MT7]-ALTSQLR.2y4_1.heavy 466.786 / 503.294 2928.0 24.74400043487549 37 14 10 3 10 2.1894000493448216 35.435451581166554 0.05060005187988281 3 0.9412077026912636 5.064669112346433 2928.0 4.556283956493381 0.0 - - - - - - - 280.0 5 5 C6orf204 chromosome 6 open reading frame 204 563 72 C20140710_OR014_02 C20140710_OR014_02 TB445608.[MT7]-ALTSQLR.2y5_1.heavy 466.786 / 604.341 7510.0 24.74400043487549 37 14 10 3 10 2.1894000493448216 35.435451581166554 0.05060005187988281 3 0.9412077026912636 5.064669112346433 7510.0 75.24860864904976 0.0 - - - - - - - 222.75 15 4 C6orf204 chromosome 6 open reading frame 204 565 72 C20140710_OR014_02 C20140710_OR014_02 TB445608.[MT7]-ALTSQLR.2y6_1.heavy 466.786 / 717.425 5092.0 24.74400043487549 37 14 10 3 10 2.1894000493448216 35.435451581166554 0.05060005187988281 3 0.9412077026912636 5.064669112346433 5092.0 45.68710191650572 0.0 - - - - - - - 203.8 10 5 C6orf204 chromosome 6 open reading frame 204 567 72 C20140710_OR014_02 C20140710_OR014_02 TB445608.[MT7]-ALTSQLR.2b5_1.heavy 466.786 / 645.369 1655.0 24.74400043487549 37 14 10 3 10 2.1894000493448216 35.435451581166554 0.05060005187988281 3 0.9412077026912636 5.064669112346433 1655.0 13.301181102362206 2.0 - - - - - - - 254.66666666666666 3 3 C6orf204 chromosome 6 open reading frame 204 569 73 C20140710_OR014_02 C20140710_OR014_02 TB424850.[MT7]-QDLQGHLQK[MT7].2y4_1.heavy 677.888 / 669.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNK18 potassium channel, subfamily K, member 18 571 73 C20140710_OR014_02 C20140710_OR014_02 TB424850.[MT7]-QDLQGHLQK[MT7].2y8_1.heavy 677.888 / 1082.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNK18 potassium channel, subfamily K, member 18 573 73 C20140710_OR014_02 C20140710_OR014_02 TB424850.[MT7]-QDLQGHLQK[MT7].2y5_1.heavy 677.888 / 726.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNK18 potassium channel, subfamily K, member 18 575 73 C20140710_OR014_02 C20140710_OR014_02 TB424850.[MT7]-QDLQGHLQK[MT7].2b4_1.heavy 677.888 / 629.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNK18 potassium channel, subfamily K, member 18 577 74 C20140710_OR014_02 C20140710_OR014_02 TB424991.[MT7]-LLAQVSMAEFPGTDPETLHYFR.3b6_1.heavy 889.452 / 756.474 5010.0 44.37189865112305 50 20 10 10 10 33.90829066498449 2.9491312607882456 0.0 3 0.9998239876086324 93.02172262098259 5010.0 31.401488166768857 0.0 - - - - - - - 233.28571428571428 10 7 RDH8 retinol dehydrogenase 8 (all-trans) 579 74 C20140710_OR014_02 C20140710_OR014_02 TB424991.[MT7]-LLAQVSMAEFPGTDPETLHYFR.3b4_1.heavy 889.452 / 570.373 11302.0 44.37189865112305 50 20 10 10 10 33.90829066498449 2.9491312607882456 0.0 3 0.9998239876086324 93.02172262098259 11302.0 34.76294706723891 0.0 - - - - - - - 320.375 22 8 RDH8 retinol dehydrogenase 8 (all-trans) 581 74 C20140710_OR014_02 C20140710_OR014_02 TB424991.[MT7]-LLAQVSMAEFPGTDPETLHYFR.3b5_1.heavy 889.452 / 669.442 6292.0 44.37189865112305 50 20 10 10 10 33.90829066498449 2.9491312607882456 0.0 3 0.9998239876086324 93.02172262098259 6292.0 27.50502857142857 0.0 - - - - - - - 191.0909090909091 12 11 RDH8 retinol dehydrogenase 8 (all-trans) 583 74 C20140710_OR014_02 C20140710_OR014_02 TB424991.[MT7]-LLAQVSMAEFPGTDPETLHYFR.3y8_1.heavy 889.452 / 1062.54 18060.0 44.37189865112305 50 20 10 10 10 33.90829066498449 2.9491312607882456 0.0 3 0.9998239876086324 93.02172262098259 18060.0 52.90107296137339 0.0 - - - - - - - 303.2 36 10 RDH8 retinol dehydrogenase 8 (all-trans) 585 75 C20140710_OR014_02 C20140710_OR014_02 TB445899.[MT7]-SAWLGPAYREFEVLK[MT7].3y5_1.heavy 685.382 / 779.478 1179.0 42.16417407989502 33 8 10 5 10 0.6728950676414188 77.60265773314427 0.042301177978515625 3 0.7821325465997329 2.5944540972269627 1179.0 1.9491421176555168 2.0 - - - - - - - 236.0 2 11 LOC55908 hepatocellular carcinoma-associated gene TD26 587 75 C20140710_OR014_02 C20140710_OR014_02 TB445899.[MT7]-SAWLGPAYREFEVLK[MT7].3b4_1.heavy 685.382 / 602.342 2240.0 42.16417407989502 33 8 10 5 10 0.6728950676414188 77.60265773314427 0.042301177978515625 3 0.7821325465997329 2.5944540972269627 2240.0 0.4768033181799204 2.0 - - - - - - - 290.46153846153845 4 13 LOC55908 hepatocellular carcinoma-associated gene TD26 589 75 C20140710_OR014_02 C20140710_OR014_02 TB445899.[MT7]-SAWLGPAYREFEVLK[MT7].3y11_2.heavy 685.382 / 726.902 8017.0 42.16417407989502 33 8 10 5 10 0.6728950676414188 77.60265773314427 0.042301177978515625 3 0.7821325465997329 2.5944540972269627 8017.0 22.692378526281487 1.0 - - - - - - - 236.0 16 5 LOC55908 hepatocellular carcinoma-associated gene TD26 591 75 C20140710_OR014_02 C20140710_OR014_02 TB445899.[MT7]-SAWLGPAYREFEVLK[MT7].3b5_1.heavy 685.382 / 659.363 3065.0 42.16417407989502 33 8 10 5 10 0.6728950676414188 77.60265773314427 0.042301177978515625 3 0.7821325465997329 2.5944540972269627 3065.0 5.394915254237288 1.0 - - - - - - - 290.46153846153845 6 13 LOC55908 hepatocellular carcinoma-associated gene TD26 593 76 C20140710_OR014_02 C20140710_OR014_02 TB424992.[MT7]-DC[CAM]LVSY[MT7]YHFHR.4y4_1.heavy 446.975 / 596.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 595 76 C20140710_OR014_02 C20140710_OR014_02 TB424992.[MT7]-DC[CAM]LVSY[MT7]YHFHR.4b4_1.heavy 446.975 / 632.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 597 76 C20140710_OR014_02 C20140710_OR014_02 TB424992.[MT7]-DC[CAM]LVSY[MT7]YHFHR.4y3_1.heavy 446.975 / 459.246 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 599 76 C20140710_OR014_02 C20140710_OR014_02 TB424992.[MT7]-DC[CAM]LVSY[MT7]YHFHR.4b3_1.heavy 446.975 / 533.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 601 77 C20140710_OR014_02 C20140710_OR014_02 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 1186050.0 35.10179901123047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1186050.0 1354.1105043460245 0.0 - - - - - - - 243.75 2372 8 603 77 C20140710_OR014_02 C20140710_OR014_02 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 250276.0 35.10179901123047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 250276.0 412.8885483397386 0.0 - - - - - - - 226.42857142857142 500 7 605 77 C20140710_OR014_02 C20140710_OR014_02 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 403609.0 35.10179901123047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 403609.0 424.4613586587043 0.0 - - - - - - - 255.8 807 10 607 78 C20140710_OR014_02 C20140710_OR014_02 TB424994.[MT7]-WSPSGTSFLVSDQSR.2y5_1.heavy 899.448 / 592.268 1175.0 36.7681999206543 43 13 10 10 10 2.5792556638694455 26.4206730295257 0.0 3 0.9280837997291211 4.574158995599708 1175.0 11.961864406779661 0.0 - - - - - - - 211.8 2 5 HSF4 heat shock transcription factor 4 609 78 C20140710_OR014_02 C20140710_OR014_02 TB424994.[MT7]-WSPSGTSFLVSDQSR.2y6_1.heavy 899.448 / 691.337 940.0 36.7681999206543 43 13 10 10 10 2.5792556638694455 26.4206730295257 0.0 3 0.9280837997291211 4.574158995599708 940.0 6.0 1.0 - - - - - - - 0.0 1 0 HSF4 heat shock transcription factor 4 611 78 C20140710_OR014_02 C20140710_OR014_02 TB424994.[MT7]-WSPSGTSFLVSDQSR.2y11_1.heavy 899.448 / 1196.59 235.0 36.7681999206543 43 13 10 10 10 2.5792556638694455 26.4206730295257 0.0 3 0.9280837997291211 4.574158995599708 235.0 2.5747433619820423 28.0 - - - - - - - 0.0 1 0 HSF4 heat shock transcription factor 4 613 78 C20140710_OR014_02 C20140710_OR014_02 TB424994.[MT7]-WSPSGTSFLVSDQSR.2y7_1.heavy 899.448 / 804.421 823.0 36.7681999206543 43 13 10 10 10 2.5792556638694455 26.4206730295257 0.0 3 0.9280837997291211 4.574158995599708 823.0 2.4374808510638295 4.0 - - - - - - - 0.0 1 0 HSF4 heat shock transcription factor 4 615 79 C20140710_OR014_02 C20140710_OR014_02 TB424997.[MT7]-AILDLVLYYNWK[MT7].3b6_1.heavy 600.35 / 769.494 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 617 79 C20140710_OR014_02 C20140710_OR014_02 TB424997.[MT7]-AILDLVLYYNWK[MT7].3b4_1.heavy 600.35 / 557.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 619 79 C20140710_OR014_02 C20140710_OR014_02 TB424997.[MT7]-AILDLVLYYNWK[MT7].3b5_1.heavy 600.35 / 670.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 621 79 C20140710_OR014_02 C20140710_OR014_02 TB424997.[MT7]-AILDLVLYYNWK[MT7].3y5_1.heavy 600.35 / 917.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 623 80 C20140710_OR014_02 C20140710_OR014_02 TB445863.[MT7]-QSHILWALTGHVQR.4y5_1.heavy 448.254 / 596.326 5094.0 34.21879959106445 44 14 10 10 10 3.79493329839437 20.63959869772102 0.0 3 0.9363370623334513 4.86505349701344 5094.0 62.013988368533816 0.0 - - - - - - - 283.0 10 3 LOC55908 hepatocellular carcinoma-associated gene TD26 625 80 C20140710_OR014_02 C20140710_OR014_02 TB445863.[MT7]-QSHILWALTGHVQR.4y8_1.heavy 448.254 / 881.495 364.0 34.21879959106445 44 14 10 10 10 3.79493329839437 20.63959869772102 0.0 3 0.9363370623334513 4.86505349701344 364.0 0.8798679867986798 2.0 - - - - - - - 0.0 1 0 LOC55908 hepatocellular carcinoma-associated gene TD26 627 80 C20140710_OR014_02 C20140710_OR014_02 TB445863.[MT7]-QSHILWALTGHVQR.4y6_1.heavy 448.254 / 697.374 4730.0 34.21879959106445 44 14 10 10 10 3.79493329839437 20.63959869772102 0.0 3 0.9363370623334513 4.86505349701344 4730.0 78.14272727272729 0.0 - - - - - - - 283.0 9 3 LOC55908 hepatocellular carcinoma-associated gene TD26 629 80 C20140710_OR014_02 C20140710_OR014_02 TB445863.[MT7]-QSHILWALTGHVQR.4b3_1.heavy 448.254 / 497.259 11157.0 34.21879959106445 44 14 10 10 10 3.79493329839437 20.63959869772102 0.0 3 0.9363370623334513 4.86505349701344 11157.0 103.233407728635 0.0 - - - - - - - 161.5 22 6 LOC55908 hepatocellular carcinoma-associated gene TD26 631 81 C20140710_OR014_02 C20140710_OR014_02 TB445862.[MT7]-QSHILWALTGHVQR.3y7_1.heavy 597.336 / 810.458 10694.0 34.21879959106445 47 17 10 10 10 4.127594521697854 24.227185949182278 0.0 3 0.9786008087485516 8.421436352787847 10694.0 62.49168724279835 0.0 - - - - - - - 256.8888888888889 21 9 LOC55908 hepatocellular carcinoma-associated gene TD26 633 81 C20140710_OR014_02 C20140710_OR014_02 TB445862.[MT7]-QSHILWALTGHVQR.3y6_1.heavy 597.336 / 697.374 26613.0 34.21879959106445 47 17 10 10 10 4.127594521697854 24.227185949182278 0.0 3 0.9786008087485516 8.421436352787847 26613.0 97.08528460038985 0.0 - - - - - - - 260.7142857142857 53 7 LOC55908 hepatocellular carcinoma-associated gene TD26 635 81 C20140710_OR014_02 C20140710_OR014_02 TB445862.[MT7]-QSHILWALTGHVQR.3b4_1.heavy 597.336 / 610.343 14583.0 34.21879959106445 47 17 10 10 10 4.127594521697854 24.227185949182278 0.0 3 0.9786008087485516 8.421436352787847 14583.0 54.01111111111111 0.0 - - - - - - - 291.8666666666667 29 15 LOC55908 hepatocellular carcinoma-associated gene TD26 637 81 C20140710_OR014_02 C20140710_OR014_02 TB445862.[MT7]-QSHILWALTGHVQR.3y8_1.heavy 597.336 / 881.495 18228.0 34.21879959106445 47 17 10 10 10 4.127594521697854 24.227185949182278 0.0 3 0.9786008087485516 8.421436352787847 18228.0 196.70316595553555 0.0 - - - - - - - 182.625 36 8 LOC55908 hepatocellular carcinoma-associated gene TD26 639 82 C20140710_OR014_02 C20140710_OR014_02 TB424668.[MT7]-TPGGLFR.2y5_1.heavy 446.262 / 549.314 3430.0 30.029300689697266 50 20 10 10 10 3.253865428020265 30.73267847491854 0.0 3 0.9961920938476948 19.99315544056817 3430.0 5.859780100447944 0.0 - - - - - - - 175.11111111111111 6 9 DEFB116 defensin, beta 116 641 82 C20140710_OR014_02 C20140710_OR014_02 TB424668.[MT7]-TPGGLFR.2b4_1.heavy 446.262 / 457.253 1205.0 30.029300689697266 50 20 10 10 10 3.253865428020265 30.73267847491854 0.0 3 0.9961920938476948 19.99315544056817 1205.0 14.690802196952117 0.0 - - - - - - - 134.9090909090909 2 11 DEFB116 defensin, beta 116 643 82 C20140710_OR014_02 C20140710_OR014_02 TB424668.[MT7]-TPGGLFR.2y6_1.heavy 446.262 / 646.367 49221.0 30.029300689697266 50 20 10 10 10 3.253865428020265 30.73267847491854 0.0 3 0.9961920938476948 19.99315544056817 49221.0 577.2113599944262 0.0 - - - - - - - 185.46666666666667 98 15 DEFB116 defensin, beta 116 645 82 C20140710_OR014_02 C20140710_OR014_02 TB424668.[MT7]-TPGGLFR.2b5_1.heavy 446.262 / 570.337 2966.0 30.029300689697266 50 20 10 10 10 3.253865428020265 30.73267847491854 0.0 3 0.9961920938476948 19.99315544056817 2966.0 46.61041848299913 0.0 - - - - - - - 139.0 5 4 DEFB116 defensin, beta 116 647 83 C20140710_OR014_02 C20140710_OR014_02 TB445762.[MT7]-MLVNFVTEK[MT7].3y3_1.heavy 456.931 / 521.305 5518.0 38.7762508392334 34 11 10 3 10 0.6761699417160663 75.17703606165827 0.0691986083984375 3 0.8524201255053399 3.172174137084722 5518.0 110.36 0.0 - - - - - - - 325.75 11 4 OR8G5;OR8G2;OR8G1 olfactory receptor, family 8, subfamily G, member 5;olfactory receptor, family 8, subfamily G, member 2;olfactory receptor, family 8, subfamily G, member 1 649 83 C20140710_OR014_02 C20140710_OR014_02 TB445762.[MT7]-MLVNFVTEK[MT7].3b4_1.heavy 456.931 / 602.345 1505.0 38.7762508392334 34 11 10 3 10 0.6761699417160663 75.17703606165827 0.0691986083984375 3 0.8524201255053399 3.172174137084722 1505.0 0.0 0.0 - - - - - - - 225.75 3 4 OR8G5;OR8G2;OR8G1 olfactory receptor, family 8, subfamily G, member 5;olfactory receptor, family 8, subfamily G, member 2;olfactory receptor, family 8, subfamily G, member 1 651 83 C20140710_OR014_02 C20140710_OR014_02 TB445762.[MT7]-MLVNFVTEK[MT7].3b5_1.heavy 456.931 / 749.414 1204.0 38.7762508392334 34 11 10 3 10 0.6761699417160663 75.17703606165827 0.0691986083984375 3 0.8524201255053399 3.172174137084722 1204.0 12.04 0.0 - - - - - - - 200.5 2 4 OR8G5;OR8G2;OR8G1 olfactory receptor, family 8, subfamily G, member 5;olfactory receptor, family 8, subfamily G, member 2;olfactory receptor, family 8, subfamily G, member 1 653 83 C20140710_OR014_02 C20140710_OR014_02 TB445762.[MT7]-MLVNFVTEK[MT7].3b3_1.heavy 456.931 / 488.302 2709.0 38.7762508392334 34 11 10 3 10 0.6761699417160663 75.17703606165827 0.0691986083984375 3 0.8524201255053399 3.172174137084722 2709.0 26.955223880597014 0.0 - - - - - - - 200.75 5 4 OR8G5;OR8G2;OR8G1 olfactory receptor, family 8, subfamily G, member 5;olfactory receptor, family 8, subfamily G, member 2;olfactory receptor, family 8, subfamily G, member 1 655 84 C20140710_OR014_02 C20140710_OR014_02 TB424882.[MT7]-YMDVSGLASSSVPANEVPAR.3b6_1.heavy 732.036 / 797.362 8977.0 35.61579895019531 46 16 10 10 10 3.1488349067314876 31.757778023300908 0.0 3 0.9652471810981236 6.600875073788129 8977.0 73.55229218106996 0.0 - - - - - - - 254.8 17 10 HOXD13 homeobox D13 657 84 C20140710_OR014_02 C20140710_OR014_02 TB424882.[MT7]-YMDVSGLASSSVPANEVPAR.3b4_1.heavy 732.036 / 653.308 2911.0 35.61579895019531 46 16 10 10 10 3.1488349067314876 31.757778023300908 0.0 3 0.9652471810981236 6.600875073788129 2911.0 43.111669421487605 0.0 - - - - - - - 155.71428571428572 5 7 HOXD13 homeobox D13 659 84 C20140710_OR014_02 C20140710_OR014_02 TB424882.[MT7]-YMDVSGLASSSVPANEVPAR.3b3_1.heavy 732.036 / 554.24 6793.0 35.61579895019531 46 16 10 10 10 3.1488349067314876 31.757778023300908 0.0 3 0.9652471810981236 6.600875073788129 6793.0 22.59055361391186 0.0 - - - - - - - 202.0 13 6 HOXD13 homeobox D13 661 84 C20140710_OR014_02 C20140710_OR014_02 TB424882.[MT7]-YMDVSGLASSSVPANEVPAR.3y8_1.heavy 732.036 / 853.453 19167.0 35.61579895019531 46 16 10 10 10 3.1488349067314876 31.757778023300908 0.0 3 0.9652471810981236 6.600875073788129 19167.0 30.444512468939628 1.0 - - - - - - - 311.85714285714283 41 7 HOXD13 homeobox D13 663 85 C20140710_OR014_02 C20140710_OR014_02 TB445769.[MT7]-SSYDMYHLSR.3b4_1.heavy 468.223 / 597.264 5797.0 26.9822998046875 45 20 10 5 10 6.671158269010847 14.98990069903218 0.04399871826171875 3 0.9926866519348746 14.422455698154534 5797.0 44.74271825396825 0.0 - - - - - - - 252.0 11 6 KIR2DS2;LOC100287457;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL1;KIR3DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 665 85 C20140710_OR014_02 C20140710_OR014_02 TB445769.[MT7]-SSYDMYHLSR.3b5_1.heavy 468.223 / 728.304 756.0 26.9822998046875 45 20 10 5 10 6.671158269010847 14.98990069903218 0.04399871826171875 3 0.9926866519348746 14.422455698154534 756.0 4.8 0.0 - - - - - - - 0.0 1 0 KIR2DS2;LOC100287457;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL1;KIR3DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 667 85 C20140710_OR014_02 C20140710_OR014_02 TB445769.[MT7]-SSYDMYHLSR.3y4_1.heavy 468.223 / 512.294 3024.0 26.9822998046875 45 20 10 5 10 6.671158269010847 14.98990069903218 0.04399871826171875 3 0.9926866519348746 14.422455698154534 3024.0 15.8 0.0 - - - - - - - 189.0 6 6 KIR2DS2;LOC100287457;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL1;KIR3DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 669 85 C20140710_OR014_02 C20140710_OR014_02 TB445769.[MT7]-SSYDMYHLSR.3y5_1.heavy 468.223 / 675.357 1512.0 26.9822998046875 45 20 10 5 10 6.671158269010847 14.98990069903218 0.04399871826171875 3 0.9926866519348746 14.422455698154534 1512.0 18.36 0.0 - - - - - - - 126.0 3 4 KIR2DS2;LOC100287457;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL1;KIR3DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 671 86 C20140710_OR014_02 C20140710_OR014_02 TB433499.[MT7]-ISAATNLSER.3b4_1.heavy 402.558 / 487.3 402075.0 27.015324592590332 28 3 10 5 10 0.6770952302623806 97.51070917865967 0.044101715087890625 3 0.5998344440277875 1.8817522501775708 402075.0 1861.363649589413 0.0 - - - - - - - 186.5 804 6 HOXD13 homeobox D13 673 86 C20140710_OR014_02 C20140710_OR014_02 TB433499.[MT7]-ISAATNLSER.3y4_1.heavy 402.558 / 504.278 7331.0 27.015324592590332 28 3 10 5 10 0.6770952302623806 97.51070917865967 0.044101715087890625 3 0.5998344440277875 1.8817522501775708 7331.0 14.287392989793524 1.0 - - - - - - - 285.8 14 10 HOXD13 homeobox D13 675 86 C20140710_OR014_02 C20140710_OR014_02 TB433499.[MT7]-ISAATNLSER.3b3_1.heavy 402.558 / 416.263 65232.0 27.015324592590332 28 3 10 5 10 0.6770952302623806 97.51070917865967 0.044101715087890625 3 0.5998344440277875 1.8817522501775708 65232.0 284.56003323639385 0.0 - - - - - - - 199.0 130 5 HOXD13 homeobox D13 677 86 C20140710_OR014_02 C20140710_OR014_02 TB433499.[MT7]-ISAATNLSER.3y5_1.heavy 402.558 / 618.321 3479.0 27.015324592590332 28 3 10 5 10 0.6770952302623806 97.51070917865967 0.044101715087890625 3 0.5998344440277875 1.8817522501775708 3479.0 2.0835433985876466 1.0 - - - - - - - 310.75 8 8 HOXD13 homeobox D13 679 87 C20140710_OR014_02 C20140710_OR014_02 TB445767.[MT7]-DFAVSLARPK[MT7].3y7_1.heavy 464.613 / 914.59 2126.0 29.4685001373291 36 13 10 3 10 1.9883350642466282 40.07563697298203 0.06499862670898438 3 0.9012619458868867 3.894754902352234 2126.0 29.24876785433998 0.0 - - - - - - - 166.2 4 5 DEC1 deleted in esophageal cancer 1 681 87 C20140710_OR014_02 C20140710_OR014_02 TB445767.[MT7]-DFAVSLARPK[MT7].3y6_1.heavy 464.613 / 815.522 5362.0 29.4685001373291 36 13 10 3 10 1.9883350642466282 40.07563697298203 0.06499862670898438 3 0.9012619458868867 3.894754902352234 5362.0 40.5772972972973 0.0 - - - - - - - 258.8 10 5 DEC1 deleted in esophageal cancer 1 683 87 C20140710_OR014_02 C20140710_OR014_02 TB445767.[MT7]-DFAVSLARPK[MT7].3b3_1.heavy 464.613 / 478.242 8506.0 29.4685001373291 36 13 10 3 10 1.9883350642466282 40.07563697298203 0.06499862670898438 3 0.9012619458868867 3.894754902352234 8506.0 16.93835497835498 1.0 - - - - - - - 263.85714285714283 17 7 DEC1 deleted in esophageal cancer 1 685 87 C20140710_OR014_02 C20140710_OR014_02 TB445767.[MT7]-DFAVSLARPK[MT7].3y8_1.heavy 464.613 / 985.628 92.0 29.4685001373291 36 13 10 3 10 1.9883350642466282 40.07563697298203 0.06499862670898438 3 0.9012619458868867 3.894754902352234 92.0 1.2 7.0 - - - - - - - 0.0 0 0 DEC1 deleted in esophageal cancer 1 687 88 C20140710_OR014_02 C20140710_OR014_02 TB424886.[MT7]-DFDLDIISLK[MT7].2b3_1.heavy 733.921 / 522.232 9145.0 44.093674659729004 39 16 10 5 8 3.829275468017315 19.514185918909792 0.043697357177734375 4 0.9646046255462268 6.540330850718484 9145.0 91.41831254331254 0.0 - - - - - - - 280.8333333333333 18 6 GRIK1 glutamate receptor, ionotropic, kainate 1 689 88 C20140710_OR014_02 C20140710_OR014_02 TB424886.[MT7]-DFDLDIISLK[MT7].2y5_1.heavy 733.921 / 717.499 1925.0 44.093674659729004 39 16 10 5 8 3.829275468017315 19.514185918909792 0.043697357177734375 4 0.9646046255462268 6.540330850718484 1925.0 13.890927977839336 1.0 - - - - - - - 275.0 4 7 GRIK1 glutamate receptor, ionotropic, kainate 1 691 88 C20140710_OR014_02 C20140710_OR014_02 TB424886.[MT7]-DFDLDIISLK[MT7].2b6_1.heavy 733.921 / 863.427 481.0 44.093674659729004 39 16 10 5 8 3.829275468017315 19.514185918909792 0.043697357177734375 4 0.9646046255462268 6.540330850718484 481.0 2.46650895140665 11.0 - - - - - - - 240.54545454545453 3 11 GRIK1 glutamate receptor, ionotropic, kainate 1 693 88 C20140710_OR014_02 C20140710_OR014_02 TB424886.[MT7]-DFDLDIISLK[MT7].2b5_1.heavy 733.921 / 750.343 6618.0 44.093674659729004 39 16 10 5 8 3.829275468017315 19.514185918909792 0.043697357177734375 4 0.9646046255462268 6.540330850718484 6618.0 40.204268226801986 0.0 - - - - - - - 189.0 13 7 GRIK1 glutamate receptor, ionotropic, kainate 1 695 89 C20140710_OR014_02 C20140710_OR014_02 TB424665.[MT7]-DGSTMTFFK[MT7].3y3_1.heavy 441.228 / 585.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 697 89 C20140710_OR014_02 C20140710_OR014_02 TB424665.[MT7]-DGSTMTFFK[MT7].3b5_1.heavy 441.228 / 636.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 699 89 C20140710_OR014_02 C20140710_OR014_02 TB424665.[MT7]-DGSTMTFFK[MT7].3b3_1.heavy 441.228 / 404.19 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 701 89 C20140710_OR014_02 C20140710_OR014_02 TB424665.[MT7]-DGSTMTFFK[MT7].3y4_1.heavy 441.228 / 686.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 703 90 C20140710_OR014_02 C20140710_OR014_02 TB424887.[MT7]-DFDLDIISLK[MT7].3b6_1.heavy 489.616 / 863.427 842.0 44.12644958496094 32 7 10 5 10 7.511763457565993 13.312453269448744 0.043701171875 3 0.7146961147001113 2.2531809380077217 842.0 10.510442600276626 0.0 - - - - - - - 0.0 1 0 GRIK1 glutamate receptor, ionotropic, kainate 1 705 90 C20140710_OR014_02 C20140710_OR014_02 TB424887.[MT7]-DFDLDIISLK[MT7].3b4_1.heavy 489.616 / 635.316 842.0 44.12644958496094 32 7 10 5 10 7.511763457565993 13.312453269448744 0.043701171875 3 0.7146961147001113 2.2531809380077217 842.0 4.198337950138504 0.0 - - - - - - - 0.0 1 0 GRIK1 glutamate receptor, ionotropic, kainate 1 707 90 C20140710_OR014_02 C20140710_OR014_02 TB424887.[MT7]-DFDLDIISLK[MT7].3b5_1.heavy 489.616 / 750.343 722.0 44.12644958496094 32 7 10 5 10 7.511763457565993 13.312453269448744 0.043701171875 3 0.7146961147001113 2.2531809380077217 722.0 3.195850622406639 1.0 - - - - - - - 0.0 1 0 GRIK1 glutamate receptor, ionotropic, kainate 1 709 90 C20140710_OR014_02 C20140710_OR014_02 TB424887.[MT7]-DFDLDIISLK[MT7].3b3_1.heavy 489.616 / 522.232 2888.0 44.12644958496094 32 7 10 5 10 7.511763457565993 13.312453269448744 0.043701171875 3 0.7146961147001113 2.2531809380077217 2888.0 19.17344398340249 0.0 - - - - - - - 210.75 5 4 GRIK1 glutamate receptor, ionotropic, kainate 1 711 91 C20140710_OR014_02 C20140710_OR014_02 TB433495.[MT7]-HSNMASFVR.2y8_1.heavy 596.804 / 911.44 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 713 91 C20140710_OR014_02 C20140710_OR014_02 TB433495.[MT7]-HSNMASFVR.2y5_1.heavy 596.804 / 579.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 715 91 C20140710_OR014_02 C20140710_OR014_02 TB433495.[MT7]-HSNMASFVR.2b4_1.heavy 596.804 / 614.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 717 91 C20140710_OR014_02 C20140710_OR014_02 TB433495.[MT7]-HSNMASFVR.2y7_1.heavy 596.804 / 824.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 719 92 C20140710_OR014_02 C20140710_OR014_02 TB433490.[MT7]-GRDAAQELR.2y6_1.heavy 580.319 / 687.378 1523.0 17.674524784088135 35 11 10 6 8 2.139526311731363 46.739317694614975 0.03790092468261719 4 0.8592452408249033 3.2501240800986064 1523.0 5.6222654849810025 1.0 - - - - - - - 173.0 4 6 LOC55908 hepatocellular carcinoma-associated gene TD26 721 92 C20140710_OR014_02 C20140710_OR014_02 TB433490.[MT7]-GRDAAQELR.2b7_1.heavy 580.319 / 872.434 7337.0 17.674524784088135 35 11 10 6 8 2.139526311731363 46.739317694614975 0.03790092468261719 4 0.8592452408249033 3.2501240800986064 7337.0 138.07996794871795 0.0 - - - - - - - 147.0 14 8 LOC55908 hepatocellular carcinoma-associated gene TD26 723 92 C20140710_OR014_02 C20140710_OR014_02 TB433490.[MT7]-GRDAAQELR.2b5_1.heavy 580.319 / 615.333 415.0 17.674524784088135 35 11 10 6 8 2.139526311731363 46.739317694614975 0.03790092468261719 4 0.8592452408249033 3.2501240800986064 415.0 11.006521739130434 2.0 - - - - - - - 138.14285714285714 2 7 LOC55908 hepatocellular carcinoma-associated gene TD26 725 92 C20140710_OR014_02 C20140710_OR014_02 TB433490.[MT7]-GRDAAQELR.2y7_1.heavy 580.319 / 802.405 831.0 17.674524784088135 35 11 10 6 8 2.139526311731363 46.739317694614975 0.03790092468261719 4 0.8592452408249033 3.2501240800986064 831.0 11.200434782608694 0.0 - - - - - - - 0.0 1 0 LOC55908 hepatocellular carcinoma-associated gene TD26 727 93 C20140710_OR014_02 C20140710_OR014_02 TB445869.[MT7]-SLAGVAFSQLELRK[MT7].3y7_1.heavy 603.028 / 1017.62 4807.0 39.138266245524086 37 13 10 6 8 1.0057458912870896 65.3659390579912 0.035800933837890625 4 0.9027451037790569 3.92484368666913 4807.0 44.945449999999994 0.0 - - - - - - - 181.8181818181818 9 11 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 729 93 C20140710_OR014_02 C20140710_OR014_02 TB445869.[MT7]-SLAGVAFSQLELRK[MT7].3b6_1.heavy 603.028 / 643.39 4106.0 39.138266245524086 37 13 10 6 8 1.0057458912870896 65.3659390579912 0.035800933837890625 4 0.9027451037790569 3.92484368666913 4106.0 9.325190816868135 0.0 - - - - - - - 273.0 8 11 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 731 93 C20140710_OR014_02 C20140710_OR014_02 TB445869.[MT7]-SLAGVAFSQLELRK[MT7].3y8_1.heavy 603.028 / 1164.69 901.0 39.138266245524086 37 13 10 6 8 1.0057458912870896 65.3659390579912 0.035800933837890625 4 0.9027451037790569 3.92484368666913 901.0 8.289200000000001 1.0 - - - - - - - 166.77777777777777 2 9 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 733 93 C20140710_OR014_02 C20140710_OR014_02 TB445869.[MT7]-SLAGVAFSQLELRK[MT7].3y9_1.heavy 603.028 / 1235.72 N/A 39.138266245524086 37 13 10 6 8 1.0057458912870896 65.3659390579912 0.035800933837890625 4 0.9027451037790569 3.92484368666913 0.0 0.0 10.0 - - - - - - - 0.0 0 0 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 735 94 C20140710_OR014_02 C20140710_OR014_02 TB424983.[MT7]-ITIAILQLQEEGK[MT7].2y8_1.heavy 872.527 / 1088.61 2024.0 42.17474937438965 45 20 10 5 10 7.190271562804395 13.907680555113467 0.042301177978515625 3 0.9966901754077262 21.445689866648642 2024.0 20.281739283050328 0.0 - - - - - - - 230.83333333333334 4 6 GRIK1;GRIK2 glutamate receptor, ionotropic, kainate 1;glutamate receptor, ionotropic, kainate 2 737 94 C20140710_OR014_02 C20140710_OR014_02 TB424983.[MT7]-ITIAILQLQEEGK[MT7].2b4_1.heavy 872.527 / 543.362 6924.0 42.17474937438965 45 20 10 5 10 7.190271562804395 13.907680555113467 0.042301177978515625 3 0.9966901754077262 21.445689866648642 6924.0 68.30428326971173 0.0 - - - - - - - 124.66666666666667 13 6 GRIK1;GRIK2 glutamate receptor, ionotropic, kainate 1;glutamate receptor, ionotropic, kainate 2 739 94 C20140710_OR014_02 C20140710_OR014_02 TB424983.[MT7]-ITIAILQLQEEGK[MT7].2y6_1.heavy 872.527 / 847.464 2343.0 42.17474937438965 45 20 10 5 10 7.190271562804395 13.907680555113467 0.042301177978515625 3 0.9966901754077262 21.445689866648642 2343.0 17.27043783205625 0.0 - - - - - - - 258.85714285714283 4 7 GRIK1;GRIK2 glutamate receptor, ionotropic, kainate 1;glutamate receptor, ionotropic, kainate 2 741 94 C20140710_OR014_02 C20140710_OR014_02 TB424983.[MT7]-ITIAILQLQEEGK[MT7].2y7_1.heavy 872.527 / 975.523 2237.0 42.17474937438965 45 20 10 5 10 7.190271562804395 13.907680555113467 0.042301177978515625 3 0.9966901754077262 21.445689866648642 2237.0 27.19941121495327 0.0 - - - - - - - 186.625 4 8 GRIK1;GRIK2 glutamate receptor, ionotropic, kainate 1;glutamate receptor, ionotropic, kainate 2 743 95 C20140710_OR014_02 C20140710_OR014_02 TB433492.[MT7]-AQVVQIVK[MT7].2y5_1.heavy 586.884 / 730.494 3290.0 28.20509910583496 48 18 10 10 10 6.897866339815495 14.497236547305263 0.0 3 0.9869669206555303 10.798564736192597 3290.0 15.551092896174863 0.0 - - - - - - - 264.3333333333333 6 12 TMPRSS9 transmembrane protease, serine 9 745 95 C20140710_OR014_02 C20140710_OR014_02 TB433492.[MT7]-AQVVQIVK[MT7].2b4_1.heavy 586.884 / 542.342 1949.0 28.20509910583496 48 18 10 10 10 6.897866339815495 14.497236547305263 0.0 3 0.9869669206555303 10.798564736192597 1949.0 7.875431101779322 0.0 - - - - - - - 341.3 3 10 TMPRSS9 transmembrane protease, serine 9 747 95 C20140710_OR014_02 C20140710_OR014_02 TB433492.[MT7]-AQVVQIVK[MT7].2y3_1.heavy 586.884 / 503.367 2680.0 28.20509910583496 48 18 10 10 10 6.897866339815495 14.497236547305263 0.0 3 0.9869669206555303 10.798564736192597 2680.0 5.84675997053562 0.0 - - - - - - - 748.4285714285714 5 7 TMPRSS9 transmembrane protease, serine 9 749 95 C20140710_OR014_02 C20140710_OR014_02 TB433492.[MT7]-AQVVQIVK[MT7].2b5_1.heavy 586.884 / 670.4 3777.0 28.20509910583496 48 18 10 10 10 6.897866339815495 14.497236547305263 0.0 3 0.9869669206555303 10.798564736192597 3777.0 19.363688692900663 0.0 - - - - - - - 257.44444444444446 7 9 TMPRSS9 transmembrane protease, serine 9 751 96 C20140710_OR014_02 C20140710_OR014_02 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 12959.0 22.744699478149414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 12959.0 167.92704166666667 0.0 - - - - - - - 216.0 25 6 753 96 C20140710_OR014_02 C20140710_OR014_02 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 18899.0 22.744699478149414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 18899.0 231.92106172839507 0.0 - - - - - - - 216.0 37 3 755 96 C20140710_OR014_02 C20140710_OR014_02 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 53997.0 22.744699478149414 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 53997.0 232.12996031746033 0.0 - - - - - - - 262.2857142857143 107 7 757 97 C20140710_OR014_02 C20140710_OR014_02 TB424982.[MT7]-DSTEATVTYVNLER.3y7_1.heavy 581.296 / 894.468 7134.0 31.83174991607666 40 14 10 6 10 1.6176814477856274 42.913437605789895 0.03569984436035156 3 0.9378762115297666 4.925598565402751 7134.0 71.60709677419354 1.0 - - - - - - - 170.0 14 12 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 759 97 C20140710_OR014_02 C20140710_OR014_02 TB424982.[MT7]-DSTEATVTYVNLER.3b4_1.heavy 581.296 / 577.259 7690.0 31.83174991607666 40 14 10 6 10 1.6176814477856274 42.913437605789895 0.03569984436035156 3 0.9378762115297666 4.925598565402751 7690.0 11.741295455810803 0.0 - - - - - - - 311.6363636363636 15 11 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 761 97 C20140710_OR014_02 C20140710_OR014_02 TB424982.[MT7]-DSTEATVTYVNLER.3b5_1.heavy 581.296 / 648.296 10098.0 31.83174991607666 40 14 10 6 10 1.6176814477856274 42.913437605789895 0.03569984436035156 3 0.9378762115297666 4.925598565402751 10098.0 19.383237790361413 0.0 - - - - - - - 278.09090909090907 20 11 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 763 97 C20140710_OR014_02 C20140710_OR014_02 TB424982.