Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140710_OR016_03 C20140710_OR016_03 TB423980.[MT7]-SDMDYLSNALEK[MT7].3y3_1.heavy 558.615 / 533.341 42856.0 36.902198791503906 44 14 10 10 10 2.1582378287130073 46.33409658083495 0.0 3 0.947296525602951 5.352006619718225 42856.0 55.630384615384614 0.0 - - - - - - - 772.5714285714286 85 7 S100A7L2 S100 calcium binding protein A7-like 2 3 1 C20140710_OR016_03 C20140710_OR016_03 TB423980.[MT7]-SDMDYLSNALEK[MT7].3b4_1.heavy 558.615 / 593.236 70179.0 36.902198791503906 44 14 10 10 10 2.1582378287130073 46.33409658083495 0.0 3 0.947296525602951 5.352006619718225 70179.0 71.76937436674564 0.0 - - - - - - - 304.8 140 5 S100A7L2 S100 calcium binding protein A7-like 2 5 1 C20140710_OR016_03 C20140710_OR016_03 TB423980.[MT7]-SDMDYLSNALEK[MT7].3b5_1.heavy 558.615 / 756.299 44382.0 36.902198791503906 44 14 10 10 10 2.1582378287130073 46.33409658083495 0.0 3 0.947296525602951 5.352006619718225 44382.0 348.1543165467626 0.0 - - - - - - - 231.33333333333334 88 3 S100A7L2 S100 calcium binding protein A7-like 2 7 1 C20140710_OR016_03 C20140710_OR016_03 TB423980.[MT7]-SDMDYLSNALEK[MT7].3y4_1.heavy 558.615 / 604.379 13869.0 36.902198791503906 44 14 10 10 10 2.1582378287130073 46.33409658083495 0.0 3 0.947296525602951 5.352006619718225 13869.0 17.813672891928174 1.0 - - - - - - - 263.4 28 10 S100A7L2 S100 calcium binding protein A7-like 2 9 2 C20140710_OR016_03 C20140710_OR016_03 TB432806.[MT7]-LTSELDK[MT7].2y5_1.heavy 547.321 / 735.401 8447.0 25.121700286865234 39 15 10 10 4 1.966905766077892 50.8412765495141 0.0 9 0.9574959673550597 5.964813922782015 8447.0 48.431289104638616 0.0 - - - - - - - 183.92857142857142 16 14 CDC42BPA CDC42 binding protein kinase alpha (DMPK-like) 11 2 C20140710_OR016_03 C20140710_OR016_03 TB432806.[MT7]-LTSELDK[MT7].2b6_2.heavy 547.321 / 402.217 515.0 25.121700286865234 39 15 10 10 4 1.966905766077892 50.8412765495141 0.0 9 0.9574959673550597 5.964813922782015 515.0 0.7428571428571428 33.0 - - - - - - - 298.7 2 10 CDC42BPA CDC42 binding protein kinase alpha (DMPK-like) 13 2 C20140710_OR016_03 C20140710_OR016_03 TB432806.[MT7]-LTSELDK[MT7].2y6_1.heavy 547.321 / 836.448 26578.0 25.121700286865234 39 15 10 10 4 1.966905766077892 50.8412765495141 0.0 9 0.9574959673550597 5.964813922782015 26578.0 84.37869902912621 0.0 - - - - - - - 229.76923076923077 53 13 CDC42BPA CDC42 binding protein kinase alpha (DMPK-like) 15 3 C20140710_OR016_03 C20140710_OR016_03 TB432767.[MT7]-FTALFR.2y4_1.heavy 449.767 / 506.309 2030.0 38.549899101257324 41 18 10 5 8 3.714479335949408 26.921673525595303 0.046001434326171875 4 0.9825842342645608 9.338105213493828 2030.0 8.05 0.0 - - - - - - - 386.6666666666667 4 3 IFNK interferon, kappa 17 3 C20140710_OR016_03 C20140710_OR016_03 TB432767.