[MT7]-DSTEATVTYVNLER.3y5_1.heavy 581.296 / 630.357 11210.0 31.83174991607666 40 14 10 6 10 1.6176814477856274 42.913437605789895 0.03569984436035156 3 0.9378762115297666 4.925598565402751 11210.0 62.661444914459565 0.0 - - - - - - - 254.75 22 12 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 765 98 C20140710_OR014_02 C20140710_OR014_02 TB445872.[MT7]-VLNQLEELLSDMK[MT7].3b6_1.heavy 607.341 / 841.49 410.0 53.870999336242676 38 12 10 6 10 1.1347009182659922 59.26066706928433 0.030399322509765625 3 0.8996202923607024 3.862226824267629 410.0 16.570833333333333 1.0 - - - - - - - 0.0 1 0 CHD3;CHD5 chromodomain helicase DNA binding protein 3;chromodomain helicase DNA binding protein 5 767 98 C20140710_OR014_02 C20140710_OR014_02 TB445872.[MT7]-VLNQLEELLSDMK[MT7].3b7_1.heavy 607.341 / 970.533 772.0 53.870999336242676 38 12 10 6 10 1.1347009182659922 59.26066706928433 0.030399322509765625 3 0.8996202923607024 3.862226824267629 772.0 5.361111111111111 0.0 - - - - - - - 0.0 1 0 CHD3;CHD5 chromodomain helicase DNA binding protein 3;chromodomain helicase DNA binding protein 5 769 98 C20140710_OR014_02 C20140710_OR014_02 TB445872.[MT7]-VLNQLEELLSDMK[MT7].3b4_1.heavy 607.341 / 599.363 458.0 53.870999336242676 38 12 10 6 10 1.1347009182659922 59.26066706928433 0.030399322509765625 3 0.8996202923607024 3.862226824267629 458.0 26.71666666666666 1.0 - - - - - - - 0.0 0 0 CHD3;CHD5 chromodomain helicase DNA binding protein 3;chromodomain helicase DNA binding protein 5 771 98 C20140710_OR014_02 C20140710_OR014_02 TB445872.[MT7]-VLNQLEELLSDMK[MT7].3y4_1.heavy 607.341 / 624.314 820.0 53.870999336242676 38 12 10 6 10 1.1347009182659922 59.26066706928433 0.030399322509765625 3 0.8996202923607024 3.862226824267629 820.0 10.930497925311201 0.0 - - - - - - - 0.0 1 0 CHD3;CHD5 chromodomain helicase DNA binding protein 3;chromodomain helicase DNA binding protein 5 773 99 C20140710_OR014_02 C20140710_OR014_02 TB424976.[MT7]-DK[MT7]QEQNIPVSK[MT7].2y4_1.heavy 859.494 / 574.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 775 99 C20140710_OR014_02 C20140710_OR014_02 TB424976.[MT7]-DK[MT7]QEQNIPVSK[MT7].2b6_1.heavy 859.494 / 1031.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 777 99 C20140710_OR014_02 C20140710_OR014_02 TB424976.[MT7]-DK[MT7]QEQNIPVSK[MT7].2b7_1.heavy 859.494 / 1144.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 779 99 C20140710_OR014_02 C20140710_OR014_02 TB424976.[MT7]-DK[MT7]QEQNIPVSK[MT7].2b5_1.heavy 859.494 / 917.493 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 781 100 C20140710_OR014_02 C20140710_OR014_02 TB445871.[MT7]-VDFEDFVELMGPK[MT7].3b6_1.heavy 605.314 / 897.411 48380.0 48.90610122680664 41 11 10 10 10 0.6975128156363739 77.00429718276841 0.0 3 0.8517274268629537 3.1645623575047592 48380.0 139.36211202031603 0.0 - - - - - - - 188.375 96 8 CABP2 calcium binding protein 2 783 100 C20140710_OR014_02 C20140710_OR014_02 TB445871.[MT7]-VDFEDFVELMGPK[MT7].3b5_1.heavy 605.314 / 750.343 47139.0 48.90610122680664 41 11 10 10 10 0.6975128156363739 77.00429718276841 0.0 3 0.8517274268629537 3.1645623575047592 47139.0 307.5174322870599 0.0 - - - - - - - 202.57142857142858 94 7 CABP2 calcium binding protein 2 785 100 C20140710_OR014_02 C20140710_OR014_02 TB445871.[MT7]-VDFEDFVELMGPK[MT7].3y4_1.heavy 605.314 / 576.33 56886.0 48.90610122680664 41 11 10 10 10 0.6975128156363739 77.00429718276841 0.0 3 0.8517274268629537 3.1645623575047592 56886.0 237.41039342147693 0.0 - - - - - - - 177.375 113 8 CABP2 calcium binding protein 2 787 100 C20140710_OR014_02 C20140710_OR014_02 TB445871.[MT7]-VDFEDFVELMGPK[MT7].3b8_1.heavy 605.314 / 1125.52 19937.0 48.90610122680664 41 11 10 10 10 0.6975128156363739 77.00429718276841 0.0 3 0.8517274268629537 3.1645623575047592 19937.0 40.32333528990294 1.0 - - - - - - - 232.625 44 8 CABP2 calcium binding protein 2 789 101 C20140710_OR014_02 C20140710_OR014_02 TB424877.[MT7]-FNNLEGFLEEFADISK[MT7].3b6_1.heavy 721.04 / 819.412 N/A N/A - - - - - - - - - 0.0 - - - - - - - CHD3;CHD5 chromodomain helicase DNA binding protein 3;chromodomain helicase DNA binding protein 5 791 101 C20140710_OR014_02 C20140710_OR014_02 TB424877.[MT7]-FNNLEGFLEEFADISK[MT7].3b4_1.heavy 721.04 / 633.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - CHD3;CHD5 chromodomain helicase DNA binding protein 3;chromodomain helicase DNA binding protein 5 793 101 C20140710_OR014_02 C20140710_OR014_02 TB424877.[MT7]-FNNLEGFLEEFADISK[MT7].3b3_1.heavy 721.04 / 520.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - CHD3;CHD5 chromodomain helicase DNA binding protein 3;chromodomain helicase DNA binding protein 5 795 101 C20140710_OR014_02 C20140710_OR014_02 TB424877.[MT7]-FNNLEGFLEEFADISK[MT7].3b7_1.heavy 721.04 / 966.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - CHD3;CHD5 chromodomain helicase DNA binding protein 3;chromodomain helicase DNA binding protein 5 797 102 C20140710_OR014_02 C20140710_OR014_02 TB424659.[MT7]-ASSSTLR.2y6_1.heavy 433.247 / 650.347 2286.0 16.304866790771484 41 20 10 5 6 4.532924068886282 16.599403900275924 0.04099845886230469 5 0.9964293304823153 20.647060493648674 2286.0 40.385999999999996 0.0 - - - - - - - 94.42857142857143 4 7 C6orf204 chromosome 6 open reading frame 204 799 102 C20140710_OR014_02 C20140710_OR014_02 TB424659.[MT7]-ASSSTLR.2b5_1.heavy 433.247 / 578.29 361.0 16.304866790771484 41 20 10 5 6 4.532924068886282 16.599403900275924 0.04099845886230469 5 0.9964293304823153 20.647060493648674 361.0 7.371580110497238 3.0 - - - - - - - 0.0 0 0 C6orf204 chromosome 6 open reading frame 204 801 102 C20140710_OR014_02 C20140710_OR014_02 TB424659.[MT7]-ASSSTLR.2b4_1.heavy 433.247 / 477.242 481.0 16.304866790771484 41 20 10 5 6 4.532924068886282 16.599403900275924 0.04099845886230469 5 0.9964293304823153 20.647060493648674 481.0 9.820195211786373 3.0 - - - - - - - 0.0 1 0 C6orf204 chromosome 6 open reading frame 204 803 102 C20140710_OR014_02 C20140710_OR014_02 TB424659.[MT7]-ASSSTLR.2b6_1.heavy 433.247 / 691.374 N/A 16.304866790771484 41 20 10 5 6 4.532924068886282 16.599403900275924 0.04099845886230469 5 0.9964293304823153 20.647060493648674 120.0 2.0979253112033196 17.0 - - - - - - - 0.0 0 0 C6orf204 chromosome 6 open reading frame 204 805 103 C20140710_OR014_02 C20140710_OR014_02 TB424658.[MT7]-VEIVPR.2y4_1.heavy 428.772 / 484.324 5890.0 26.96030044555664 47 17 10 10 10 4.149972193390095 24.096546998381314 0.0 3 0.9744901188427153 7.710465002986104 5890.0 19.292510326102654 0.0 - - - - - - - 269.7142857142857 11 7 FAM150B family with sequence similarity 150, member B 807 103 C20140710_OR014_02 C20140710_OR014_02 TB424658.[MT7]-VEIVPR.2b3_1.heavy 428.772 / 486.304 6001.0 26.96030044555664 47 17 10 10 10 4.149972193390095 24.096546998381314 0.0 3 0.9744901188427153 7.710465002986104 6001.0 25.22942942942943 0.0 - - - - - - - 222.0 12 5 FAM150B family with sequence similarity 150, member B 809 103 C20140710_OR014_02 C20140710_OR014_02 TB424658.[MT7]-VEIVPR.2y5_1.heavy 428.772 / 613.367 16781.0 26.96030044555664 47 17 10 10 10 4.149972193390095 24.096546998381314 0.0 3 0.9744901188427153 7.710465002986104 16781.0 187.37849073792893 0.0 - - - - - - - 111.0 33 5 FAM150B family with sequence similarity 150, member B 811 103 C20140710_OR014_02 C20140710_OR014_02 TB424658.[MT7]-VEIVPR.2b4_1.heavy 428.772 / 585.373 3334.0 26.96030044555664 47 17 10 10 10 4.149972193390095 24.096546998381314 0.0 3 0.9744901188427153 7.710465002986104 3334.0 28.934954954954957 1.0 - - - - - - - 166.5 6 2 FAM150B family with sequence similarity 150, member B 813 104 C20140710_OR014_02 C20140710_OR014_02 TB433488.[MT7]-LLDFLIK[MT7].2y4_1.heavy 575.378 / 664.451 7391.0 47.4049015045166 43 18 10 5 10 3.8125638603506107 20.76169823111134 0.042400360107421875 3 0.9895184272451067 12.043953534054525 7391.0 40.47521854379336 0.0 - - - - - - - 216.63636363636363 14 11 GRM1 glutamate receptor, metabotropic 1 815 104 C20140710_OR014_02 C20140710_OR014_02 TB433488.[MT7]-LLDFLIK[MT7].2b4_1.heavy 575.378 / 633.373 3695.0 47.4049015045166 43 18 10 5 10 3.8125638603506107 20.76169823111134 0.042400360107421875 3 0.9895184272451067 12.043953534054525 3695.0 31.050420168067227 0.0 - - - - - - - 158.66666666666666 7 6 GRM1 glutamate receptor, metabotropic 1 817 104 C20140710_OR014_02 C20140710_OR014_02 TB433488.[MT7]-LLDFLIK[MT7].2y3_1.heavy 575.378 / 517.383 3218.0 47.4049015045166 43 18 10 5 10 3.8125638603506107 20.76169823111134 0.042400360107421875 3 0.9895184272451067 12.043953534054525 3218.0 19.456362595352605 0.0 - - - - - - - 304.77777777777777 6 9 GRM1 glutamate receptor, metabotropic 1 819 104 C20140710_OR014_02 C20140710_OR014_02 TB433488.[MT7]-LLDFLIK[MT7].2y6_1.heavy 575.378 / 892.562 5364.0 47.4049015045166 43 18 10 5 10 3.8125638603506107 20.76169823111134 0.042400360107421875 3 0.9895184272451067 12.043953534054525 5364.0 44.17411764705882 0.0 - - - - - - - 178.5 10 2 GRM1 glutamate receptor, metabotropic 1 821 105 C20140710_OR014_02 C20140710_OR014_02 TB445778.[MT7]-LLAETADMIGVR.2y8_1.heavy 716.901 / 862.445 15042.0 42.2775993347168 42 12 10 10 10 2.005152223337344 39.83576762210861 0.0 3 0.8934149809008364 3.746098344083308 15042.0 173.79922660952963 0.0 - - - - - - - 145.4 30 5 CABP2 calcium binding protein 2 823 105 C20140710_OR014_02 C20140710_OR014_02 TB445778.[MT7]-LLAETADMIGVR.2y5_1.heavy 716.901 / 575.333 15163.0 42.2775993347168 42 12 10 10 10 2.005152223337344 39.83576762210861 0.0 3 0.8934149809008364 3.746098344083308 15163.0 162.80498365271092 0.0 - - - - - - - 303.3333333333333 30 6 CABP2 calcium binding protein 2 825 105 C20140710_OR014_02 C20140710_OR014_02 TB445778.[MT7]-LLAETADMIGVR.2y10_1.heavy 716.901 / 1062.52 30447.0 42.2775993347168 42 12 10 10 10 2.005152223337344 39.83576762210861 0.0 3 0.8934149809008364 3.746098344083308 30447.0 100.38024188507288 0.0 - - - - - - - 208.0 60 7 CABP2 calcium binding protein 2 827 105 C20140710_OR014_02 C20140710_OR014_02 TB445778.[MT7]-LLAETADMIGVR.2y11_1.heavy 716.901 / 1175.61 10553.0 42.2775993347168 42 12 10 10 10 2.005152223337344 39.83576762210861 0.0 3 0.8934149809008364 3.746098344083308 10553.0 68.79756161533939 0.0 - - - - - - - 277.42857142857144 21 7 CABP2 calcium binding protein 2 829 106 C20140710_OR014_02 C20140710_OR014_02 TB433484.[MT7]-LLGEVQALR.2y8_1.heavy 571.854 / 885.515 19695.0 37.4275016784668 50 20 10 10 10 18.267814040814763 5.474108712546315 0.0 3 0.996499440563415 20.85291970189778 19695.0 253.09802631578947 0.0 - - - - - - - 189.83333333333334 39 6 HSF4 heat shock transcription factor 4 831 106 C20140710_OR014_02 C20140710_OR014_02 TB433484.[MT7]-LLGEVQALR.2y5_1.heavy 571.854 / 586.367 4212.0 37.4275016784668 50 20 10 10 10 18.267814040814763 5.474108712546315 0.0 3 0.996499440563415 20.85291970189778 4212.0 0.36404690535046136 1.0 - - - - - - - 185.25 10 8 HSF4 heat shock transcription factor 4 833 106 C20140710_OR014_02 C20140710_OR014_02 TB433484.[MT7]-LLGEVQALR.2b4_1.heavy 571.854 / 557.341 7514.0 37.4275016784668 50 20 10 10 10 18.267814040814763 5.474108712546315 0.0 3 0.996499440563415 20.85291970189778 7514.0 20.59352161247955 0.0 - - - - - - - 270.625 15 8 HSF4 heat shock transcription factor 4 835 106 C20140710_OR014_02 C20140710_OR014_02 TB433484.[MT7]-LLGEVQALR.2y7_1.heavy 571.854 / 772.431 12751.0 37.4275016784668 50 20 10 10 10 18.267814040814763 5.474108712546315 0.0 3 0.996499440563415 20.85291970189778 12751.0 60.643660947239894 0.0 - - - - - - - 270.5 25 8 HSF4 heat shock transcription factor 4 837 107 C20140710_OR014_02 C20140710_OR014_02 TB433482.[MT7]-NVFLNQTR.2b3_1.heavy 568.321 / 505.289 12800.0 28.56542444229126 46 20 10 6 10 9.383756796550049 10.656712675755315 0.03930091857910156 3 0.9974516220588198 24.44208101045437 12800.0 50.45125348189415 1.0 - - - - - - - 256.7142857142857 25 7 MPL myeloproliferative leukemia virus oncogene 839 107 C20140710_OR014_02 C20140710_OR014_02 TB433482.[MT7]-NVFLNQTR.2y5_1.heavy 568.321 / 631.352 15193.0 28.56542444229126 46 20 10 6 10 9.383756796550049 10.656712675755315 0.03930091857910156 3 0.9974516220588198 24.44208101045437 15193.0 69.85589954979588 0.0 - - - - - - - 188.14285714285714 30 14 MPL myeloproliferative leukemia virus oncogene 841 107 C20140710_OR014_02 C20140710_OR014_02 TB433482.[MT7]-NVFLNQTR.2y6_1.heavy 568.321 / 778.421 19978.0 28.56542444229126 46 20 10 6 10 9.383756796550049 10.656712675755315 0.03930091857910156 3 0.9974516220588198 24.44208101045437 19978.0 52.50890023519709 0.0 - - - - - - - 259.3333333333333 39 6 MPL myeloproliferative leukemia virus oncogene 843 107 C20140710_OR014_02 C20140710_OR014_02 TB433482.[MT7]-NVFLNQTR.2y7_1.heavy 568.321 / 877.489 21533.0 28.56542444229126 46 20 10 6 10 9.383756796550049 10.656712675755315 0.03930091857910156 3 0.9974516220588198 24.44208101045437 21533.0 79.18830409629126 0.0 - - - - - - - 239.42857142857142 43 7 MPL myeloproliferative leukemia virus oncogene 845 108 C20140710_OR014_02 C20140710_OR014_02 TB433480.[MT7]-MAGSTLTFR.2b8_1.heavy 564.304 / 953.488 465.0 31.295900344848633 44 20 10 6 8 5.020360329874653 19.91888896996698 0.03260040283203125 4 0.9900202570861847 12.343571906825586 465.0 1.5 10.0 - - - - - - - 0.0 1 0 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 847 108 C20140710_OR014_02 C20140710_OR014_02 TB433480.[MT7]-MAGSTLTFR.2y8_1.heavy 564.304 / 852.457 7818.0 31.295900344848633 44 20 10 6 8 5.020360329874653 19.91888896996698 0.03260040283203125 4 0.9900202570861847 12.343571906825586 7818.0 118.53096774193548 0.0 - - - - - - - 220.875 15 8 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 849 108 C20140710_OR014_02 C20140710_OR014_02 TB433480.[MT7]-MAGSTLTFR.2b5_1.heavy 564.304 / 592.288 931.0 31.295900344848633 44 20 10 6 8 5.020360329874653 19.91888896996698 0.03260040283203125 4 0.9900202570861847 12.343571906825586 931.0 4.004301075268817 8.0 - - - - - - - 259.07142857142856 2 14 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 851 108 C20140710_OR014_02 C20140710_OR014_02 TB433480.[MT7]-MAGSTLTFR.2y7_1.heavy 564.304 / 781.42 3630.0 31.295900344848633 44 20 10 6 8 5.020360329874653 19.91888896996698 0.03260040283203125 4 0.9900202570861847 12.343571906825586 3630.0 7.494193548387097 1.0 - - - - - - - 178.25 7 12 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 853 109 C20140710_OR014_02 C20140710_OR014_02 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 91423.0 32.36949920654297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 91423.0 932.5868235681369 0.0 - - - - - - - 238.0 182 7 855 109 C20140710_OR014_02 C20140710_OR014_02 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 94755.0 32.36949920654297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 94755.0 521.2662515006002 0.0 - - - - - - - 343.0 189 6 857 109 C20140710_OR014_02 C20140710_OR014_02 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 185002.0 32.36949920654297 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 185002.0 26.12886229458148 1.0 - - - - - - - 245.0 390 10 859 110 C20140710_OR014_02 C20140710_OR014_02 TB445877.[MT7]-AHLGTASLLGLGGSPVK[MT7].4b7_1.heavy 467.282 / 782.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 861 110 C20140710_OR014_02 C20140710_OR014_02 TB445877.[MT7]-AHLGTASLLGLGGSPVK[MT7].4y6_1.heavy 467.282 / 688.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 863 110 C20140710_OR014_02 C20140710_OR014_02 TB445877.[MT7]-AHLGTASLLGLGGSPVK[MT7].4y3_1.heavy 467.282 / 487.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 865 110 C20140710_OR014_02 C20140710_OR014_02 TB445877.[MT7]-AHLGTASLLGLGGSPVK[MT7].4b6_1.heavy 467.282 / 695.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 867 111 C20140710_OR014_02 C20140710_OR014_02 TB445879.[MT7]-EDFLVK[MT7]PEVLQK[MT7].3y3_1.heavy 626.375 / 532.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 869 111 C20140710_OR014_02 C20140710_OR014_02 TB445879.[MT7]-EDFLVK[MT7]PEVLQK[MT7].3y6_1.heavy 626.375 / 857.521 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 871 111 C20140710_OR014_02 C20140710_OR014_02 TB445879.[MT7]-EDFLVK[MT7]PEVLQK[MT7].3b4_1.heavy 626.375 / 649.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 873 111 C20140710_OR014_02 C20140710_OR014_02 TB445879.[MT7]-EDFLVK[MT7]PEVLQK[MT7].3b3_1.heavy 626.375 / 536.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 875 112 C20140710_OR014_02 C20140710_OR014_02 TB445844.[MT7]-FLAPEASGRDSPGGAR.3y15_2.heavy 577.968 / 720.863 16463.0 26.211599349975586 40 10 10 10 10 2.799107087766046 28.61652096490691 0.0 3 0.8361318135678958 3.00606096459325 16463.0 50.86685186174594 0.0 - - - - - - - 329.2 32 5 C6orf204 chromosome 6 open reading frame 204 877 112 C20140710_OR014_02 C20140710_OR014_02 TB445844.[MT7]-FLAPEASGRDSPGGAR.3y6_1.heavy 577.968 / 544.284 12537.0 26.211599349975586 40 10 10 10 10 2.799107087766046 28.61652096490691 0.0 3 0.8361318135678958 3.00606096459325 12537.0 37.92627958579882 0.0 - - - - - - - 232.16666666666666 25 6 C6orf204 chromosome 6 open reading frame 204 879 112 C20140710_OR014_02 C20140710_OR014_02 TB445844.[MT7]-FLAPEASGRDSPGGAR.3y14_2.heavy 577.968 / 664.321 14944.0 26.211599349975586 40 10 10 10 10 2.799107087766046 28.61652096490691 0.0 3 0.8361318135678958 3.00606096459325 14944.0 52.81976951407865 0.0 - - - - - - - 221.75 29 4 C6orf204 chromosome 6 open reading frame 204 881 112 C20140710_OR014_02 C20140710_OR014_02 TB445844.[MT7]-FLAPEASGRDSPGGAR.3y13_2.heavy 577.968 / 628.802 13804.0 26.211599349975586 40 10 10 10 10 2.799107087766046 28.61652096490691 0.0 3 0.8361318135678958 3.00606096459325 13804.0 10.75814984921303 1.0 - - - - - - - 316.5 39 4 C6orf204 chromosome 6 open reading frame 204 883 113 C20140710_OR014_02 C20140710_OR014_02 TB445846.[MT7]-DSTEATVTYVNLER.2b4_1.heavy 871.44 / 577.259 3628.0 31.80537509918213 38 12 10 6 10 3.8974889654190616 25.657545380439043 0.034099578857421875 3 0.8848913154996504 3.6020653615089717 3628.0 32.32218181818182 0.0 - - - - - - - 220.0 7 4 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 885 113 C20140710_OR014_02 C20140710_OR014_02 TB445846.[MT7]-DSTEATVTYVNLER.2y9_1.heavy 871.44 / 1094.58 3189.0 31.80537509918213 38 12 10 6 10 3.8974889654190616 25.657545380439043 0.034099578857421875 3 0.8848913154996504 3.6020653615089717 3189.0 42.32672727272727 0.0 - - - - - - - 209.0 6 10 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 887 113 C20140710_OR014_02 C20140710_OR014_02 TB445846.[MT7]-DSTEATVTYVNLER.2y10_1.heavy 871.44 / 1165.62 1209.0 31.80537509918213 38 12 10 6 10 3.8974889654190616 25.657545380439043 0.034099578857421875 3 0.8848913154996504 3.6020653615089717 1209.0 14.282686363636364 0.0 - - - - - - - 206.25 2 8 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 889 113 C20140710_OR014_02 C20140710_OR014_02 TB445846.[MT7]-DSTEATVTYVNLER.2y7_1.heavy 871.44 / 894.468 1539.0 31.80537509918213 38 12 10 6 10 3.8974889654190616 25.657545380439043 0.034099578857421875 3 0.8848913154996504 3.6020653615089717 1539.0 4.197272727272727 0.0 - - - - - - - 188.57142857142858 3 7 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 891 114 C20140710_OR014_02 C20140710_OR014_02 TB425117.[MT7]-QIWALALTGPGAPSSLTSQK[MT7].3b6_1.heavy 772.105 / 827.49 7203.0 43.54494857788086 35 10 10 5 10 0.8644281482053786 72.44291473532023 0.04470062255859375 3 0.8295128670559748 2.9453979315288112 7203.0 21.006123085339166 0.0 - - - - - - - 228.6 14 10 HSF4 heat shock transcription factor 4 893 114 C20140710_OR014_02 C20140710_OR014_02 TB425117.[MT7]-QIWALALTGPGAPSSLTSQK[MT7].3b4_1.heavy 772.105 / 643.368 6746.0 43.54494857788086 35 10 10 5 10 0.8644281482053786 72.44291473532023 0.04470062255859375 3 0.8295128670559748 2.9453979315288112 6746.0 37.171836734693876 0.0 - - - - - - - 280.6363636363636 13 11 HSF4 heat shock transcription factor 4 895 114 C20140710_OR014_02 C20140710_OR014_02 TB425117.[MT7]-QIWALALTGPGAPSSLTSQK[MT7].3b3_1.heavy 772.105 / 572.331 3087.0 43.54494857788086 35 10 10 5 10 0.8644281482053786 72.44291473532023 0.04470062255859375 3 0.8295128670559748 2.9453979315288112 3087.0 14.04 0.0 - - - - - - - 274.3 6 10 HSF4 heat shock transcription factor 4 897 114 C20140710_OR014_02 C20140710_OR014_02 TB425117.[MT7]-QIWALALTGPGAPSSLTSQK[MT7].3y8_1.heavy 772.105 / 991.554 18294.0 43.54494857788086 35 10 10 5 10 0.8644281482053786 72.44291473532023 0.04470062255859375 3 0.8295128670559748 2.9453979315288112 18294.0 59.80730769230769 0.0 - - - - - - - 266.6666666666667 36 6 HSF4 heat shock transcription factor 4 899 115 C20140710_OR014_02 C20140710_OR014_02 TB433685.[MT7]-TSEYSTVLVLC[CAM]YRK[MT7].2b4_1.heavy 1004.04 / 625.295 1068.0 35.04270076751709 38 13 10 5 10 1.3116614317890403 51.165889981424286 0.047199249267578125 3 0.9158734167103798 4.22476954626615 1068.0 11.974789915966387 0.0 - - - - - - - 237.0 2 1 SPANXN5 SPANX family, member N5 901 115 C20140710_OR014_02 C20140710_OR014_02 TB433685.[MT7]-TSEYSTVLVLC[CAM]YRK[MT7].2y6_1.heavy 1004.04 / 982.562 1305.0 35.04270076751709 38 13 10 5 10 1.3116614317890403 51.165889981424286 0.047199249267578125 3 0.9158734167103798 4.22476954626615 1305.0 16.4727156685459 0.0 - - - - - - - 296.75 2 4 SPANXN5 SPANX family, member N5 903 115 C20140710_OR014_02 C20140710_OR014_02 TB433685.[MT7]-TSEYSTVLVLC[CAM]YRK[MT7].2b7_1.heavy 1004.04 / 912.443 475.0 35.04270076751709 38 13 10 5 10 1.3116614317890403 51.165889981424286 0.047199249267578125 3 0.9158734167103798 4.22476954626615 475.0 1.5631559473747876 7.0 - - - - - - - 0.0 1 0 SPANXN5 SPANX family, member N5 905 115 C20140710_OR014_02 C20140710_OR014_02 TB433685.[MT7]-TSEYSTVLVLC[CAM]YRK[MT7].2y7_1.heavy 1004.04 / 1095.65 1187.0 35.04270076751709 38 13 10 5 10 1.3116614317890403 51.165889981424286 0.047199249267578125 3 0.9158734167103798 4.22476954626615 1187.0 13.309059578887735 0.0 - - - - - - - 158.33333333333334 2 3 SPANXN5 SPANX family, member N5 907 116 C20140710_OR014_02 C20140710_OR014_02 TB425111.[MT7]-RMEGHC[CAM]EAEC[CAM]LTFEVK[MT7].4y4_1.heavy 571.775 / 666.394 4529.0 29.54949951171875 37 11 10 6 10 1.9461090592804922 41.21897693518463 0.03179931640625 3 0.8767669978411354 3.478840963789567 4529.0 30.562205727431042 0.0 - - - - - - - 224.73333333333332 9 15 DEFB107A;DEFB107B defensin, beta 107A;defensin, beta 107B 909 116 C20140710_OR014_02 C20140710_OR014_02 TB425111.[MT7]-RMEGHC[CAM]EAEC[CAM]LTFEVK[MT7].4b7_2.heavy 571.775 / 522.727 3951.0 29.54949951171875 37 11 10 6 10 1.9461090592804922 41.21897693518463 0.03179931640625 3 0.8767669978411354 3.478840963789567 3951.0 13.051534480035606 0.0 - - - - - - - 264.8333333333333 7 12 DEFB107A;DEFB107B defensin, beta 107A;defensin, beta 107B 911 116 C20140710_OR014_02 C20140710_OR014_02 TB425111.[MT7]-RMEGHC[CAM]EAEC[CAM]LTFEVK[MT7].4b5_1.heavy 571.775 / 755.374 2024.0 29.54949951171875 37 11 10 6 10 1.9461090592804922 41.21897693518463 0.03179931640625 3 0.8767669978411354 3.478840963789567 2024.0 8.389637305699482 0.0 - - - - - - - 176.5 4 12 DEFB107A;DEFB107B defensin, beta 107A;defensin, beta 107B 913 116 C20140710_OR014_02 C20140710_OR014_02 TB425111.[MT7]-RMEGHC[CAM]EAEC[CAM]LTFEVK[MT7].4b9_2.heavy 571.775 / 622.767 7516.0 29.54949951171875 37 11 10 6 10 1.9461090592804922 41.21897693518463 0.03179931640625 3 0.8767669978411354 3.478840963789567 7516.0 49.082729559478 0.0 - - - - - - - 250.6 15 10 DEFB107A;DEFB107B defensin, beta 107A;defensin, beta 107B 915 117 C20140710_OR014_02 C20140710_OR014_02 TB445847.[MT7]-ITIAILQLQEEGK[MT7].3b6_1.heavy 582.02 / 769.53 2556.0 42.17474937438965 38 13 10 5 10 1.6393336373719092 38.87633069597623 0.042301177978515625 3 0.9203758063101622 4.34425326427166 2556.0 27.68956891317547 0.0 - - - - - - - 208.71428571428572 5 7 GRIK1;GRIK2 glutamate receptor, ionotropic, kainate 1;glutamate receptor, ionotropic, kainate 2 917 117 C20140710_OR014_02 C20140710_OR014_02 TB445847.[MT7]-ITIAILQLQEEGK[MT7].3b4_1.heavy 582.02 / 543.362 13389.0 42.17474937438965 38 13 10 5 10 1.6393336373719092 38.87633069597623 0.042301177978515625 3 0.9203758063101622 4.34425326427166 13389.0 70.87059834263488 0.0 - - - - - - - 182.5 26 4 GRIK1;GRIK2 glutamate receptor, ionotropic, kainate 1;glutamate receptor, ionotropic, kainate 2 919 117 C20140710_OR014_02 C20140710_OR014_02 TB445847.[MT7]-ITIAILQLQEEGK[MT7].3b5_1.heavy 582.02 / 656.446 13633.0 42.17474937438965 38 13 10 5 10 1.6393336373719092 38.87633069597623 0.042301177978515625 3 0.9203758063101622 4.34425326427166 13633.0 62.32847613287953 0.0 - - - - - - - 257.0 27 9 GRIK1;GRIK2 glutamate receptor, ionotropic, kainate 1;glutamate receptor, ionotropic, kainate 2 921 117 C20140710_OR014_02 C20140710_OR014_02 TB445847.[MT7]-ITIAILQLQEEGK[MT7].3y4_1.heavy 582.02 / 606.321 7060.0 42.17474937438965 38 13 10 5 10 1.6393336373719092 38.87633069597623 0.042301177978515625 3 0.9203758063101622 4.34425326427166 7060.0 38.326754041287465 0.0 - - - - - - - 295.57142857142856 14 7 GRIK1;GRIK2 glutamate receptor, ionotropic, kainate 1;glutamate receptor, ionotropic, kainate 2 923 118 C20140710_OR014_02 C20140710_OR014_02 TB425011.[MT7]-EYMSPDIALLYLK[MT7].3y3_1.heavy 615.342 / 567.362 31164.0 46.4552001953125 43 13 10 10 10 1.779622642766535 43.364717606134974 0.0 3 0.901563529264597 3.9008183189654235 31164.0 336.76927446235334 0.0 - - - - - - - 258.85714285714283 62 7 OVCH1 ovochymase 1 925 118 C20140710_OR014_02 C20140710_OR014_02 TB425011.[MT7]-EYMSPDIALLYLK[MT7].3b6_1.heavy 615.342 / 867.367 21742.0 46.4552001953125 43 13 10 10 10 1.779622642766535 43.364717606134974 0.0 3 0.901563529264597 3.9008183189654235 21742.0 256.86106611570244 0.0 - - - - - - - 172.85714285714286 43 7 OVCH1 ovochymase 1 927 118 C20140710_OR014_02 C20140710_OR014_02 TB425011.[MT7]-EYMSPDIALLYLK[MT7].3b4_1.heavy 615.342 / 655.288 6764.0 46.4552001953125 43 13 10 10 10 1.779622642766535 43.364717606134974 0.0 3 0.901563529264597 3.9008183189654235 6764.0 23.22176283286928 0.0 - - - - - - - 261.6666666666667 13 6 OVCH1 ovochymase 1 929 118 C20140710_OR014_02 C20140710_OR014_02 TB425011.[MT7]-EYMSPDIALLYLK[MT7].3b8_1.heavy 615.342 / 1051.49 10267.0 46.4552001953125 43 13 10 10 10 1.779622642766535 43.364717606134974 0.0 3 0.901563529264597 3.9008183189654235 10267.0 43.241588597966214 0.0 - - - - - - - 241.6 20 5 OVCH1 ovochymase 1 931 119 C20140710_OR014_02 C20140710_OR014_02 TB445705.[MT7]-YSPLTTLK[MT7].2y5_1.heavy 605.868 / 719.478 2070.0 33.08522605895996 40 17 10 5 8 3.023235141019273 33.07714925749552 0.04270172119140625 4 0.9757532211680446 7.9095886323749 2070.0 5.417534246575342 1.0 - - - - - - - 243.57142857142858 4 7 RDH8 retinol dehydrogenase 8 (all-trans) 933 119 C20140710_OR014_02 C20140710_OR014_02 TB445705.[MT7]-YSPLTTLK[MT7].2y3_1.heavy 605.868 / 505.347 2800.0 33.08522605895996 40 17 10 5 8 3.023235141019273 33.07714925749552 0.04270172119140625 4 0.9757532211680446 7.9095886323749 2800.0 2.893927368812264 3.0 - - - - - - - 713.4285714285714 14 7 RDH8 retinol dehydrogenase 8 (all-trans) 935 119 C20140710_OR014_02 C20140710_OR014_02 TB445705.[MT7]-YSPLTTLK[MT7].2y6_1.heavy 605.868 / 816.531 9253.0 33.08522605895996 40 17 10 5 8 3.023235141019273 33.07714925749552 0.04270172119140625 4 0.9757532211680446 7.9095886323749 9253.0 46.6452602739726 0.0 - - - - - - - 298.90909090909093 18 11 RDH8 retinol dehydrogenase 8 (all-trans) 937 119 C20140710_OR014_02 C20140710_OR014_02 TB445705.[MT7]-YSPLTTLK[MT7].2y7_1.heavy 605.868 / 903.563 9010.0 33.08522605895996 40 17 10 5 8 3.023235141019273 33.07714925749552 0.04270172119140625 4 0.9757532211680446 7.9095886323749 9010.0 43.22112801696569 0.0 - - - - - - - 176.11111111111111 18 9 RDH8 retinol dehydrogenase 8 (all-trans) 939 120 C20140710_OR014_02 C20140710_OR014_02 TB425012.[MT7]-GYGVGTPIGSPYRDK[MT7].3y7_1.heavy 619.003 / 966.513 3675.0 27.79330062866211 43 13 10 10 10 3.129414126289038 31.95486310358779 0.0 3 0.9039701601081837 3.950217173998312 3675.0 43.60536113179449 0.0 - - - - - - - 222.375 7 8 GRIK1 glutamate receptor, ionotropic, kainate 1 941 120 C20140710_OR014_02 C20140710_OR014_02 TB425012.[MT7]-GYGVGTPIGSPYRDK[MT7].3b5_1.heavy 619.003 / 578.305 1897.0 27.79330062866211 43 13 10 10 10 3.129414126289038 31.95486310358779 0.0 3 0.9039701601081837 3.950217173998312 1897.0 9.431713483146067 0.0 - - - - - - - 296.625 3 8 GRIK1 glutamate receptor, ionotropic, kainate 1 943 120 C20140710_OR014_02 C20140710_OR014_02 TB425012.[MT7]-GYGVGTPIGSPYRDK[MT7].3y9_2.heavy 619.003 / 588.828 3913.0 27.79330062866211 43 13 10 10 10 3.129414126289038 31.95486310358779 0.0 3 0.9039701601081837 3.950217173998312 3913.0 12.752448983458706 0.0 - - - - - - - 286.5833333333333 7 12 GRIK1 glutamate receptor, ionotropic, kainate 1 945 120 C20140710_OR014_02 C20140710_OR014_02 TB425012.[MT7]-GYGVGTPIGSPYRDK[MT7].3y9_1.heavy 619.003 / 1176.65 949.0 27.79330062866211 43 13 10 10 10 3.129414126289038 31.95486310358779 0.0 3 0.9039701601081837 3.950217173998312 949.0 -0.24897468276408136 2.0 - - - - - - - 166.2 4 5 GRIK1 glutamate receptor, ionotropic, kainate 1 947 121 C20140710_OR014_02 C20140710_OR014_02 TB433586.[MT7]-LRESLTPDGSK[MT7].2b8_1.heavy 745.924 / 1056.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf204 chromosome 6 open reading frame 204 949 121 C20140710_OR014_02 C20140710_OR014_02 TB433586.[MT7]-LRESLTPDGSK[MT7].2y5_1.heavy 745.924 / 647.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf204 chromosome 6 open reading frame 204 951 121 C20140710_OR014_02 C20140710_OR014_02 TB433586.[MT7]-LRESLTPDGSK[MT7].2b6_1.heavy 745.924 / 844.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf204 chromosome 6 open reading frame 204 953 121 C20140710_OR014_02 C20140710_OR014_02 TB433586.[MT7]-LRESLTPDGSK[MT7].2y6_1.heavy 745.924 / 748.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf204 chromosome 6 open reading frame 204 955 122 C20140710_OR014_02 C20140710_OR014_02 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 209460.0 26.60700035095215 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 209460.0 452.2388446635927 0.0 - - - - - - - 1654.0 418 1 957 122 C20140710_OR014_02 C20140710_OR014_02 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 261205.0 26.60700035095215 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 261205.0 368.1927551125561 0.0 - - - - - - - 2245.0 522 1 959 122 C20140710_OR014_02 C20140710_OR014_02 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 361150.0 26.60700035095215 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 361150.0 353.1344281501402 0.0 - - - - - - - 2717.0 722 1 961 123 C20140710_OR014_02 C20140710_OR014_02 TB433585.[MT7]-TNPGLQTPQFSR.2y5_1.heavy 745.398 / 634.331 2198.0 28.72374963760376 17 5 2 6 4 0.7491079479146694 85.80947142235974 0.03940010070800781 8 0.6789213853605729 2.1168238540682367 2198.0 6.575164307173902 1.0 - - - - - - - 274.625 11 8 MPL myeloproliferative leukemia virus oncogene 963 123 C20140710_OR014_02 C20140710_OR014_02 TB433585.[MT7]-TNPGLQTPQFSR.2y10_1.heavy 745.398 / 1130.6 1099.0 28.72374963760376 17 5 2 6 4 0.7491079479146694 85.80947142235974 0.03940010070800781 8 0.6789213853605729 2.1168238540682367 1099.0 0.7194762684124387 2.0 - - - - - - - 331.42857142857144 3 7 MPL myeloproliferative leukemia virus oncogene 965 123 C20140710_OR014_02 C20140710_OR014_02 TB433585.[MT7]-TNPGLQTPQFSR.2y11_1.heavy 745.398 / 1244.64 122.0 28.72374963760376 17 5 2 6 4 0.7491079479146694 85.80947142235974 0.03940010070800781 8 0.6789213853605729 2.1168238540682367 122.0 -0.5 22.0 - - - - - - - 0.0 1 0 MPL myeloproliferative leukemia virus oncogene 967 123 C20140710_OR014_02 C20140710_OR014_02 TB433585.[MT7]-TNPGLQTPQFSR.2y7_1.heavy 745.398 / 863.437 611.0 28.72374963760376 17 5 2 6 4 0.7491079479146694 85.80947142235974 0.03940010070800781 8 0.6789213853605729 2.1168238540682367 611.0 1.7528688524590161 4.0 - - - - - - - 0.0 1 0 MPL myeloproliferative leukemia virus oncogene 969 124 C20140710_OR014_02 C20140710_OR014_02 TB425014.[MT7]-VLRDSVQRLEVQLR.3y6_1.heavy 619.038 / 757.457 4396.0 35.441650390625 35 18 4 5 8 5.23278782637935 19.110272252179506 0.0469970703125 4 0.9807108239017943 8.871661243225306 4396.0 34.25454545454546 1.0 - - - - - - - 260.125 15 8 LOC55908 hepatocellular carcinoma-associated gene TD26 971 124 C20140710_OR014_02 C20140710_OR014_02 TB425014.[MT7]-VLRDSVQRLEVQLR.3b10_2.heavy 619.038 / 670.892 2545.0 35.441650390625 35 18 4 5 8 5.23278782637935 19.110272252179506 0.0469970703125 4 0.9807108239017943 8.871661243225306 2545.0 15.027571456621132 0.0 - - - - - - - 205.66666666666666 5 9 LOC55908 hepatocellular carcinoma-associated gene TD26 973 124 C20140710_OR014_02 C20140710_OR014_02 TB425014.[MT7]-VLRDSVQRLEVQLR.3y4_1.heavy 619.038 / 515.33 2545.0 35.441650390625 35 18 4 5 8 5.23278782637935 19.110272252179506 0.0469970703125 4 0.9807108239017943 8.871661243225306 2545.0 9.889616287757498 2.0 - - - - - - - 308.3333333333333 5 9 LOC55908 hepatocellular carcinoma-associated gene TD26 975 124 C20140710_OR014_02 C20140710_OR014_02 TB425014.[MT7]-VLRDSVQRLEVQLR.3y5_1.heavy 619.038 / 644.373 2082.0 35.441650390625 35 18 4 5 8 5.23278782637935 19.110272252179506 0.0469970703125 4 0.9807108239017943 8.871661243225306 2082.0 1.1127101605070986 4.0 - - - - - - - 318.125 5 8 LOC55908 hepatocellular carcinoma-associated gene TD26 977 125 C20140710_OR014_02 C20140710_OR014_02 TB424771.[MT7]-IYSNAGEK[MT7].2y4_1.heavy 585.324 / 548.316 1559.0 21.00309944152832 48 20 10 10 8 8.911401136401816 11.221579914242007 0.0 4 0.990324900641049 12.536718566848167 1559.0 4.117658673381788 0.0 - - - - - - - 220.54545454545453 3 11 GRM1 glutamate receptor, metabotropic 1 979 125 C20140710_OR014_02 C20140710_OR014_02 TB424771.[MT7]-IYSNAGEK[MT7].2y5_1.heavy 585.324 / 662.359 693.0 21.00309944152832 48 20 10 10 8 8.911401136401816 11.221579914242007 0.0 4 0.990324900641049 12.536718566848167 693.0 7.646896551724137 0.0 - - - - - - - 0.0 1 0 GRM1 glutamate receptor, metabotropic 1 981 125 C20140710_OR014_02 C20140710_OR014_02 TB424771.[MT7]-IYSNAGEK[MT7].2y6_1.heavy 585.324 / 749.391 1732.0 21.00309944152832 48 20 10 10 8 8.911401136401816 11.221579914242007 0.0 4 0.990324900641049 12.536718566848167 1732.0 4.82923076923077 2.0 - - - - - - - 188.52941176470588 7 17 GRM1 glutamate receptor, metabotropic 1 983 125 C20140710_OR014_02 C20140710_OR014_02 TB424771.[MT7]-IYSNAGEK[MT7].2y7_1.heavy 585.324 / 912.454 3985.0 21.00309944152832 48 20 10 10 8 8.911401136401816 11.221579914242007 0.0 4 0.990324900641049 12.536718566848167 3985.0 56.41908511062388 0.0 - - - - - - - 115.77777777777777 7 9 GRM1 glutamate receptor, metabotropic 1 985 126 C20140710_OR014_02 C20140710_OR014_02 TB425019.[MT7]-TVQTIVFLYSLYK[MT7].3b6_1.heavy 621.701 / 786.484 4197.0 49.380001068115234 41 11 10 10 10 2.253938416432532 35.43413356642642 0.0 3 0.8738734277072387 3.437834953270214 4197.0 15.794280970211698 0.0 - - - - - - - 193.8 8 5 CHD5 chromodomain helicase DNA binding protein 5 987 126 C20140710_OR014_02 C20140710_OR014_02 TB425019.[MT7]-TVQTIVFLYSLYK[MT7].3b4_1.heavy 621.701 / 574.332 2260.0 49.380001068115234 41 11 10 10 10 2.253938416432532 35.43413356642642 0.0 3 0.8738734277072387 3.437834953270214 2260.0 11.290577225979801 0.0 - - - - - - - 188.25 4 4 CHD5 chromodomain helicase DNA binding protein 5 989 126 C20140710_OR014_02 C20140710_OR014_02 TB425019.[MT7]-TVQTIVFLYSLYK[MT7].3b5_1.heavy 621.701 / 687.416 969.0 49.380001068115234 41 11 10 10 10 2.253938416432532 35.43413356642642 0.0 3 0.8738734277072387 3.437834953270214 969.0 4.215 0.0 - - - - - - - 0.0 1 0 CHD5 chromodomain helicase DNA binding protein 5 991 126 C20140710_OR014_02 C20140710_OR014_02 TB425019.[MT7]-TVQTIVFLYSLYK[MT7].3y4_1.heavy 621.701 / 654.394 2153.0 49.380001068115234 41 11 10 10 10 2.253938416432532 35.43413356642642 0.0 3 0.8738734277072387 3.437834953270214 2153.0 4.478979073416853 1.0 - - - - - - - 242.25 5 8 CHD5 chromodomain helicase DNA binding protein 5 993 127 C20140710_OR014_02 C20140710_OR014_02 TB445902.[MT7]-GVNIGDVGC[CAM]YIYDPVK[MT7].3b9_1.heavy 686.359 / 1016.5 7487.0 41.301249504089355 46 20 10 6 10 4.949038691793188 20.205944270717946 0.036602020263671875 3 0.9911100423110631 13.07947339507416 7487.0 59.130973451327435 1.0 - - - - - - - 150.88888888888889 14 9 CRIP3 cysteine-rich protein 3 995 127 C20140710_OR014_02 C20140710_OR014_02 TB445902.[MT7]-GVNIGDVGC[CAM]YIYDPVK[MT7].3b6_1.heavy 686.359 / 700.375 21667.0 41.301249504089355 46 20 10 6 10 4.949038691793188 20.205944270717946 0.036602020263671875 3 0.9911100423110631 13.07947339507416 21667.0 265.1717792678648 0.0 - - - - - - - 260.7 43 10 CRIP3 cysteine-rich protein 3 997 127 C20140710_OR014_02 C20140710_OR014_02 TB445902.[MT7]-GVNIGDVGC[CAM]YIYDPVK[MT7].3b4_1.heavy 686.359 / 528.326 7941.0 41.301249504089355 46 20 10 6 10 4.949038691793188 20.205944270717946 0.036602020263671875 3 0.9911100423110631 13.07947339507416 7941.0 25.268753234039576 0.0 - - - - - - - 260.8 15 10 CRIP3 cysteine-rich protein 3 999 127 C20140710_OR014_02 C20140710_OR014_02 TB445902.[MT7]-GVNIGDVGC[CAM]YIYDPVK[MT7].3b7_1.heavy 686.359 / 799.443 6353.0 41.301249504089355 46 20 10 6 10 4.949038691793188 20.205944270717946 0.036602020263671875 3 0.9911100423110631 13.07947339507416 6353.0 77.74629566098787 0.0 - - - - - - - 155.75 12 8 CRIP3 cysteine-rich protein 3 1001 128 C20140710_OR014_02 C20140710_OR014_02 TB445650.[MT7]-NAPTMEK[MT7].2y4_1.heavy 539.794 / 652.346 3359.0 19.788424968719482 44 18 10 6 10 2.4744873507579426 31.034275987312434 0.03610038757324219 3 0.9877430099294183 11.135913713873771 3359.0 56.63430232558139 0.0 - - - - - - - 147.42857142857142 6 7 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1003 128 C20140710_OR014_02 C20140710_OR014_02 TB445650.[MT7]-NAPTMEK[MT7].2y5_1.heavy 539.794 / 749.398 15072.0 19.788424968719482 44 18 10 6 10 2.4744873507579426 31.034275987312434 0.03610038757324219 3 0.9877430099294183 11.135913713873771 15072.0 145.674492653014 0.0 - - - - - - - 244.0 30 6 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1005 128 C20140710_OR014_02 C20140710_OR014_02 TB445650.[MT7]-NAPTMEK[MT7].2y3_1.heavy 539.794 / 551.298 3617.0 19.788424968719482 44 18 10 6 10 2.4744873507579426 31.034275987312434 0.03610038757324219 3 0.9877430099294183 11.135913713873771 3617.0 23.131976744186048 0.0 - - - - - - - 125.6923076923077 7 13 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1007 128 C20140710_OR014_02 C20140710_OR014_02 TB445650.[MT7]-NAPTMEK[MT7].2y6_1.heavy 539.794 / 820.435 7149.0 19.788424968719482 44 18 10 6 10 2.4744873507579426 31.034275987312434 0.03610038757324219 3 0.9877430099294183 11.135913713873771 7149.0 166.25581395348837 0.0 - - - - - - - 86.0 14 1 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1009 129 C20140710_OR014_02 C20140710_OR014_02 TB424758.[MT7]-TAISTNIK[MT7].2y4_1.heavy 568.35 / 619.39 493.0 24.512800216674805 34 16 8 10 0 3.3825119769394467 29.563827321753244 0.0 26 0.9689352535610583 6.98389552910237 493.0 1.92 17.0 - - - - - - - 320.4 3 5 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1011 129 C20140710_OR014_02 C20140710_OR014_02 TB424758.[MT7]-TAISTNIK[MT7].2y5_1.heavy 568.35 / 706.422 2219.0 24.512800216674805 34 16 8 10 0 3.3825119769394467 29.563827321753244 0.0 26 0.9689352535610583 6.98389552910237 2219.0 26.287710970672457 3.0 - - - - - - - 185.0 5 4 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1013 129 C20140710_OR014_02 C20140710_OR014_02 TB424758.[MT7]-TAISTNIK[MT7].2y3_1.heavy 568.35 / 518.342 740.0 24.512800216674805 34 16 8 10 0 3.3825119769394467 29.563827321753244 0.0 26 0.9689352535610583 6.98389552910237 740.0 2.0004056795131846 20.0 - - - - - - - 317.14285714285717 3 7 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1015 129 C20140710_OR014_02 C20140710_OR014_02 TB424758.[MT7]-TAISTNIK[MT7].2y7_1.heavy 568.35 / 890.543 N/A 24.512800216674805 34 16 8 10 0 3.3825119769394467 29.563827321753244 0.0 26 0.9689352535610583 6.98389552910237 1110.0 4.285271040091721 2.0 - - - - - - - 205.66666666666666 2 3 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1017 130 C20140710_OR014_02 C20140710_OR014_02 TB445653.[MT7]-HPSVDNK[MT7].2y4_1.heavy 542.803 / 619.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1019 130 C20140710_OR014_02 C20140710_OR014_02 TB445653.[MT7]-HPSVDNK[MT7].2y5_1.heavy 542.803 / 706.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1021 130 C20140710_OR014_02 C20140710_OR014_02 TB445653.[MT7]-HPSVDNK[MT7].2y3_1.heavy 542.803 / 520.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1023 130 C20140710_OR014_02 C20140710_OR014_02 TB445653.[MT7]-HPSVDNK[MT7].2y6_1.heavy 542.803 / 803.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1025 131 C20140710_OR014_02 C20140710_OR014_02 TB433689.[MT7]-VLFVDSVGLPAPPSIIK[MT7].2b3_1.heavy 1020.62 / 504.33 4104.0 46.21760177612305 43 13 10 10 10 0.7674587654163721 74.66821928437132 0.0 3 0.9007256052447434 3.884039563575744 4104.0 39.47905209807771 0.0 - - - - - - - 275.85714285714283 8 7 MPL myeloproliferative leukemia virus oncogene 1027 131 C20140710_OR014_02 C20140710_OR014_02 TB433689.[MT7]-VLFVDSVGLPAPPSIIK[MT7].2y6_1.heavy 1020.62 / 798.521 6156.0 46.21760177612305 43 13 10 10 10 0.7674587654163721 74.66821928437132 0.0 3 0.9007256052447434 3.884039563575744 6156.0 99.20826446280992 0.0 - - - - - - - 293.2857142857143 12 7 MPL myeloproliferative leukemia virus oncogene 1029 131 C20140710_OR014_02 C20140710_OR014_02 TB433689.[MT7]-VLFVDSVGLPAPPSIIK[MT7].2y10_1.heavy 1020.62 / 1136.72 4466.0 46.21760177612305 43 13 10 10 10 0.7674587654163721 74.66821928437132 0.0 3 0.9007256052447434 3.884039563575744 4466.0 15.092283609576429 0.0 - - - - - - - 241.4 8 5 MPL myeloproliferative leukemia virus oncogene 1031 131 C20140710_OR014_02 C20140710_OR014_02 TB433689.[MT7]-VLFVDSVGLPAPPSIIK[MT7].2b5_1.heavy 1020.62 / 718.426 3863.0 46.21760177612305 43 13 10 10 10 0.7674587654163721 74.66821928437132 0.0 3 0.9007256052447434 3.884039563575744 3863.0 46.278239257912965 0.0 - - - - - - - 241.42857142857142 7 7 MPL myeloproliferative leukemia virus oncogene 1033 132 C20140710_OR014_02 C20140710_OR014_02 TB433710.[MT7]-TQMWLTEQLRTNPLEGR.3y7_1.heavy 739.724 / 786.41 2258.0 39.45677471160889 41 15 10 6 10 1.928865689721904 35.1710441113448 0.037502288818359375 3 0.9579200261399627 5.9950088289031065 2258.0 20.597365853658534 0.0 - - - - - - - 177.45454545454547 4 11 C6orf204 chromosome 6 open reading frame 204 1035 132 C20140710_OR014_02 C20140710_OR014_02 TB433710.[MT7]-TQMWLTEQLRTNPLEGR.3y14_2.heavy 739.724 / 856.958 2874.0 39.45677471160889 41 15 10 6 10 1.928865689721904 35.1710441113448 0.037502288818359375 3 0.9579200261399627 5.9950088289031065 2874.0 3.732467532467533 0.0 - - - - - - - 193.88888888888889 5 9 C6orf204 chromosome 6 open reading frame 204 1037 132 C20140710_OR014_02 C20140710_OR014_02 TB433710.[MT7]-TQMWLTEQLRTNPLEGR.3b3_1.heavy 739.724 / 505.256 3798.0 39.45677471160889 41 15 10 6 10 1.928865689721904 35.1710441113448 0.037502288818359375 3 0.9579200261399627 5.9950088289031065 3798.0 21.60059866962306 0.0 - - - - - - - 271.35714285714283 7 14 C6orf204 chromosome 6 open reading frame 204 1039 132 C20140710_OR014_02 C20140710_OR014_02 TB433710.[MT7]-TQMWLTEQLRTNPLEGR.3y5_1.heavy 739.724 / 571.32 1334.0 39.45677471160889 41 15 10 6 10 1.928865689721904 35.1710441113448 0.037502288818359375 3 0.9579200261399627 5.9950088289031065 1334.0 8.233277288565093 1.0 - - - - - - - 205.25 3 8 C6orf204 chromosome 6 open reading frame 204 1041 133 C20140710_OR014_02 C20140710_OR014_02 TB433692.[MT7]-GVNIGDVGC[CAM]YIYDPVK[MT7].4b7_1.heavy 515.021 / 799.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRIP3 cysteine-rich protein 3 1043 133 C20140710_OR014_02 C20140710_OR014_02 TB433692.[MT7]-GVNIGDVGC[CAM]YIYDPVK[MT7].4b4_1.heavy 515.021 / 528.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRIP3 cysteine-rich protein 3 1045 133 C20140710_OR014_02 C20140710_OR014_02 TB433692.[MT7]-GVNIGDVGC[CAM]YIYDPVK[MT7].4b5_1.heavy 515.021 / 585.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRIP3 cysteine-rich protein 3 1047 133 C20140710_OR014_02 C20140710_OR014_02 TB433692.[MT7]-GVNIGDVGC[CAM]YIYDPVK[MT7].4b6_1.heavy 515.021 / 700.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - CRIP3 cysteine-rich protein 3 1049 134 C20140710_OR014_02 C20140710_OR014_02 TB425000.[MT7]-LWALVGDPGTDHLIR.4y4_1.heavy 452.505 / 538.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1051 134 C20140710_OR014_02 C20140710_OR014_02 TB425000.[MT7]-LWALVGDPGTDHLIR.4b4_1.heavy 452.505 / 628.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1053 134 C20140710_OR014_02 C20140710_OR014_02 TB425000.[MT7]-LWALVGDPGTDHLIR.4y7_1.heavy 452.505 / 811.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1055 134 C20140710_OR014_02 C20140710_OR014_02 TB425000.[MT7]-LWALVGDPGTDHLIR.4b3_1.heavy 452.505 / 515.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1057 135 C20140710_OR014_02 C20140710_OR014_02 TB445719.[MT7]-ARNSLGLYGR.2y8_1.heavy 625.858 / 879.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC55908 hepatocellular carcinoma-associated gene TD26 1059 135 C20140710_OR014_02 C20140710_OR014_02 TB445719.[MT7]-ARNSLGLYGR.2y5_1.heavy 625.858 / 565.309 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC55908 hepatocellular carcinoma-associated gene TD26 1061 135 C20140710_OR014_02 C20140710_OR014_02 TB445719.[MT7]-ARNSLGLYGR.2b6_1.heavy 625.858 / 743.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC55908 hepatocellular carcinoma-associated gene TD26 1063 135 C20140710_OR014_02 C20140710_OR014_02 TB445719.[MT7]-ARNSLGLYGR.2b7_1.heavy 625.858 / 856.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC55908 hepatocellular carcinoma-associated gene TD26 1065 136 C20140710_OR014_02 C20140710_OR014_02 TB433417.[MT7]-SNDLAR.2b3_1.heavy 410.226 / 461.211 2126.0 16.01427459716797 41 20 10 5 6 2.9214248441297097 25.013537777325915 0.04109954833984375 5 0.9925692314319282 14.307910223963122 2126.0 11.479546040881797 0.0 - - - - - - - 191.33333333333334 4 12 C6orf15 chromosome 6 open reading frame 15 1067 136 C20140710_OR014_02 C20140710_OR014_02 TB433417.[MT7]-SNDLAR.2b5_1.heavy 410.226 / 645.332 517.0 16.01427459716797 41 20 10 5 6 2.9214248441297097 25.013537777325915 0.04109954833984375 5 0.9925692314319282 14.307910223963122 517.0 11.482053394355454 4.0 - - - - - - - 0.0 1 0 C6orf15 chromosome 6 open reading frame 15 1069 136 C20140710_OR014_02 C20140710_OR014_02 TB433417.[MT7]-SNDLAR.2y5_1.heavy 410.226 / 588.31 402.0 16.01427459716797 41 20 10 5 6 2.9214248441297097 25.013537777325915 0.04109954833984375 5 0.9925692314319282 14.307910223963122 402.0 1.897391304347826 3.0 - - - - - - - 0.0 0 0 C6orf15 chromosome 6 open reading frame 15 1071 136 C20140710_OR014_02 C20140710_OR014_02 TB433417.[MT7]-SNDLAR.2b4_1.heavy 410.226 / 574.295 460.0 16.01427459716797 41 20 10 5 6 2.9214248441297097 25.013537777325915 0.04109954833984375 5 0.9925692314319282 14.307910223963122 460.0 3.7199999999999998 3.0 - - - - - - - 147.64285714285714 2 14 C6orf15 chromosome 6 open reading frame 15 1073 137 C20140710_OR014_02 C20140710_OR014_02 TB425003.[MT7]-VDFEDFVELMGPK[MT7].2b8_1.heavy 907.468 / 1125.52 3003.0 48.85860061645508 43 13 10 10 10 2.486042629545875 40.22457169942697 0.0 3 0.9270030879429181 4.539752694319473 3003.0 6.488835843162852 0.0 - - - - - - - 222.2 6 10 CABP2 calcium binding protein 2 1075 137 C20140710_OR014_02 C20140710_OR014_02 TB425003.[MT7]-VDFEDFVELMGPK[MT7].2y4_1.heavy 907.468 / 576.33 4338.0 48.85860061645508 43 13 10 10 10 2.486042629545875 40.22457169942697 0.0 3 0.9270030879429181 4.539752694319473 4338.0 48.85135135135135 0.0 - - - - - - - 222.25 8 4 CABP2 calcium binding protein 2 1077 137 C20140710_OR014_02 C20140710_OR014_02 TB425003.[MT7]-VDFEDFVELMGPK[MT7].2b6_1.heavy 907.468 / 897.411 3225.0 48.85860061645508 43 13 10 10 10 2.486042629545875 40.22457169942697 0.0 3 0.9270030879429181 4.539752694319473 3225.0 22.36796373711841 0.0 - - - - - - - 222.375 6 8 CABP2 calcium binding protein 2 1079 137 C20140710_OR014_02 C20140710_OR014_02 TB425003.[MT7]-VDFEDFVELMGPK[MT7].2b5_1.heavy 907.468 / 750.343 4783.0 48.85860061645508 43 13 10 10 10 2.486042629545875 40.22457169942697 0.0 3 0.9270030879429181 4.539752694319473 4783.0 19.225153265298495 1.0 - - - - - - - 172.77777777777777 11 9 CABP2 calcium binding protein 2 1081 138 C20140710_OR014_02 C20140710_OR014_02 TB433599.[MT7]-GVPEASGSQNDGK[MT7].3b4_1.heavy 511.93 / 527.295 10452.0 18.25830078125 48 18 10 10 10 4.522716600998988 22.11060493551857 0.0 3 0.9837355254344394 9.663889531402507 10452.0 125.43024652622142 0.0 - - - - - - - 226.36363636363637 20 11 SSX7 synovial sarcoma, X breakpoint 7 1083 138 C20140710_OR014_02 C20140710_OR014_02 TB433599.[MT7]-GVPEASGSQNDGK[MT7].3b5_1.heavy 511.93 / 598.332 5814.0 18.25830078125 48 18 10 10 10 4.522716600998988 22.11060493551857 0.0 3 0.9837355254344394 9.663889531402507 5814.0 25.396895306859207 0.0 - - - - - - - 190.1875 11 16 SSX7 synovial sarcoma, X breakpoint 7 1085 138 C20140710_OR014_02 C20140710_OR014_02 TB433599.[MT7]-GVPEASGSQNDGK[MT7].3y4_1.heavy 511.93 / 577.306 9552.0 18.25830078125 48 18 10 10 10 4.522716600998988 22.11060493551857 0.0 3 0.9837355254344394 9.663889531402507 9552.0 69.16735463593504 0.0 - - - - - - - 227.14285714285714 19 7 SSX7 synovial sarcoma, X breakpoint 7 1087 138 C20140710_OR014_02 C20140710_OR014_02 TB433599.[MT7]-GVPEASGSQNDGK[MT7].3b7_1.heavy 511.93 / 742.385 2007.0 18.25830078125 48 18 10 10 10 4.522716600998988 22.11060493551857 0.0 3 0.9837355254344394 9.663889531402507 2007.0 13.331696750902527 0.0 - - - - - - - 155.625 4 8 SSX7 synovial sarcoma, X breakpoint 7 1089 139 C20140710_OR014_02 C20140710_OR014_02 TB424762.[MT7]-GREQLLER.2y6_1.heavy 572.831 / 787.431 185.0 22.322599411010742 27 10 10 5 2 1.5138304462294365 66.05759598049727 0.042400360107421875 13 0.8300640288875212 2.9503151480463328 185.0 0.2021739130434782 21.0 - - - - - - - 0.0 1 0 HSF4 heat shock transcription factor 4 1091 139 C20140710_OR014_02 C20140710_OR014_02 TB424762.[MT7]-GREQLLER.2b7_1.heavy 572.831 / 970.544 3419.0 22.322599411010742 27 10 10 5 2 1.5138304462294365 66.05759598049727 0.042400360107421875 13 0.8300640288875212 2.9503151480463328 3419.0 25.134270270270274 0.0 - - - - - - - 254.25 6 8 HSF4 heat shock transcription factor 4 1093 139 C20140710_OR014_02 C20140710_OR014_02 TB424762.[MT7]-GREQLLER.2b5_1.heavy 572.831 / 728.417 832.0 22.322599411010742 27 10 10 5 2 1.5138304462294365 66.05759598049727 0.042400360107421875 13 0.8300640288875212 2.9503151480463328 832.0 4.9069247731486 0.0 - - - - - - - 0.0 1 0 HSF4 heat shock transcription factor 4 1095 139 C20140710_OR014_02 C20140710_OR014_02 TB424762.[MT7]-GREQLLER.2b4_1.heavy 572.831 / 615.333 277.0 22.322599411010742 27 10 10 5 2 1.5138304462294365 66.05759598049727 0.042400360107421875 13 0.8300640288875212 2.9503151480463328 277.0 1.5475675675675675 14.0 - - - - - - - 0.0 1 0 HSF4 heat shock transcription factor 4 1097 140 C20140710_OR014_02 C20140710_OR014_02 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 222496.0 37.766300201416016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 222496.0 129.55140657545397 0.0 - - - - - - - 280.8 444 10 1099 140 C20140710_OR014_02 C20140710_OR014_02 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 432198.0 37.766300201416016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 432198.0 325.1539022492142 0.0 - - - - - - - 650.0 864 8 1101 140 C20140710_OR014_02 C20140710_OR014_02 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 575369.0 37.766300201416016 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 575369.0 326.4733124759296 0.0 - - - - - - - 252.57142857142858 1150 7 1103 141 C20140710_OR014_02 C20140710_OR014_02 TB433596.[MT7]-EVLQLNEFLK[MT7].3y3_1.heavy 507.636 / 551.367 3893.0 42.428425788879395 34 8 10 6 10 0.8947757084177144 69.86570673398245 0.039501190185546875 3 0.7585849917344287 2.459396119357657 3893.0 43.36152946499264 0.0 - - - - - - - 245.33333333333334 7 6 C6orf204 chromosome 6 open reading frame 204 1105 141 C20140710_OR014_02 C20140710_OR014_02 TB433596.[MT7]-EVLQLNEFLK[MT7].3b4_1.heavy 507.636 / 614.363 1683.0 42.428425788879395 34 8 10 6 10 0.8947757084177144 69.86570673398245 0.039501190185546875 3 0.7585849917344287 2.459396119357657 1683.0 24.042857142857144 0.0 - - - - - - - 289.25 3 4 C6orf204 chromosome 6 open reading frame 204 1107 141 C20140710_OR014_02 C20140710_OR014_02 TB433596.[MT7]-EVLQLNEFLK[MT7].3y4_1.heavy 507.636 / 680.41 947.0 42.428425788879395 34 8 10 6 10 0.8947757084177144 69.86570673398245 0.039501190185546875 3 0.7585849917344287 2.459396119357657 947.0 6.079598608754666 0.0 - - - - - - - 0.0 1 0 C6orf204 chromosome 6 open reading frame 204 1109 141 C20140710_OR014_02 C20140710_OR014_02 TB433596.[MT7]-EVLQLNEFLK[MT7].3y5_1.heavy 507.636 / 794.453 1157.0 42.428425788879395 34 8 10 6 10 0.8947757084177144 69.86570673398245 0.039501190185546875 3 0.7585849917344287 2.459396119357657 1157.0 14.276989451476792 0.0 - - - - - - - 294.8 2 5 C6orf204 chromosome 6 open reading frame 204 1111 142 C20140710_OR014_02 C20140710_OR014_02 TB424765.[MT7]-SIGVVEEK[MT7].2y4_1.heavy 574.842 / 648.369 10950.0 25.355300903320312 44 14 10 10 10 2.4223952431665077 33.016010360179294 0.0 3 0.9399475971389123 5.010712376490093 10950.0 60.159828961053975 0.0 - - - - - - - 191.0 21 2 C6orf15 chromosome 6 open reading frame 15 1113 142 C20140710_OR014_02 C20140710_OR014_02 TB424765.[MT7]-SIGVVEEK[MT7].2b4_1.heavy 574.842 / 501.315 10823.0 25.355300903320312 44 14 10 10 10 2.4223952431665077 33.016010360179294 0.0 3 0.9399475971389123 5.010712376490093 10823.0 38.103684163202814 0.0 - - - - - - - 297.3333333333333 21 3 C6orf15 chromosome 6 open reading frame 15 1115 142 C20140710_OR014_02 C20140710_OR014_02 TB424765.[MT7]-SIGVVEEK[MT7].2y3_1.heavy 574.842 / 549.3 3947.0 25.355300903320312 44 14 10 10 10 2.4223952431665077 33.016010360179294 0.0 3 0.9399475971389123 5.010712376490093 3947.0 5.888787007352277 1.0 - - - - - - - 223.0 12 4 C6orf15 chromosome 6 open reading frame 15 1117 142 C20140710_OR014_02 C20140710_OR014_02 TB424765.[MT7]-SIGVVEEK[MT7].2y6_1.heavy 574.842 / 804.458 8022.0 25.355300903320312 44 14 10 10 10 2.4223952431665077 33.016010360179294 0.0 3 0.9399475971389123 5.010712376490093 8022.0 39.33588235294118 0.0 - - - - - - - 203.6 16 5 C6orf15 chromosome 6 open reading frame 15 1119 143 C20140710_OR014_02 C20140710_OR014_02 TB433594.[MT7]-ILEQEAGMLLPR.3y6_1.heavy 505.289 / 686.402 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 1121 143 C20140710_OR014_02 C20140710_OR014_02 TB433594.[MT7]-ILEQEAGMLLPR.3b4_1.heavy 505.289 / 628.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 1123 143 C20140710_OR014_02 C20140710_OR014_02 TB433594.[MT7]-ILEQEAGMLLPR.3b3_1.heavy 505.289 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 1125 143 C20140710_OR014_02 C20140710_OR014_02 TB433594.[MT7]-ILEQEAGMLLPR.3b7_1.heavy 505.289 / 885.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 1127 144 C20140710_OR014_02 C20140710_OR014_02 TB425005.[MT7]-QTNIRYSPLTTLK[MT7].3y3_1.heavy 608.359 / 505.347 2151.0 31.754225730895996 39 13 10 6 10 2.8884807944434314 29.348515232911225 0.034099578857421875 3 0.9289568685475238 4.602523617690812 2151.0 0.5112299465240642 1.0 - - - - - - - 292.5625 4 16 RDH8 retinol dehydrogenase 8 (all-trans) 1129 144 C20140710_OR014_02 C20140710_OR014_02 TB425005.[MT7]-QTNIRYSPLTTLK[MT7].3y6_1.heavy 608.359 / 816.531 1590.0 31.754225730895996 39 13 10 6 10 2.8884807944434314 29.348515232911225 0.034099578857421875 3 0.9289568685475238 4.602523617690812 1590.0 16.53269449407179 0.0 - - - - - - - 212.72727272727272 3 11 RDH8 retinol dehydrogenase 8 (all-trans) 1131 144 C20140710_OR014_02 C20140710_OR014_02 TB425005.[MT7]-QTNIRYSPLTTLK[MT7].3b4_1.heavy 608.359 / 601.343 1216.0 31.754225730895996 39 13 10 6 10 2.8884807944434314 29.348515232911225 0.034099578857421875 3 0.9289568685475238 4.602523617690812 1216.0 0.5393162393162394 5.0 - - - - - - - 212.26666666666668 3 15 RDH8 retinol dehydrogenase 8 (all-trans) 1133 144 C20140710_OR014_02 C20140710_OR014_02 TB425005.[MT7]-QTNIRYSPLTTLK[MT7].3y4_1.heavy 608.359 / 606.394 3273.0 31.754225730895996 39 13 10 6 10 2.8884807944434314 29.348515232911225 0.034099578857421875 3 0.9289568685475238 4.602523617690812 3273.0 4.167379679144385 1.0 - - - - - - - 234.07142857142858 6 14 RDH8 retinol dehydrogenase 8 (all-trans) 1135 145 C20140710_OR014_02 C20140710_OR014_02 TB433593.[MT7]-ELENEYAINK[MT7].2b3_1.heavy 755.903 / 516.279 2401.0 28.215149402618408 42 17 10 5 10 3.42172530122116 19.56044836915388 0.04020118713378906 3 0.9779310071159283 8.292188339557446 2401.0 12.347094986807388 0.0 - - - - - - - 294.6666666666667 4 3 HOXD13 homeobox D13 1137 145 C20140710_OR014_02 C20140710_OR014_02 TB433593.[MT7]-ELENEYAINK[MT7].2b4_1.heavy 755.903 / 630.321 1769.0 28.215149402618408 42 17 10 5 10 3.42172530122116 19.56044836915388 0.04020118713378906 3 0.9779310071159283 8.292188339557446 1769.0 9.349909955187002 0.0 - - - - - - - 180.28571428571428 3 7 HOXD13 homeobox D13 1139 145 C20140710_OR014_02 C20140710_OR014_02 TB433593.[MT7]-ELENEYAINK[MT7].2y3_1.heavy 755.903 / 518.342 1263.0 28.215149402618408 42 17 10 5 10 3.42172530122116 19.56044836915388 0.04020118713378906 3 0.9779310071159283 8.292188339557446 1263.0 -0.15374315276932438 3.0 - - - - - - - 189.5 3 2 HOXD13 homeobox D13 1141 145 C20140710_OR014_02 C20140710_OR014_02 TB433593.[MT7]-ELENEYAINK[MT7].2b5_1.heavy 755.903 / 759.364 1895.0 28.215149402618408 42 17 10 5 10 3.42172530122116 19.56044836915388 0.04020118713378906 3 0.9779310071159283 8.292188339557446 1895.0 10.990118577075098 0.0 - - - - - - - 252.5 3 6 HOXD13 homeobox D13 1143 146 C20140710_OR014_02 C20140710_OR014_02 TB424787.[MT7]-ISAATNLSER.2y8_1.heavy 603.334 / 861.443 6229.0 25.62980079650879 50 20 10 10 10 4.505609301895525 16.477567810462972 0.0 3 0.9950092208632464 17.46213761585116 6229.0 55.99749875469888 0.0 - - - - - - - 211.66666666666666 12 6 HOXD13 homeobox D13 1145 146 C20140710_OR014_02 C20140710_OR014_02 TB424787.[MT7]-ISAATNLSER.2y9_1.heavy 603.334 / 948.474 54539.0 25.62980079650879 50 20 10 10 10 4.505609301895525 16.477567810462972 0.0 3 0.9950092208632464 17.46213761585116 54539.0 475.8745988173497 0.0 - - - - - - - 158.75 109 4 HOXD13 homeobox D13 1147 146 C20140710_OR014_02 C20140710_OR014_02 TB424787.[MT7]-ISAATNLSER.2b6_1.heavy 603.334 / 702.39 2797.0 25.62980079650879 50 20 10 10 10 4.505609301895525 16.477567810462972 0.0 3 0.9950092208632464 17.46213761585116 2797.0 25.320675092430736 0.0 - - - - - - - 190.5 5 4 HOXD13 homeobox D13 1149 146 C20140710_OR014_02 C20140710_OR014_02 TB424787.[MT7]-ISAATNLSER.2y7_1.heavy 603.334 / 790.405 7882.0 25.62980079650879 50 20 10 10 10 4.505609301895525 16.477567810462972 0.0 3 0.9950092208632464 17.46213761585116 7882.0 121.02283464566929 0.0 - - - - - - - 127.0 15 1 HOXD13 homeobox D13 1151 147 C20140710_OR014_02 C20140710_OR014_02 TB433592.[MT7]-K[MT7]PAEEGNDSK[MT7].2b8_1.heavy 753.91 / 1129.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - SSX7 synovial sarcoma, X breakpoint 7 1153 147 C20140710_OR014_02 C20140710_OR014_02 TB433592.[MT7]-K[MT7]PAEEGNDSK[MT7].2y5_1.heavy 753.91 / 664.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - SSX7 synovial sarcoma, X breakpoint 7 1155 147 C20140710_OR014_02 C20140710_OR014_02 TB433592.[MT7]-K[MT7]PAEEGNDSK[MT7].2y9_1.heavy 753.91 / 1090.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - SSX7 synovial sarcoma, X breakpoint 7 1157 147 C20140710_OR014_02 C20140710_OR014_02 TB433592.[MT7]-K[MT7]PAEEGNDSK[MT7].2y7_1.heavy 753.91 / 922.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - SSX7 synovial sarcoma, X breakpoint 7 1159 148 C20140710_OR014_02 C20140710_OR014_02 TB424769.[MT7]-DVQVLFMR.2y5_1.heavy 576.322 / 665.38 6302.0 39.03439903259277 46 20 10 6 10 11.380092694850628 8.787274645420853 0.03479766845703125 3 0.996184132126829 19.972273649454515 6302.0 26.745063250290436 0.0 - - - - - - - 221.9090909090909 12 11 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1161 148 C20140710_OR014_02 C20140710_OR014_02 TB424769.[MT7]-DVQVLFMR.2b4_1.heavy 576.322 / 586.332 7521.0 39.03439903259277 46 20 10 6 10 11.380092694850628 8.787274645420853 0.03479766845703125 3 0.996184132126829 19.972273649454515 7521.0 28.35786885245902 0.0 - - - - - - - 680.9 15 10 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1163 148 C20140710_OR014_02 C20140710_OR014_02 TB424769.[MT7]-DVQVLFMR.2y6_1.heavy 576.322 / 793.439 7623.0 39.03439903259277 46 20 10 6 10 11.380092694850628 8.787274645420853 0.03479766845703125 3 0.996184132126829 19.972273649454515 7623.0 112.10294117647058 0.0 - - - - - - - 140.0 15 8 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1165 148 C20140710_OR014_02 C20140710_OR014_02 TB424769.[MT7]-DVQVLFMR.2y7_1.heavy 576.322 / 892.507 9656.0 39.03439903259277 46 20 10 6 10 11.380092694850628 8.787274645420853 0.03479766845703125 3 0.996184132126829 19.972273649454515 9656.0 94.71318591318591 0.0 - - - - - - - 248.55555555555554 19 9 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1167 149 C20140710_OR014_02 C20140710_OR014_02 TB445710.[MT7]-QQNEILWR.2y4_1.heavy 615.839 / 587.366 3577.0 32.25997447967529 29 10 10 3 6 1.0182091838992746 57.50610705676114 0.07740020751953125 6 0.837166797565583 3.01587605820271 3577.0 7.283849739408994 2.0 - - - - - - - 715.4 10 10 HSF4 heat shock transcription factor 4 1169 149 C20140710_OR014_02 C20140710_OR014_02 TB445710.[MT7]-QQNEILWR.2b4_1.heavy 615.839 / 644.312 2423.0 32.25997447967529 29 10 10 3 6 1.0182091838992746 57.50610705676114 0.07740020751953125 6 0.837166797565583 3.01587605820271 2423.0 4.72012987012987 4.0 - - - - - - - 240.41666666666666 7 12 HSF4 heat shock transcription factor 4 1171 149 C20140710_OR014_02 C20140710_OR014_02 TB445710.[MT7]-QQNEILWR.2y6_1.heavy 615.839 / 830.452 1731.0 32.25997447967529 29 10 10 3 6 1.0182091838992746 57.50610705676114 0.07740020751953125 6 0.837166797565583 3.01587605820271 1731.0 5.152796268859165 2.0 - - - - - - - 197.57142857142858 3 7 HSF4 heat shock transcription factor 4 1173 149 C20140710_OR014_02 C20140710_OR014_02 TB445710.