[MT7]-FTALFR.2b3_1.heavy 449.767 / 464.263 3335.0 38.549899101257324 41 18 10 5 8 3.714479335949408 26.921673525595303 0.046001434326171875 4 0.9825842342645608 9.338105213493828 3335.0 14.95 1.0 - - - - - - - 253.75 8 4 IFNK interferon, kappa 19 3 C20140710_OR016_03 C20140710_OR016_03 TB432767.[MT7]-FTALFR.2y5_1.heavy 449.767 / 607.356 4785.0 38.549899101257324 41 18 10 5 8 3.714479335949408 26.921673525595303 0.046001434326171875 4 0.9825842342645608 9.338105213493828 4785.0 27.5 0.0 - - - - - - - 435.0 9 1 IFNK interferon, kappa 21 3 C20140710_OR016_03 C20140710_OR016_03 TB432767.[MT7]-FTALFR.2b4_1.heavy 449.767 / 577.347 2465.0 38.549899101257324 41 18 10 5 8 3.714479335949408 26.921673525595303 0.046001434326171875 4 0.9825842342645608 9.338105213493828 2465.0 13.26 0.0 - - - - - - - 253.75 4 4 IFNK interferon, kappa 23 4 C20140710_OR016_03 C20140710_OR016_03 TB432946.[MT7]-ENRFLPC[CAM]EEK[MT7].3y3_1.heavy 537.28 / 549.3 2673.0 26.343599319458008 40 15 10 5 10 2.6794049971767424 37.321718853763734 0.04199981689453125 3 0.9545787496735743 5.768662284097076 2673.0 9.36610557999537 0.0 - - - - - - - 167.25 5 8 ADAM7 ADAM metallopeptidase domain 7 25 4 C20140710_OR016_03 C20140710_OR016_03 TB432946.[MT7]-ENRFLPC[CAM]EEK[MT7].3b3_1.heavy 537.28 / 544.296 822.0 26.343599319458008 40 15 10 5 10 2.6794049971767424 37.321718853763734 0.04199981689453125 3 0.9545787496735743 5.768662284097076 822.0 4.108701298701298 8.0 - - - - - - - 252.36363636363637 3 11 ADAM7 ADAM metallopeptidase domain 7 27 4 C20140710_OR016_03 C20140710_OR016_03 TB432946.[MT7]-ENRFLPC[CAM]EEK[MT7].3y4_1.heavy 537.28 / 709.331 2776.0 26.343599319458008 40 15 10 5 10 2.6794049971767424 37.321718853763734 0.04199981689453125 3 0.9545787496735743 5.768662284097076 2776.0 22.384791061346938 0.0 - - - - - - - 226.2 5 5 ADAM7 ADAM metallopeptidase domain 7 29 4 C20140710_OR016_03 C20140710_OR016_03 TB432946.[MT7]-ENRFLPC[CAM]EEK[MT7].3y5_1.heavy 537.28 / 806.383 2879.0 26.343599319458008 40 15 10 5 10 2.6794049971767424 37.321718853763734 0.04199981689453125 3 0.9545787496735743 5.768662284097076 2879.0 4.32614262560778 1.0 - - - - - - - 205.66666666666666 5 3 ADAM7 ADAM metallopeptidase domain 7 31 5 C20140710_OR016_03 C20140710_OR016_03 TB432808.[MT7]-VVEEARK[MT7].2y4_1.heavy 559.842 / 647.396 377.0 17.89419937133789 47 17 10 10 10 3.578950336919156 27.94115329526543 0.0 3 0.9727292451367661 7.456273960311929 377.0 5.355496228975355 4.0 - - - - - - - 0.0 1 0 LMLN leishmanolysin-like (metallopeptidase M8 family) 33 5 C20140710_OR016_03 C20140710_OR016_03 TB432808.[MT7]-VVEEARK[MT7].2y5_1.heavy 559.842 / 776.438 691.0 17.89419937133789 47 17 10 10 10 3.578950336919156 27.94115329526543 0.0 3 0.9727292451367661 7.456273960311929 691.0 6.215343915343915 0.0 - - - - - - - 0.0 1 0 LMLN leishmanolysin-like (metallopeptidase M8 family) 35 5 C20140710_OR016_03 C20140710_OR016_03 TB432808.