[MT7]-QQNEILWR.2y7_1.heavy 615.839 / 958.51 6924.0 32.25997447967529 29 10 10 3 6 1.0182091838992746 57.50610705676114 0.07740020751953125 6 0.837166797565583 3.01587605820271 6924.0 64.99754913294798 0.0 - - - - - - - 230.63636363636363 13 11 HSF4 heat shock transcription factor 4 1175 150 C20140710_OR014_02 C20140710_OR014_02 TB433709.[MT7]-LIQC[CAM]LFGPLQAGPSNAGGK[MT7].3y7_1.heavy 739.408 / 774.423 5594.0 45.01679992675781 43 13 10 10 10 1.5031463241750493 46.38449038582563 0.0 3 0.9290026398648279 4.604025012221294 5594.0 59.49513586346283 0.0 - - - - - - - 263.5 11 6 HSF4 heat shock transcription factor 4 1177 150 C20140710_OR014_02 C20140710_OR014_02 TB433709.[MT7]-LIQC[CAM]LFGPLQAGPSNAGGK[MT7].3b4_1.heavy 739.408 / 659.367 4256.0 45.01679992675781 43 13 10 10 10 1.5031463241750493 46.38449038582563 0.0 3 0.9290026398648279 4.604025012221294 4256.0 45.72930069615989 0.0 - - - - - - - 243.5 8 4 HSF4 heat shock transcription factor 4 1179 150 C20140710_OR014_02 C20140710_OR014_02 TB433709.[MT7]-LIQC[CAM]LFGPLQAGPSNAGGK[MT7].3y8_1.heavy 739.408 / 831.444 4378.0 45.01679992675781 43 13 10 10 10 1.5031463241750493 46.38449038582563 0.0 3 0.9290026398648279 4.604025012221294 4378.0 40.21390368852459 0.0 - - - - - - - 182.5 8 2 HSF4 heat shock transcription factor 4 1181 150 C20140710_OR014_02 C20140710_OR014_02 TB433709.[MT7]-LIQC[CAM]LFGPLQAGPSNAGGK[MT7].3b7_1.heavy 739.408 / 976.541 5229.0 45.01679992675781 43 13 10 10 10 1.5031463241750493 46.38449038582563 0.0 3 0.9290026398648279 4.604025012221294 5229.0 8.274754086482726 1.0 - - - - - - - 304.0 13 4 HSF4 heat shock transcription factor 4 1183 151 C20140710_OR014_02 C20140710_OR014_02 TB433707.[MT7]-TTAGLTVPGATPSRPTPGAASR.3y15_2.heavy 737.405 / 711.876 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 1185 151 C20140710_OR014_02 C20140710_OR014_02 TB433707.[MT7]-TTAGLTVPGATPSRPTPGAASR.3y6_1.heavy 737.405 / 558.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 1187 151 C20140710_OR014_02 C20140710_OR014_02 TB433707.[MT7]-TTAGLTVPGATPSRPTPGAASR.3y17_2.heavy 737.405 / 811.934 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 1189 151 C20140710_OR014_02 C20140710_OR014_02 TB433707.[MT7]-TTAGLTVPGATPSRPTPGAASR.3y8_1.heavy 737.405 / 756.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 1191 152 C20140710_OR014_02 C20140710_OR014_02 TB433703.[MT7]-NTTAFSVLYAVFGQHSMR.3y7_1.heavy 725.038 / 862.399 3569.0 49.5467004776001 39 14 10 5 10 2.4987217697363655 40.020462146352045 0.044399261474609375 3 0.9423321247138303 5.114296488861185 3569.0 -0.7457611940298516 0.0 - - - - - - - 251.25 7 4 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1193 152 C20140710_OR014_02 C20140710_OR014_02 TB433703.[MT7]-NTTAFSVLYAVFGQHSMR.3b6_1.heavy 725.038 / 766.385 1115.0 49.5467004776001 39 14 10 5 10 2.4987217697363655 40.020462146352045 0.044399261474609375 3 0.9423321247138303 5.114296488861185 1115.0 12.875714285714285 0.0 - - - - - - - 195.5 2 4 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1195 152 C20140710_OR014_02 C20140710_OR014_02 TB433703.[MT7]-NTTAFSVLYAVFGQHSMR.3b4_1.heavy 725.038 / 532.285 3569.0 49.5467004776001 39 14 10 5 10 2.4987217697363655 40.020462146352045 0.044399261474609375 3 0.9423321247138303 5.114296488861185 3569.0 10.642982062780268 0.0 - - - - - - - 260.3333333333333 7 6 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1197 152 C20140710_OR014_02 C20140710_OR014_02 TB433703.[MT7]-NTTAFSVLYAVFGQHSMR.3b5_1.heavy 725.038 / 679.353 1338.0 49.5467004776001 39 14 10 5 10 2.4987217697363655 40.020462146352045 0.044399261474609375 3 0.9423321247138303 5.114296488861185 1338.0 11.376712435970402 1.0 - - - - - - - 210.77777777777777 2 9 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1199 153 C20140710_OR014_02 C20140710_OR014_02 TB433701.[MT7]-TPPTDIIVYTELPNAESR.2y6_1.heavy 1080.57 / 673.326 3142.0 39.68432426452637 37 11 10 6 10 2.8373896991893233 35.24366075924333 0.03690338134765625 3 0.8632621577639716 3.2986812263894363 3142.0 6.043186462277803 0.0 - - - - - - - 146.11111111111111 6 9 LOC100287457;KIR2DL1 killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1 1201 153 C20140710_OR014_02 C20140710_OR014_02 TB433701.[MT7]-TPPTDIIVYTELPNAESR.2y10_1.heavy 1080.57 / 1179.56 1318.0 39.68432426452637 37 11 10 6 10 2.8373896991893233 35.24366075924333 0.03690338134765625 3 0.8632621577639716 3.2986812263894363 1318.0 7.207822504639481 0.0 - - - - - - - 225.22222222222223 2 9 LOC100287457;KIR2DL1 killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1 1203 153 C20140710_OR014_02 C20140710_OR014_02 TB433701.[MT7]-TPPTDIIVYTELPNAESR.2b5_1.heavy 1080.57 / 656.337 2737.0 39.68432426452637 37 11 10 6 10 2.8373896991893233 35.24366075924333 0.03690338134765625 3 0.8632621577639716 3.2986812263894363 2737.0 11.921205196218457 0.0 - - - - - - - 240.75 5 8 LOC100287457;KIR2DL1 killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1 1205 153 C20140710_OR014_02 C20140710_OR014_02 TB433701.[MT7]-TPPTDIIVYTELPNAESR.2y7_1.heavy 1080.57 / 786.41 1419.0 39.68432426452637 37 11 10 6 10 2.8373896991893233 35.24366075924333 0.03690338134765625 3 0.8632621577639716 3.2986812263894363 1419.0 0.0 0.0 - - - - - - - 243.0 2 5 LOC100287457;KIR2DL1 killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1 1207 154 C20140710_OR014_02 C20140710_OR014_02 TB433700.[MT7]-YLMLGQQAVGGVPIQPSVR.2b3_1.heavy 1079.1 / 552.297 4498.0 40.40299987792969 40 14 10 6 10 1.3175106205184945 54.10782813669 0.0301971435546875 3 0.933227852373886 4.749173038402441 4498.0 42.730999999999995 0.0 - - - - - - - 333.3333333333333 8 3 C6orf204 chromosome 6 open reading frame 204 1209 154 C20140710_OR014_02 C20140710_OR014_02 TB433700.[MT7]-YLMLGQQAVGGVPIQPSVR.2y10_1.heavy 1079.1 / 1009.58 6597.0 40.40299987792969 40 14 10 6 10 1.3175106205184945 54.10782813669 0.0301971435546875 3 0.933227852373886 4.749173038402441 6597.0 11.711222138836773 0.0 - - - - - - - 222.22222222222223 13 9 C6orf204 chromosome 6 open reading frame 204 1211 154 C20140710_OR014_02 C20140710_OR014_02 TB433700.[MT7]-YLMLGQQAVGGVPIQPSVR.2y11_1.heavy 1079.1 / 1108.65 2199.0 40.40299987792969 40 14 10 6 10 1.3175106205184945 54.10782813669 0.0301971435546875 3 0.933227852373886 4.749173038402441 2199.0 0.0 1.0 - - - - - - - 208.33333333333334 4 12 C6orf204 chromosome 6 open reading frame 204 1213 154 C20140710_OR014_02 C20140710_OR014_02 TB433700.[MT7]-YLMLGQQAVGGVPIQPSVR.2y7_1.heavy 1079.1 / 796.468 6697.0 40.40299987792969 40 14 10 6 10 1.3175106205184945 54.10782813669 0.0301971435546875 3 0.933227852373886 4.749173038402441 6697.0 64.86614016198189 0.0 - - - - - - - 225.0 13 8 C6orf204 chromosome 6 open reading frame 204 1215 155 C20140710_OR014_02 C20140710_OR014_02 TB425133.[MT7]-EK[MT7]PDLEFVLEMSSPQLIK[MT7].4b7_2.heavy 634.608 / 574.315 30983.0 44.46260070800781 45 15 10 10 10 1.867127995635621 42.39203770691987 0.0 3 0.956838049310888 5.91884878312087 30983.0 147.79900241354403 0.0 - - - - - - - 268.0 61 8 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1217 155 C20140710_OR014_02 C20140710_OR014_02 TB425133.[MT7]-EK[MT7]PDLEFVLEMSSPQLIK[MT7].4y3_1.heavy 634.608 / 517.383 22403.0 44.46260070800781 45 15 10 10 10 1.867127995635621 42.39203770691987 0.0 3 0.956838049310888 5.91884878312087 22403.0 49.738472764416095 1.0 - - - - - - - 381.2 44 5 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1219 155 C20140710_OR014_02 C20140710_OR014_02 TB425133.[MT7]-EK[MT7]PDLEFVLEMSSPQLIK[MT7].4b6_1.heavy 634.608 / 1000.56 8937.0 44.46260070800781 45 15 10 10 10 1.867127995635621 42.39203770691987 0.0 3 0.956838049310888 5.91884878312087 8937.0 36.45769418816477 0.0 - - - - - - - 267.75 17 4 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1221 155 C20140710_OR014_02 C20140710_OR014_02 TB425133.[MT7]-EK[MT7]PDLEFVLEMSSPQLIK[MT7].4b6_2.heavy 634.608 / 500.781 13823.0 44.46260070800781 45 15 10 10 10 1.867127995635621 42.39203770691987 0.0 3 0.956838049310888 5.91884878312087 13823.0 74.34218487394958 0.0 - - - - - - - 261.9 27 10 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1223 156 C20140710_OR014_02 C20140710_OR014_02 TB425134.[MT7]-MDGDVIIGALFSVHHQPPAEK[MT7].4y4_1.heavy 638.091 / 588.347 4985.0 42.687198638916016 42 16 10 6 10 3.367455289909808 29.696014168217317 0.0391998291015625 3 0.9639243177965892 6.477997095079681 4985.0 17.783676404301787 0.0 - - - - - - - 596.5 9 8 GRM1 glutamate receptor, metabotropic 1 1225 156 C20140710_OR014_02 C20140710_OR014_02 TB425134.[MT7]-MDGDVIIGALFSVHHQPPAEK[MT7].4y5_1.heavy 638.091 / 685.4 16123.0 42.687198638916016 42 16 10 6 10 3.367455289909808 29.696014168217317 0.0391998291015625 3 0.9639243177965892 6.477997095079681 16123.0 35.375325093543225 0.0 - - - - - - - 702.75 32 8 GRM1 glutamate receptor, metabotropic 1 1227 156 C20140710_OR014_02 C20140710_OR014_02 TB425134.[MT7]-MDGDVIIGALFSVHHQPPAEK[MT7].4b4_1.heavy 638.091 / 563.225 22593.0 42.687198638916016 42 16 10 6 10 3.367455289909808 29.696014168217317 0.0391998291015625 3 0.9639243177965892 6.477997095079681 22593.0 75.901850540036 0.0 - - - - - - - 818.5714285714286 45 7 GRM1 glutamate receptor, metabotropic 1 1229 156 C20140710_OR014_02 C20140710_OR014_02 TB425134.[MT7]-MDGDVIIGALFSVHHQPPAEK[MT7].4b5_1.heavy 638.091 / 662.294 19942.0 42.687198638916016 42 16 10 6 10 3.367455289909808 29.696014168217317 0.0391998291015625 3 0.9639243177965892 6.477997095079681 19942.0 72.901179245283 0.0 - - - - - - - 328.6 39 10 GRM1 glutamate receptor, metabotropic 1 1231 157 C20140710_OR014_02 C20140710_OR014_02 TB425135.[MT7]-DTFFLTVHDAILYLQNQVK[MT7].3b9_2.heavy 851.803 / 610.807 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC26A4 solute carrier family 26, member 4 1233 157 C20140710_OR014_02 C20140710_OR014_02 TB425135.[MT7]-DTFFLTVHDAILYLQNQVK[MT7].3y6_1.heavy 851.803 / 873.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC26A4 solute carrier family 26, member 4 1235 157 C20140710_OR014_02 C20140710_OR014_02 TB425135.[MT7]-DTFFLTVHDAILYLQNQVK[MT7].3b4_1.heavy 851.803 / 655.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC26A4 solute carrier family 26, member 4 1237 157 C20140710_OR014_02 C20140710_OR014_02 TB425135.[MT7]-DTFFLTVHDAILYLQNQVK[MT7].3b3_1.heavy 851.803 / 508.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC26A4 solute carrier family 26, member 4 1239 158 C20140710_OR014_02 C20140710_OR014_02 TB424898.[MT7]-DSVQRLEVQLR.3y10_2.heavy 496.287 / 614.362 4199.0 30.52537441253662 38 13 10 7 8 1.9969719802534835 45.19327674666375 0.027500152587890625 4 0.9197371699811725 4.3266982886947964 4199.0 49.59315738025415 0.0 - - - - - - - 170.05882352941177 8 17 LOC55908 hepatocellular carcinoma-associated gene TD26 1241 158 C20140710_OR014_02 C20140710_OR014_02 TB424898.[MT7]-DSVQRLEVQLR.3y6_1.heavy 496.287 / 757.457 747.0 30.52537441253662 38 13 10 7 8 1.9969719802534835 45.19327674666375 0.027500152587890625 4 0.9197371699811725 4.3266982886947964 747.0 9.093663594470048 0.0 - - - - - - - 0.0 1 0 LOC55908 hepatocellular carcinoma-associated gene TD26 1243 158 C20140710_OR014_02 C20140710_OR014_02 TB424898.[MT7]-DSVQRLEVQLR.3y4_1.heavy 496.287 / 515.33 1586.0 30.52537441253662 38 13 10 7 8 1.9969719802534835 45.19327674666375 0.027500152587890625 4 0.9197371699811725 4.3266982886947964 1586.0 11.545004946165646 1.0 - - - - - - - 170.05882352941177 3 17 LOC55908 hepatocellular carcinoma-associated gene TD26 1245 158 C20140710_OR014_02 C20140710_OR014_02 TB424898.[MT7]-DSVQRLEVQLR.3y5_1.heavy 496.287 / 644.373 3173.0 30.52537441253662 38 13 10 7 8 1.9969719802534835 45.19327674666375 0.027500152587890625 4 0.9197371699811725 4.3266982886947964 3173.0 1.9177730192719487 1.0 - - - - - - - 271.45454545454544 6 11 LOC55908 hepatocellular carcinoma-associated gene TD26 1247 159 C20140710_OR014_02 C20140710_OR014_02 TB445822.[MT7]-TLVPILEWLPK[MT7].2y8_1.heavy 799.002 / 1139.69 1647.0 51.60999870300293 45 20 10 5 10 10.212042739895374 9.792360113156414 0.043399810791015625 3 0.9945775697492537 16.752087891437895 1647.0 16.1351062033536 0.0 - - - - - - - 162.83333333333334 3 6 SLC26A4 solute carrier family 26, member 4 1249 159 C20140710_OR014_02 C20140710_OR014_02 TB445822.[MT7]-TLVPILEWLPK[MT7].2y3_1.heavy 799.002 / 501.352 875.0 51.60999870300293 45 20 10 5 10 10.212042739895374 9.792360113156414 0.043399810791015625 3 0.9945775697492537 16.752087891437895 875.0 9.514563106796118 0.0 - - - - - - - 0.0 1 0 SLC26A4 solute carrier family 26, member 4 1251 159 C20140710_OR014_02 C20140710_OR014_02 TB445822.[MT7]-TLVPILEWLPK[MT7].2b7_1.heavy 799.002 / 910.573 515.0 51.60999870300293 45 20 10 5 10 10.212042739895374 9.792360113156414 0.043399810791015625 3 0.9945775697492537 16.752087891437895 515.0 7.6000000000000005 1.0 - - - - - - - 0.0 1 0 SLC26A4 solute carrier family 26, member 4 1253 159 C20140710_OR014_02 C20140710_OR014_02 TB445822.[MT7]-TLVPILEWLPK[MT7].2b5_1.heavy 799.002 / 668.446 360.0 51.60999870300293 45 20 10 5 10 10.212042739895374 9.792360113156414 0.043399810791015625 3 0.9945775697492537 16.752087891437895 360.0 1.8640776699029127 5.0 - - - - - - - 0.0 1 0 SLC26A4 solute carrier family 26, member 4 1255 160 C20140710_OR014_02 C20140710_OR014_02 TB433425.[MT7]-EPAVGSR.2b3_1.heavy 430.241 / 442.242 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 1257 160 C20140710_OR014_02 C20140710_OR014_02 TB433425.[MT7]-EPAVGSR.2y5_1.heavy 430.241 / 489.278 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 1259 160 C20140710_OR014_02 C20140710_OR014_02 TB433425.[MT7]-EPAVGSR.2b4_1.heavy 430.241 / 541.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 1261 160 C20140710_OR014_02 C20140710_OR014_02 TB433425.[MT7]-EPAVGSR.2y6_1.heavy 430.241 / 586.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 1263 161 C20140710_OR014_02 C20140710_OR014_02 TB424897.[MT7]-DSVQRLEVQLR.2y4_1.heavy 743.927 / 515.33 1119.0 30.504749298095703 41 16 10 7 8 7.064342808612069 14.15559843416588 0.027500152587890625 4 0.9675337013910148 6.8306798211686 1119.0 12.629032258064516 1.0 - - - - - - - 186.42857142857142 2 7 LOC55908 hepatocellular carcinoma-associated gene TD26 1265 161 C20140710_OR014_02 C20140710_OR014_02 TB424897.[MT7]-DSVQRLEVQLR.2b4_1.heavy 743.927 / 574.295 280.0 30.504749298095703 41 16 10 7 8 7.064342808612069 14.15559843416588 0.027500152587890625 4 0.9675337013910148 6.8306798211686 280.0 1.8883957219251335 18.0 - - - - - - - 0.0 1 0 LOC55908 hepatocellular carcinoma-associated gene TD26 1267 161 C20140710_OR014_02 C20140710_OR014_02 TB424897.[MT7]-DSVQRLEVQLR.2y6_1.heavy 743.927 / 757.457 933.0 30.504749298095703 41 16 10 7 8 7.064342808612069 14.15559843416588 0.027500152587890625 4 0.9675337013910148 6.8306798211686 933.0 1.9957219251336902 1.0 - - - - - - - 176.22222222222223 2 9 LOC55908 hepatocellular carcinoma-associated gene TD26 1269 161 C20140710_OR014_02 C20140710_OR014_02 TB424897.[MT7]-DSVQRLEVQLR.2y10_2.heavy 743.927 / 614.362 2705.0 30.504749298095703 41 16 10 7 8 7.064342808612069 14.15559843416588 0.027500152587890625 4 0.9675337013910148 6.8306798211686 2705.0 1.7602506887165448 0.0 - - - - - - - 169.54545454545453 5 11 LOC55908 hepatocellular carcinoma-associated gene TD26 1271 162 C20140710_OR014_02 C20140710_OR014_02 TB433426.[MT7]-EVVTLR.2y4_1.heavy 430.77 / 488.319 3685.0 25.707499504089355 33 20 0 5 8 14.622333522516808 6.838853719620801 0.044399261474609375 4 0.9969102643621611 22.196772149581413 3685.0 3.2640932487964327 0.0 - - - - - - - 254.0 7 4 GRM2;HSF4 glutamate receptor, metabotropic 2;heat shock transcription factor 4 1273 162 C20140710_OR014_02 C20140710_OR014_02 TB433426.[MT7]-EVVTLR.2b3_1.heavy 430.77 / 472.289 4701.0 25.707499504089355 33 20 0 5 8 14.622333522516808 6.838853719620801 0.044399261474609375 4 0.9969102643621611 22.196772149581413 4701.0 53.11759842519685 0.0 - - - - - - - 217.71428571428572 9 7 GRM2;HSF4 glutamate receptor, metabotropic 2;heat shock transcription factor 4 1275 162 C20140710_OR014_02 C20140710_OR014_02 TB433426.[MT7]-EVVTLR.2y5_1.heavy 430.77 / 587.388 10546.0 25.707499504089355 33 20 0 5 8 14.622333522516808 6.838853719620801 0.044399261474609375 4 0.9969102643621611 22.196772149581413 10546.0 43.44689041994751 1.0 - - - - - - - 203.2 97 5 GRM2;HSF4 glutamate receptor, metabotropic 2;heat shock transcription factor 4 1277 162 C20140710_OR014_02 C20140710_OR014_02 TB433426.[MT7]-EVVTLR.2b4_1.heavy 430.77 / 573.336 2287.0 25.707499504089355 33 20 0 5 8 14.622333522516808 6.838853719620801 0.044399261474609375 4 0.9969102643621611 22.196772149581413 2287.0 4.19326209223847 4.0 - - - - - - - 228.6 96 10 GRM2;HSF4 glutamate receptor, metabotropic 2;heat shock transcription factor 4 1279 163 C20140710_OR014_02 C20140710_OR014_02 TB445639.[MT7]-FAVTSINR.2y5_1.heavy 526.304 / 590.326 6356.0 29.112299919128418 46 20 10 6 10 6.972685477731112 14.341676577750881 0.03539848327636719 3 0.9900089549724967 12.33657659468801 6356.0 38.66870665932856 0.0 - - - - - - - 240.76923076923077 12 13 GRIK1 glutamate receptor, ionotropic, kainate 1 1281 163 C20140710_OR014_02 C20140710_OR014_02 TB445639.[MT7]-FAVTSINR.2y6_1.heavy 526.304 / 689.394 4882.0 29.112299919128418 46 20 10 6 10 6.972685477731112 14.341676577750881 0.03539848327636719 3 0.9900089549724967 12.33657659468801 4882.0 20.809680397057434 0.0 - - - - - - - 257.8 9 15 GRIK1 glutamate receptor, ionotropic, kainate 1 1283 163 C20140710_OR014_02 C20140710_OR014_02 TB445639.[MT7]-FAVTSINR.2b5_1.heavy 526.304 / 650.363 1842.0 29.112299919128418 46 20 10 6 10 6.972685477731112 14.341676577750881 0.03539848327636719 3 0.9900089549724967 12.33657659468801 1842.0 34.03695652173913 0.0 - - - - - - - 214.73333333333332 3 15 GRIK1 glutamate receptor, ionotropic, kainate 1 1285 163 C20140710_OR014_02 C20140710_OR014_02 TB445639.[MT7]-FAVTSINR.2y7_1.heavy 526.304 / 760.431 11514.0 29.112299919128418 46 20 10 6 10 6.972685477731112 14.341676577750881 0.03539848327636719 3 0.9900089549724967 12.33657659468801 11514.0 134.52771597507436 0.0 - - - - - - - 210.35714285714286 23 14 GRIK1 glutamate receptor, ionotropic, kainate 1 1287 164 C20140710_OR014_02 C20140710_OR014_02 TB424730.[MT7]-AMLDIVK[MT7].2y4_1.heavy 539.333 / 618.394 8074.0 34.21879959106445 43 13 10 10 10 2.590285901758671 38.60577704264426 0.0 3 0.9282513459136552 4.5795623047587295 8074.0 20.947452429794158 0.0 - - - - - - - 277.4 16 10 GRM1 glutamate receptor, metabotropic 1 1289 164 C20140710_OR014_02 C20140710_OR014_02 TB424730.[MT7]-AMLDIVK[MT7].2y5_1.heavy 539.333 / 731.478 2531.0 34.21879959106445 43 13 10 10 10 2.590285901758671 38.60577704264426 0.0 3 0.9282513459136552 4.5795623047587295 2531.0 10.972200264790228 0.0 - - - - - - - 293.0 5 7 GRM1 glutamate receptor, metabotropic 1 1291 164 C20140710_OR014_02 C20140710_OR014_02 TB424730.[MT7]-AMLDIVK[MT7].2b4_1.heavy 539.333 / 575.298 10725.0 34.21879959106445 43 13 10 10 10 2.590285901758671 38.60577704264426 0.0 3 0.9282513459136552 4.5795623047587295 10725.0 39.62515546856589 0.0 - - - - - - - 289.5 21 10 GRM1 glutamate receptor, metabotropic 1 1293 164 C20140710_OR014_02 C20140710_OR014_02 TB424730.[MT7]-AMLDIVK[MT7].2y3_1.heavy 539.333 / 503.367 9159.0 34.21879959106445 43 13 10 10 10 2.590285901758671 38.60577704264426 0.0 3 0.9282513459136552 4.5795623047587295 9159.0 9.324589508002372 0.0 - - - - - - - 301.5 18 8 GRM1 glutamate receptor, metabotropic 1 1295 165 C20140710_OR014_02 C20140710_OR014_02 TB445722.[MT7]-RSSTLDC[CAM]K[MT7].3b6_1.heavy 418.895 / 804.433 596.0 16.4158992767334 38 18 2 10 8 7.88420392945493 12.68358871672583 0.0 4 0.9820011461660296 9.185152774903006 596.0 18.060606060606062 0.0 - - - - - - - 0.0 1 0 C6orf204 chromosome 6 open reading frame 204 1297 165 C20140710_OR014_02 C20140710_OR014_02 TB445722.[MT7]-RSSTLDC[CAM]K[MT7].3y3_1.heavy 418.895 / 566.273 2450.0 16.4158992767334 38 18 2 10 8 7.88420392945493 12.68358871672583 0.0 4 0.9820011461660296 9.185152774903006 2450.0 43.39679817038308 0.0 - - - - - - - 113.28571428571429 4 7 C6orf204 chromosome 6 open reading frame 204 1299 165 C20140710_OR014_02 C20140710_OR014_02 TB445722.[MT7]-RSSTLDC[CAM]K[MT7].3b4_1.heavy 418.895 / 576.322 1324.0 16.4158992767334 38 18 2 10 8 7.88420392945493 12.68358871672583 0.0 4 0.9820011461660296 9.185152774903006 1324.0 26.07878787878788 1.0 - - - - - - - 198.5 15 4 C6orf204 chromosome 6 open reading frame 204 1301 165 C20140710_OR014_02 C20140710_OR014_02 TB445722.[MT7]-RSSTLDC[CAM]K[MT7].3b5_1.heavy 418.895 / 689.406 132.0 16.4158992767334 38 18 2 10 8 7.88420392945493 12.68358871672583 0.0 4 0.9820011461660296 9.185152774903006 132.0 0.8797583081570998 10.0 - - - - - - - 0.0 0 0 C6orf204 chromosome 6 open reading frame 204 1303 166 C20140710_OR014_02 C20140710_OR014_02 TB424733.[MT7]-SFDDIAK[MT7].2y4_1.heavy 542.3 / 590.363 12447.0 27.624300003051758 48 18 10 10 10 3.7706978413459056 26.520289932408424 0.0 3 0.9835308781670218 9.603494751238381 12447.0 40.03260223048327 0.0 - - - - - - - 287.875 24 8 SSX7 synovial sarcoma, X breakpoint 7 1305 166 C20140710_OR014_02 C20140710_OR014_02 TB424733.[MT7]-SFDDIAK[MT7].2y5_1.heavy 542.3 / 705.39 3688.0 27.624300003051758 48 18 10 10 10 3.7706978413459056 26.520289932408424 0.0 3 0.9835308781670218 9.603494751238381 3688.0 7.031559716830327 1.0 - - - - - - - 268.6666666666667 8 6 SSX7 synovial sarcoma, X breakpoint 7 1307 166 C20140710_OR014_02 C20140710_OR014_02 TB424733.[MT7]-SFDDIAK[MT7].2b4_1.heavy 542.3 / 609.264 19823.0 27.624300003051758 48 18 10 10 10 3.7706978413459056 26.520289932408424 0.0 3 0.9835308781670218 9.603494751238381 19823.0 107.13586705202313 0.0 - - - - - - - 273.625 39 8 SSX7 synovial sarcoma, X breakpoint 7 1309 166 C20140710_OR014_02 C20140710_OR014_02 TB424733.[MT7]-SFDDIAK[MT7].2y6_1.heavy 542.3 / 852.458 5071.0 27.624300003051758 48 18 10 10 10 3.7706978413459056 26.520289932408424 0.0 3 0.9835308781670218 9.603494751238381 5071.0 29.07764161849711 0.0 - - - - - - - 201.5 10 8 SSX7 synovial sarcoma, X breakpoint 7 1311 167 C20140710_OR014_02 C20140710_OR014_02 TB433561.[MT7]-AVILQSASVSK[MT7].3b9_2.heavy 464.288 / 507.309 114.0 28.954274654388428 24 14 2 6 2 4.468260174712009 22.38007548574435 0.03790092468261719 15 0.9490719450738437 5.445317690047538 114.0 0.3677419354838709 30.0 - - - - - - - 252.77777777777777 4 9 C15orf2 chromosome 15 open reading frame 2 1313 167 C20140710_OR014_02 C20140710_OR014_02 TB433561.[MT7]-AVILQSASVSK[MT7].3y3_1.heavy 464.288 / 477.315 455.0 28.954274654388428 24 14 2 6 2 4.468260174712009 22.38007548574435 0.03790092468261719 15 0.9490719450738437 5.445317690047538 455.0 3.2927631578947367 15.0 - - - - - - - 227.72727272727272 3 11 C15orf2 chromosome 15 open reading frame 2 1315 167 C20140710_OR014_02 C20140710_OR014_02 TB433561.[MT7]-AVILQSASVSK[MT7].3b4_1.heavy 464.288 / 541.383 911.0 28.954274654388428 24 14 2 6 2 4.468260174712009 22.38007548574435 0.03790092468261719 15 0.9490719450738437 5.445317690047538 911.0 3.1759649122807017 6.0 - - - - - - - 240.44444444444446 2 9 C15orf2 chromosome 15 open reading frame 2 1317 167 C20140710_OR014_02 C20140710_OR014_02 TB433561.[MT7]-AVILQSASVSK[MT7].3y4_1.heavy 464.288 / 564.347 1138.0 28.954274654388428 24 14 2 6 2 4.468260174712009 22.38007548574435 0.03790092468261719 15 0.9490719450738437 5.445317690047538 1138.0 11.772277617119723 2.0 - - - - - - - 208.66666666666666 2 6 C15orf2 chromosome 15 open reading frame 2 1319 168 C20140710_OR014_02 C20140710_OR014_02 TB445727.[MT7]-RYQVVATMR.3b4_1.heavy 423.24 / 691.401 2352.0 24.302799224853516 48 18 10 10 10 6.3647115573489685 15.7116310926197 0.0 3 0.9808355908215329 8.900586380287733 2352.0 9.199048413153369 1.0 - - - - - - - 247.6 4 5 RDH8 retinol dehydrogenase 8 (all-trans) 1321 168 C20140710_OR014_02 C20140710_OR014_02 TB445727.[MT7]-RYQVVATMR.3b3_1.heavy 423.24 / 592.332 6561.0 24.302799224853516 48 18 10 10 10 6.3647115573489685 15.7116310926197 0.0 3 0.9808355908215329 8.900586380287733 6561.0 105.29346774193549 0.0 - - - - - - - 124.0 13 2 RDH8 retinol dehydrogenase 8 (all-trans) 1323 168 C20140710_OR014_02 C20140710_OR014_02 TB445727.[MT7]-RYQVVATMR.3y4_1.heavy 423.24 / 478.244 20549.0 24.302799224853516 48 18 10 10 10 6.3647115573489685 15.7116310926197 0.0 3 0.9808355908215329 8.900586380287733 20549.0 173.2168882372108 0.0 - - - - - - - 165.33333333333334 41 3 RDH8 retinol dehydrogenase 8 (all-trans) 1325 168 C20140710_OR014_02 C20140710_OR014_02 TB445727.[MT7]-RYQVVATMR.3y5_1.heavy 423.24 / 577.313 7551.0 24.302799224853516 48 18 10 10 10 6.3647115573489685 15.7116310926197 0.0 3 0.9808355908215329 8.900586380287733 7551.0 51.97643793687318 0.0 - - - - - - - 247.8 15 5 RDH8 retinol dehydrogenase 8 (all-trans) 1327 169 C20140710_OR014_02 C20140710_OR014_02 TB424890.[MT7]-SSVDFQAFGVK[MT7].2y4_1.heavy 736.903 / 594.373 2268.0 36.233001708984375 48 18 10 10 10 5.22501361731297 19.138706101865868 0.0 3 0.9819816917268679 9.18017783075496 2268.0 19.75459020428255 0.0 - - - - - - - 291.77777777777777 4 9 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1329 169 C20140710_OR014_02 C20140710_OR014_02 TB424890.[MT7]-SSVDFQAFGVK[MT7].2b4_1.heavy 736.903 / 533.269 3701.0 36.233001708984375 48 18 10 10 10 5.22501361731297 19.138706101865868 0.0 3 0.9819816917268679 9.18017783075496 3701.0 53.493445378151264 0.0 - - - - - - - 255.71428571428572 7 7 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1331 169 C20140710_OR014_02 C20140710_OR014_02 TB424890.[MT7]-SSVDFQAFGVK[MT7].2b6_1.heavy 736.903 / 808.396 1074.0 36.233001708984375 48 18 10 10 10 5.22501361731297 19.138706101865868 0.0 3 0.9819816917268679 9.18017783075496 1074.0 4.943096234309624 0.0 - - - - - - - 271.3636363636364 2 11 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1333 169 C20140710_OR014_02 C20140710_OR014_02 TB424890.[MT7]-SSVDFQAFGVK[MT7].2y7_1.heavy 736.903 / 940.537 1433.0 36.233001708984375 48 18 10 10 10 5.22501361731297 19.138706101865868 0.0 3 0.9819816917268679 9.18017783075496 1433.0 6.084245810055866 1.0 - - - - - - - 271.27272727272725 2 11 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1335 170 C20140710_OR014_02 C20140710_OR014_02 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 94885.0 40.508399963378906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 94885.0 306.3856555944056 0.0 - - - - - - - 1158.142857142857 189 7 1337 170 C20140710_OR014_02 C20140710_OR014_02 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 174957.0 40.508399963378906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 174957.0 309.84925444103055 0.0 - - - - - - - 675.75 349 8 1339 170 C20140710_OR014_02 C20140710_OR014_02 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 236112.0 40.508399963378906 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 236112.0 610.1457788494661 0.0 - - - - - - - 1172.4285714285713 472 7 1341 171 C20140710_OR014_02 C20140710_OR014_02 TB425132.[MT7]-EK[MT7]PDLEFVLEMSSPQLIK[MT7].3b6_2.heavy 845.808 / 500.781 4914.0 44.41630172729492 40 12 10 10 8 2.6069016255472426 38.3597136999782 0.0 4 0.8929378273566656 3.7375865258704386 4914.0 34.125 0.0 - - - - - - - 240.0 9 2 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1343 171 C20140710_OR014_02 C20140710_OR014_02 TB425132.[MT7]-EK[MT7]PDLEFVLEMSSPQLIK[MT7].3b6_1.heavy 845.808 / 1000.56 2397.0 44.41630172729492 40 12 10 10 8 2.6069016255472426 38.3597136999782 0.0 4 0.8929378273566656 3.7375865258704386 2397.0 9.727611648865153 1.0 - - - - - - - 220.0 5 6 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1345 171 C20140710_OR014_02 C20140710_OR014_02 TB425132.[MT7]-EK[MT7]PDLEFVLEMSSPQLIK[MT7].3b4_1.heavy 845.808 / 758.429 2637.0 44.41630172729492 40 12 10 10 8 2.6069016255472426 38.3597136999782 0.0 4 0.8929378273566656 3.7375865258704386 2637.0 22.951171930870082 1.0 - - - - - - - 203.8 5 10 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1347 171 C20140710_OR014_02 C20140710_OR014_02 TB425132.[MT7]-EK[MT7]PDLEFVLEMSSPQLIK[MT7].3b7_2.heavy 845.808 / 574.315 8869.0 44.41630172729492 40 12 10 10 8 2.6069016255472426 38.3597136999782 0.0 4 0.8929378273566656 3.7375865258704386 8869.0 44.53000208594076 1.0 - - - - - - - 188.57142857142858 19 7 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1349 172 C20140710_OR014_02 C20140710_OR014_02 TB424792.[MT7]-VVPSDTLQAR.2y8_1.heavy 615.352 / 887.458 55208.0 26.60700035095215 47 17 10 10 10 2.1875459610980212 34.59323603901875 0.0 3 0.9790527142400677 8.512114467906107 55208.0 573.2372263281454 0.0 - - - - - - - 235.4 110 10 GRM1 glutamate receptor, metabotropic 1 1351 172 C20140710_OR014_02 C20140710_OR014_02 TB424792.[MT7]-VVPSDTLQAR.2y5_1.heavy 615.352 / 588.346 9531.0 26.60700035095215 47 17 10 10 10 2.1875459610980212 34.59323603901875 0.0 3 0.9790527142400677 8.512114467906107 9531.0 43.612452872531414 0.0 - - - - - - - 220.22222222222223 19 9 GRM1 glutamate receptor, metabotropic 1 1353 172 C20140710_OR014_02 C20140710_OR014_02 TB424792.[MT7]-VVPSDTLQAR.2y9_1.heavy 615.352 / 986.526 19929.0 26.60700035095215 47 17 10 10 10 2.1875459610980212 34.59323603901875 0.0 3 0.9790527142400677 8.512114467906107 19929.0 56.221247340621225 0.0 - - - - - - - 247.6 39 5 GRM1 glutamate receptor, metabotropic 1 1355 172 C20140710_OR014_02 C20140710_OR014_02 TB424792.[MT7]-VVPSDTLQAR.2y7_1.heavy 615.352 / 790.405 2723.0 26.60700035095215 47 17 10 10 10 2.1875459610980212 34.59323603901875 0.0 3 0.9790527142400677 8.512114467906107 2723.0 15.973149726110773 0.0 - - - - - - - 300.7142857142857 5 7 GRM1 glutamate receptor, metabotropic 1 1357 173 C20140710_OR014_02 C20140710_OR014_02 TB433567.[MT7]-LLAETADMIGVR.3y6_1.heavy 478.27 / 690.36 831.0 42.2775993347168 41 11 10 10 10 1.8761153372800317 42.3858789368538 0.0 3 0.8533741013725965 3.182744334266926 831.0 2.996153846153846 1.0 - - - - - - - 0.0 1 0 CABP2 calcium binding protein 2 1359 173 C20140710_OR014_02 C20140710_OR014_02 TB433567.[MT7]-LLAETADMIGVR.3b4_1.heavy 478.27 / 571.357 1662.0 42.2775993347168 41 11 10 10 10 1.8761153372800317 42.3858789368538 0.0 3 0.8533741013725965 3.182744334266926 1662.0 20.98807692307692 0.0 - - - - - - - 242.66666666666666 3 3 CABP2 calcium binding protein 2 1361 173 C20140710_OR014_02 C20140710_OR014_02 TB433567.[MT7]-LLAETADMIGVR.3b7_1.heavy 478.27 / 858.469 1351.0 42.2775993347168 41 11 10 10 10 1.8761153372800317 42.3858789368538 0.0 3 0.8533741013725965 3.182744334266926 1351.0 15.588461538461537 0.0 - - - - - - - 242.66666666666666 2 3 CABP2 calcium binding protein 2 1363 173 C20140710_OR014_02 C20140710_OR014_02 TB433567.[MT7]-LLAETADMIGVR.3y5_1.heavy 478.27 / 575.333 3013.0 42.2775993347168 41 11 10 10 10 1.8761153372800317 42.3858789368538 0.0 3 0.8533741013725965 3.182744334266926 3013.0 46.35384615384615 0.0 - - - - - - - 104.0 6 2 CABP2 calcium binding protein 2 1365 174 C20140710_OR014_02 C20140710_OR014_02 TB445921.[MT7]-LIQC[CAM]LFGPLQAGPSNAGGK[MT7].4b7_1.heavy 554.808 / 976.541 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1367 174 C20140710_OR014_02 C20140710_OR014_02 TB445921.