[MT7]-VVEEARK[MT7].2y3_1.heavy 559.842 / 518.353 1006.0 17.89419937133789 47 17 10 10 10 3.578950336919156 27.94115329526543 0.0 3 0.9727292451367661 7.456273960311929 1006.0 5.804979868884251 1.0 - - - - - - - 153.88888888888889 2 9 LMLN leishmanolysin-like (metallopeptidase M8 family) 37 5 C20140710_OR016_03 C20140710_OR016_03 TB432808.[MT7]-VVEEARK[MT7].2y6_1.heavy 559.842 / 875.507 1194.0 17.89419937133789 47 17 10 10 10 3.578950336919156 27.94115329526543 0.0 3 0.9727292451367661 7.456273960311929 1194.0 10.802857142857142 0.0 - - - - - - - 118.88888888888889 2 9 LMLN leishmanolysin-like (metallopeptidase M8 family) 39 6 C20140710_OR016_03 C20140710_OR016_03 TB432940.[MT7]-LFPQAISYLEK[MT7].3b4_1.heavy 532.979 / 630.373 1738.0 43.143550872802734 34 8 10 6 10 1.7662756399496757 45.07648193486702 0.03929901123046875 3 0.762599186109938 2.481012520369629 1738.0 15.731896551724137 1.0 - - - - - - - 248.57142857142858 13 7 LMLN leishmanolysin-like (metallopeptidase M8 family) 41 6 C20140710_OR016_03 C20140710_OR016_03 TB432940.[MT7]-LFPQAISYLEK[MT7].3b5_1.heavy 532.979 / 701.41 8341.0 43.143550872802734 34 8 10 6 10 1.7662756399496757 45.07648193486702 0.03929901123046875 3 0.762599186109938 2.481012520369629 8341.0 67.59086206896552 0.0 - - - - - - - 318.75 16 4 LMLN leishmanolysin-like (metallopeptidase M8 family) 43 6 C20140710_OR016_03 C20140710_OR016_03 TB432940.[MT7]-LFPQAISYLEK[MT7].3y4_1.heavy 532.979 / 696.405 6835.0 43.143550872802734 34 8 10 6 10 1.7662756399496757 45.07648193486702 0.03929901123046875 3 0.762599186109938 2.481012520369629 6835.0 35.942672413793105 0.0 - - - - - - - 154.66666666666666 13 6 LMLN leishmanolysin-like (metallopeptidase M8 family) 45 6 C20140710_OR016_03 C20140710_OR016_03 TB432940.[MT7]-LFPQAISYLEK[MT7].3y5_1.heavy 532.979 / 783.437 17146.0 43.143550872802734 34 8 10 6 10 1.7662756399496757 45.07648193486702 0.03929901123046875 3 0.762599186109938 2.481012520369629 17146.0 288.2301724137931 0.0 - - - - - - - 232.0 34 3 LMLN leishmanolysin-like (metallopeptidase M8 family) 47 7 C20140710_OR016_03 C20140710_OR016_03 TB423985.[MT7]-AFATDSTDAEEDK[MT7].2b8_1.heavy 844.399 / 953.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 49 7 C20140710_OR016_03 C20140710_OR016_03 TB423985.[MT7]-AFATDSTDAEEDK[MT7].2y8_1.heavy 844.399 / 1038.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 51 7 C20140710_OR016_03 C20140710_OR016_03 TB423985.[MT7]-AFATDSTDAEEDK[MT7].2y5_1.heavy 844.399 / 735.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 53 7 C20140710_OR016_03 C20140710_OR016_03 TB423985.[MT7]-AFATDSTDAEEDK[MT7].2b5_1.heavy 844.399 / 650.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 55 8 C20140710_OR016_03 C20140710_OR016_03 TB432809.[MT7]-LQESLLK[MT7].2y4_1.heavy 559.855 / 604.415 18519.0 31.4419002532959 48 18 10 10 10 5.730964725129886 17.44906918751513 0.0 3 0.9820971364144057 9.209818151440498 18519.0 63.60128112594731 0.0 - - - - - - - 255.66666666666666 37 15 SAG S-antigen; retina and pineal gland (arrestin) 57 8 C20140710_OR016_03 C20140710_OR016_03 TB432809.[MT7]-LQESLLK[MT7].2y5_1.heavy 559.855 / 733.458 11748.0 31.4419002532959 48 18 10 10 10 5.730964725129886 17.44906918751513 0.0 3 0.9820971364144057 9.209818151440498 11748.0 79.07769702689947 0.0 - - - - - - - 292.1666666666667 23 12 SAG S-antigen; retina and pineal gland (arrestin) 59 8 C20140710_OR016_03 C20140710_OR016_03 TB432809.[MT7]-LQESLLK[MT7].2b4_1.heavy 559.855 / 602.327 6200.0 31.4419002532959 48 18 10 10 10 5.730964725129886 17.44906918751513 0.0 3 0.9820971364144057 9.209818151440498 6200.0 18.77953195288623 0.0 - - - - - - - 335.3333333333333 12 18 SAG S-antigen; retina and pineal gland (arrestin) 61 8 C20140710_OR016_03 C20140710_OR016_03 TB432809.[MT7]-LQESLLK[MT7].2y6_1.heavy 559.855 / 861.516 16643.0 31.4419002532959 48 18 10 10 10 5.730964725129886 17.44906918751513 0.0 3 0.9820971364144057 9.209818151440498 16643.0 37.96539546805698 0.0 - - - - - - - 192.9090909090909 33 11 SAG S-antigen; retina and pineal gland (arrestin) 63 9 C20140710_OR016_03 C20140710_OR016_03 TB432948.[MT7]-LRVC[CAM]VLSELQK[MT7].3y3_1.heavy 544.995 / 532.357 11531.0 35.2544002532959 38 13 10 5 10 1.7743377639183795 44.824292510156454 0.048000335693359375 3 0.9087573999273785 4.054195558200082 11531.0 39.61456451612903 0.0 - - - - - - - 283.42857142857144 23 7 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 65 9 C20140710_OR016_03 C20140710_OR016_03 TB432948.[MT7]-LRVC[CAM]VLSELQK[MT7].3b4_1.heavy 544.995 / 673.394 2728.0 35.2544002532959 38 13 10 5 10 1.7743377639183795 44.824292510156454 0.048000335693359375 3 0.9087573999273785 4.054195558200082 2728.0 3.6499999999999995 1.0 - - - - - - - 330.6666666666667 5 9 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 67 9 C20140710_OR016_03 C20140710_OR016_03 TB432948.[MT7]-LRVC[CAM]VLSELQK[MT7].3b5_1.heavy 544.995 / 772.462 4340.0 35.2544002532959 38 13 10 5 10 1.7743377639183795 44.824292510156454 0.048000335693359375 3 0.9087573999273785 4.054195558200082 4340.0 41.06666666666666 0.0 - - - - - - - 230.28571428571428 8 7 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 69 9 C20140710_OR016_03 C20140710_OR016_03 TB432948.[MT7]-LRVC[CAM]VLSELQK[MT7].3y5_1.heavy 544.995 / 748.432 9919.0 35.2544002532959 38 13 10 5 10 1.7743377639183795 44.824292510156454 0.048000335693359375 3 0.9087573999273785 4.054195558200082 9919.0 115.9883064516129 0.0 - - - - - - - 248.0 19 5 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 71 10 C20140710_OR016_03 C20140710_OR016_03 TB445097.