[MT7]-LIQC[CAM]LFGPLQAGPSNAGGK[MT7].4b4_1.heavy 554.808 / 659.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1369 174 C20140710_OR014_02 C20140710_OR014_02 TB445921.[MT7]-LIQC[CAM]LFGPLQAGPSNAGGK[MT7].4y3_1.heavy 554.808 / 405.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1371 174 C20140710_OR014_02 C20140710_OR014_02 TB445921.[MT7]-LIQC[CAM]LFGPLQAGPSNAGGK[MT7].4b10_2.heavy 554.808 / 657.872 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1373 175 C20140710_OR014_02 C20140710_OR014_02 TB424739.[MT7]-GILDMEK[MT7].2y4_1.heavy 547.312 / 666.325 7214.0 32.410499572753906 46 16 10 10 10 6.816106073675108 14.671133183536565 0.0 3 0.9633553375227031 6.427199660028729 7214.0 22.83890299770402 0.0 - - - - - - - 216.0 14 8 OVCH1 ovochymase 1 1375 175 C20140710_OR014_02 C20140710_OR014_02 TB424739.[MT7]-GILDMEK[MT7].2y5_1.heavy 547.312 / 779.409 3454.0 32.410499572753906 46 16 10 10 10 6.816106073675108 14.671133183536565 0.0 3 0.9633553375227031 6.427199660028729 3454.0 31.347682784108404 1.0 - - - - - - - 142.4 9 5 OVCH1 ovochymase 1 1377 175 C20140710_OR014_02 C20140710_OR014_02 TB424739.[MT7]-GILDMEK[MT7].2b4_1.heavy 547.312 / 543.326 11582.0 32.410499572753906 46 16 10 10 10 6.816106073675108 14.671133183536565 0.0 3 0.9633553375227031 6.427199660028729 11582.0 21.427722895466765 0.0 - - - - - - - 261.2857142857143 23 7 OVCH1 ovochymase 1 1379 175 C20140710_OR014_02 C20140710_OR014_02 TB424739.[MT7]-GILDMEK[MT7].2y3_1.heavy 547.312 / 551.298 11074.0 32.410499572753906 46 16 10 10 10 6.816106073675108 14.671133183536565 0.0 3 0.9633553375227031 6.427199660028729 11074.0 57.970605751976336 0.0 - - - - - - - 212.45454545454547 22 11 OVCH1 ovochymase 1 1381 176 C20140710_OR014_02 C20140710_OR014_02 TB424735.[MT7]-GFRDLLHIGTQAR.3b6_1.heavy 543.31 / 846.495 2047.0 34.40409851074219 40 14 6 10 10 2.2495273328773084 44.453783040765614 0.0 3 0.9321768355553567 4.711808578243486 2047.0 18.797604054123575 0.0 - - - - - - - 213.25 4 8 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1383 176 C20140710_OR014_02 C20140710_OR014_02 TB424735.[MT7]-GFRDLLHIGTQAR.3y6_1.heavy 543.31 / 645.368 4094.0 34.40409851074219 40 14 6 10 10 2.2495273328773084 44.453783040765614 0.0 3 0.9321768355553567 4.711808578243486 4094.0 11.633841736153293 0.0 - - - - - - - 284.3333333333333 8 6 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1385 176 C20140710_OR014_02 C20140710_OR014_02 TB424735.[MT7]-GFRDLLHIGTQAR.3b4_1.heavy 543.31 / 620.327 1706.0 34.40409851074219 40 14 6 10 10 2.2495273328773084 44.453783040765614 0.0 3 0.9321768355553567 4.711808578243486 1706.0 5.649322750114207 3.0 - - - - - - - 255.875 28 8 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1387 176 C20140710_OR014_02 C20140710_OR014_02 TB424735.[MT7]-GFRDLLHIGTQAR.3y5_1.heavy 543.31 / 532.284 10007.0 34.40409851074219 40 14 6 10 10 2.2495273328773084 44.453783040765614 0.0 3 0.9321768355553567 4.711808578243486 10007.0 68.28965959150982 0.0 - - - - - - - 238.8 20 10 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1389 177 C20140710_OR014_02 C20140710_OR014_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 110649.0 35.6599006652832 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 110649.0 453.6249966386228 0.0 - - - - - - - 107.0 221 2 1391 177 C20140710_OR014_02 C20140710_OR014_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 26941.0 35.6599006652832 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 26941.0 131.68357943925236 1.0 - - - - - - - 192.6 61 5 1393 177 C20140710_OR014_02 C20140710_OR014_02 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 25123.0 35.6599006652832 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 25123.0 94.17141553792993 0.0 - - - - - - - 187.25 50 4 1395 178 C20140710_OR014_02 C20140710_OR014_02 TB424899.[MT7]-TRVTITGLLPK[MT7].3b4_1.heavy 496.323 / 602.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1397 178 C20140710_OR014_02 C20140710_OR014_02 TB424899.[MT7]-TRVTITGLLPK[MT7].3b5_1.heavy 496.323 / 715.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1399 178 C20140710_OR014_02 C20140710_OR014_02 TB424899.[MT7]-TRVTITGLLPK[MT7].3y5_1.heavy 496.323 / 671.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1401 178 C20140710_OR014_02 C20140710_OR014_02 TB424899.[MT7]-TRVTITGLLPK[MT7].3b7_1.heavy 496.323 / 873.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1403 179 C20140710_OR014_02 C20140710_OR014_02 TB425124.[MT7]-TLIVTTILEEPYVMYRK[MT7].3y7_1.heavy 786.451 / 1100.6 4224.0 46.407501220703125 45 15 10 10 10 2.8820290364110384 34.697776717936534 0.0 3 0.9560148204286404 5.862789665721599 4224.0 51.73788004526594 0.0 - - - - - - - 281.6666666666667 8 3 GRIK1 glutamate receptor, ionotropic, kainate 1 1405 179 C20140710_OR014_02 C20140710_OR014_02 TB425124.[MT7]-TLIVTTILEEPYVMYRK[MT7].3b4_1.heavy 786.451 / 571.394 3379.0 46.407501220703125 45 15 10 10 10 2.8820290364110384 34.697776717936534 0.0 3 0.9560148204286404 5.862789665721599 3379.0 9.773138018599225 0.0 - - - - - - - 331.75 6 4 GRIK1 glutamate receptor, ionotropic, kainate 1 1407 179 C20140710_OR014_02 C20140710_OR014_02 TB425124.[MT7]-TLIVTTILEEPYVMYRK[MT7].3y7_2.heavy 786.451 / 550.806 2655.0 46.407501220703125 45 15 10 10 10 2.8820290364110384 34.697776717936534 0.0 3 0.9560148204286404 5.862789665721599 2655.0 10.620262908525271 1.0 - - - - - - - 265.6 6 5 GRIK1 glutamate receptor, ionotropic, kainate 1 1409 179 C20140710_OR014_02 C20140710_OR014_02 TB425124.[MT7]-TLIVTTILEEPYVMYRK[MT7].3y8_1.heavy 786.451 / 1229.65 1086.0 46.407501220703125 45 15 10 10 10 2.8820290364110384 34.697776717936534 0.0 3 0.9560148204286404 5.862789665721599 1086.0 10.596102133958308 0.0 - - - - - - - 221.33333333333334 2 6 GRIK1 glutamate receptor, ionotropic, kainate 1 1411 180 C20140710_OR014_02 C20140710_OR014_02 TB425128.[MT7]-VPIHSLVLDC[CAM]GAISFLDVVGVR.3y12_1.heavy 837.469 / 1232.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC26A4 solute carrier family 26, member 4 1413 180 C20140710_OR014_02 C20140710_OR014_02 TB425128.[MT7]-VPIHSLVLDC[CAM]GAISFLDVVGVR.3y8_1.heavy 837.469 / 904.525 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC26A4 solute carrier family 26, member 4 1415 180 C20140710_OR014_02 C20140710_OR014_02 TB425128.[MT7]-VPIHSLVLDC[CAM]GAISFLDVVGVR.3y5_1.heavy 837.469 / 529.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC26A4 solute carrier family 26, member 4 1417 180 C20140710_OR014_02 C20140710_OR014_02 TB425128.[MT7]-VPIHSLVLDC[CAM]GAISFLDVVGVR.3y10_1.heavy 837.469 / 1104.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC26A4 solute carrier family 26, member 4 1419 181 C20140710_OR014_02 C20140710_OR014_02 TB445835.[MT7]-HLTGPLY[MT7]FSPK[MT7].4y4_1.heavy 423.752 / 622.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM150B family with sequence similarity 150, member B 1421 181 C20140710_OR014_02 C20140710_OR014_02 TB445835.[MT7]-HLTGPLY[MT7]FSPK[MT7].4b4_1.heavy 423.752 / 553.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM150B family with sequence similarity 150, member B 1423 181 C20140710_OR014_02 C20140710_OR014_02 TB445835.[MT7]-HLTGPLY[MT7]FSPK[MT7].4y3_1.heavy 423.752 / 475.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM150B family with sequence similarity 150, member B 1425 181 C20140710_OR014_02 C20140710_OR014_02 TB445835.[MT7]-HLTGPLY[MT7]FSPK[MT7].4b3_1.heavy 423.752 / 496.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM150B family with sequence similarity 150, member B 1427 182 C20140710_OR014_02 C20140710_OR014_02 TB425129.[MT7]-NDEMQETPNRDLVLEPSLK[MT7].4y4_1.heavy 629.828 / 588.384 60899.0 33.4296989440918 44 14 10 10 10 2.325950896160679 36.28132790390836 0.0 3 0.9468524184476166 5.329397574483545 60899.0 102.4804837273724 0.0 - - - - - - - 767.5 121 8 SPANXN5 SPANX family, member N5 1429 182 C20140710_OR014_02 C20140710_OR014_02 TB425129.[MT7]-NDEMQETPNRDLVLEPSLK[MT7].4b11_2.heavy 629.828 / 737.821 29784.0 33.4296989440918 44 14 10 10 10 2.325950896160679 36.28132790390836 0.0 3 0.9468524184476166 5.329397574483545 29784.0 91.16499185667752 0.0 - - - - - - - 281.5 59 4 SPANXN5 SPANX family, member N5 1431 182 C20140710_OR014_02 C20140710_OR014_02 TB425129.[MT7]-NDEMQETPNRDLVLEPSLK[MT7].4b12_2.heavy 629.828 / 794.363 33059.0 33.4296989440918 44 14 10 10 10 2.325950896160679 36.28132790390836 0.0 3 0.9468524184476166 5.329397574483545 33059.0 184.61071507640156 0.0 - - - - - - - 204.8 66 5 SPANXN5 SPANX family, member N5 1433 182 C20140710_OR014_02 C20140710_OR014_02 TB425129.[MT7]-NDEMQETPNRDLVLEPSLK[MT7].4b3_1.heavy 629.828 / 503.222 12180.0 33.4296989440918 44 14 10 10 10 2.325950896160679 36.28132790390836 0.0 3 0.9468524184476166 5.329397574483545 12180.0 63.89788074512396 0.0 - - - - - - - 260.54545454545456 24 11 SPANXN5 SPANX family, member N5 1435 183 C20140710_OR014_02 C20140710_OR014_02 TB425127.[MT7]-GWILEIMSSQPLPMSPPSTTR.3b6_1.heavy 824.763 / 856.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 1437 183 C20140710_OR014_02 C20140710_OR014_02 TB425127.[MT7]-GWILEIMSSQPLPMSPPSTTR.3y11_1.heavy 824.763 / 1183.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 1439 183 C20140710_OR014_02 C20140710_OR014_02 TB425127.[MT7]-GWILEIMSSQPLPMSPPSTTR.3b3_1.heavy 824.763 / 501.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 1441 183 C20140710_OR014_02 C20140710_OR014_02 TB425127.[MT7]-GWILEIMSSQPLPMSPPSTTR.3y9_1.heavy 824.763 / 973.477 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 1443 184 C20140710_OR014_02 C20140710_OR014_02 TB433573.[MT7]-TQMWLTEQLR.2y8_1.heavy 725.386 / 1076.56 5413.0 38.205101013183594 40 14 10 6 10 5.764721822814653 17.346890808197667 0.03900146484375 3 0.9482392951569271 5.400960015987294 5413.0 35.074092336182034 0.0 - - - - - - - 300.8888888888889 10 9 C6orf204 chromosome 6 open reading frame 204 1445 184 C20140710_OR014_02 C20140710_OR014_02 TB433573.[MT7]-TQMWLTEQLR.2y9_1.heavy 725.386 / 1204.61 1516.0 38.205101013183594 40 14 10 6 10 5.764721822814653 17.346890808197667 0.03900146484375 3 0.9482392951569271 5.400960015987294 1516.0 2.896120092378753 1.0 - - - - - - - 279.8333333333333 3 12 C6orf204 chromosome 6 open reading frame 204 1447 184 C20140710_OR014_02 C20140710_OR014_02 TB433573.[MT7]-TQMWLTEQLR.2y6_1.heavy 725.386 / 759.436 3572.0 38.205101013183594 40 14 10 6 10 5.764721822814653 17.346890808197667 0.03900146484375 3 0.9482392951569271 5.400960015987294 3572.0 46.21103533026114 0.0 - - - - - - - 151.6 7 10 C6orf204 chromosome 6 open reading frame 204 1449 184 C20140710_OR014_02 C20140710_OR014_02 TB433573.[MT7]-TQMWLTEQLR.2y7_1.heavy 725.386 / 945.515 6279.0 38.205101013183594 40 14 10 6 10 5.764721822814653 17.346890808197667 0.03900146484375 3 0.9482392951569271 5.400960015987294 6279.0 24.643039260969978 0.0 - - - - - - - 240.66666666666666 12 9 C6orf204 chromosome 6 open reading frame 204 1451 185 C20140710_OR014_02 C20140710_OR014_02 TB445628.[MT7]-DQPQGSHFWK[MT7].3y3_1.heavy 506.596 / 624.363 7494.0 26.133049488067627 41 20 10 1 10 17.36447123641635 5.758885406788686 0.09020042419433594 3 0.9980331600893624 27.823172966922986 7494.0 40.95146456692913 0.0 - - - - - - - 163.28571428571428 14 7 HOXD13 homeobox D13 1453 185 C20140710_OR014_02 C20140710_OR014_02 TB445628.[MT7]-DQPQGSHFWK[MT7].3b6_1.heavy 506.596 / 757.36 1778.0 26.133049488067627 41 20 10 1 10 17.36447123641635 5.758885406788686 0.09020042419433594 3 0.9980331600893624 27.823172966922986 1778.0 5.016666666666667 0.0 - - - - - - - 304.8 3 5 HOXD13 homeobox D13 1455 185 C20140710_OR014_02 C20140710_OR014_02 TB445628.[MT7]-DQPQGSHFWK[MT7].3b4_1.heavy 506.596 / 613.306 1905.0 26.133049488067627 41 20 10 1 10 17.36447123641635 5.758885406788686 0.09020042419433594 3 0.9980331600893624 27.823172966922986 1905.0 5.1499999999999995 1.0 - - - - - - - 222.25 3 8 HOXD13 homeobox D13 1457 185 C20140710_OR014_02 C20140710_OR014_02 TB445628.[MT7]-DQPQGSHFWK[MT7].3b5_1.heavy 506.596 / 670.328 2032.0 26.133049488067627 41 20 10 1 10 17.36447123641635 5.758885406788686 0.09020042419433594 3 0.9980331600893624 27.823172966922986 2032.0 16.64 0.0 - - - - - - - 199.57142857142858 4 7 HOXD13 homeobox D13 1459 186 C20140710_OR014_02 C20140710_OR014_02 TB445626.[MT7]-GWWAAK[MT7].2b3_1.heavy 503.789 / 574.289 1081.0 32.96760177612305 40 20 0 10 10 3.574499711217723 21.22439899123262 0.0 3 0.9919223236273017 13.722282955224216 1081.0 1.9142122158597952 10.0 - - - - - - - 300.0 30 6 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1461 186 C20140710_OR014_02 C20140710_OR014_02 TB445626.[MT7]-GWWAAK[MT7].2y4_1.heavy 503.789 / 619.368 4443.0 32.96760177612305 40 20 0 10 10 3.574499711217723 21.22439899123262 0.0 3 0.9919223236273017 13.722282955224216 4443.0 14.128318765175166 0.0 - - - - - - - 225.0 8 8 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1463 186 C20140710_OR014_02 C20140710_OR014_02 TB445626.[MT7]-GWWAAK[MT7].2y5_1.heavy 503.789 / 805.448 1201.0 32.96760177612305 40 20 0 10 10 3.574499711217723 21.22439899123262 0.0 3 0.9919223236273017 13.722282955224216 1201.0 5.347309523809523 0.0 - - - - - - - 240.0 2 7 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1465 186 C20140710_OR014_02 C20140710_OR014_02 TB445626.[MT7]-GWWAAK[MT7].2b4_1.heavy 503.789 / 645.326 1561.0 32.96760177612305 40 20 0 10 10 3.574499711217723 21.22439899123262 0.0 3 0.9919223236273017 13.722282955224216 1561.0 10.315608333333333 1.0 - - - - - - - 280.0 3 6 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1467 187 C20140710_OR014_02 C20140710_OR014_02 TB424740.[MT7]-VLEPPLGAR.2y8_1.heavy 548.336 / 852.494 11606.0 31.434450149536133 46 20 10 6 10 96.59569100602226 1.0352428659966364 0.03260040283203125 3 0.9994970811137052 55.02945279449916 11606.0 16.859653392065418 0.0 - - - - - - - 214.8 23 5 MPL myeloproliferative leukemia virus oncogene 1469 187 C20140710_OR014_02 C20140710_OR014_02 TB424740.[MT7]-VLEPPLGAR.2y5_1.heavy 548.336 / 513.314 3023.0 31.434450149536133 46 20 10 6 10 96.59569100602226 1.0352428659966364 0.03260040283203125 3 0.9994970811137052 55.02945279449916 3023.0 2.0596263736263736 0.0 - - - - - - - 682.7777777777778 6 9 MPL myeloproliferative leukemia virus oncogene 1471 187 C20140710_OR014_02 C20140710_OR014_02 TB424740.[MT7]-VLEPPLGAR.2y6_1.heavy 548.336 / 610.367 36573.0 31.434450149536133 46 20 10 6 10 96.59569100602226 1.0352428659966364 0.03260040283203125 3 0.9994970811137052 55.02945279449916 36573.0 4.6236409608091025 1.0 - - - - - - - 292.8 73 5 MPL myeloproliferative leukemia virus oncogene 1473 187 C20140710_OR014_02 C20140710_OR014_02 TB424740.[MT7]-VLEPPLGAR.2y7_1.heavy 548.336 / 739.41 5266.0 31.434450149536133 46 20 10 6 10 96.59569100602226 1.0352428659966364 0.03260040283203125 3 0.9994970811137052 55.02945279449916 5266.0 2.7005128205128206 0.0 - - - - - - - 210.23076923076923 10 13 MPL myeloproliferative leukemia virus oncogene 1475 188 C20140710_OR014_02 C20140710_OR014_02 TB425120.[MT7]-TFEDLTC[CAM]FWDEEEAAPSGTYQLLYAYPR.3y5_1.heavy 1172.87 / 669.336 1922.0 50.78869915008545 35 13 10 2 10 2.050835979771218 38.71127531884029 0.087799072265625 3 0.926157733660239 4.513365313634858 1922.0 20.856554455445544 0.0 - - - - - - - 134.66666666666666 3 3 MPL myeloproliferative leukemia virus oncogene 1477 188 C20140710_OR014_02 C20140710_OR014_02 TB425120.[MT7]-TFEDLTC[CAM]FWDEEEAAPSGTYQLLYAYPR.3b4_1.heavy 1172.87 / 637.295 1315.0 50.78869915008545 35 13 10 2 10 2.050835979771218 38.71127531884029 0.087799072265625 3 0.926157733660239 4.513365313634858 1315.0 7.811881188118812 0.0 - - - - - - - 134.66666666666666 2 3 MPL myeloproliferative leukemia virus oncogene 1479 188 C20140710_OR014_02 C20140710_OR014_02 TB425120.[MT7]-TFEDLTC[CAM]FWDEEEAAPSGTYQLLYAYPR.3b5_1.heavy 1172.87 / 750.379 1012.0 50.78869915008545 35 13 10 2 10 2.050835979771218 38.71127531884029 0.087799072265625 3 0.926157733660239 4.513365313634858 1012.0 1.099753086419753 1.0 - - - - - - - 354.0 2 2 MPL myeloproliferative leukemia virus oncogene 1481 188 C20140710_OR014_02 C20140710_OR014_02 TB425120.[MT7]-TFEDLTC[CAM]FWDEEEAAPSGTYQLLYAYPR.3b3_1.heavy 1172.87 / 522.268 405.0 50.78869915008545 35 13 10 2 10 2.050835979771218 38.71127531884029 0.087799072265625 3 0.926157733660239 4.513365313634858 405.0 0.0 2.0 - - - - - - - 0.0 0 0 MPL myeloproliferative leukemia virus oncogene 1483 189 C20140710_OR014_02 C20140710_OR014_02 TB445625.[MT7]-TREVAER.2b3_1.heavy 502.784 / 531.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEFB113 defensin, beta 113 1485 189 C20140710_OR014_02 C20140710_OR014_02 TB445625.[MT7]-TREVAER.2y5_1.heavy 502.784 / 603.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEFB113 defensin, beta 113 1487 189 C20140710_OR014_02 C20140710_OR014_02 TB445625.[MT7]-TREVAER.2b6_1.heavy 502.784 / 830.449 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEFB113 defensin, beta 113 1489 189 C20140710_OR014_02 C20140710_OR014_02 TB445625.[MT7]-TREVAER.2b5_1.heavy 502.784 / 701.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEFB113 defensin, beta 113 1491 190 C20140710_OR014_02 C20140710_OR014_02 TB445624.[MT7]-AVLPGMK[MT7].2y4_1.heavy 502.314 / 576.33 34039.0 29.12114953994751 46 20 10 6 10 6.225101009186001 16.06399636767919 0.03539848327636719 3 0.9970626587452336 22.765584441302895 34039.0 230.58677419354837 0.0 - - - - - - - 186.0 68 5 RDH8 retinol dehydrogenase 8 (all-trans) 1493 190 C20140710_OR014_02 C20140710_OR014_02 TB445624.[MT7]-AVLPGMK[MT7].2y5_1.heavy 502.314 / 689.414 5022.0 29.12114953994751 46 20 10 6 10 6.225101009186001 16.06399636767919 0.03539848327636719 3 0.9970626587452336 22.765584441302895 5022.0 9.956842105263158 0.0 - - - - - - - 260.4 10 10 RDH8 retinol dehydrogenase 8 (all-trans) 1495 190 C20140710_OR014_02 C20140710_OR014_02 TB445624.[MT7]-AVLPGMK[MT7].2y3_1.heavy 502.314 / 479.277 6045.0 29.12114953994751 46 20 10 6 10 6.225101009186001 16.06399636767919 0.03539848327636719 3 0.9970626587452336 22.765584441302895 6045.0 9.75 1.0 - - - - - - - 255.75 12 12 RDH8 retinol dehydrogenase 8 (all-trans) 1497 190 C20140710_OR014_02 C20140710_OR014_02 TB445624.[MT7]-AVLPGMK[MT7].2y6_1.heavy 502.314 / 788.482 2046.0 29.12114953994751 46 20 10 6 10 6.225101009186001 16.06399636767919 0.03539848327636719 3 0.9970626587452336 22.765584441302895 2046.0 42.28399999999999 2.0 - - - - - - - 116.25 4 4 RDH8 retinol dehydrogenase 8 (all-trans) 1499 191 C20140710_OR014_02 C20140710_OR014_02 TB445623.[MT7]-RAQTLDR.2b3_1.heavy 502.292 / 500.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1501 191 C20140710_OR014_02 C20140710_OR014_02 TB445623.[MT7]-RAQTLDR.2b4_1.heavy 502.292 / 601.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1503 191 C20140710_OR014_02 C20140710_OR014_02 TB445623.[MT7]-RAQTLDR.2b6_1.heavy 502.292 / 829.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1505 191 C20140710_OR014_02 C20140710_OR014_02 TB445623.[MT7]-RAQTLDR.2y6_1.heavy 502.292 / 703.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1507 192 C20140710_OR014_02 C20140710_OR014_02 TB424747.[MT7]-STVGFDAIR.2y8_1.heavy 555.307 / 878.473 5343.0 30.51849937438965 47 17 10 10 10 17.093781337568487 5.850080682863383 0.0 3 0.9723467826048949 7.404293400736424 5343.0 4.131714198261981 0.0 - - - - - - - 235.875 10 16 SLC26A4 solute carrier family 26, member 4 1509 192 C20140710_OR014_02 C20140710_OR014_02 TB424747.[MT7]-STVGFDAIR.2b6_1.heavy 555.307 / 751.374 5343.0 30.51849937438965 47 17 10 10 10 17.093781337568487 5.850080682863383 0.0 3 0.9723467826048949 7.404293400736424 5343.0 25.15230167465996 0.0 - - - - - - - 199.41666666666666 10 12 SLC26A4 solute carrier family 26, member 4 1511 192 C20140710_OR014_02 C20140710_OR014_02 TB424747.[MT7]-STVGFDAIR.2y6_1.heavy 555.307 / 678.357 5619.0 30.51849937438965 47 17 10 10 10 17.093781337568487 5.850080682863383 0.0 3 0.9723467826048949 7.404293400736424 5619.0 16.504345311385823 0.0 - - - - - - - 243.64705882352942 11 17 SLC26A4 solute carrier family 26, member 4 1513 192 C20140710_OR014_02 C20140710_OR014_02 TB424747.[MT7]-STVGFDAIR.2y7_1.heavy 555.307 / 777.425 2026.0 30.51849937438965 47 17 10 10 10 17.093781337568487 5.850080682863383 0.0 3 0.9723467826048949 7.404293400736424 2026.0 0.07842058207903402 0.0 - - - - - - - 208.53333333333333 4 15 SLC26A4 solute carrier family 26, member 4 1515 193 C20140710_OR014_02 C20140710_OR014_02 TB424748.[MT7]-ASLGIFSK[MT7].2y4_1.heavy 555.842 / 638.399 2072.0 34.91279983520508 50 20 10 10 10 5.202524284777131 19.221438387631448 0.0 3 0.9914993233483451 13.376037911699337 2072.0 10.75705859926891 0.0 - - - - - - - 341.6 4 5 OVCH1 ovochymase 1 1517 193 C20140710_OR014_02 C20140710_OR014_02 TB424748.[MT7]-ASLGIFSK[MT7].2y5_1.heavy 555.842 / 695.421 6338.0 34.91279983520508 50 20 10 10 10 5.202524284777131 19.221438387631448 0.0 3 0.9914993233483451 13.376037911699337 6338.0 26.7209714996237 1.0 - - - - - - - 244.0 12 6 OVCH1 ovochymase 1 1519 193 C20140710_OR014_02 C20140710_OR014_02 TB424748.[MT7]-ASLGIFSK[MT7].2y3_1.heavy 555.842 / 525.315 7556.0 34.91279983520508 50 20 10 10 10 5.202524284777131 19.221438387631448 0.0 3 0.9914993233483451 13.376037911699337 7556.0 6.1494105595790405 1.0 - - - - - - - 305.0 15 6 OVCH1 ovochymase 1 1521 193 C20140710_OR014_02 C20140710_OR014_02 TB424748.[MT7]-ASLGIFSK[MT7].2y7_1.heavy 555.842 / 895.537 3169.0 34.91279983520508 50 20 10 10 10 5.202524284777131 19.221438387631448 0.0 3 0.9914993233483451 13.376037911699337 3169.0 24.572737704918033 0.0 - - - - - - - 244.0 6 5 OVCH1 ovochymase 1 1523 194 C20140710_OR014_02 C20140710_OR014_02 TB433431.[MT7]-VSSLGK[MT7].2y4_1.heavy 439.781 / 548.352 2566.0 21.399224281311035 32 10 10 6 6 0.8787014717418292 69.40155854513938 0.033100128173828125 5 0.8324539751970821 2.9719141072979776 2566.0 5.552163742690059 1.0 - - - - - - - 218.5 7 10 CRIP2;CRIP3 cysteine-rich protein 2;cysteine-rich protein 3 1525 194 C20140710_OR014_02 C20140710_OR014_02 TB433431.[MT7]-VSSLGK[MT7].2y5_1.heavy 439.781 / 635.385 3707.0 21.399224281311035 32 10 10 6 6 0.8787014717418292 69.40155854513938 0.033100128173828125 5 0.8324539751970821 2.9719141072979776 3707.0 8.584631578947368 1.0 - - - - - - - 190.0 7 3 CRIP2;CRIP3 cysteine-rich protein 2;cysteine-rich protein 3 1527 194 C20140710_OR014_02 C20140710_OR014_02 TB433431.[MT7]-VSSLGK[MT7].2b4_1.heavy 439.781 / 531.326 1236.0 21.399224281311035 32 10 10 6 6 0.8787014717418292 69.40155854513938 0.033100128173828125 5 0.8324539751970821 2.9719141072979776 1236.0 6.993157894736841 3.0 - - - - - - - 237.5 3 6 CRIP2;CRIP3 cysteine-rich protein 2;cysteine-rich protein 3 1529 194 C20140710_OR014_02 C20140710_OR014_02 TB433431.[MT7]-VSSLGK[MT7].2y3_1.heavy 439.781 / 461.32 5037.0 21.399224281311035 32 10 10 6 6 0.8787014717418292 69.40155854513938 0.033100128173828125 5 0.8324539751970821 2.9719141072979776 5037.0 22.136289473684208 0.0 - - - - - - - 221.66666666666666 10 12 CRIP2;CRIP3 cysteine-rich protein 2;cysteine-rich protein 3 1531 195 C20140710_OR014_02 C20140710_OR014_02 TB445939.[MT7]-TLIVTTILEEPYVMYRK[MT7].4y5_1.heavy 590.09 / 840.488 2146.0 46.407501220703125 39 9 10 10 10 1.9490988529283255 51.30576104426927 0.0 3 0.8126823501016948 2.8057446861240694 2146.0 28.48672566371682 0.0 - - - - - - - 254.25 4 4 GRIK1 glutamate receptor, ionotropic, kainate 1 1533 195 C20140710_OR014_02 C20140710_OR014_02 TB445939.[MT7]-TLIVTTILEEPYVMYRK[MT7].4b4_1.heavy 590.09 / 571.394 7681.0 46.407501220703125 39 9 10 10 10 1.9490988529283255 51.30576104426927 0.0 3 0.8126823501016948 2.8057446861240694 7681.0 32.28738938053097 0.0 - - - - - - - 282.5 15 8 GRIK1 glutamate receptor, ionotropic, kainate 1 1535 195 C20140710_OR014_02 C20140710_OR014_02 TB445939.[MT7]-TLIVTTILEEPYVMYRK[MT7].4y7_1.heavy 590.09 / 1100.6 1694.0 46.407501220703125 39 9 10 10 10 1.9490988529283255 51.30576104426927 0.0 3 0.8126823501016948 2.8057446861240694 1694.0 13.791792045191896 1.0 - - - - - - - 263.6666666666667 4 3 GRIK1 glutamate receptor, ionotropic, kainate 1 1537 195 C20140710_OR014_02 C20140710_OR014_02 TB445939.[MT7]-TLIVTTILEEPYVMYRK[MT7].4y6_1.heavy 590.09 / 1003.55 2485.0 46.407501220703125 39 9 10 10 10 1.9490988529283255 51.30576104426927 0.0 3 0.8126823501016948 2.8057446861240694 2485.0 25.28982300884956 0.0 - - - - - - - 180.8 4 5 GRIK1 glutamate receptor, ionotropic, kainate 1 1539 196 C20140710_OR014_02 C20140710_OR014_02 TB425057.[MT7]-VLFVDSVGLPAPPSIIK[MT7].3y6_1.heavy 680.75 / 798.521 10747.0 46.21760177612305 47 17 10 10 10 2.6680522510429663 29.900784358643484 0.0 3 0.9758076813638739 7.918522666248185 10747.0 55.41150887573964 0.0 - - - - - - - 172.85714285714286 21 7 MPL myeloproliferative leukemia virus oncogene 1541 196 C20140710_OR014_02 C20140710_OR014_02 TB425057.[MT7]-VLFVDSVGLPAPPSIIK[MT7].3b5_1.heavy 680.75 / 718.426 9057.0 46.21760177612305 47 17 10 10 10 2.6680522510429663 29.900784358643484 0.0 3 0.9758076813638739 7.918522666248185 9057.0 146.33417355371898 0.0 - - - - - - - 193.4 18 5 MPL myeloproliferative leukemia virus oncogene 1543 196 C20140710_OR014_02 C20140710_OR014_02 TB425057.[MT7]-VLFVDSVGLPAPPSIIK[MT7].3b3_1.heavy 680.75 / 504.33 15457.0 46.21760177612305 47 17 10 10 10 2.6680522510429663 29.900784358643484 0.0 3 0.9758076813638739 7.918522666248185 15457.0 64.36363570670667 0.0 - - - - - - - 271.875 30 8 MPL myeloproliferative leukemia virus oncogene 1545 196 C20140710_OR014_02 C20140710_OR014_02 TB425057.[MT7]-VLFVDSVGLPAPPSIIK[MT7].3y5_1.heavy 680.75 / 701.468 9781.0 46.21760177612305 47 17 10 10 10 2.6680522510429663 29.900784358643484 0.0 3 0.9758076813638739 7.918522666248185 9781.0 22.671192052980135 0.0 - - - - - - - 241.66666666666666 19 3 MPL myeloproliferative leukemia virus oncogene 1547 197 C20140710_OR014_02 C20140710_OR014_02 TB433541.[MT7]-QVTIWFQNR.2y8_1.heavy 668.368 / 1063.57 6085.0 37.59320068359375 47 17 10 10 10 3.1575075203396157 25.19054771987765 0.0 3 0.9786016859868844 8.42160959277391 6085.0 69.51691103314656 0.0 - - - - - - - 187.88888888888889 12 9 HOXA13;HOXC13;HOXD13 homeobox A13;homeobox C13;homeobox D13 1549 197 C20140710_OR014_02 C20140710_OR014_02 TB433541.[MT7]-QVTIWFQNR.2y5_1.heavy 668.368 / 750.368 3832.0 37.59320068359375 47 17 10 10 10 3.1575075203396157 25.19054771987765 0.0 3 0.9786016859868844 8.42160959277391 3832.0 41.855625490914804 0.0 - - - - - - - 197.125 7 8 HOXA13;HOXC13;HOXD13 homeobox A13;homeobox C13;homeobox D13 1551 197 C20140710_OR014_02 C20140710_OR014_02 TB433541.[MT7]-QVTIWFQNR.2y6_1.heavy 668.368 / 863.452 1916.0 37.59320068359375 47 17 10 10 10 3.1575075203396157 25.19054771987765 0.0 3 0.9786016859868844 8.42160959277391 1916.0 24.773107571288104 0.0 - - - - - - - 177.14285714285714 3 7 HOXA13;HOXC13;HOXD13 homeobox A13;homeobox C13;homeobox D13 1553 197 C20140710_OR014_02 C20140710_OR014_02 TB433541.[MT7]-QVTIWFQNR.2y7_1.heavy 668.368 / 964.5 4958.0 37.59320068359375 47 17 10 10 10 3.1575075203396157 25.19054771987765 0.0 3 0.9786016859868844 8.42160959277391 4958.0 22.06653136725278 0.0 - - - - - - - 184.54545454545453 9 11 HOXA13;HOXC13;HOXD13 homeobox A13;homeobox C13;homeobox D13 1555 198 C20140710_OR014_02 C20140710_OR014_02 TB425152.[MT7]-TLGYMPTEMELIEISQQISGGK[MT7].3b4_1.heavy 905.139 / 579.326 21207.0 50.215898513793945 41 16 10 5 10 2.9606132025862775 33.77678648215304 0.042400360107421875 3 0.9607210672677697 6.206555300370095 21207.0 169.6903155339806 0.0 - - - - - - - 206.0 42 4 CABP2 calcium binding protein 2 1557 198 C20140710_OR014_02 C20140710_OR014_02 TB425152.[MT7]-TLGYMPTEMELIEISQQISGGK[MT7].3b5_1.heavy 905.139 / 710.366 27693.0 50.215898513793945 41 16 10 5 10 2.9606132025862775 33.77678648215304 0.042400360107421875 3 0.9607210672677697 6.206555300370095 27693.0 132.63961165048545 0.0 - - - - - - - 206.0 55 5 CABP2 calcium binding protein 2 1559 198 C20140710_OR014_02 C20140710_OR014_02 TB425152.[MT7]-TLGYMPTEMELIEISQQISGGK[MT7].3y8_1.heavy 905.139 / 948.523 17913.0 50.215898513793945 41 16 10 5 10 2.9606132025862775 33.77678648215304 0.042400360107421875 3 0.9607210672677697 6.206555300370095 17913.0 114.78233009708737 0.0 - - - - - - - 220.71428571428572 35 7 CABP2 calcium binding protein 2 1561 198 C20140710_OR014_02 C20140710_OR014_02 TB425152.[MT7]-TLGYMPTEMELIEISQQISGGK[MT7].3b8_1.heavy 905.139 / 1037.51 20178.0 50.215898513793945 41 16 10 5 10 2.9606132025862775 33.77678648215304 0.042400360107421875 3 0.9607210672677697 6.206555300370095 20178.0 98.21266019417476 0.0 - - - - - - - 248.91666666666666 40 12 CABP2 calcium binding protein 2 1563 199 C20140710_OR014_02 C20140710_OR014_02 TB425154.[MT7]-IISMFY[MT7]GVMTPMMNPLIYSLR.3y7_1.heavy 922.488 / 861.519 N/A N/A - - - - - - - - - 0.0 - - - - - - - OR13C9;OR13C2 olfactory receptor, family 13, subfamily C, member 9;olfactory receptor, family 13, subfamily C, member 2 1565 199 C20140710_OR014_02 C20140710_OR014_02 TB425154.[MT7]-IISMFY[MT7]GVMTPMMNPLIYSLR.3y5_1.heavy 922.488 / 651.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - OR13C9;OR13C2 olfactory receptor, family 13, subfamily C, member 9;olfactory receptor, family 13, subfamily C, member 2 1567 199 C20140710_OR014_02 C20140710_OR014_02 TB425154.[MT7]-IISMFY[MT7]GVMTPMMNPLIYSLR.3b7_2.heavy 922.488 / 550.806 N/A N/A - - - - - - - - - 0.0 - - - - - - - OR13C9;OR13C2 olfactory receptor, family 13, subfamily C, member 9;olfactory receptor, family 13, subfamily C, member 2 1569 199 C20140710_OR014_02 C20140710_OR014_02 TB425154.[MT7]-IISMFY[MT7]GVMTPMMNPLIYSLR.3y10_1.heavy 922.488 / 1237.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - OR13C9;OR13C2 olfactory receptor, family 13, subfamily C, member 9;olfactory receptor, family 13, subfamily C, member 2 1571 200 C20140710_OR014_02 C20140710_OR014_02 TB445940.[MT7]-MASFMPDPQNLEEFYEK[MT7].4b7_1.heavy 591.784 / 924.408 1557.0 45.15439987182617 38 8 10 10 10 1.8274178877580458 49.76355225494836 0.0 3 0.7940832741484712 2.6715648302618904 1557.0 5.903354123173277 1.0 - - - - - - - 160.0 4 6 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1573 200 C20140710_OR014_02 C20140710_OR014_02 TB445940.[MT7]-MASFMPDPQNLEEFYEK[MT7].4b4_1.heavy 591.784 / 581.287 719.0 45.15439987182617 38 8 10 10 10 1.8274178877580458 49.76355225494836 0.0 3 0.7940832741484712 2.6715648302618904 719.0 5.671833333333333 1.0 - - - - - - - 120.0 2 3 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1575 200 C20140710_OR014_02 C20140710_OR014_02 TB445940.[MT7]-MASFMPDPQNLEEFYEK[MT7].4b5_1.heavy 591.784 / 712.328 5988.0 45.15439987182617 38 8 10 10 10 1.8274178877580458 49.76355225494836 0.0 3 0.7940832741484712 2.6715648302618904 5988.0 7.172891231071318 0.0 - - - - - - - 200.0 11 3 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1577 200 C20140710_OR014_02 C20140710_OR014_02 TB445940.[MT7]-MASFMPDPQNLEEFYEK[MT7].4y3_1.heavy 591.784 / 583.321 5509.0 45.15439987182617 38 8 10 10 10 1.8274178877580458 49.76355225494836 0.0 3 0.7940832741484712 2.6715648302618904 5509.0 67.7607 0.0 - - - - - - - 325.14285714285717 11 7 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1579 201 C20140710_OR014_02 C20140710_OR014_02 TB425059.