[MT7]-WVGILEGLQSILHK[MT7].3y3_1.heavy 627.712 / 541.358 1424.0 52.799848556518555 41 15 10 6 10 2.7395682039658245 36.50210272379387 0.035900115966796875 3 0.9526862911600444 5.651210482810125 1424.0 29.718260869565214 0.0 - - - - - - - 112.9090909090909 2 11 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 73 10 C20140710_OR016_03 C20140710_OR016_03 TB445097.[MT7]-WVGILEGLQSILHK[MT7].3b4_1.heavy 627.712 / 600.363 1654.0 52.799848556518555 41 15 10 6 10 2.7395682039658245 36.50210272379387 0.035900115966796875 3 0.9526862911600444 5.651210482810125 1654.0 26.188333333333333 0.0 - - - - - - - 111.71428571428571 3 7 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 75 10 C20140710_OR016_03 C20140710_OR016_03 TB445097.[MT7]-WVGILEGLQSILHK[MT7].3b5_1.heavy 627.712 / 713.447 965.0 52.799848556518555 41 15 10 6 10 2.7395682039658245 36.50210272379387 0.035900115966796875 3 0.9526862911600444 5.651210482810125 965.0 13.111413043478262 1.0 - - - - - - - 133.8181818181818 3 11 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 77 10 C20140710_OR016_03 C20140710_OR016_03 TB445097.[MT7]-WVGILEGLQSILHK[MT7].3b7_1.heavy 627.712 / 899.511 1608.0 52.799848556518555 41 15 10 6 10 2.7395682039658245 36.50210272379387 0.035900115966796875 3 0.9526862911600444 5.651210482810125 1608.0 44.56956521739131 0.0 - - - - - - - 107.22222222222223 3 9 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 79 11 C20140710_OR016_03 C20140710_OR016_03 TB445095.[MT7]-FILGVEGQQLVRPK[MT7].3y6_1.heavy 624.715 / 884.58 11455.0 36.57389831542969 43 13 10 10 10 2.860323830645302 27.755914161120334 0.0 3 0.9001488915222629 3.8726135181000148 11455.0 63.792500000000004 0.0 - - - - - - - 248.57142857142858 22 7 ADAM7 ADAM metallopeptidase domain 7 81 11 C20140710_OR016_03 C20140710_OR016_03 TB445095.[MT7]-FILGVEGQQLVRPK[MT7].3b4_1.heavy 624.715 / 575.367 17835.0 36.57389831542969 43 13 10 10 10 2.860323830645302 27.755914161120334 0.0 3 0.9001488915222629 3.8726135181000148 17835.0 50.799 0.0 - - - - - - - 314.1666666666667 35 6 ADAM7 ADAM metallopeptidase domain 7 83 11 C20140710_OR016_03 C20140710_OR016_03 TB445095.[MT7]-FILGVEGQQLVRPK[MT7].3y8_1.heavy 624.715 / 1069.66 21750.0 36.57389831542969 43 13 10 10 10 2.860323830645302 27.755914161120334 0.0 3 0.9001488915222629 3.8726135181000148 21750.0 146.925 0.0 - - - - - - - 241.66666666666666 43 6 ADAM7 ADAM metallopeptidase domain 7 85 11 C20140710_OR016_03 C20140710_OR016_03 TB445095.[MT7]-FILGVEGQQLVRPK[MT7].3y9_1.heavy 624.715 / 1198.7 5655.0 36.57389831542969 43 13 10 10 10 2.860323830645302 27.755914161120334 0.0 3 0.9001488915222629 3.8726135181000148 5655.0 75.231 0.0 - - - - - - - 181.25 11 4 ADAM7 ADAM metallopeptidase domain 7 87 12 C20140710_OR016_03 C20140710_OR016_03 TB423988.[MT7]-TVPGDNESEEDSK[MT7].3y6_1.heavy 565.603 / 838.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM7 ADAM metallopeptidase domain 7 89 12 C20140710_OR016_03 C20140710_OR016_03 TB423988.[MT7]-TVPGDNESEEDSK[MT7].3b6_1.heavy 565.603 / 728.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM7 ADAM metallopeptidase domain 7 91 12 C20140710_OR016_03 C20140710_OR016_03 TB423988.[MT7]-TVPGDNESEEDSK[MT7].3b5_1.heavy 565.603 / 614.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM7 ADAM metallopeptidase domain 7 93 12 C20140710_OR016_03 C20140710_OR016_03 TB423988.[MT7]-TVPGDNESEEDSK[MT7].3y4_1.heavy 565.603 / 622.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM7 ADAM metallopeptidase domain 7 95 13 C20140710_OR016_03 C20140710_OR016_03 TB423832.[MT7]-VSAPNLLNVK[MT7].3b6_1.heavy 448.281 / 726.427 253.0 34.66120147705078 36 12 10 10 4 1.9262564816670127 38.28945137119163 0.0 8 0.8866224962490142 3.6300081281161654 253.0 1.4015873015873015 6.0 - - - - - - - 0.0 1 0 SDCCAG1 serologically defined colon cancer antigen 1 97 13 C20140710_OR016_03 C20140710_OR016_03 TB423832.[MT7]-VSAPNLLNVK[MT7].3y3_1.heavy 448.281 / 504.326 2403.0 34.66120147705078 36 12 10 10 4 1.9262564816670127 38.28945137119163 0.0 8 0.8866224962490142 3.6300081281161654 2403.0 26.856792772444948 0.0 - - - - - - - 238.55555555555554 4 9 SDCCAG1 serologically defined colon cancer antigen 1 99 13 C20140710_OR016_03 C20140710_OR016_03 TB423832.[MT7]-VSAPNLLNVK[MT7].3b5_1.heavy 448.281 / 613.343 1644.0 34.66120147705078 36 12 10 10 4 1.9262564816670127 38.28945137119163 0.0 8 0.8866224962490142 3.6300081281161654 1644.0 1.2996047430830036 1.0 - - - - - - - 126.0 4 2 SDCCAG1 serologically defined colon cancer antigen 1 101 13 C20140710_OR016_03 C20140710_OR016_03 TB423832.[MT7]-VSAPNLLNVK[MT7].3y4_1.heavy 448.281 / 617.41 506.0 34.66120147705078 36 12 10 10 4 1.9262564816670127 38.28945137119163 0.0 8 0.8866224962490142 3.6300081281161654 506.0 4.130223298358891 5.0 - - - - - - - 278.0 4 5 SDCCAG1 serologically defined colon cancer antigen 1 103 14 C20140710_OR016_03 C20140710_OR016_03 TB445192.[MT7]-QIQIGLDQQAEYLNQC[CAM]LEEDK[MT7]NENEDMK[MT7].4b8_1.heavy 957.716 / 1040.59 1661.0 40.371474266052246 45 20 10 5 10 6.897700408253902 14.49758529383769 0.046100616455078125 3 0.9957693119664078 18.96721801335107 1661.0 3.9048338708851684 0.0 - - - - - - - 227.0 3 9 IFNK interferon, kappa 105 14 C20140710_OR016_03 C20140710_OR016_03 TB445192.[MT7]-QIQIGLDQQAEYLNQC[CAM]LEEDK[MT7]NENEDMK[MT7].4b7_1.heavy 957.716 / 912.527 1788.0 40.371474266052246 45 20 10 5 10 6.897700408253902 14.49758529383769 0.046100616455078125 3 0.9957693119664078 18.96721801335107 1788.0 4.7150182685839646 1.0 - - - - - - - 271.25 3 8 IFNK interferon, kappa 107 14 C20140710_OR016_03 C20140710_OR016_03 TB445192.[MT7]-QIQIGLDQQAEYLNQC[CAM]LEEDK[MT7]NENEDMK[MT7].4b4_1.heavy 957.716 / 627.395 3704.0 40.371474266052246 45 20 10 5 10 6.897700408253902 14.49758529383769 0.046100616455078125 3 0.9957693119664078 18.96721801335107 3704.0 6.837864264811538 0.0 - - - - - - - 239.375 7 8 IFNK interferon, kappa 109 14 C20140710_OR016_03 C20140710_OR016_03 TB445192.