[MT7]-SAWLGPAYREFEVLK[MT7].4b5_1.heavy 514.288 / 659.363 3023.0 42.20597553253174 38 16 10 2 10 3.221137935227997 31.044929466183152 0.0836029052734375 3 0.9672239709748849 6.798150971200213 3023.0 35.18601773825025 0.0 - - - - - - - 268.6666666666667 6 6 1581 201 C20140710_OR014_02 C20140710_OR014_02 TB425059.[MT7]-SAWLGPAYREFEVLK[MT7].4y10_2.heavy 514.288 / 698.391 3325.0 42.20597553253174 38 16 10 2 10 3.221137935227997 31.044929466183152 0.0836029052734375 3 0.9672239709748849 6.798150971200213 3325.0 8.67657499310725 0.0 - - - - - - - 202.0 6 3 1583 201 C20140710_OR014_02 C20140710_OR014_02 TB425059.[MT7]-SAWLGPAYREFEVLK[MT7].4y9_2.heavy 514.288 / 649.865 3224.0 42.20597553253174 38 16 10 2 10 3.221137935227997 31.044929466183152 0.0836029052734375 3 0.9672239709748849 6.798150971200213 3224.0 21.20705956309917 0.0 - - - - - - - 235.33333333333334 6 3 1585 201 C20140710_OR014_02 C20140710_OR014_02 TB425059.[MT7]-SAWLGPAYREFEVLK[MT7].4y11_2.heavy 514.288 / 726.902 1814.0 42.20597553253174 38 16 10 2 10 3.221137935227997 31.044929466183152 0.0836029052734375 3 0.9672239709748849 6.798150971200213 1814.0 4.048571090847687 1.0 - - - - - - - 227.0 3 4 1587 202 C20140710_OR014_02 C20140710_OR014_02 TB424710.[MT7]-VIVQPGK[MT7].2y4_1.heavy 514.839 / 573.348 233.0 23.49590015411377 34 13 10 5 6 0.9728608319664883 58.94995929428844 0.04659843444824219 5 0.904136761780939 3.953705146517785 233.0 2.072067555086423 26.0 - - - - - - - 0.0 1 0 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1589 202 C20140710_OR014_02 C20140710_OR014_02 TB424710.[MT7]-VIVQPGK[MT7].2y5_1.heavy 514.839 / 672.416 932.0 23.49590015411377 34 13 10 5 6 0.9728608319664883 58.94995929428844 0.04659843444824219 5 0.904136761780939 3.953705146517785 932.0 6.643487179487179 1.0 - - - - - - - 0.0 1 0 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1591 202 C20140710_OR014_02 C20140710_OR014_02 TB424710.[MT7]-VIVQPGK[MT7].2b4_1.heavy 514.839 / 584.389 1282.0 23.49590015411377 34 13 10 5 6 0.9728608319664883 58.94995929428844 0.04659843444824219 5 0.904136761780939 3.953705146517785 1282.0 11.746376141740948 1.0 - - - - - - - 233.14285714285714 2 7 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1593 202 C20140710_OR014_02 C20140710_OR014_02 TB424710.[MT7]-VIVQPGK[MT7].2y6_1.heavy 514.839 / 785.5 583.0 23.49590015411377 34 13 10 5 6 0.9728608319664883 58.94995929428844 0.04659843444824219 5 0.904136761780939 3.953705146517785 583.0 1.3300416350940658 4.0 - - - - - - - 233.4 2 5 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 1595 203 C20140710_OR014_02 C20140710_OR014_02 TB433540.[MT7]-QEQNIPVSK[MT7].2b3_1.heavy 665.882 / 530.269 289.0 22.007800102233887 42 18 10 6 8 2.713092488196815 28.878169474650154 0.036800384521484375 4 0.9808417074592207 8.9020116746155 289.0 1.38 9.0 - - - - - - - 0.0 0 0 OVCH1 ovochymase 1 1597 203 C20140710_OR014_02 C20140710_OR014_02 TB433540.[MT7]-QEQNIPVSK[MT7].2y4_1.heavy 665.882 / 574.368 1639.0 22.007800102233887 42 18 10 6 8 2.713092488196815 28.878169474650154 0.036800384521484375 4 0.9808417074592207 8.9020116746155 1639.0 33.61657291666667 0.0 - - - - - - - 192.5 3 4 OVCH1 ovochymase 1 1599 203 C20140710_OR014_02 C20140710_OR014_02 TB433540.[MT7]-QEQNIPVSK[MT7].2b4_1.heavy 665.882 / 644.312 868.0 22.007800102233887 42 18 10 6 8 2.713092488196815 28.878169474650154 0.036800384521484375 4 0.9808417074592207 8.9020116746155 868.0 7.22864853195164 3.0 - - - - - - - 0.0 1 0 OVCH1 ovochymase 1 1601 203 C20140710_OR014_02 C20140710_OR014_02 TB433540.[MT7]-QEQNIPVSK[MT7].2b5_1.heavy 665.882 / 757.396 1060.0 22.007800102233887 42 18 10 6 8 2.713092488196815 28.878169474650154 0.036800384521484375 4 0.9808417074592207 8.9020116746155 1060.0 7.689119170984457 0.0 - - - - - - - 289.5 2 2 OVCH1 ovochymase 1 1603 204 C20140710_OR014_02 C20140710_OR014_02 TB433750.[MT7]-SGTTWMHEILDMILNDGDVEK[MT7].4b8_2.heavy 673.835 / 537.743 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1605 204 C20140710_OR014_02 C20140710_OR014_02 TB433750.[MT7]-SGTTWMHEILDMILNDGDVEK[MT7].4b11_2.heavy 673.835 / 708.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1607 204 C20140710_OR014_02 C20140710_OR014_02 TB433750.[MT7]-SGTTWMHEILDMILNDGDVEK[MT7].4b5_1.heavy 673.835 / 677.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1609 204 C20140710_OR014_02 C20140710_OR014_02 TB433750.[MT7]-SGTTWMHEILDMILNDGDVEK[MT7].4b6_1.heavy 673.835 / 808.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1611 205 C20140710_OR014_02 C20140710_OR014_02 TB433751.[MT7]-SGTTWMHEILDMILNDGDVEK[MT7].3b11_2.heavy 898.112 / 708.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1613 205 C20140710_OR014_02 C20140710_OR014_02 TB433751.[MT7]-SGTTWMHEILDMILNDGDVEK[MT7].3b6_1.heavy 898.112 / 808.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1615 205 C20140710_OR014_02 C20140710_OR014_02 TB433751.[MT7]-SGTTWMHEILDMILNDGDVEK[MT7].3y8_1.heavy 898.112 / 1033.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1617 205 C20140710_OR014_02 C20140710_OR014_02 TB433751.[MT7]-SGTTWMHEILDMILNDGDVEK[MT7].3b8_2.heavy 898.112 / 537.743 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1619 206 C20140710_OR014_02 C20140710_OR014_02 TB433752.[MT7]-TLGYMPTEMELIEISQQISGGK[MT7].4b8_1.heavy 679.106 / 1037.51 4468.0 50.194698333740234 50 20 10 10 10 27.450231427103496 3.6429565362885485 0.0 3 0.9992560049153333 45.2428970932722 4468.0 17.08641450773385 0.0 - - - - - - - 233.8 8 5 CABP2 calcium binding protein 2 1621 206 C20140710_OR014_02 C20140710_OR014_02 TB433752.[MT7]-TLGYMPTEMELIEISQQISGGK[MT7].4y5_1.heavy 679.106 / 605.374 3829.0 50.194698333740234 50 20 10 10 10 27.450231427103496 3.6429565362885485 0.0 3 0.9992560049153333 45.2428970932722 3829.0 -0.3891260162601625 2.0 - - - - - - - 191.2 7 5 CABP2 calcium binding protein 2 1623 206 C20140710_OR014_02 C20140710_OR014_02 TB433752.[MT7]-TLGYMPTEMELIEISQQISGGK[MT7].4b4_1.heavy 679.106 / 579.326 13403.0 50.194698333740234 50 20 10 10 10 27.450231427103496 3.6429565362885485 0.0 3 0.9992560049153333 45.2428970932722 13403.0 40.18339346405229 0.0 - - - - - - - 243.0 26 7 CABP2 calcium binding protein 2 1625 206 C20140710_OR014_02 C20140710_OR014_02 TB433752.[MT7]-TLGYMPTEMELIEISQQISGGK[MT7].4b5_1.heavy 679.106 / 710.366 11595.0 50.194698333740234 50 20 10 10 10 27.450231427103496 3.6429565362885485 0.0 3 0.9992560049153333 45.2428970932722 11595.0 122.25660093630304 0.0 - - - - - - - 167.0 23 7 CABP2 calcium binding protein 2 1627 207 C20140710_OR014_02 C20140710_OR014_02 TB425052.[MT7]-ANFSIGPMMQDLAGTYR.2y5_1.heavy 1008.49 / 567.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS2;LOC100287457;KIR2DL3 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 1629 207 C20140710_OR014_02 C20140710_OR014_02 TB425052.[MT7]-ANFSIGPMMQDLAGTYR.2b4_1.heavy 1008.49 / 564.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS2;LOC100287457;KIR2DL3 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 1631 207 C20140710_OR014_02 C20140710_OR014_02 TB425052.[MT7]-ANFSIGPMMQDLAGTYR.2y6_1.heavy 1008.49 / 680.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS2;LOC100287457;KIR2DL3 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 1633 207 C20140710_OR014_02 C20140710_OR014_02 TB425052.[MT7]-ANFSIGPMMQDLAGTYR.2y10_1.heavy 1008.49 / 1185.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS2;LOC100287457;KIR2DL3 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 1635 208 C20140710_OR014_02 C20140710_OR014_02 TB425155.[MT7]-LEQGEGPWTLEGEAPHQSC[CAM]SDGK[MT7].4y7_1.heavy 700.833 / 925.417 2479.0 32.8608512878418 43 18 10 5 10 4.163116604383839 24.02046579591313 0.0420989990234375 3 0.9857422541325076 10.323324424633078 2479.0 1.266621926460636 0.0 - - - - - - - 166.75 4 8 ZNF81 zinc finger protein 81 1637 208 C20140710_OR014_02 C20140710_OR014_02 TB425155.[MT7]-LEQGEGPWTLEGEAPHQSC[CAM]SDGK[MT7].4y6_1.heavy 700.833 / 797.358 5149.0 32.8608512878418 43 18 10 5 10 4.163116604383839 24.02046579591313 0.0420989990234375 3 0.9857422541325076 10.323324424633078 5149.0 28.366263799093986 0.0 - - - - - - - 247.9 10 10 ZNF81 zinc finger protein 81 1639 208 C20140710_OR014_02 C20140710_OR014_02 TB425155.[MT7]-LEQGEGPWTLEGEAPHQSC[CAM]SDGK[MT7].4b6_1.heavy 700.833 / 758.38 8772.0 32.8608512878418 43 18 10 5 10 4.163116604383839 24.02046579591313 0.0420989990234375 3 0.9857422541325076 10.323324424633078 8772.0 52.90483030058947 0.0 - - - - - - - 340.7142857142857 17 7 ZNF81 zinc finger protein 81 1641 208 C20140710_OR014_02 C20140710_OR014_02 TB425155.[MT7]-LEQGEGPWTLEGEAPHQSC[CAM]SDGK[MT7].4b3_1.heavy 700.833 / 515.295 5054.0 32.8608512878418 43 18 10 5 10 4.163116604383839 24.02046579591313 0.0420989990234375 3 0.9857422541325076 10.323324424633078 5054.0 4.157486993975199 0.0 - - - - - - - 245.28571428571428 10 7 ZNF81 zinc finger protein 81 1643 209 C20140710_OR014_02 C20140710_OR014_02 TB433643.[MT7]-WSPSGTSFLVSDQSR.3y7_1.heavy 599.968 / 804.421 5888.0 36.7681999206543 47 17 10 10 10 4.114610915615681 18.874872970887722 0.0 3 0.9786859679524452 8.43830366255439 5888.0 14.854060612022396 0.0 - - - - - - - 314.0 11 9 HSF4 heat shock transcription factor 4 1645 209 C20140710_OR014_02 C20140710_OR014_02 TB433643.[MT7]-WSPSGTSFLVSDQSR.3y6_1.heavy 599.968 / 691.337 12247.0 36.7681999206543 47 17 10 10 10 4.114610915615681 18.874872970887722 0.0 3 0.9786859679524452 8.43830366255439 12247.0 75.66088977653028 0.0 - - - - - - - 290.0 24 13 HSF4 heat shock transcription factor 4 1647 209 C20140710_OR014_02 C20140710_OR014_02 TB433643.[MT7]-WSPSGTSFLVSDQSR.3b7_1.heavy 599.968 / 847.407 1766.0 36.7681999206543 47 17 10 10 10 4.114610915615681 18.874872970887722 0.0 3 0.9786859679524452 8.43830366255439 1766.0 14.584466101694915 1.0 - - - - - - - 177.0 7 10 HSF4 heat shock transcription factor 4 1649 209 C20140710_OR014_02 C20140710_OR014_02 TB433643.[MT7]-WSPSGTSFLVSDQSR.3y5_1.heavy 599.968 / 592.268 15309.0 36.7681999206543 47 17 10 10 10 4.114610915615681 18.874872970887722 0.0 3 0.9786859679524452 8.43830366255439 15309.0 41.45046691364333 0.0 - - - - - - - 299.90909090909093 30 11 HSF4 heat shock transcription factor 4 1651 210 C20140710_OR014_02 C20140710_OR014_02 TB433759.[MT7]-QNPMTNYTTLPTSIMDHSISPFMR.3y7_1.heavy 976.139 / 837.429 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1653 210 C20140710_OR014_02 C20140710_OR014_02 TB433759.[MT7]-QNPMTNYTTLPTSIMDHSISPFMR.3b6_1.heavy 976.139 / 830.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1655 210 C20140710_OR014_02 C20140710_OR014_02 TB433759.[MT7]-QNPMTNYTTLPTSIMDHSISPFMR.3b7_1.heavy 976.139 / 993.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1657 210 C20140710_OR014_02 C20140710_OR014_02 TB433759.[MT7]-QNPMTNYTTLPTSIMDHSISPFMR.3y10_1.heavy 976.139 / 1220.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1659 211 C20140710_OR014_02 C20140710_OR014_02 TB424921.[MT7]-LAVSPVC[CAM]MEDK[MT7].3y3_1.heavy 512.938 / 535.284 15312.0 32.24022388458252 41 15 10 6 10 2.7900840898447976 35.841213662331825 0.037899017333984375 3 0.953421548343399 5.695994125599282 15312.0 178.22163934426231 0.0 - - - - - - - 183.125 30 8 FAM150B family with sequence similarity 150, member B 1661 211 C20140710_OR014_02 C20140710_OR014_02 TB424921.[MT7]-LAVSPVC[CAM]MEDK[MT7].3b4_1.heavy 512.938 / 515.331 15702.0 32.24022388458252 41 15 10 6 10 2.7900840898447976 35.841213662331825 0.037899017333984375 3 0.953421548343399 5.695994125599282 15702.0 43.88507692307692 0.0 - - - - - - - 249.55555555555554 31 9 FAM150B family with sequence similarity 150, member B 1663 211 C20140710_OR014_02 C20140710_OR014_02 TB424921.[MT7]-LAVSPVC[CAM]MEDK[MT7].3y4_1.heavy 512.938 / 666.325 12678.0 32.24022388458252 41 15 10 6 10 2.7900840898447976 35.841213662331825 0.037899017333984375 3 0.953421548343399 5.695994125599282 12678.0 178.84538147566718 0.0 - - - - - - - 152.0 25 9 FAM150B family with sequence similarity 150, member B 1665 211 C20140710_OR014_02 C20140710_OR014_02 TB424921.[MT7]-LAVSPVC[CAM]MEDK[MT7].3y5_1.heavy 512.938 / 826.356 6144.0 32.24022388458252 41 15 10 6 10 2.7900840898447976 35.841213662331825 0.037899017333984375 3 0.953421548343399 5.695994125599282 6144.0 45.13234969808349 0.0 - - - - - - - 214.8 12 10 FAM150B family with sequence similarity 150, member B 1667 212 C20140710_OR014_02 C20140710_OR014_02 TB433441.[MT7]-IEYGAVR.2y5_1.heavy 476.273 / 565.309 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1669 212 C20140710_OR014_02 C20140710_OR014_02 TB433441.[MT7]-IEYGAVR.2b4_1.heavy 476.273 / 607.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1671 212 C20140710_OR014_02 C20140710_OR014_02 TB433441.[MT7]-IEYGAVR.2y6_1.heavy 476.273 / 694.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1673 212 C20140710_OR014_02 C20140710_OR014_02 TB433441.[MT7]-IEYGAVR.2b5_1.heavy 476.273 / 678.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1675 213 C20140710_OR014_02 C20140710_OR014_02 TB433647.[MT7]-ELSNILGFIYDVK[MT7].3b4_1.heavy 600.345 / 588.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1677 213 C20140710_OR014_02 C20140710_OR014_02 TB433647.[MT7]-ELSNILGFIYDVK[MT7].3b5_1.heavy 600.345 / 701.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1679 213 C20140710_OR014_02 C20140710_OR014_02 TB433647.[MT7]-ELSNILGFIYDVK[MT7].3y4_1.heavy 600.345 / 668.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1681 213 C20140710_OR014_02 C20140710_OR014_02 TB433647.[MT7]-ELSNILGFIYDVK[MT7].3b7_1.heavy 600.345 / 871.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1683 214 C20140710_OR014_02 C20140710_OR014_02 TB433646.[MT7]-ELSNILGFIYDVK[MT7].2y8_1.heavy 900.013 / 1098.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1685 214 C20140710_OR014_02 C20140710_OR014_02 TB433646.[MT7]-ELSNILGFIYDVK[MT7].2b4_1.heavy 900.013 / 588.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1687 214 C20140710_OR014_02 C20140710_OR014_02 TB433646.[MT7]-ELSNILGFIYDVK[MT7].2b5_1.heavy 900.013 / 701.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1689 214 C20140710_OR014_02 C20140710_OR014_02 TB433646.[MT7]-ELSNILGFIYDVK[MT7].2y7_1.heavy 900.013 / 985.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 1691 215 C20140710_OR014_02 C20140710_OR014_02 TB433445.[MT7]-ELGAC[CAM]MR.2y4_1.heavy 490.742 / 537.227 679.0 23.65222454071045 39 18 10 5 6 2.817704941832665 27.71132560908252 0.049900054931640625 5 0.9809176313026591 8.919760337025366 679.0 4.8070796460177 2.0 - - - - - - - 254.25 3 12 CABP2 calcium binding protein 2 1693 215 C20140710_OR014_02 C20140710_OR014_02 TB433445.[MT7]-ELGAC[CAM]MR.2y5_1.heavy 490.742 / 594.249 1244.0 23.65222454071045 39 18 10 5 6 2.817704941832665 27.71132560908252 0.049900054931640625 5 0.9809176313026591 8.919760337025366 1244.0 7.15575221238938 3.0 - - - - - - - 188.33333333333334 2 3 CABP2 calcium binding protein 2 1695 215 C20140710_OR014_02 C20140710_OR014_02 TB433445.[MT7]-ELGAC[CAM]MR.2b4_1.heavy 490.742 / 515.295 1470.0 23.65222454071045 39 18 10 5 6 2.817704941832665 27.71132560908252 0.049900054931640625 5 0.9809176313026591 8.919760337025366 1470.0 8.889380530973451 0.0 - - - - - - - 282.5 2 4 CABP2 calcium binding protein 2 1697 215 C20140710_OR014_02 C20140710_OR014_02 TB433445.[MT7]-ELGAC[CAM]MR.2y6_1.heavy 490.742 / 707.333 3846.0 23.65222454071045 39 18 10 5 6 2.817704941832665 27.71132560908252 0.049900054931640625 5 0.9809176313026591 8.919760337025366 3846.0 15.62646017699115 1.0 - - - - - - - 248.6 7 5 CABP2 calcium binding protein 2 1699 216 C20140710_OR014_02 C20140710_OR014_02 TB433444.[MT7]-LQSPEVR.2y4_1.heavy 486.783 / 500.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRM1 glutamate receptor, metabotropic 1 1701 216 C20140710_OR014_02 C20140710_OR014_02 TB433444.[MT7]-LQSPEVR.2y5_1.heavy 486.783 / 587.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRM1 glutamate receptor, metabotropic 1 1703 216 C20140710_OR014_02 C20140710_OR014_02 TB433444.[MT7]-LQSPEVR.2y6_1.heavy 486.783 / 715.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRM1 glutamate receptor, metabotropic 1 1705 216 C20140710_OR014_02 C20140710_OR014_02 TB433444.[MT7]-LQSPEVR.2b5_1.heavy 486.783 / 699.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRM1 glutamate receptor, metabotropic 1 1707 217 C20140710_OR014_02 C20140710_OR014_02 TB433756.[MT7]-SIVPAPGEGLLAVLHMMVFTDALHR.3y7_1.heavy 940.179 / 859.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEC1 deleted in esophageal cancer 1 1709 217 C20140710_OR014_02 C20140710_OR014_02 TB433756.[MT7]-SIVPAPGEGLLAVLHMMVFTDALHR.3b5_1.heavy 940.179 / 612.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEC1 deleted in esophageal cancer 1 1711 217 C20140710_OR014_02 C20140710_OR014_02 TB433756.[MT7]-SIVPAPGEGLLAVLHMMVFTDALHR.3y8_1.heavy 940.179 / 958.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEC1 deleted in esophageal cancer 1 1713 217 C20140710_OR014_02 C20140710_OR014_02 TB433756.[MT7]-SIVPAPGEGLLAVLHMMVFTDALHR.3y9_1.heavy 940.179 / 1089.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEC1 deleted in esophageal cancer 1 1715 218 C20140710_OR014_02 C20140710_OR014_02 TB445947.[MT7]-TLHPLRGPGFLPPVMAGAPPPLPVAVVQAILEGK[MT7].3y6_1.heavy 1243.39 / 774.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1717 218 C20140710_OR014_02 C20140710_OR014_02 TB445947.[MT7]-TLHPLRGPGFLPPVMAGAPPPLPVAVVQAILEGK[MT7].3b3_1.heavy 1243.39 / 496.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1719 218 C20140710_OR014_02 C20140710_OR014_02 TB445947.[MT7]-TLHPLRGPGFLPPVMAGAPPPLPVAVVQAILEGK[MT7].3y4_1.heavy 1243.39 / 590.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1721 218 C20140710_OR014_02 C20140710_OR014_02 TB445947.[MT7]-TLHPLRGPGFLPPVMAGAPPPLPVAVVQAILEGK[MT7].3y10_1.heavy 1243.39 / 1171.72 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1723 219 C20140710_OR014_02 C20140710_OR014_02 TB433549.[MT7]-QDLQGHLQK[MT7].3y3_1.heavy 452.261 / 532.357 5639.0 21.188300132751465 42 16 10 6 10 2.5515409144847294 31.11483825596304 0.03420066833496094 3 0.9625944275082622 6.36108330919401 5639.0 49.59677497789567 0.0 - - - - - - - 225.8 11 5 KCNK18 potassium channel, subfamily K, member 18 1725 219 C20140710_OR014_02 C20140710_OR014_02 TB433549.[MT7]-QDLQGHLQK[MT7].3b4_1.heavy 452.261 / 629.338 1648.0 21.188300132751465 42 16 10 6 10 2.5515409144847294 31.11483825596304 0.03420066833496094 3 0.9625944275082622 6.36108330919401 1648.0 10.613275033952764 0.0 - - - - - - - 225.8 3 10 KCNK18 potassium channel, subfamily K, member 18 1727 219 C20140710_OR014_02 C20140710_OR014_02 TB433549.[MT7]-QDLQGHLQK[MT7].3b5_1.heavy 452.261 / 686.359 2256.0 21.188300132751465 42 16 10 6 10 2.5515409144847294 31.11483825596304 0.03420066833496094 3 0.9625944275082622 6.36108330919401 2256.0 21.538716180371352 0.0 - - - - - - - 195.25 4 4 KCNK18 potassium channel, subfamily K, member 18 1729 219 C20140710_OR014_02 C20140710_OR014_02 TB433549.[MT7]-QDLQGHLQK[MT7].3b3_1.heavy 452.261 / 501.279 3123.0 21.188300132751465 42 16 10 6 10 2.5515409144847294 31.11483825596304 0.03420066833496094 3 0.9625944275082622 6.36108330919401 3123.0 13.95 0.0 - - - - - - - 188.16666666666666 6 12 KCNK18 potassium channel, subfamily K, member 18 1731 220 C20140710_OR014_02 C20140710_OR014_02 TB445949.[MT7]-EPAVVAAEAATVAAATMAMPEVK[MT7].3b6_1.heavy 839.45 / 711.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHDC1 AT hook, DNA binding motif, containing 1 1733 220 C20140710_OR014_02 C20140710_OR014_02 TB445949.[MT7]-EPAVVAAEAATVAAATMAMPEVK[MT7].3b5_1.heavy 839.45 / 640.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHDC1 AT hook, DNA binding motif, containing 1 1735 220 C20140710_OR014_02 C20140710_OR014_02 TB445949.[MT7]-EPAVVAAEAATVAAATMAMPEVK[MT7].3y4_1.heavy 839.45 / 616.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHDC1 AT hook, DNA binding motif, containing 1 1737 220 C20140710_OR014_02 C20140710_OR014_02 TB445949.[MT7]-EPAVVAAEAATVAAATMAMPEVK[MT7].3b8_1.heavy 839.45 / 911.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHDC1 AT hook, DNA binding motif, containing 1 1739 221 C20140710_OR014_02 C20140710_OR014_02 TB433546.[MT7]-IVYVARNPK[MT7].2b3_1.heavy 674.421 / 520.325 1062.0 24.577425479888916 28 5 10 3 10 6.748465943000253 14.81818250912617 0.05169868469238281 3 0.6879089654075146 2.148911506496658 1062.0 10.575 0.0 - - - - - - - 472.0 2 3 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1741 221 C20140710_OR014_02 C20140710_OR014_02 TB433546.[MT7]-IVYVARNPK[MT7].2y8_1.heavy 674.421 / 1090.65 354.0 24.577425479888916 28 5 10 3 10 6.748465943000253 14.81818250912617 0.05169868469238281 3 0.6879089654075146 2.148911506496658 354.0 5.997 2.0 - - - - - - - 0.0 1 0 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1743 221 C20140710_OR014_02 C20140710_OR014_02 TB433546.[MT7]-IVYVARNPK[MT7].2y5_1.heavy 674.421 / 729.449 826.0 24.577425479888916 28 5 10 3 10 6.748465943000253 14.81818250912617 0.05169868469238281 3 0.6879089654075146 2.148911506496658 826.0 8.4 2.0 - - - - - - - 0.0 1 0 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1745 221 C20140710_OR014_02 C20140710_OR014_02 TB433546.[MT7]-IVYVARNPK[MT7].2y7_1.heavy 674.421 / 991.581 1534.0 24.577425479888916 28 5 10 3 10 6.748465943000253 14.81818250912617 0.05169868469238281 3 0.6879089654075146 2.148911506496658 1534.0 17.537 0.0 - - - - - - - 295.0 3 4 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1747 222 C20140710_OR014_02 C20140710_OR014_02 TB445951.[MT7]-VC[CAM]NFQAK[MT7]PDDLILATYPK[MT7].3b6_1.heavy 842.465 / 864.415 1020.0 37.469600677490234 48 18 10 10 10 6.035617581009528 16.568312796132094 0.0 3 0.9829563563559537 9.439791035764534 1020.0 2.7333333333333334 0.0 - - - - - - - 204.0 2 9 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1749 222 C20140710_OR014_02 C20140710_OR014_02 TB445951.[MT7]-VC[CAM]NFQAK[MT7]PDDLILATYPK[MT7].3b4_1.heavy 842.465 / 665.32 1224.0 37.469600677490234 48 18 10 10 10 6.035617581009528 16.568312796132094 0.0 3 0.9829563563559537 9.439791035764534 1224.0 5.862857142857143 0.0 - - - - - - - 191.25 2 8 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1751 222 C20140710_OR014_02 C20140710_OR014_02 TB445951.[MT7]-VC[CAM]NFQAK[MT7]PDDLILATYPK[MT7].3b3_1.heavy 842.465 / 518.251 1326.0 37.469600677490234 48 18 10 10 10 6.035617581009528 16.568312796132094 0.0 3 0.9829563563559537 9.439791035764534 1326.0 4.16 0.0 - - - - - - - 238.0 2 9 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1753 222 C20140710_OR014_02 C20140710_OR014_02 TB445951.[MT7]-VC[CAM]NFQAK[MT7]PDDLILATYPK[MT7].3b10_2.heavy 842.465 / 732.363 3673.0 37.469600677490234 48 18 10 10 10 6.035617581009528 16.568312796132094 0.0 3 0.9829563563559537 9.439791035764534 3673.0 2.88078431372549 0.0 - - - - - - - 276.85714285714283 7 7 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1755 223 C20140710_OR014_02 C20140710_OR014_02 TB425045.[MT7]-LSLMLDEGSSC[CAM]PTPAK[MT7].3b5_1.heavy 665.344 / 702.434 8022.0 36.85960006713867 48 18 10 10 10 4.620304727253514 21.64359407078412 0.0 3 0.9819169015108108 9.16366736556432 8022.0 54.89982300884955 0.0 - - - - - - - 248.6 16 10 HSF4 heat shock transcription factor 4 1757 223 C20140710_OR014_02 C20140710_OR014_02 TB425045.[MT7]-LSLMLDEGSSC[CAM]PTPAK[MT7].3b8_1.heavy 665.344 / 1003.53 2938.0 36.85960006713867 48 18 10 10 10 4.620304727253514 21.64359407078412 0.0 3 0.9819169015108108 9.16366736556432 2938.0 14.17 0.0 - - - - - - - 236.27272727272728 5 11 HSF4 heat shock transcription factor 4 1759 223 C20140710_OR014_02 C20140710_OR014_02 TB425045.[MT7]-LSLMLDEGSSC[CAM]PTPAK[MT7].3b7_1.heavy 665.344 / 946.504 6214.0 36.85960006713867 48 18 10 10 10 4.620304727253514 21.64359407078412 0.0 3 0.9819169015108108 9.16366736556432 6214.0 58.84053097345132 0.0 - - - - - - - 163.22222222222223 12 9 HSF4 heat shock transcription factor 4 1761 223 C20140710_OR014_02 C20140710_OR014_02 TB425045.[MT7]-LSLMLDEGSSC[CAM]PTPAK[MT7].3y5_1.heavy 665.344 / 657.405 22372.0 36.85960006713867 48 18 10 10 10 4.620304727253514 21.64359407078412 0.0 3 0.9819169015108108 9.16366736556432 22372.0 57.28287905604719 1.0 - - - - - - - 242.14285714285714 44 7 HSF4 heat shock transcription factor 4 1763 224 C20140710_OR014_02 C20140710_OR014_02 TB445950.[MT7]-VC[CAM]NFQAK[MT7]PDDLILATYPK[MT7].4y5_1.heavy 632.1 / 723.416 9586.0 37.469600677490234 44 14 10 10 10 2.2888949195037225 43.689205278887144 0.0 3 0.9458509338432304 5.279434592126556 9586.0 12.676910675381263 0.0 - - - - - - - 268.90909090909093 19 11 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1765 224 C20140710_OR014_02 C20140710_OR014_02 TB445950.[MT7]-VC[CAM]NFQAK[MT7]PDDLILATYPK[MT7].4b11_2.heavy 632.1 / 788.905 50686.0 37.469600677490234 44 14 10 10 10 2.2888949195037225 43.689205278887144 0.0 3 0.9458509338432304 5.279434592126556 50686.0 82.24051960784313 0.0 - - - - - - - 238.0 101 9 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1767 224 C20140710_OR014_02 C20140710_OR014_02 TB445950.[MT7]-VC[CAM]NFQAK[MT7]PDDLILATYPK[MT7].4b7_2.heavy 632.1 / 568.81 15298.0 37.469600677490234 44 14 10 10 10 2.2888949195037225 43.689205278887144 0.0 3 0.9458509338432304 5.279434592126556 15298.0 64.24160130718954 0.0 - - - - - - - 291.42857142857144 30 7 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1769 224 C20140710_OR014_02 C20140710_OR014_02 TB445950.[MT7]-VC[CAM]NFQAK[MT7]PDDLILATYPK[MT7].4b10_2.heavy 632.1 / 732.363 52521.0 37.469600677490234 44 14 10 10 10 2.2888949195037225 43.689205278887144 0.0 3 0.9458509338432304 5.279434592126556 52521.0 59.18184577677225 0.0 - - - - - - - 204.0 105 7 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1771 225 C20140710_OR014_02 C20140710_OR014_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 154969.0 44.0172004699707 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 154969.0 541.0203688367349 0.0 - - - - - - - 274.5 309 10 1773 225 C20140710_OR014_02 C20140710_OR014_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 193174.0 44.0172004699707 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 193174.0 399.0410245229675 0.0 - - - - - - - 358.22222222222223 386 9 1775 225 C20140710_OR014_02 C20140710_OR014_02 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 178011.0 44.0172004699707 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 178011.0 170.67708881824979 0.0 - - - - - - - 358.2 356 5 1777 226 C20140710_OR014_02 C20140710_OR014_02 TB433551.[MT7]-AQTGPPRVDK[MT7].2y4_1.heavy 678.896 / 661.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 1779 226 C20140710_OR014_02 C20140710_OR014_02 TB433551.[MT7]-AQTGPPRVDK[MT7].2y8_1.heavy 678.896 / 1013.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 1781 226 C20140710_OR014_02 C20140710_OR014_02 TB433551.[MT7]-AQTGPPRVDK[MT7].2y3_1.heavy 678.896 / 505.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 1783 226 C20140710_OR014_02 C20140710_OR014_02 TB433551.[MT7]-AQTGPPRVDK[MT7].2b9_1.heavy 678.896 / 1066.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 1785 227 C20140710_OR014_02 C20140710_OR014_02 TB424722.[MT7]-RTPLSSGEASSTSR.3y8_1.heavy 527.277 / 794.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - C15orf2 chromosome 15 open reading frame 2 1787 227 C20140710_OR014_02 C20140710_OR014_02 TB424722.[MT7]-RTPLSSGEASSTSR.3b7_1.heavy 527.277 / 843.481 N/A N/A - - - - - - - - - 0.0 - - - - - - - C15orf2 chromosome 15 open reading frame 2 1789 227 C20140710_OR014_02 C20140710_OR014_02 TB424722.[MT7]-RTPLSSGEASSTSR.3y5_1.heavy 527.277 / 537.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - C15orf2 chromosome 15 open reading frame 2 1791 227 C20140710_OR014_02 C20140710_OR014_02 TB424722.[MT7]-RTPLSSGEASSTSR.3y9_1.heavy 527.277 / 881.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - C15orf2 chromosome 15 open reading frame 2 1793 228 C20140710_OR014_02 C20140710_OR014_02 TB433650.[MT7]-LWALVGDPGTDHLIR.3y7_1.heavy 603.004 / 811.442 24370.0 42.11140060424805 48 18 10 10 10 4.619256220643513 21.64850686417843 0.0 3 0.9851090210188143 10.100906350658974 24370.0 120.58183840470326 0.0 - - - - - - - 217.5 48 8 HSF4 heat shock transcription factor 4 1795 228 C20140710_OR014_02 C20140710_OR014_02 TB433650.[MT7]-LWALVGDPGTDHLIR.3y4_1.heavy 603.004 / 538.346 37375.0 42.11140060424805 48 18 10 10 10 4.619256220643513 21.64850686417843 0.0 3 0.9851090210188143 10.100906350658974 37375.0 118.9049161585366 0.0 - - - - - - - 278.0 74 7 HSF4 heat shock transcription factor 4 1797 228 C20140710_OR014_02 C20140710_OR014_02 TB433650.[MT7]-LWALVGDPGTDHLIR.3b3_1.heavy 603.004 / 515.31 84477.0 42.11140060424805 48 18 10 10 10 4.619256220643513 21.64850686417843 0.0 3 0.9851090210188143 10.100906350658974 84477.0 466.08324000953365 0.0 - - - - - - - 286.7 168 10 HSF4 heat shock transcription factor 4 1799 228 C20140710_OR014_02 C20140710_OR014_02 TB433650.[MT7]-LWALVGDPGTDHLIR.3y8_1.heavy 603.004 / 908.495 44338.0 42.11140060424805 48 18 10 10 10 4.619256220643513 21.64850686417843 0.0 3 0.9851090210188143 10.100906350658974 44338.0 475.426745426204 0.0 - - - - - - - 673.0 88 7 HSF4 heat shock transcription factor 4 1801 229 C20140710_OR014_02 C20140710_OR014_02 TB433457.[MT7]-FESC[CAM]SK[MT7].2b3_1.heavy 523.265 / 508.252 466.0 19.507800102233887 30 18 0 6 6 12.383204114799804 8.075454387486422 0.03800010681152344 5 0.9850292670875169 10.07389770379105 466.0 3.0825806451612903 12.0 - - - - - - - 218.8181818181818 2 11 C6orf204 chromosome 6 open reading frame 204 1803 229 C20140710_OR014_02 C20140710_OR014_02 TB433457.[MT7]-FESC[CAM]SK[MT7].2y4_1.heavy 523.265 / 625.31 1010.0 19.507800102233887 30 18 0 6 6 12.383204114799804 8.075454387486422 0.03800010681152344 5 0.9850292670875169 10.07389770379105 1010.0 5.49491961414791 1.0 - - - - - - - 174.875 11 8 C6orf204 chromosome 6 open reading frame 204 1805 229 C20140710_OR014_02 C20140710_OR014_02 TB433457.[MT7]-FESC[CAM]SK[MT7].2y5_1.heavy 523.265 / 754.352 933.0 19.507800102233887 30 18 0 6 6 12.383204114799804 8.075454387486422 0.03800010681152344 5 0.9850292670875169 10.07389770379105 933.0 1.2000000000000002 2.0 - - - - - - - 183.8181818181818 7 11 C6orf204 chromosome 6 open reading frame 204 1807 229 C20140710_OR014_02 C20140710_OR014_02 TB433457.[MT7]-FESC[CAM]SK[MT7].2y3_1.heavy 523.265 / 538.278 622.0 19.507800102233887 30 18 0 6 6 12.383204114799804 8.075454387486422 0.03800010681152344 5 0.9850292670875169 10.07389770379105 622.0 6.6498624408495655 1.0 - - - - - - - 0.0 1 0 C6orf204 chromosome 6 open reading frame 204 1809 230 C20140710_OR014_02 C20140710_OR014_02 TB445810.[MT7]-EVLQLNEFLK[MT7].2y4_1.heavy 760.95 / 680.41 608.0 42.398799896240234 39 12 9 10 8 1.0124162662374867 60.95753820864529 0.0 4 0.887755568214431 3.6486434588977246 608.0 1.3326027397260276 15.0 - - - - - - - 0.0 1 0 C6orf204 chromosome 6 open reading frame 204 1811 230 C20140710_OR014_02 C20140710_OR014_02 TB445810.[MT7]-EVLQLNEFLK[MT7].2y5_1.heavy 760.95 / 794.453 2068.0 42.398799896240234 39 12 9 10 8 1.0124162662374867 60.95753820864529 0.0 4 0.887755568214431 3.6486434588977246 2068.0 18.68077986912231 1.0 - - - - - - - 243.5 6 4 C6orf204 chromosome 6 open reading frame 204 1813 230 C20140710_OR014_02 C20140710_OR014_02 TB445810.