[MT7]-QIQIGLDQQAEYLNQC[CAM]LEEDK[MT7]NENEDMK[MT7].4b5_1.heavy 957.716 / 684.416 3449.0 40.371474266052246 45 20 10 5 10 6.897700408253902 14.49758529383769 0.046100616455078125 3 0.9957693119664078 18.96721801335107 3449.0 16.050853533359653 0.0 - - - - - - - 287.125 6 8 IFNK interferon, kappa 111 15 C20140710_OR016_03 C20140710_OR016_03 TB423835.[MT7]-LEVTNILQK[MT7].3y3_1.heavy 449.281 / 532.357 1918.0 37.21055030822754 38 13 10 5 10 3.021811419980095 22.061822331423247 0.046497344970703125 2 0.92677910709868 4.532716939274587 1918.0 15.447675675675676 0.0 - - - - - - - 246.33333333333334 3 3 RPGRIP1 retinitis pigmentosa GTPase regulator interacting protein 1 113 15 C20140710_OR016_03 C20140710_OR016_03 TB423835.[MT7]-LEVTNILQK[MT7].3b6_1.heavy 449.281 / 814.479 N/A 37.21055030822754 38 13 10 5 10 3.021811419980095 22.061822331423247 0.046497344970703125 2 0.92677910709868 4.532716939274587 0.0 -0.0 0.0 - - - - - - - 0.0 0 0 RPGRIP1 retinitis pigmentosa GTPase regulator interacting protein 1 115 15 C20140710_OR016_03 C20140710_OR016_03 TB423835.[MT7]-LEVTNILQK[MT7].3b5_1.heavy 449.281 / 701.395 N/A 37.21055030822754 38 13 10 5 10 3.021811419980095 22.061822331423247 0.046497344970703125 2 0.92677910709868 4.532716939274587 885.0 11.95945945945946 0.0 - - - - - - - 0.0 1 0 RPGRIP1 retinitis pigmentosa GTPase regulator interacting protein 1 117 15 C20140710_OR016_03 C20140710_OR016_03 TB423835.[MT7]-LEVTNILQK[MT7].3b3_1.heavy 449.281 / 486.304 1180.0 37.21055030822754 38 13 10 5 10 3.021811419980095 22.061822331423247 0.046497344970703125 2 0.92677910709868 4.532716939274587 1180.0 9.013058995790372 0.0 - - - - - - - 240.0 2 8 RPGRIP1 retinitis pigmentosa GTPase regulator interacting protein 1 119 16 C20140710_OR016_03 C20140710_OR016_03 TB423991.[MT7]-TYEEELLYEIK[MT7].3b6_1.heavy 573.309 / 909.432 36156.0 41.89680099487305 43 17 10 6 10 3.9784581904230145 25.135365313306806 0.0395965576171875 3 0.9703236827155554 7.146237630978252 36156.0 328.4341193181818 0.0 - - - - - - - 205.0 72 5 ADAM7 ADAM metallopeptidase domain 7 121 16 C20140710_OR016_03 C20140710_OR016_03 TB423991.[MT7]-TYEEELLYEIK[MT7].3b4_1.heavy 573.309 / 667.305 22437.0 41.89680099487305 43 17 10 6 10 3.9784581904230145 25.135365313306806 0.0395965576171875 3 0.9703236827155554 7.146237630978252 22437.0 244.52824218749998 0.0 - - - - - - - 201.14285714285714 44 7 ADAM7 ADAM metallopeptidase domain 7 123 16 C20140710_OR016_03 C20140710_OR016_03 TB423991.[MT7]-TYEEELLYEIK[MT7].3b5_1.heavy 573.309 / 796.348 67311.0 41.89680099487305 43 17 10 6 10 3.9784581904230145 25.135365313306806 0.0395965576171875 3 0.9703236827155554 7.146237630978252 67311.0 658.6452376217533 0.0 - - - - - - - 243.5 134 10 ADAM7 ADAM metallopeptidase domain 7 125 16 C20140710_OR016_03 C20140710_OR016_03 TB423991.