[MT7]-EVLQLNEFLK[MT7].2b4_1.heavy 760.95 / 614.363 2311.0 42.398799896240234 39 12 9 10 8 1.0124162662374867 60.95753820864529 0.0 4 0.887755568214431 3.6486434588977246 2311.0 25.982574714969978 0.0 - - - - - - - 287.6363636363636 4 11 C6orf204 chromosome 6 open reading frame 204 1815 230 C20140710_OR014_02 C20140710_OR014_02 TB445810.[MT7]-EVLQLNEFLK[MT7].2y6_1.heavy 760.95 / 907.537 2676.0 42.398799896240234 39 12 9 10 8 1.0124162662374867 60.95753820864529 0.0 4 0.887755568214431 3.6486434588977246 2676.0 29.208892936652497 0.0 - - - - - - - 178.0 5 13 C6orf204 chromosome 6 open reading frame 204 1817 231 C20140710_OR014_02 C20140710_OR014_02 TB425146.[MT7]-K[MT7]PELFNIMEVDGVPTLILSK[MT7].4b7_2.heavy 669.641 / 565.844 34726.0 47.71609878540039 44 14 10 10 10 2.943267626329071 33.975843414797765 0.0 3 0.9409311940048508 5.052682017029985 34726.0 114.90759600555636 0.0 - - - - - - - 261.6666666666667 69 9 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1819 231 C20140710_OR014_02 C20140710_OR014_02 TB425146.[MT7]-K[MT7]PELFNIMEVDGVPTLILSK[MT7].4b9_2.heavy 669.641 / 695.886 20247.0 47.71609878540039 44 14 10 10 10 2.943267626329071 33.975843414797765 0.0 3 0.9409311940048508 5.052682017029985 20247.0 68.2503733744744 0.0 - - - - - - - 376.6 40 5 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1821 231 C20140710_OR014_02 C20140710_OR014_02 TB425146.[MT7]-K[MT7]PELFNIMEVDGVPTLILSK[MT7].4b6_1.heavy 669.641 / 1017.6 16127.0 47.71609878540039 44 14 10 10 10 2.943267626329071 33.975843414797765 0.0 3 0.9409311940048508 5.052682017029985 16127.0 77.42026027680231 0.0 - - - - - - - 235.5 32 8 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1823 231 C20140710_OR014_02 C20140710_OR014_02 TB425146.[MT7]-K[MT7]PELFNIMEVDGVPTLILSK[MT7].4b6_2.heavy 669.641 / 509.302 39199.0 47.71609878540039 44 14 10 10 10 2.943267626329071 33.975843414797765 0.0 3 0.9409311940048508 5.052682017029985 39199.0 104.18498082266518 1.0 - - - - - - - 249.875 79 8 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1825 232 C20140710_OR014_02 C20140710_OR014_02 TB425145.[MT7]-TFTGETSLC[CAM]PGC[CAM]GEPVYFAEK[MT7].3y7_1.heavy 880.085 / 997.547 28012.0 37.40650177001953 39 14 10 5 10 3.3342996020453253 29.991306101784623 0.04199981689453125 3 0.9387772899670238 4.962094983730279 28012.0 134.079929506732 0.0 - - - - - - - 322.77777777777777 56 9 CRIP3 cysteine-rich protein 3 1827 232 C20140710_OR014_02 C20140710_OR014_02 TB425145.[MT7]-TFTGETSLC[CAM]PGC[CAM]GEPVYFAEK[MT7].3b5_1.heavy 880.085 / 680.337 9763.0 37.40650177001953 39 14 10 5 10 3.3342996020453253 29.991306101784623 0.04199981689453125 3 0.9387772899670238 4.962094983730279 9763.0 122.66872844827586 0.0 - - - - - - - 298.7142857142857 19 7 CRIP3 cysteine-rich protein 3 1829 232 C20140710_OR014_02 C20140710_OR014_02 TB425145.[MT7]-TFTGETSLC[CAM]PGC[CAM]GEPVYFAEK[MT7].3y4_1.heavy 880.085 / 638.363 8252.0 37.40650177001953 39 14 10 5 10 3.3342996020453253 29.991306101784623 0.04199981689453125 3 0.9387772899670238 4.962094983730279 8252.0 102.43862068965517 0.0 - - - - - - - 188.625 16 8 CRIP3 cysteine-rich protein 3 1831 232 C20140710_OR014_02 C20140710_OR014_02 TB425145.[MT7]-TFTGETSLC[CAM]PGC[CAM]GEPVYFAEK[MT7].3y5_1.heavy 880.085 / 801.426 6625.0 37.40650177001953 39 14 10 5 10 3.3342996020453253 29.991306101784623 0.04199981689453125 3 0.9387772899670238 4.962094983730279 6625.0 50.82974137931034 0.0 - - - - - - - 232.14285714285714 13 7 CRIP3 cysteine-rich protein 3 1833 233 C20140710_OR014_02 C20140710_OR014_02 TB433651.[MT7]-TLMPNTTLTYDIQR.3y7_1.heavy 604.321 / 908.484 5593.0 37.17319869995117 50 20 10 10 10 8.777708102077964 11.392495493935005 0.0 3 0.9970517974205388 22.723590386213548 5593.0 23.404184549356223 0.0 - - - - - - - 252.83333333333334 11 6 GRIK1 glutamate receptor, ionotropic, kainate 1 1835 233 C20140710_OR014_02 C20140710_OR014_02 TB433651.[MT7]-TLMPNTTLTYDIQR.3y6_1.heavy 604.321 / 795.399 11536.0 37.17319869995117 50 20 10 10 10 8.777708102077964 11.392495493935005 0.0 3 0.9970517974205388 22.723590386213548 11536.0 43.52606123032905 0.0 - - - - - - - 296.8181818181818 23 11 GRIK1 glutamate receptor, ionotropic, kainate 1 1837 233 C20140710_OR014_02 C20140710_OR014_02 TB433651.[MT7]-TLMPNTTLTYDIQR.3y4_1.heavy 604.321 / 531.289 4661.0 37.17319869995117 50 20 10 10 10 8.777708102077964 11.392495493935005 0.0 3 0.9970517974205388 22.723590386213548 4661.0 8.701857604815043 0.0 - - - - - - - 297.8888888888889 9 9 GRIK1 glutamate receptor, ionotropic, kainate 1 1839 233 C20140710_OR014_02 C20140710_OR014_02 TB433651.[MT7]-TLMPNTTLTYDIQR.3y5_1.heavy 604.321 / 694.352 6991.0 37.17319869995117 50 20 10 10 10 8.777708102077964 11.392495493935005 0.0 3 0.9970517974205388 22.723590386213548 6991.0 29.567424650820875 0.0 - - - - - - - 274.7857142857143 13 14 GRIK1 glutamate receptor, ionotropic, kainate 1 1841 234 C20140710_OR014_02 C20140710_OR014_02 TB445815.[MT7]-HLTGPLYFSPK[MT7].2y4_1.heavy 774.445 / 622.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM150B family with sequence similarity 150, member B 1843 234 C20140710_OR014_02 C20140710_OR014_02 TB445815.[MT7]-HLTGPLYFSPK[MT7].2y8_1.heavy 774.445 / 1052.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM150B family with sequence similarity 150, member B 1845 234 C20140710_OR014_02 C20140710_OR014_02 TB445815.[MT7]-HLTGPLYFSPK[MT7].2y9_1.heavy 774.445 / 1153.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM150B family with sequence similarity 150, member B 1847 234 C20140710_OR014_02 C20140710_OR014_02 TB445815.[MT7]-HLTGPLYFSPK[MT7].2b6_1.heavy 774.445 / 763.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - FAM150B family with sequence similarity 150, member B 1849 235 C20140710_OR014_02 C20140710_OR014_02 TB425144.[MT7]-DPLQWLGSPPRGSC[CAM]PSPSSSPK[MT7].4y4_1.heavy 657.089 / 562.332 2225.0 36.893574714660645 41 20 10 5 6 7.316876002961391 13.667034942170206 0.045299530029296875 5 0.9943984222254515 16.481785138587675 2225.0 1.9157030223390277 1.0 - - - - - - - 331.5 4 6 CABP2 calcium binding protein 2 1851 235 C20140710_OR014_02 C20140710_OR014_02 TB425144.[MT7]-DPLQWLGSPPRGSC[CAM]PSPSSSPK[MT7].4y5_1.heavy 657.089 / 649.364 3044.0 36.893574714660645 41 20 10 5 6 7.316876002961391 13.667034942170206 0.045299530029296875 5 0.9943984222254515 16.481785138587675 3044.0 4.240644106301776 2.0 - - - - - - - 300.85714285714283 9 7 CABP2 calcium binding protein 2 1853 235 C20140710_OR014_02 C20140710_OR014_02 TB425144.[MT7]-DPLQWLGSPPRGSC[CAM]PSPSSSPK[MT7].4b4_1.heavy 657.089 / 598.332 9366.0 36.893574714660645 41 20 10 5 6 7.316876002961391 13.667034942170206 0.045299530029296875 5 0.9943984222254515 16.481785138587675 9366.0 14.971624072110288 0.0 - - - - - - - 429.0 18 3 CABP2 calcium binding protein 2 1855 235 C20140710_OR014_02 C20140710_OR014_02 TB425144.[MT7]-DPLQWLGSPPRGSC[CAM]PSPSSSPK[MT7].4b5_1.heavy 657.089 / 784.411 2927.0 36.893574714660645 41 20 10 5 6 7.316876002961391 13.667034942170206 0.045299530029296875 5 0.9943984222254515 16.481785138587675 2927.0 3.585569837064286 1.0 - - - - - - - 312.0 5 9 CABP2 calcium binding protein 2 1857 236 C20140710_OR014_02 C20140710_OR014_02 TB433452.[MT7]-MLATTSPR.2y3_1.heavy 510.785 / 359.204 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 1859 236 C20140710_OR014_02 C20140710_OR014_02 TB433452.[MT7]-MLATTSPR.2y6_1.heavy 510.785 / 632.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - TMPRSS9 transmembrane protease, serine 9 1861 237 C20140710_OR014_02 C20140710_OR014_02 TB424912.[MT7]-ELENEYAINK[MT7].3y3_1.heavy 504.271 / 518.342 11217.0 28.20509910583496 42 12 10 10 10 0.7231540529781934 70.4921035091383 0.0 3 0.8832639794511163 3.576363610194982 11217.0 36.29029411764706 0.0 - - - - - - - 226.66666666666666 22 6 HOXD13 homeobox D13 1863 237 C20140710_OR014_02 C20140710_OR014_02 TB424912.[MT7]-ELENEYAINK[MT7].3b4_1.heavy 504.271 / 630.321 8724.0 28.20509910583496 42 12 10 10 10 0.7231540529781934 70.4921035091383 0.0 3 0.8832639794511163 3.576363610194982 8724.0 49.978188649909306 0.0 - - - - - - - 259.0 17 7 HOXD13 homeobox D13 1865 237 C20140710_OR014_02 C20140710_OR014_02 TB424912.[MT7]-ELENEYAINK[MT7].3b5_1.heavy 504.271 / 759.364 9744.0 28.20509910583496 42 12 10 10 10 0.7231540529781934 70.4921035091383 0.0 3 0.8832639794511163 3.576363610194982 9744.0 59.28213554278379 0.0 - - - - - - - 302.3333333333333 19 3 HOXD13 homeobox D13 1867 237 C20140710_OR014_02 C20140710_OR014_02 TB424912.[MT7]-ELENEYAINK[MT7].3b3_1.heavy 504.271 / 516.279 4419.0 28.20509910583496 42 12 10 10 10 0.7231540529781934 70.4921035091383 0.0 3 0.8832639794511163 3.576363610194982 4419.0 17.723892240345908 1.0 - - - - - - - 210.42857142857142 9 7 HOXD13 homeobox D13 1869 238 C20140710_OR014_02 C20140710_OR014_02 TB433749.[MT7]-K[MT7]PELFNIMEVDGVPTLILSK[MT7].3b6_2.heavy 892.519 / 509.302 27936.0 47.71609878540039 43 13 10 10 10 2.467685036829712 31.640729321009005 0.0 3 0.9169561214264498 4.2526169452757845 27936.0 137.21742550655543 0.0 - - - - - - - 257.14285714285717 55 7 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1871 238 C20140710_OR014_02 C20140710_OR014_02 TB433749.[MT7]-K[MT7]PELFNIMEVDGVPTLILSK[MT7].3y7_1.heavy 892.519 / 915.599 33691.0 47.71609878540039 43 13 10 10 10 2.467685036829712 31.640729321009005 0.0 3 0.9169561214264498 4.2526169452757845 33691.0 119.5066016630625 0.0 - - - - - - - 257.14285714285717 67 7 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1873 238 C20140710_OR014_02 C20140710_OR014_02 TB433749.[MT7]-K[MT7]PELFNIMEVDGVPTLILSK[MT7].3b6_1.heavy 892.519 / 1017.6 14028.0 47.71609878540039 43 13 10 10 10 2.467685036829712 31.640729321009005 0.0 3 0.9169561214264498 4.2526169452757845 14028.0 23.136335428181 0.0 - - - - - - - 274.2857142857143 28 7 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1875 238 C20140710_OR014_02 C20140710_OR014_02 TB433749.[MT7]-K[MT7]PELFNIMEVDGVPTLILSK[MT7].3b7_2.heavy 892.519 / 565.844 17385.0 47.71609878540039 43 13 10 10 10 2.467685036829712 31.640729321009005 0.0 3 0.9169561214264498 4.2526169452757845 17385.0 36.81712527381001 0.0 - - - - - - - 180.0 34 2 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1877 239 C20140710_OR014_02 C20140710_OR014_02 TB433656.[MT7]-YIQPVC[CAM]LPLAIQK[MT7].3y6_1.heavy 611.03 / 813.531 7884.0 41.70159912109375 46 18 10 10 8 4.188853675446453 23.872879729880246 0.0 4 0.9847401625680909 9.977772390921052 7884.0 52.688195121951225 0.0 - - - - - - - 248.71428571428572 15 7 TMPRSS9 transmembrane protease, serine 9 1879 239 C20140710_OR014_02 C20140710_OR014_02 TB433656.[MT7]-YIQPVC[CAM]LPLAIQK[MT7].3b5_1.heavy 611.03 / 745.437 2253.0 41.70159912109375 46 18 10 10 8 4.188853675446453 23.872879729880246 0.0 4 0.9847401625680909 9.977772390921052 2253.0 -0.14667968749999996 2.0 - - - - - - - 266.3 6 10 TMPRSS9 transmembrane protease, serine 9 1881 239 C20140710_OR014_02 C20140710_OR014_02 TB433656.[MT7]-YIQPVC[CAM]LPLAIQK[MT7].3y4_1.heavy 611.03 / 603.395 7168.0 41.70159912109375 46 18 10 10 8 4.188853675446453 23.872879729880246 0.0 4 0.9847401625680909 9.977772390921052 7168.0 19.018326359832635 1.0 - - - - - - - 285.2857142857143 21 14 TMPRSS9 transmembrane protease, serine 9 1883 239 C20140710_OR014_02 C20140710_OR014_02 TB433656.[MT7]-YIQPVC[CAM]LPLAIQK[MT7].3b3_1.heavy 611.03 / 549.315 15871.0 41.70159912109375 46 18 10 10 8 4.188853675446453 23.872879729880246 0.0 4 0.9847401625680909 9.977772390921052 15871.0 84.60306573088269 0.0 - - - - - - - 230.375 31 8 TMPRSS9 transmembrane protease, serine 9 1885 240 C20140710_OR014_02 C20140710_OR014_02 TB424917.[MT7]-VVGGSWFDHVK[MT7].3y3_1.heavy 506.948 / 527.342 8207.0 34.819698333740234 47 17 10 10 10 7.03875103649078 14.207065924277344 0.0 3 0.9767374200067477 8.075843893127145 8207.0 24.42851172707889 0.0 - - - - - - - 309.0 16 11 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1887 240 C20140710_OR014_02 C20140710_OR014_02 TB424917.[MT7]-VVGGSWFDHVK[MT7].3b5_1.heavy 506.948 / 544.321 7386.0 34.819698333740234 47 17 10 10 10 7.03875103649078 14.207065924277344 0.0 3 0.9767374200067477 8.075843893127145 7386.0 52.56499125874126 0.0 - - - - - - - 253.83333333333334 14 6 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1889 240 C20140710_OR014_02 C20140710_OR014_02 TB424917.[MT7]-VVGGSWFDHVK[MT7].3y4_1.heavy 506.948 / 642.369 5628.0 34.819698333740234 47 17 10 10 10 7.03875103649078 14.207065924277344 0.0 3 0.9767374200067477 8.075843893127145 5628.0 90.43282051282051 0.0 - - - - - - - 208.22222222222223 11 9 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1891 240 C20140710_OR014_02 C20140710_OR014_02 TB424917.[MT7]-VVGGSWFDHVK[MT7].3b8_1.heavy 506.948 / 992.496 821.0 34.819698333740234 47 17 10 10 10 7.03875103649078 14.207065924277344 0.0 3 0.9767374200067477 8.075843893127145 821.0 6.596068376068375 0.0 - - - - - - - 0.0 1 0 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 1893 241 C20140710_OR014_02 C20140710_OR014_02 TB433744.[MT7]-VAGSC[CAM]APLGLLLVC[CAM]LHLPGLFAR.4y8_1.heavy 645.367 / 910.526 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf15 chromosome 6 open reading frame 15 1895 241 C20140710_OR014_02 C20140710_OR014_02 TB433744.[MT7]-VAGSC[CAM]APLGLLLVC[CAM]LHLPGLFAR.4b5_1.heavy 645.367 / 619.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf15 chromosome 6 open reading frame 15 1897 241 C20140710_OR014_02 C20140710_OR014_02 TB433744.[MT7]-VAGSC[CAM]APLGLLLVC[CAM]LHLPGLFAR.4y6_1.heavy 645.367 / 660.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf15 chromosome 6 open reading frame 15 1899 241 C20140710_OR014_02 C20140710_OR014_02 TB433744.[MT7]-VAGSC[CAM]APLGLLLVC[CAM]LHLPGLFAR.4b6_1.heavy 645.367 / 690.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf15 chromosome 6 open reading frame 15 1901 242 C20140710_OR014_02 C20140710_OR014_02 TB433659.[MT7]-EYMSPDIALLYLK[MT7].2b3_1.heavy 922.51 / 568.256 1809.0 46.4552001953125 48 18 10 10 10 6.294585636026831 15.886669239616609 0.0 3 0.988799382935944 11.650248694074174 1809.0 4.99931111162055 0.0 - - - - - - - 219.36363636363637 3 11 OVCH1 ovochymase 1 1903 242 C20140710_OR014_02 C20140710_OR014_02 TB433659.[MT7]-EYMSPDIALLYLK[MT7].2y9_1.heavy 922.51 / 1189.73 1326.0 46.4552001953125 48 18 10 10 10 6.294585636026831 15.886669239616609 0.0 3 0.988799382935944 11.650248694074174 1326.0 5.040022007748561 0.0 - - - - - - - 241.42857142857142 2 7 OVCH1 ovochymase 1 1905 242 C20140710_OR014_02 C20140710_OR014_02 TB433659.[MT7]-EYMSPDIALLYLK[MT7].2b4_1.heavy 922.51 / 655.288 1688.0 46.4552001953125 48 18 10 10 10 6.294585636026831 15.886669239616609 0.0 3 0.988799382935944 11.650248694074174 1688.0 2.1768057058722303 2.0 - - - - - - - 361.6666666666667 4 3 OVCH1 ovochymase 1 1907 242 C20140710_OR014_02 C20140710_OR014_02 TB433659.[MT7]-EYMSPDIALLYLK[MT7].2y3_1.heavy 922.51 / 567.362 1809.0 46.4552001953125 48 18 10 10 10 6.294585636026831 15.886669239616609 0.0 3 0.988799382935944 11.650248694074174 1809.0 9.444779005524861 0.0 - - - - - - - 281.5 3 6 OVCH1 ovochymase 1 1909 243 C20140710_OR014_02 C20140710_OR014_02 TB424914.[MT7]-ILEQEAGMLLPR.2b3_1.heavy 757.43 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 1911 243 C20140710_OR014_02 C20140710_OR014_02 TB424914.[MT7]-ILEQEAGMLLPR.2b4_1.heavy 757.43 / 628.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 1913 243 C20140710_OR014_02 C20140710_OR014_02 TB424914.[MT7]-ILEQEAGMLLPR.2y9_1.heavy 757.43 / 1014.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 1915 243 C20140710_OR014_02 C20140710_OR014_02 TB424914.[MT7]-ILEQEAGMLLPR.2y10_1.heavy 757.43 / 1143.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 1917 244 C20140710_OR014_02 C20140710_OR014_02 TB433453.[MT7]-NSLGLYGR.2y5_1.heavy 512.289 / 565.309 4306.0 27.39889907836914 46 18 10 10 8 3.7349156112951727 26.774366654384078 0.0 4 0.981188915106072 8.984052726511157 4306.0 43.426714877745546 0.0 - - - - - - - 199.28571428571428 8 7 LOC55908 hepatocellular carcinoma-associated gene TD26 1919 244 C20140710_OR014_02 C20140710_OR014_02 TB433453.[MT7]-NSLGLYGR.2b4_1.heavy 512.289 / 516.29 2533.0 27.39889907836914 46 18 10 10 8 3.7349156112951727 26.774366654384078 0.0 4 0.981188915106072 8.984052726511157 2533.0 9.337354763775306 2.0 - - - - - - - 202.6 6 5 LOC55908 hepatocellular carcinoma-associated gene TD26 1921 244 C20140710_OR014_02 C20140710_OR014_02 TB433453.[MT7]-NSLGLYGR.2y6_1.heavy 512.289 / 678.393 1393.0 27.39889907836914 46 18 10 10 8 3.7349156112951727 26.774366654384078 0.0 4 0.981188915106072 8.984052726511157 1393.0 3.0592339348444573 0.0 - - - - - - - 316.5 2 4 LOC55908 hepatocellular carcinoma-associated gene TD26 1923 244 C20140710_OR014_02 C20140710_OR014_02 TB433453.[MT7]-NSLGLYGR.2y7_1.heavy 512.289 / 765.425 5319.0 27.39889907836914 46 18 10 10 8 3.7349156112951727 26.774366654384078 0.0 4 0.981188915106072 8.984052726511157 5319.0 16.217488151658767 0.0 - - - - - - - 253.5 10 4 LOC55908 hepatocellular carcinoma-associated gene TD26 1925 245 C20140710_OR014_02 C20140710_OR014_02 TB445957.[MT7]-IGGIFETVENEPVNVEELAFK[MT7].4b7_1.heavy 656.353 / 862.479 470.0 48.48789978027344 41 11 10 10 10 1.3078916288251907 64.25509352291954 0.0 3 0.8724129586169015 3.4176657399641357 470.0 3.8569254185692543 5.0 - - - - - - - 0.0 1 0 GRIK1 glutamate receptor, ionotropic, kainate 1 1927 245 C20140710_OR014_02 C20140710_OR014_02 TB445957.[MT7]-IGGIFETVENEPVNVEELAFK[MT7].4b5_1.heavy 656.353 / 632.389 2254.0 48.48789978027344 41 11 10 10 10 1.3078916288251907 64.25509352291954 0.0 3 0.8724129586169015 3.4176657399641357 2254.0 35.17678723404255 0.0 - - - - - - - 125.33333333333333 4 3 GRIK1 glutamate receptor, ionotropic, kainate 1 1929 245 C20140710_OR014_02 C20140710_OR014_02 TB445957.[MT7]-IGGIFETVENEPVNVEELAFK[MT7].4y3_1.heavy 656.353 / 509.32 5072.0 48.48789978027344 41 11 10 10 10 1.3078916288251907 64.25509352291954 0.0 3 0.8724129586169015 3.4176657399641357 5072.0 51.79914893617021 1.0 - - - - - - - 219.33333333333334 10 6 GRIK1 glutamate receptor, ionotropic, kainate 1 1931 245 C20140710_OR014_02 C20140710_OR014_02 TB445957.[MT7]-IGGIFETVENEPVNVEELAFK[MT7].4b6_1.heavy 656.353 / 761.431 939.0 48.48789978027344 41 11 10 10 10 1.3078916288251907 64.25509352291954 0.0 3 0.8724129586169015 3.4176657399641357 939.0 12.886276595744683 0.0 - - - - - - - 0.0 1 0 GRIK1 glutamate receptor, ionotropic, kainate 1 1933 246 C20140710_OR014_02 C20140710_OR014_02 TB433559.[MT7]-ASLLHQDSESR.2y8_1.heavy 693.858 / 971.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf15 chromosome 6 open reading frame 15 1935 246 C20140710_OR014_02 C20140710_OR014_02 TB433559.[MT7]-ASLLHQDSESR.2b4_1.heavy 693.858 / 529.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf15 chromosome 6 open reading frame 15 1937 246 C20140710_OR014_02 C20140710_OR014_02 TB433559.[MT7]-ASLLHQDSESR.2y6_1.heavy 693.858 / 721.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf15 chromosome 6 open reading frame 15 1939 246 C20140710_OR014_02 C20140710_OR014_02 TB433559.[MT7]-ASLLHQDSESR.2y7_1.heavy 693.858 / 858.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - C6orf15 chromosome 6 open reading frame 15 1941 247 C20140710_OR014_02 C20140710_OR014_02 TB424729.[MT7]-GSFSPEGPR.2y8_1.heavy 539.276 / 876.421 2967.0 22.695274829864502 44 18 10 6 10 3.702703897680731 18.30957161527671 0.03890037536621094 3 0.9836633332803622 9.642455042178662 2967.0 27.05205882352941 1.0 - - - - - - - 194.4 5 10 HSF4 heat shock transcription factor 4 1943 247 C20140710_OR014_02 C20140710_OR014_02 TB424729.[MT7]-GSFSPEGPR.2y5_1.heavy 539.276 / 555.289 3274.0 22.695274829864502 44 18 10 6 10 3.702703897680731 18.30957161527671 0.03890037536621094 3 0.9836633332803622 9.642455042178662 3274.0 9.141665598290597 0.0 - - - - - - - 307.0 6 4 HSF4 heat shock transcription factor 4 1945 247 C20140710_OR014_02 C20140710_OR014_02 TB424729.[MT7]-GSFSPEGPR.2b4_1.heavy 539.276 / 523.263 4195.0 22.695274829864502 44 18 10 6 10 3.702703897680731 18.30957161527671 0.03890037536621094 3 0.9836633332803622 9.642455042178662 4195.0 9.436185819070904 1.0 - - - - - - - 272.8333333333333 8 6 HSF4 heat shock transcription factor 4 1947 247 C20140710_OR014_02 C20140710_OR014_02 TB424729.[MT7]-GSFSPEGPR.2y6_1.heavy 539.276 / 642.321 4297.0 22.695274829864502 44 18 10 6 10 3.702703897680731 18.30957161527671 0.03890037536621094 3 0.9836633332803622 9.642455042178662 4297.0 41.29312195121951 0.0 - - - - - - - 230.25 8 4 HSF4 heat shock transcription factor 4 1949 248 C20140710_OR014_02 C20140710_OR014_02 TB445954.[MT7]-DTFFLTVHDAILYLQNQVK[MT7].4b4_1.heavy 639.104 / 655.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC26A4 solute carrier family 26, member 4 1951 248 C20140710_OR014_02 C20140710_OR014_02 TB445954.[MT7]-DTFFLTVHDAILYLQNQVK[MT7].4b5_1.heavy 639.104 / 768.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC26A4 solute carrier family 26, member 4 1953 248 C20140710_OR014_02 C20140710_OR014_02 TB445954.[MT7]-DTFFLTVHDAILYLQNQVK[MT7].4b3_1.heavy 639.104 / 508.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC26A4 solute carrier family 26, member 4 1955 248 C20140710_OR014_02 C20140710_OR014_02 TB445954.[MT7]-DTFFLTVHDAILYLQNQVK[MT7].4b6_1.heavy 639.104 / 869.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC26A4 solute carrier family 26, member 4 1957 249 C20140710_OR014_02 C20140710_OR014_02 TB433556.[MT7]-IITHPEYNSR.2y8_1.heavy 687.368 / 1003.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 1959 249 C20140710_OR014_02 C20140710_OR014_02 TB433556.[MT7]-IITHPEYNSR.2y9_1.heavy 687.368 / 1116.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 1961 249 C20140710_OR014_02 C20140710_OR014_02 TB433556.[MT7]-IITHPEYNSR.2y6_1.heavy 687.368 / 765.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 1963 249 C20140710_OR014_02 C20140710_OR014_02 TB433556.[MT7]-IITHPEYNSR.2y7_1.heavy 687.368 / 902.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 1965 250 C20140710_OR014_02 C20140710_OR014_02 TB425038.[MT7]-GGTFTDVFAQC[CAM]PGGHVR.3y7_1.heavy 650.652 / 782.373 5375.0 33.51210021972656 45 15 10 10 10 3.065590641765468 32.62014133185446 0.0 3 0.9597101648782036 6.1276731961380015 5375.0 30.34743907972349 0.0 - - - - - - - 180.75 10 8 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1967 250 C20140710_OR014_02 C20140710_OR014_02 TB425038.[MT7]-GGTFTDVFAQC[CAM]PGGHVR.3y6_1.heavy 650.652 / 622.342 10233.0 33.51210021972656 45 15 10 10 10 3.065590641765468 32.62014133185446 0.0 3 0.9597101648782036 6.1276731961380015 10233.0 15.331210574680755 1.0 - - - - - - - 679.2857142857143 22 7 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1969 250 C20140710_OR014_02 C20140710_OR014_02 TB425038.[MT7]-GGTFTDVFAQC[CAM]PGGHVR.3b6_1.heavy 650.652 / 723.343 11783.0 33.51210021972656 45 15 10 10 10 3.065590641765468 32.62014133185446 0.0 3 0.9597101648782036 6.1276731961380015 11783.0 55.49412903225806 0.0 - - - - - - - 335.625 23 8 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1971 250 C20140710_OR014_02 C20140710_OR014_02 TB425038.[MT7]-GGTFTDVFAQC[CAM]PGGHVR.3b7_1.heavy 650.652 / 822.411 5271.0 33.51210021972656 45 15 10 10 10 3.065590641765468 32.62014133185446 0.0 3 0.9597101648782036 6.1276731961380015 5271.0 56.92283808330724 1.0 - - - - - - - 197.0909090909091 10 11 OPLAH 5-oxoprolinase (ATP-hydrolysing) 1973 251 C20140710_OR014_02 C20140710_OR014_02 TB425174.[MT7]-FNTC[CAM]PLPGALLQDPYFIQSPSTYSLSQR.4y10_1.heavy 836.924 / 1125.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1975 251 C20140710_OR014_02 C20140710_OR014_02 TB425174.[MT7]-FNTC[CAM]PLPGALLQDPYFIQSPSTYSLSQR.4y9_1.heavy 836.924 / 1038.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1977 251 C20140710_OR014_02 C20140710_OR014_02 TB425174.[MT7]-FNTC[CAM]PLPGALLQDPYFIQSPSTYSLSQR.4b4_1.heavy 836.924 / 667.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1979 251 C20140710_OR014_02 C20140710_OR014_02 TB425174.[MT7]-FNTC[CAM]PLPGALLQDPYFIQSPSTYSLSQR.4b6_1.heavy 836.924 / 877.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - HSF4 heat shock transcription factor 4 1981 252 C20140710_OR014_02 C20140710_OR014_02 TB445678.[MT7]-VLLAGASSQR.2y8_1.heavy 573.342 / 789.421 12982.0 26.96030044555664 45 17 10 10 8 2.734306661995416 36.57234259416351 0.0 4 0.9732790279430152 7.532938232770743 12982.0 146.14188608313236 0.0 - - - - - - - 266.0 25 6 GRM1 glutamate receptor, metabotropic 1 1983 252 C20140710_OR014_02 C20140710_OR014_02 TB445678.[MT7]-VLLAGASSQR.2y9_1.heavy 573.342 / 902.505 18835.0 26.96030044555664 45 17 10 10 8 2.734306661995416 36.57234259416351 0.0 4 0.9732790279430152 7.532938232770743 18835.0 245.71090884932238 0.0 - - - - - - - 199.375 37 8 GRM1 glutamate receptor, metabotropic 1 1985 252 C20140710_OR014_02 C20140710_OR014_02 TB445678.[MT7]-VLLAGASSQR.2y6_1.heavy 573.342 / 605.3 17664.0 26.96030044555664 45 17 10 10 8 2.734306661995416 36.57234259416351 0.0 4 0.9732790279430152 7.532938232770743 17664.0 57.192141259760945 1.0 - - - - - - - 319.2 42 5 GRM1 glutamate receptor, metabotropic 1 1987 252 C20140710_OR014_02 C20140710_OR014_02 TB445678.[MT7]-VLLAGASSQR.2y7_1.heavy 573.342 / 676.337 19261.0 26.96030044555664 45 17 10 10 8 2.734306661995416 36.57234259416351 0.0 4 0.9732790279430152 7.532938232770743 19261.0 100.61659300631374 0.0 - - - - - - - 283.6666666666667 38 9 GRM1 glutamate receptor, metabotropic 1 1989 253 C20140710_OR014_02 C20140710_OR014_02 TB433521.[MT7]-RYQVVATMR.2b3_1.heavy 634.357 / 592.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDH8 retinol dehydrogenase 8 (all-trans) 1991 253 C20140710_OR014_02 C20140710_OR014_02 TB433521.[MT7]-RYQVVATMR.2y8_1.heavy 634.357 / 967.503 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDH8 retinol dehydrogenase 8 (all-trans) 1993 253 C20140710_OR014_02 C20140710_OR014_02 TB433521.[MT7]-RYQVVATMR.2b4_1.heavy 634.357 / 691.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDH8 retinol dehydrogenase 8 (all-trans) 1995 253 C20140710_OR014_02 C20140710_OR014_02 TB433521.[MT7]-RYQVVATMR.2y7_1.heavy 634.357 / 804.44 N/A N/A - - - - - - - - - 0.0 - - - - - - - RDH8 retinol dehydrogenase 8 (all-trans) 1997 254 C20140710_OR014_02 C20140710_OR014_02 TB433663.[MT7]-HLC[CAM]PPGK[MT7]PSTSEK[MT7].2b3_1.heavy 935.514 / 555.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - SSX7 synovial sarcoma, X breakpoint 7 1999 254 C20140710_OR014_02 C20140710_OR014_02 TB433663.[MT7]-HLC[CAM]PPGK[MT7]PSTSEK[MT7].2y8_1.heavy 935.514 / 1121.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - SSX7 synovial sarcoma, X breakpoint 7 2001 254 C20140710_OR014_02 C20140710_OR014_02 TB433663.[MT7]-HLC[CAM]PPGK[MT7]PSTSEK[MT7].2y9_1.heavy 935.514 / 1218.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - SSX7 synovial sarcoma, X breakpoint 7 2003 254 C20140710_OR014_02 C20140710_OR014_02 TB433663.[MT7]-HLC[CAM]PPGK[MT7]PSTSEK[MT7].2y6_1.heavy 935.514 / 792.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - SSX7 synovial sarcoma, X breakpoint 7 2005 255 C20140710_OR014_02 C20140710_OR014_02 TB433665.[MT7]-NITVTSGEYSLFQK[MT7].2y8_1.heavy 938.009 / 1115.59 2680.0 37.26129913330078 38 8 10 10 10 1.8092378194286425 43.84138636706926 0.0 3 0.7647047659508245 2.4925680242968418 2680.0 10.351931330472103 0.0 - - - - - - - 303.0 5 10 OVCH1 ovochymase 1 2007 255 C20140710_OR014_02 C20140710_OR014_02 TB433665.[MT7]-NITVTSGEYSLFQK[MT7].2y5_1.heavy 938.009 / 766.458 1398.0 37.26129913330078 38 8 10 10 10 1.8092378194286425 43.84138636706926 0.0 3 0.7647047659508245 2.4925680242968418 1398.0 11.392820512820514 0.0 - - - - - - - 194.33333333333334 2 6 OVCH1 ovochymase 1 2009 255 C20140710_OR014_02 C20140710_OR014_02 TB433665.[MT7]-NITVTSGEYSLFQK[MT7].2b4_1.heavy 938.009 / 572.352 3495.0 37.26129913330078 38 8 10 10 10 1.8092378194286425 43.84138636706926 0.0 3 0.7647047659508245 2.4925680242968418 3495.0 19.98857142857143 0.0 - - - - - - - 310.8333333333333 6 6 OVCH1 ovochymase 1 2011 255 C20140710_OR014_02 C20140710_OR014_02 TB433665.[MT7]-NITVTSGEYSLFQK[MT7].2y3_1.heavy 938.009 / 566.342 1398.0 37.26129913330078 38 8 10 10 10 1.8092378194286425 43.84138636706926 0.0 3 0.7647047659508245 2.4925680242968418 1398.0 8.64 0.0 - - - - - - - 279.8 2 5 OVCH1 ovochymase 1 2013 256 C20140710_OR014_02 C20140710_OR014_02 TB433733.[MT7]-AAAAAAAAAAAAAAASGFAYPGTSER.4b7_1.heavy 596.055 / 642.369 8080.0 44.41630172729492 43 13 10 10 10 1.021137048994113 58.77566167370536 0.0 3 0.9008752205238691 3.8870199723655343 8080.0 44.4956681662564 0.0 - - - - - - - 237.85714285714286 16 7 HOXD13 homeobox D13 2015 256 C20140710_OR014_02 C20140710_OR014_02 TB433733.[MT7]-AAAAAAAAAAAAAAASGFAYPGTSER.4b5_1.heavy 596.055 / 500.295 9743.0 44.41630172729492 43 13 10 10 10 1.021137048994113 58.77566167370536 0.0 3 0.9008752205238691 3.8870199723655343 9743.0 54.48064971251658 0.0 - - - - - - - 326.625 19 8 HOXD13 homeobox D13 2017 256 C20140710_OR014_02 C20140710_OR014_02 TB433733.[MT7]-AAAAAAAAAAAAAAASGFAYPGTSER.4y6_1.heavy 596.055 / 646.315 25071.0 44.41630172729492 43 13 10 10 10 1.021137048994113 58.77566167370536 0.0 3 0.9008752205238691 3.8870199723655343 25071.0 252.9276912870411 0.0 - - - - - - - 297.0 50 6 HOXD13 homeobox D13 2019 256 C20140710_OR014_02 C20140710_OR014_02 TB433733.[MT7]-AAAAAAAAAAAAAAASGFAYPGTSER.4b6_1.heavy 596.055 / 571.332 15684.0 44.41630172729492 43 13 10 10 10 1.021137048994113 58.77566167370536 0.0 3 0.9008752205238691 3.8870199723655343 15684.0 56.89742118881367 0.0 - - - - - - - 282.25 31 8 HOXD13 homeobox D13 2021 257 C20140710_OR014_02 C20140710_OR014_02 TB433732.[MT7]-EQYGIQRVEAMFHTLDK[MT7].4b4_1.heavy 589.061 / 622.295 2695.0 41.82229995727539 41 11 10 10 10 0.8196135073844026 70.02442461297336 0.0 3 0.8737803871602229 3.4365397045438377 2695.0 28.57456112224449 1.0 - - - - - - - 290.27272727272725 5 11 GRM1 glutamate receptor, metabotropic 1 2023 257 C20140710_OR014_02 C20140710_OR014_02 TB433732.[MT7]-EQYGIQRVEAMFHTLDK[MT7].4y3_1.heavy 589.061 / 519.326 8486.0 41.82229995727539 41 11 10 10 10 0.8196135073844026 70.02442461297336 0.0 3 0.8737803871602229 3.4365397045438377 8486.0 21.02317415923216 0.0 - - - - - - - 266.22222222222223 16 9 GRM1 glutamate receptor, metabotropic 1 2025 257 C20140710_OR014_02 C20140710_OR014_02 TB433732.[MT7]-EQYGIQRVEAMFHTLDK[MT7].4b10_2.heavy 589.061 / 659.847 6289.0 41.82229995727539 41 11 10 10 10 0.8196135073844026 70.02442461297336 0.0 3 0.8737803871602229 3.4365397045438377 6289.0 64.15724530663329 0.0 - - - - - - - 128.57142857142858 12 7 GRM1 glutamate receptor, metabotropic 1 2027 257 C20140710_OR014_02 C20140710_OR014_02 TB433732.[MT7]-EQYGIQRVEAMFHTLDK[MT7].4b9_2.heavy 589.061 / 624.329 3294.0 41.82229995727539 41 11 10 10 10 0.8196135073844026 70.02442461297336 0.0 3 0.8737803871602229 3.4365397045438377 3294.0 18.129383458646615 0.0 - - - - - - - 216.25 6 12 GRM1 glutamate receptor, metabotropic 1 2029 258 C20140710_OR014_02 C20140710_OR014_02 TB445574.[MT7]-VMSLGR.2b3_1.heavy 403.737 / 462.25 1580.0 26.563100814819336 39 11 10 10 8 1.2203095193198683 51.62199482275935 0.0 4 0.8614279393974652 3.276249264084218 1580.0 6.6228101116990015 3.0 - - - - - - - 288.75 3 8 CRIP3 cysteine-rich protein 3 2031 258 C20140710_OR014_02 C20140710_OR014_02 TB445574.[MT7]-VMSLGR.2y4_1.heavy 403.737 / 432.257 5833.0 26.563100814819336 39 11 10 10 8 1.2203095193198683 51.62199482275935 0.0 4 0.8614279393974652 3.276249264084218 5833.0 25.095147260273972 0.0 - - - - - - - 295.42857142857144 11 7 CRIP3 cysteine-rich protein 3 2033 258 C20140710_OR014_02 C20140710_OR014_02 TB445574.[MT7]-VMSLGR.2y5_1.heavy 403.737 / 563.297 5590.0 26.563100814819336 39 11 10 10 8 1.2203095193198683 51.62199482275935 0.0 4 0.8614279393974652 3.276249264084218 5590.0 32.078135746096166 0.0 - - - - - - - 213.0 11 4 CRIP3 cysteine-rich protein 3 2035 258 C20140710_OR014_02 C20140710_OR014_02 TB445574.[MT7]-VMSLGR.2b5_1.heavy 403.737 / 632.356 1580.0 26.563100814819336 39 11 10 10 8 1.2203095193198683 51.62199482275935 0.0 4 0.8614279393974652 3.276249264084218 1580.0 7.200984271943177 0.0 - - - - - - - 316.2 3 5 CRIP3 cysteine-rich protein 3 2037 259 C20140710_OR014_02 C20140710_OR014_02 TB433467.[MT7]-LRDWILEATTK[MT7].3b4_1.heavy 545.322 / 715.401 1112.0 40.49334907531738 41 15 10 6 10 2.1982702725210412 31.83347205698863 0.030101776123046875 3 0.9524293657752039 5.635806134276757 1112.0 1.320970316616231 2.0 - - - - - - - 189.375 2 8 TMPRSS9 transmembrane protease, serine 9 2039 259 C20140710_OR014_02 C20140710_OR014_02 TB433467.[MT7]-LRDWILEATTK[MT7].3b5_1.heavy 545.322 / 828.485 1921.0 40.49334907531738 41 15 10 6 10 2.1982702725210412 31.83347205698863 0.030101776123046875 3 0.9524293657752039 5.635806134276757 1921.0 5.071947194719471 0.0 - - - - - - - 214.625 3 8 TMPRSS9 transmembrane protease, serine 9 2041 259 C20140710_OR014_02 C20140710_OR014_02 TB433467.[MT7]-LRDWILEATTK[MT7].3y4_1.heavy 545.322 / 564.347 2528.0 40.49334907531738 41 15 10 6 10 2.1982702725210412 31.83347205698863 0.030101776123046875 3 0.9524293657752039 5.635806134276757 2528.0 11.43023102310231 0.0 - - - - - - - 202.0 5 10 TMPRSS9 transmembrane protease, serine 9 2043 259 C20140710_OR014_02 C20140710_OR014_02 TB433467.[MT7]-LRDWILEATTK[MT7].3b3_1.heavy 545.322 / 529.321 1719.0 40.49334907531738 41 15 10 6 10 2.1982702725210412 31.83347205698863 0.030101776123046875 3 0.9524293657752039 5.635806134276757 1719.0 1.8438118811881186 1.0 - - - - - - - 596.9 3 10 TMPRSS9 transmembrane protease, serine 9 2045 260 C20140710_OR014_02 C20140710_OR014_02 TB433466.[MT7]-WESMLK[MT7].2b3_1.heavy 541.301 / 547.263 N/A 35.243499755859375 50 20 10 10 10 13.62351982226768 7.340246962943434 0.0 2 0.991804944481462 13.623521584108822 1092.0 10.222314049586776 3.0 - - - - - - - 233.23076923076923 2 13 C6orf204 chromosome 6 open reading frame 204 2047 260 C20140710_OR014_02 C20140710_OR014_02 TB433466.[MT7]-WESMLK[MT7].2y4_1.heavy 541.301 / 622.371 2790.0 35.243499755859375 50 20 10 10 10 13.62351982226768 7.340246962943434 0.0 2 0.991804944481462 13.623521584108822 2790.0 9.954535393934687 0.0 - - - - - - - 212.25 5 8 C6orf204 chromosome 6 open reading frame 204 2049 260 C20140710_OR014_02 C20140710_OR014_02 TB433466.[MT7]-WESMLK[MT7].2y5_1.heavy 541.301 / 751.414 3033.0 35.243499755859375 50 20 10 10 10 13.62351982226768 7.340246962943434 0.0 2 0.991804944481462 13.623521584108822 3033.0 31.044513504302635 0.0 - - - - - - - 303.3333333333333 6 6 C6orf204 chromosome 6 open reading frame 204 2051 260 C20140710_OR014_02 C20140710_OR014_02 TB433466.[MT7]-WESMLK[MT7].2y3_1.heavy 541.301 / 535.339 N/A 35.243499755859375 50 20 10 10 10 13.62351982226768 7.340246962943434 0.0 2 0.991804944481462 13.623521584108822 1577.0 2.8594670374967155 9.0 - - - - - - - 303.2 6 10 C6orf204 chromosome 6 open reading frame 204 2053 261 C20140710_OR014_02 C20140710_OR014_02 TB433461.[MT7]-FMNLIK[MT7].2y4_1.heavy 527.322 / 631.426 1648.0 37.679901123046875 43 14 9 10 10 1.1727635710790723 49.88611104760197 0.0 3 0.9419365757357491 5.0966748498988945 1648.0 6.743524539242079 1.0 - - - - - - - 175.9 3 10 GRIK1 glutamate receptor, ionotropic, kainate 1 2055 261 C20140710_OR014_02 C20140710_OR014_02 TB433461.[MT7]-FMNLIK[MT7].2b3_1.heavy 527.322 / 537.261 1428.0 37.679901123046875 43 14 9 10 10 1.1727635710790723 49.88611104760197 0.0 3 0.9419365757357491 5.0966748498988945 1428.0 6.519494719403603 1.0 - - - - - - - 274.7 2 10 GRIK1 glutamate receptor, ionotropic, kainate 1 2057 261 C20140710_OR014_02 C20140710_OR014_02 TB433461.[MT7]-FMNLIK[MT7].2y5_1.heavy 527.322 / 762.466 989.0 37.679901123046875 43 14 9 10 10 1.1727635710790723 49.88611104760197 0.0 3 0.9419365757357491 5.0966748498988945 989.0 2.4778758218207164 3.0 - - - - - - - 219.75 5 4 GRIK1 glutamate receptor, ionotropic, kainate 1 2059 261 C20140710_OR014_02 C20140710_OR014_02 TB433461.[MT7]-FMNLIK[MT7].2y3_1.heavy 527.322 / 517.383 1428.0 37.679901123046875 43 14 9 10 10 1.1727635710790723 49.88611104760197 0.0 3 0.9419365757357491 5.0966748498988945 1428.0 1.3646120601937797 3.0 - - - - - - - 247.25 4 12 GRIK1 glutamate receptor, ionotropic, kainate 1 2061 262 C20140710_OR014_02 C20140710_OR014_02 TB433736.[MT7]-FSPNC[CAM]IYDAVVIYGDSEEK[MT7].3y6_1.heavy 832.073 / 808.38 2871.0 44.91024875640869 35 14 10 1 10 3.694182920984101 27.069585383000145 0.09510040283203125 3 0.9338814517139269 4.772855195521872 2871.0 12.611297071129709 0.0 - - - - - - - 239.33333333333334 5 6 OVCH1 ovochymase 1 2063 262 C20140710_OR014_02 C20140710_OR014_02 TB433736.[MT7]-FSPNC[CAM]IYDAVVIYGDSEEK[MT7].3b6_1.heavy 832.073 / 863.42 2393.0 44.91024875640869 35 14 10 1 10 3.694182920984101 27.069585383000145 0.09510040283203125 3 0.9338814517139269 4.772855195521872 2393.0 22.944026230269266 0.0 - - - - - - - 279.3333333333333 4 6 OVCH1 ovochymase 1 2065 262 C20140710_OR014_02 C20140710_OR014_02 TB433736.[MT7]-FSPNC[CAM]IYDAVVIYGDSEEK[MT7].3b5_1.heavy 832.073 / 750.336 1316.0 44.91024875640869 35 14 10 1 10 3.694182920984101 27.069585383000145 0.09510040283203125 3 0.9338814517139269 4.772855195521872 1316.0 11.241692789968653 1.0 - - - - - - - 279.3333333333333 2 3 OVCH1 ovochymase 1 2067 262 C20140710_OR014_02 C20140710_OR014_02 TB433736.[MT7]-FSPNC[CAM]IYDAVVIYGDSEEK[MT7].3y4_1.heavy 832.073 / 636.332 1077.0 44.91024875640869 35 14 10 1 10 3.694182920984101 27.069585383000145 0.09510040283203125 3 0.9338814517139269 4.772855195521872 1077.0 9.666025 2.0 - - - - - - - 171.0 2 7 OVCH1 ovochymase 1 2069 263 C20140710_OR014_02 C20140710_OR014_02 TB445964.[MT7]-SIVPAPGEGLLAVLHMMVFTDALHR.4y9_1.heavy 705.386 / 1089.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEC1 deleted in esophageal cancer 1 2071 263 C20140710_OR014_02 C20140710_OR014_02 TB445964.[MT7]-SIVPAPGEGLLAVLHMMVFTDALHR.4y10_1.heavy 705.386 / 1220.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEC1 deleted in esophageal cancer 1 2073 263 C20140710_OR014_02 C20140710_OR014_02 TB445964.[MT7]-SIVPAPGEGLLAVLHMMVFTDALHR.4b5_1.heavy 705.386 / 612.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEC1 deleted in esophageal cancer 1 2075 263 C20140710_OR014_02 C20140710_OR014_02 TB445964.[MT7]-SIVPAPGEGLLAVLHMMVFTDALHR.4y7_1.heavy 705.386 / 859.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEC1 deleted in esophageal cancer 1 2077 264 C20140710_OR014_02 C20140710_OR014_02 TB445677.[MT7]-SLLGGTALLR.2y8_1.heavy 572.862 / 800.499 6612.0 38.341675758361816 35 14 10 3 8 2.470401531316995 40.47924951968801 0.07590103149414062 4 0.9450879987005301 5.242290540145401 6612.0 51.28363853820598 0.0 - - - - - - - 212.875 13 8 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 2079 264 C20140710_OR014_02 C20140710_OR014_02 TB445677.[MT7]-SLLGGTALLR.2y9_1.heavy 572.862 / 913.583 3306.0 38.341675758361816 35 14 10 3 8 2.470401531316995 40.47924951968801 0.07590103149414062 4 0.9450879987005301 5.242290540145401 3306.0 6.612000000000001 1.0 - - - - - - - 183.5 6 6 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 2081 264 C20140710_OR014_02 C20140710_OR014_02 TB445677.[MT7]-SLLGGTALLR.2b7_1.heavy 572.862 / 744.437 2004.0 38.341675758361816 35 14 10 3 8 2.470401531316995 40.47924951968801 0.07590103149414062 4 0.9450879987005301 5.242290540145401 2004.0 4.497755610972569 0.0 - - - - - - - 273.27272727272725 4 11 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 2083 264 C20140710_OR014_02 C20140710_OR014_02 TB445677.[MT7]-SLLGGTALLR.2y7_1.heavy 572.862 / 687.415 16529.0 38.341675758361816 35 14 10 3 8 2.470401531316995 40.47924951968801 0.07590103149414062 4 0.9450879987005301 5.242290540145401 16529.0 74.9995802676602 0.0 - - - - - - - 200.33333333333334 33 12 LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 2085 265 C20140710_OR014_02 C20140710_OR014_02 TB424804.[MT7]-GGC[CAM]VSC[CAM]GGSK[MT7].2y6_1.heavy 628.802 / 739.352 647.0 15.24590015411377 37 13 10 10 4 1.4945325387259327 54.92748879399726 0.0 10 0.9061938366004735 3.997530456743274 647.0 14.518726296958855 0.0 - - - - - - - 0.0 1 0 KRTAP5-4 keratin associated protein 5-4 2087 265 C20140710_OR014_02 C20140710_OR014_02 TB424804.[MT7]-GGC[CAM]VSC[CAM]GGSK[MT7].2y5_1.heavy 628.802 / 652.32 129.0 15.24590015411377 37 13 10 10 4 1.4945325387259327 54.92748879399726 0.0 10 0.9061938366004735 3.997530456743274 129.0 5.2281572164948455 5.0 - - - - - - - 0.0 0 0 KRTAP5-4 keratin associated protein 5-4 2089 265 C20140710_OR014_02 C20140710_OR014_02 TB424804.[MT7]-GGC[CAM]VSC[CAM]GGSK[MT7].2b4_1.heavy 628.802 / 518.251 259.0 15.24590015411377 37 13 10 10 4 1.4945325387259327 54.92748879399726 0.0 10 0.9061938366004735 3.997530456743274 259.0 0.7622144511558198 16.0 - - - - - - - 0.0 1 0 KRTAP5-4 keratin associated protein 5-4 2091 265 C20140710_OR014_02 C20140710_OR014_02 TB424804.[MT7]-GGC[CAM]VSC[CAM]GGSK[MT7].2y7_1.heavy 628.802 / 838.421 32.0 15.24590015411377 37 13 10 10 4 1.4945325387259327 54.92748879399726 0.0 10 0.9061938366004735 3.997530456743274 32.0 0.9255384615384616 18.0 - - - - - - - 0.0 0 0 KRTAP5-4 keratin associated protein 5-4 2093 266 C20140710_OR014_02 C20140710_OR014_02 TB445670.[MT7]-TVTVVYEDSTGLIR.3y7_1.heavy 566.313 / 761.415 6412.0 37.385501861572266 47 17 10 10 10 6.339887418260706 15.77315075216811 0.0 3 0.9763319473893096 8.006095940597756 6412.0 22.083741233894642 0.0 - - - - - - - 174.85714285714286 12 7 GRIK1 glutamate receptor, ionotropic, kainate 1 2095 266 C20140710_OR014_02 C20140710_OR014_02 TB445670.[MT7]-TVTVVYEDSTGLIR.3b4_1.heavy 566.313 / 545.341 8956.0 37.385501861572266 47 17 10 10 10 6.339887418260706 15.77315075216811 0.0 3 0.9763319473893096 8.006095940597756 8956.0 21.29236981507315 0.0 - - - - - - - 178.375 17 8 GRIK1 glutamate receptor, ionotropic, kainate 1 2097 266 C20140710_OR014_02 C20140710_OR014_02 TB445670.[MT7]-TVTVVYEDSTGLIR.3b5_1.heavy 566.313 / 644.41 8854.0 37.385501861572266 47 17 10 10 10 6.339887418260706 15.77315075216811 0.0 3 0.9763319473893096 8.006095940597756 8854.0 60.81179891121067 0.0 - - - - - - - 213.9 17 10 GRIK1 glutamate receptor, ionotropic, kainate 1 2099 266 C20140710_OR014_02 C20140710_OR014_02 TB445670.[MT7]-TVTVVYEDSTGLIR.3y9_2.heavy 566.313 / 527.264 5394.0 37.385501861572266 47 17 10 10 10 6.339887418260706 15.77315075216811 0.0 3 0.9763319473893096 8.006095940597756 5394.0 10.9201575053695 0.0 - - - - - - - 261.7142857142857 10 7 GRIK1 glutamate receptor, ionotropic, kainate 1 2101 267 C20140710_OR014_02 C20140710_OR014_02 TB424806.[MT7]-NYFTVAQNEEFDK[MT7].3y3_1.heavy 631.647 / 553.31 30602.0 34.93644905090332 42 17 10 5 10 2.4366606335183407 32.93166073477934 0.047298431396484375 3 0.9749014107936502 7.7736531210650135 30602.0 77.23547389823784 0.0 - - - - - - - 299.6666666666667 61 12 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 2103 267 C20140710_OR014_02 C20140710_OR014_02 TB424806.[MT7]-NYFTVAQNEEFDK[MT7].3b4_1.heavy 631.647 / 670.332 21445.0 34.93644905090332 42 17 10 5 10 2.4366606335183407 32.93166073477934 0.047298431396484375 3 0.9749014107936502 7.7736531210650135 21445.0 49.802914487220804 0.0 - - - - - - - 253.0909090909091 42 11 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 2105 267 C20140710_OR014_02 C20140710_OR014_02 TB424806.[MT7]-NYFTVAQNEEFDK[MT7].3y4_1.heavy 631.647 / 682.353 16113.0 34.93644905090332 42 17 10 5 10 2.4366606335183407 32.93166073477934 0.047298431396484375 3 0.9749014107936502 7.7736531210650135 16113.0 86.12120689655171 0.0 - - - - - - - 242.54545454545453 32 11 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 2107 267 C20140710_OR014_02 C20140710_OR014_02 TB424806.[MT7]-NYFTVAQNEEFDK[MT7].3b3_1.heavy 631.647 / 569.284 17619.0 34.93644905090332 42 17 10 5 10 2.4366606335183407 32.93166073477934 0.047298431396484375 3 0.9749014107936502 7.7736531210650135 17619.0 37.18806280533159 0.0 - - - - - - - 681.375 35 8 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 2109 268 C20140710_OR014_02 C20140710_OR014_02 TB425161.[MT7]-DTLELIETELTEEELDVQDEAMR.3y7_1.heavy 955.794 / 848.393 1527.0 52.69477653503418 41 18 10 3 10 5.246609156160118 19.059929379833562 0.0746002197265625 3 0.985799470880038 10.34415045836192 1527.0 -1.9008298755186726 0.0 - - - - - - - 209.0 3 5 SLC26A4 solute carrier family 26, member 4 2111 268 C20140710_OR014_02 C20140710_OR014_02 TB425161.[MT7]-DTLELIETELTEEELDVQDEAMR.3b6_1.heavy 955.794 / 829.479 1769.0 52.69477653503418 41 18 10 3 10 5.246609156160118 19.059929379833562 0.0746002197265625 3 0.985799470880038 10.34415045836192 1769.0 -0.14680497925311187 0.0 - - - - - - - 192.8 3 5 SLC26A4 solute carrier family 26, member 4 2113 268 C20140710_OR014_02 C20140710_OR014_02 TB425161.[MT7]-DTLELIETELTEEELDVQDEAMR.3b5_1.heavy 955.794 / 716.395 3618.0 52.69477653503418 41 18 10 3 10 5.246609156160118 19.059929379833562 0.0746002197265625 3 0.985799470880038 10.34415045836192 3618.0 -0.06004979253112008 0.0 - - - - - - - 268.0 7 3 SLC26A4 solute carrier family 26, member 4 2115 268 C20140710_OR014_02 C20140710_OR014_02 TB425161.[MT7]-DTLELIETELTEEELDVQDEAMR.3y8_1.heavy 955.794 / 963.42 2010.0 52.69477653503418 41 18 10 3 10 5.246609156160118 19.059929379833562 0.0746002197265625 3 0.985799470880038 10.34415045836192 2010.0 -1.5 1.0 - - - - - - - 160.75 4 4 SLC26A4 solute carrier family 26, member 4 2117 269 C20140710_OR014_02 C20140710_OR014_02 TB433533.[MT7]-DLVLEPSLK[MT7].3y3_1.heavy 434.602 / 491.331 2434.0 35.10179901123047 47 17 10 10 10 4.4683584063494415 22.379583485940195 0.0 3 0.97636315775114 8.011400887125598 2434.0 12.87019178082192 0.0 - - - - - - - 304.25 4 4 SPANXN5 SPANX family, member N5 2119 269 C20140710_OR014_02 C20140710_OR014_02 TB433533.[MT7]-DLVLEPSLK[MT7].3b4_1.heavy 434.602 / 585.373 1826.0 35.10179901123047 47 17 10 10 10 4.4683584063494415 22.379583485940195 0.0 3 0.97636315775114 8.011400887125598 1826.0 15.02880658436214 0.0 - - - - - - - 609.0 3 1 SPANXN5 SPANX family, member N5 2121 269 C20140710_OR014_02 C20140710_OR014_02 TB433533.[MT7]-DLVLEPSLK[MT7].3y4_1.heavy 434.602 / 588.384 2434.0 35.10179901123047 47 17 10 10 10 4.4683584063494415 22.379583485940195 0.0 3 0.97636315775114 8.011400887125598 2434.0 4.534611872146119 1.0 - - - - - - - 263.6666666666667 7 6 SPANXN5 SPANX family, member N5 2123 269 C20140710_OR014_02 C20140710_OR014_02 TB433533.[MT7]-DLVLEPSLK[MT7].3b3_1.heavy 434.602 / 472.289 3286.0 35.10179901123047 47 17 10 10 10 4.4683584063494415 22.379583485940195 0.0 3 0.97636315775114 8.011400887125598 3286.0 27.045267489711936 0.0 - - - - - - - 284.0 6 3 SPANXN5 SPANX family, member N5 2125 270 C20140710_OR014_02 C20140710_OR014_02 TB445971.[MT7]-LLPASFPC[CAM]IFGPGENQPLSPEASRK[MT7].4y7_1.heavy 750.902 / 918.513 965.0 44.53190040588379 37 16 10 1 10 2.8980813882119354 34.50558718148983 0.09239959716796875 3 0.9672232126748174 6.798071897375831 965.0 7.829765767561205 2.0 - - - - - - - 224.14285714285714 2 7 OPLAH 5-oxoprolinase (ATP-hydrolysing) 2127 270 C20140710_OR014_02 C20140710_OR014_02 TB445971.[MT7]-LLPASFPC[CAM]IFGPGENQPLSPEASRK[MT7].4y9_1.heavy 750.902 / 1128.65 2774.0 44.53190040588379 37 16 10 1 10 2.8980813882119354 34.50558718148983 0.09239959716796875 3 0.9672232126748174 6.798071897375831 2774.0 8.667202100253682 0.0 - - - - - - - 258.42857142857144 5 7 OPLAH 5-oxoprolinase (ATP-hydrolysing) 2129 270 C20140710_OR014_02 C20140710_OR014_02 TB445971.[MT7]-LLPASFPC[CAM]IFGPGENQPLSPEASRK[MT7].4y6_1.heavy 750.902 / 831.481 2774.0 44.53190040588379 37 16 10 1 10 2.8980813882119354 34.50558718148983 0.09239959716796875 3 0.9672232126748174 6.798071897375831 2774.0 24.874732129567974 0.0 - - - - - - - 221.16666666666666 5 6 OPLAH 5-oxoprolinase (ATP-hydrolysing) 2131 270 C20140710_OR014_02 C20140710_OR014_02 TB445971.[MT7]-LLPASFPC[CAM]IFGPGENQPLSPEASRK[MT7].4b4_1.heavy 750.902 / 539.367 844.0 44.53190040588379 37 16 10 1 10 2.8980813882119354 34.50558718148983 0.09239959716796875 3 0.9672232126748174 6.798071897375831 844.0 1.0597014925373136 6.0 - - - - - - - 267.8888888888889 2 9 OPLAH 5-oxoprolinase (ATP-hydrolysing) 2133 271 C20140710_OR014_02 C20140710_OR014_02 TB425024.[MT7]-VVGDTYHSVSLVWK[MT7].4b8_2.heavy 470.265 / 502.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 2135 271 C20140710_OR014_02 C20140710_OR014_02 TB425024.[MT7]-VVGDTYHSVSLVWK[MT7].4b4_1.heavy 470.265 / 515.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 2137 271 C20140710_OR014_02 C20140710_OR014_02 TB425024.[MT7]-VVGDTYHSVSLVWK[MT7].4b5_1.heavy 470.265 / 616.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 2139 271 C20140710_OR014_02 C20140710_OR014_02 TB425024.[MT7]-VVGDTYHSVSLVWK[MT7].4b6_1.heavy 470.265 / 779.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - LRIT1 leucine-rich repeat, immunoglobulin-like and transmembrane domains 1 2141 272 C20140710_OR014_02 C20140710_OR014_02 TB425163.[MT7]-QNPMTNYTTLPTSIMDHSISPFMR.4y8_1.heavy 732.356 / 974.488 1215.0 45.928749084472656 37 14 10 5 8 3.348836714813608 23.705468582877643 0.043701171875 4 0.9494559130935131 5.466139989308809 1215.0 9.349999999999998 0.0 - - - - - - - 208.14285714285714 2 7 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 2143 272 C20140710_OR014_02 C20140710_OR014_02 TB425163.[MT7]-QNPMTNYTTLPTSIMDHSISPFMR.4y10_1.heavy 732.356 / 1220.56 243.0 45.928749084472656 37 14 10 5 8 3.348836714813608 23.705468582877643 0.043701171875 4 0.9494559130935131 5.466139989308809 243.0 0.6005494505494504 16.0 - - - - - - - 0.0 0 0 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 2145 272 C20140710_OR014_02 C20140710_OR014_02 TB425163.[MT7]-QNPMTNYTTLPTSIMDHSISPFMR.4y7_1.heavy 732.356 / 837.429 850.0 45.928749084472656 37 14 10 5 8 3.348836714813608 23.705468582877643 0.043701171875 4 0.9494559130935131 5.466139989308809 850.0 6.3581607318981055 3.0 - - - - - - - 0.0 1 0 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 2147 272 C20140710_OR014_02 C20140710_OR014_02 TB425163.[MT7]-QNPMTNYTTLPTSIMDHSISPFMR.4b6_1.heavy 732.356 / 830.395 1458.0 45.928749084472656 37 14 10 5 8 3.348836714813608 23.705468582877643 0.043701171875 4 0.9494559130935131 5.466139989308809 1458.0 2.6099173553719 1.0 - - - - - - - 161.66666666666666 2 6 SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 2149 273 C20140710_OR014_02 C20140710_OR014_02 TB445972.[MT7]-SIVPAPGEGLLAVLHMMVFTDALHRER.4y16_2.heavy 776.672 / 963.495 2182.0 52.452149391174316 35 12 9 6 8 1.0403905053145135 58.2945407669618 0.037403106689453125 4 0.8824215490613159 3.5632670937552753 2182.0 39.789411764705875 1.0 - - - - - - - 167.5 4 10 DEC1 deleted in esophageal cancer 1 2151 273 C20140710_OR014_02 C20140710_OR014_02 TB445972.[MT7]-SIVPAPGEGLLAVLHMMVFTDALHRER.4b5_1.heavy 776.672 / 612.384 2131.0 52.452149391174316 35 12 9 6 8 1.0403905053145135 58.2945407669618 0.037403106689453125 4 0.8824215490613159 3.5632670937552753 2131.0 14.769306930693068 1.0 - - - - - - - 158.4375 5 16 DEC1 deleted in esophageal cancer 1 2153 273 C20140710_OR014_02 C20140710_OR014_02 TB445972.[MT7]-SIVPAPGEGLLAVLHMMVFTDALHRER.4b9_1.heavy 776.672 / 952.522 1624.0 52.452149391174316 35 12 9 6 8 1.0403905053145135 58.2945407669618 0.037403106689453125 4 0.8824215490613159 3.5632670937552753 1624.0 2.136842105263158 0.0 - - - - - - - 175.27272727272728 3 11 DEC1 deleted in esophageal cancer 1 2155 273 C20140710_OR014_02 C20140710_OR014_02 TB445972.[MT7]-SIVPAPGEGLLAVLHMMVFTDALHRER.4y6_1.heavy 776.672 / 781.443 558.0 52.452149391174316 35 12 9 6 8 1.0403905053145135 58.2945407669618 0.037403106689453125 4 0.8824215490613159 3.5632670937552753 558.0 3.911997776130467 1.0 - - - - - - - 0.0 1 0 DEC1 deleted in esophageal cancer 1 2157 274 C20140710_OR014_02 C20140710_OR014_02 TB425022.[MT7]-HLC[CAM]PPGK[MT7]PSTSEK[MT7].4y8_2.heavy 468.261 / 561.324 1648.0 20.280799388885498 31 8 10 3 10 0.8344202884852361 77.15512554441753 0.06879997253417969 3 0.7553010321211877 2.4421026455520876 1648.0 3.358980891719745 0.0 - - - - - - - 235.25 3 16 SSX7 synovial sarcoma, X breakpoint 7 2159 274 C20140710_OR014_02 C20140710_OR014_02 TB425022.[MT7]-HLC[CAM]PPGK[MT7]PSTSEK[MT7].4y9_2.heavy 468.261 / 609.85 5494.0 20.280799388885498 31 8 10 3 10 0.8344202884852361 77.15512554441753 0.06879997253417969 3 0.7553010321211877 2.4421026455520876 5494.0 18.05685606134388 1.0 - - - - - - - 224.0 10 7 SSX7 synovial sarcoma, X breakpoint 7 2161 274 C20140710_OR014_02 C20140710_OR014_02 TB425022.[MT7]-HLC[CAM]PPGK[MT7]PSTSEK[MT7].4y3_1.heavy 468.261 / 507.289 1962.0 20.280799388885498 31 8 10 3 10 0.8344202884852361 77.15512554441753 0.06879997253417969 3 0.7553010321211877 2.4421026455520876 1962.0 6.823873767351668 0.0 - - - - - - - 294.125 3 8 SSX7 synovial sarcoma, X breakpoint 7 2163 274 C20140710_OR014_02 C20140710_OR014_02 TB425022.[MT7]-HLC[CAM]PPGK[MT7]PSTSEK[MT7].4y6_1.heavy 468.261 / 792.422 2355.0 20.280799388885498 31 8 10 3 10 0.8344202884852361 77.15512554441753 0.06879997253417969 3 0.7553010321211877 2.4421026455520876 2355.0 8.312765957446809 0.0 - - - - - - - 219.5 4 10 SSX7 synovial sarcoma, X breakpoint 7 2165 275 C20140710_OR014_02 C20140710_OR014_02 TB425166.[MT7]-AMGGSQPGELQISWEEPAPEISDFLR.3b9_1.heavy 996.823 / 959.437 4912.0 48.23139953613281 45 15 10 10 10 2.6005194687145217 30.81361659164245 0.0 3 0.9580751229017626 6.006166395106351 4912.0 30.5425641025641 0.0 - - - - - - - 292.5 9 6 MPL myeloproliferative leukemia virus oncogene 2167 275 C20140710_OR014_02 C20140710_OR014_02 TB425166.[MT7]-AMGGSQPGELQISWEEPAPEISDFLR.3b6_1.heavy 996.823 / 676.32 18830.0 48.23139953613281 45 15 10 10 10 2.6005194687145217 30.81361659164245 0.0 3 0.9580751229017626 6.006166395106351 18830.0 179.5824074074074 0.0 - - - - - - - 277.875 37 8 MPL myeloproliferative leukemia virus oncogene 2169 275 C20140710_OR014_02 C20140710_OR014_02 TB425166.[MT7]-AMGGSQPGELQISWEEPAPEISDFLR.3y8_1.heavy 996.823 / 976.51 9707.0 48.23139953613281 45 15 10 10 10 2.6005194687145217 30.81361659164245 0.0 3 0.9580751229017626 6.006166395106351 9707.0 97.27741452991452 0.0 - - - - - - - 234.0 19 7 MPL myeloproliferative leukemia virus oncogene 2171 275 C20140710_OR014_02 C20140710_OR014_02 TB425166.[MT7]-AMGGSQPGELQISWEEPAPEISDFLR.3y10_1.heavy 996.823 / 1144.6 14152.0 48.23139953613281 45 15 10 10 10 2.6005194687145217 30.81361659164245 0.0 3 0.9580751229017626 6.006166395106351 14152.0 138.94965811965812 0.0 - - - - - - - 255.27272727272728 28 11 MPL myeloproliferative leukemia virus oncogene 2173 276 C20140710_OR014_02 C20140710_OR014_02 TB433671.[MT7]-THLPSHLIPPSIWK[MT7].4b7_1.heavy 479.286 / 930.528 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 2175 276 C20140710_OR014_02 C20140710_OR014_02 TB433671.[MT7]-THLPSHLIPPSIWK[MT7].4b5_1.heavy 479.286 / 680.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 2177 276 C20140710_OR014_02 C20140710_OR014_02 TB433671.[MT7]-THLPSHLIPPSIWK[MT7].4b6_1.heavy 479.286 / 817.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 2179 276 C20140710_OR014_02 C20140710_OR014_02 TB433671.[MT7]-THLPSHLIPPSIWK[MT7].4b3_1.heavy 479.286 / 496.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - SULT1C3 sulfotransferase family, cytosolic, 1C, member 3 2181 277 C20140710_OR014_02 C20140710_OR014_02 TB433477.[MT7]-AQVAANQK[MT7].2y4_1.heavy 559.332 / 604.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 2183 277 C20140710_OR014_02 C20140710_OR014_02 TB433477.[MT7]-AQVAANQK[MT7].2y5_1.heavy 559.332 / 675.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 2185 277 C20140710_OR014_02 C20140710_OR014_02 TB433477.[MT7]-AQVAANQK[MT7].2b4_1.heavy 559.332 / 514.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 2187 277 C20140710_OR014_02 C20140710_OR014_02 TB433477.[MT7]-AQVAANQK[MT7].2y6_1.heavy 559.332 / 774.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - OPLAH 5-oxoprolinase (ATP-hydrolysing) 2189 278 C20140710_OR014_02 C20140710_OR014_02 TB433473.[MT7]-AGAQIPEK[MT7].2y4_1.heavy 551.329 / 630.394 3068.0 21.961824893951416 41 18 10 3 10 2.6997657876414403 28.503994113241205 0.07349967956542969 3 0.9865431168617123 10.626785204957812 3068.0 1.2796663190823776 0.0 - - - - - - - 214.15384615384616 6 13 SSX7 synovial sarcoma, X breakpoint 7 2191 278 C20140710_OR014_02 C20140710_OR014_02 TB433473.[MT7]-AGAQIPEK[MT7].2y3_1.heavy 551.329 / 517.31 11027.0 21.961824893951416 41 18 10 3 10 2.6997657876414403 28.503994113241205 0.07349967956542969 3 0.9865431168617123 10.626785204957812 11027.0 26.95123695976155 0.0 - - - - - - - 239.875 22 8 SSX7 synovial sarcoma, X breakpoint 7 2193 278 C20140710_OR014_02 C20140710_OR014_02 TB433473.[MT7]-AGAQIPEK[MT7].2b5_1.heavy 551.329 / 585.348 2877.0 21.961824893951416 41 18 10 3 10 2.6997657876414403 28.503994113241205 0.07349967956542969 3 0.9865431168617123 10.626785204957812 2877.0 1.3128422425032593 1.0 - - - - - - - 216.0 5 4 SSX7 synovial sarcoma, X breakpoint 7 2195 278 C20140710_OR014_02 C20140710_OR014_02 TB433473.[MT7]-AGAQIPEK[MT7].2y7_1.heavy 551.329 / 886.511 1726.0 21.961824893951416 41 18 10 3 10 2.6997657876414403 28.503994113241205 0.07349967956542969 3 0.9865431168617123 10.626785204957812 1726.0 25.350625 0.0 - - - - - - - 209.45454545454547 3 11 SSX7 synovial sarcoma, X breakpoint 7 2197 279 C20140710_OR014_02 C20140710_OR014_02 TB424709.[MT7]-ISTYEK[MT7].2y4_1.heavy 514.797 / 684.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 2199 279 C20140710_OR014_02 C20140710_OR014_02 TB424709.[MT7]-ISTYEK[MT7].2y5_1.heavy 514.797 / 771.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 2201 279 C20140710_OR014_02 C20140710_OR014_02 TB424709.[MT7]-ISTYEK[MT7].2y3_1.heavy 514.797 / 583.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - GRIK1 glutamate receptor, ionotropic, kainate 1 2203 280 C20140710_OR014_02 C20140710_OR014_02 TB445666.[MT7]-GVQESTEAR.2y5_1.heavy 560.789 / 563.278 2327.0 16.08609962463379 50 20 10 10 10 9.05306403735389 11.045983943932079 0.0 3 0.9922989504774792 14.054270467171728 2327.0 45.74590833054533 0.0 - - - - - - - 153.0 4 6 HSF4 heat shock transcription factor 4 2205 280 C20140710_OR014_02 C20140710_OR014_02 TB445666.[MT7]-GVQESTEAR.2b4_1.heavy 560.789 / 558.3 2510.0 16.08609962463379 50 20 10 10 10 9.05306403735389 11.045983943932079 0.0 3 0.9922989504774792 14.054270467171728 2510.0 17.815651940858537 0.0 - - - - - - - 134.5 5 10 HSF4 heat shock transcription factor 4 2207 280 C20140710_OR014_02 C20140710_OR014_02 TB445666.[MT7]-GVQESTEAR.2y6_1.heavy 560.789 / 692.321 1714.0 16.08609962463379 50 20 10 10 10 9.05306403735389 11.045983943932079 0.0 3 0.9922989504774792 14.054270467171728 1714.0 20.181952957947257 0.0 - - - - - - - 183.6 3 5 HSF4 heat shock transcription factor 4 2209 280 C20140710_OR014_02 C20140710_OR014_02 TB445666.[MT7]-GVQESTEAR.2y7_1.heavy 560.789 / 820.38 2449.0 16.08609962463379 50 20 10 10 10 9.05306403735389 11.045983943932079 0.0 3 0.9922989504774792 14.054270467171728 2449.0 46.14509200401472 0.0 - - - - - - - 142.66666666666666 4 6 HSF4 heat shock transcription factor 4 2211 281 C20140710_OR014_02 C20140710_OR014_02 TB433537.[MT7]-SFDDYFLK[MT7].3y3_1.heavy 441.567 / 551.367 1129.0 39.06980037689209 34 8 10 6 10 1.0899779633617113 73.59969787981989 0.035602569580078125 3 0.799752781543225 2.710504649393259 1129.0 10.46116504854369 1.0 - - - - - - - 205.33333333333334 2 3 GRM1 glutamate receptor, metabotropic 1 2213 281 C20140710_OR014_02 C20140710_OR014_02 TB433537.[MT7]-SFDDYFLK[MT7].3b4_1.heavy 441.567 / 609.264 1129.0 39.06980037689209 34 8 10 6 10 1.0899779633617113 73.59969787981989 0.035602569580078125 3 0.799752781543225 2.710504649393259 1129.0 2.065909090909091 2.0 - - - - - - - 218.25 2 8 GRM1 glutamate receptor, metabotropic 1 2215 281 C20140710_OR014_02 C20140710_OR014_02 TB433537.[MT7]-SFDDYFLK[MT7].3b5_1.heavy 441.567 / 772.327 719.0 39.06980037689209 34 8 10 6 10 1.0899779633617113 73.59969787981989 0.035602569580078125 3 0.799752781543225 2.710504649393259 719.0 1.6340909090909088 2.0 - - - - - - - 308.0 3 3 GRM1 glutamate receptor, metabotropic 1 2217 281 C20140710_OR014_02 C20140710_OR014_02 TB433537.[MT7]-SFDDYFLK[MT7].3b3_1.heavy 441.567 / 494.237 1951.0 39.06980037689209 34 8 10 6 10 1.0899779633617113 73.59969787981989 0.035602569580078125 3 0.799752781543225 2.710504649393259 1951.0 9.150533383891048 0.0 - - - - - - - 322.7142857142857 3 7 GRM1 glutamate receptor, metabotropic 1 2219 282 C20140710_OR014_02 C20140710_OR014_02 TB433536.[MT7]-FMSIAEQMGR.2y8_1.heavy 657.327 / 891.435 1803.0 37.787750244140625 36 11 10 5 10 0.8559212848301769 67.475076643117 0.04290008544921875 3 0.8615770265031616 3.2780560356075763 1803.0 4.608 1.0 - - - - - - - 225.2 3 5 OPLAH 5-oxoprolinase (ATP-hydrolysing) 2221 282 C20140710_OR014_02 C20140710_OR014_02 TB433536.[MT7]-FMSIAEQMGR.2y9_1.heavy 657.327 / 1022.48 5860.0 37.787750244140625 36 11 10 5 10 0.8559212848301769 67.475076643117 0.04290008544921875 3 0.8615770265031616 3.2780560356075763 5860.0 64.69106142326021 0.0 - - - - - - - 187.88888888888889 11 9 OPLAH 5-oxoprolinase (ATP-hydrolysing) 2223 282 C20140710_OR014_02 C20140710_OR014_02 TB433536.[MT7]-FMSIAEQMGR.2y6_1.heavy 657.327 / 691.319 3719.0 37.787750244140625 36 11 10 5 10 0.8559212848301769 67.475076643117 0.04290008544921875 3 0.8615770265031616 3.2780560356075763 3719.0 18.259056009656383 0.0 - - - - - - - 257.57142857142856 7 7 OPLAH 5-oxoprolinase (ATP-hydrolysing) 2225 282 C20140710_OR014_02 C20140710_OR014_02 TB433536.[MT7]-FMSIAEQMGR.2y7_1.heavy 657.327 / 804.403 902.0 37.787750244140625 36 11 10 5 10 0.8559212848301769 67.475076643117 0.04290008544921875 3 0.8615770265031616 3.2780560356075763 902.0 5.369538987508218 2.0 - - - - - - - 183.25 3 8 OPLAH 5-oxoprolinase (ATP-hydrolysing) 2227 283 C20140710_OR014_02 C20140710_OR014_02 TB424702.[MT7]-ESTEQVR.2y4_1.heavy 496.76 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 2229 283 C20140710_OR014_02 C20140710_OR014_02 TB424702.[MT7]-ESTEQVR.2y5_1.heavy 496.76 / 632.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 2231 283 C20140710_OR014_02 C20140710_OR014_02 TB424702.[MT7]-ESTEQVR.2b4_1.heavy 496.76 / 591.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1 2233 283 C20140710_OR014_02 C20140710_OR014_02 TB424702.[MT7]-ESTEQVR.2y3_1.heavy 496.76 / 402.246 N/A N/A - - - - - - - - - 0.0 - - - - - - - OVCH1 ovochymase 1