[MT7]-TYEEELLYEIK[MT7].3y4_1.heavy 573.309 / 696.405 41925.0 41.89680099487305 43 17 10 6 10 3.9784581904230145 25.135365313306806 0.0395965576171875 3 0.9703236827155554 7.146237630978252 41925.0 317.712890625 0.0 - - - - - - - 164.57142857142858 83 7 ADAM7 ADAM metallopeptidase domain 7 127 17 C20140710_OR016_03 C20140710_OR016_03 TB423996.[MT7]-ENFPNFLSGC[CAM]EK[MT7].4y5_1.heavy 433.217 / 724.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - S100A7L2 S100 calcium binding protein A7-like 2 129 17 C20140710_OR016_03 C20140710_OR016_03 TB423996.[MT7]-ENFPNFLSGC[CAM]EK[MT7].4b5_1.heavy 433.217 / 746.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - S100A7L2 S100 calcium binding protein A7-like 2 131 17 C20140710_OR016_03 C20140710_OR016_03 TB423996.[MT7]-ENFPNFLSGC[CAM]EK[MT7].4b6_1.heavy 433.217 / 893.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - S100A7L2 S100 calcium binding protein A7-like 2 133 17 C20140710_OR016_03 C20140710_OR016_03 TB423996.[MT7]-ENFPNFLSGC[CAM]EK[MT7].4b3_1.heavy 433.217 / 535.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - S100A7L2 S100 calcium binding protein A7-like 2 135 18 C20140710_OR016_03 C20140710_OR016_03 TB432939.[MT7]-LFPQAISYLEK[MT7].2y4_1.heavy 798.966 / 696.405 1855.0 43.12392616271973 40 17 10 3 10 3.8233528477367353 26.1550539493617 0.07849884033203125 3 0.978597836383794 8.420849439258802 1855.0 12.633189655172414 0.0 - - - - - - - 232.0 3 9 LMLN leishmanolysin-like (metallopeptidase M8 family) 137 18 C20140710_OR016_03 C20140710_OR016_03 TB432939.[MT7]-LFPQAISYLEK[MT7].2y5_1.heavy 798.966 / 783.437 2667.0 43.12392616271973 40 17 10 3 10 3.8233528477367353 26.1550539493617 0.07849884033203125 3 0.978597836383794 8.420849439258802 2667.0 6.897413793103448 0.0 - - - - - - - 217.5 5 8 LMLN leishmanolysin-like (metallopeptidase M8 family) 139 18 C20140710_OR016_03 C20140710_OR016_03 TB432939.[MT7]-LFPQAISYLEK[MT7].2y9_1.heavy 798.966 / 1192.67 2783.0 43.12392616271973 40 17 10 3 10 3.8233528477367353 26.1550539493617 0.07849884033203125 3 0.978597836383794 8.420849439258802 2783.0 2.399137931034483 1.0 - - - - - - - 322.22222222222223 5 9 LMLN leishmanolysin-like (metallopeptidase M8 family) 141 18 C20140710_OR016_03 C20140710_OR016_03 TB432939.[MT7]-LFPQAISYLEK[MT7].2y3_1.heavy 798.966 / 533.341 1276.0 43.12392616271973 40 17 10 3 10 3.8233528477367353 26.1550539493617 0.07849884033203125 3 0.978597836383794 8.420849439258802 1276.0 7.2875 1.0 - - - - - - - 281.7142857142857 2 7 LMLN leishmanolysin-like (metallopeptidase M8 family) 143 19 C20140710_OR016_03 C20140710_OR016_03 TB432937.[MT7]-LALQEFSELNER.2y4_1.heavy 796.924 / 531.289 1529.0 39.90370178222656 47 17 10 10 10 3.0783119099052803 25.839424554853597 0.0 3 0.973608896326597 7.58008040391768 1529.0 3.0066666666666664 1.0 - - - - - - - 312.75 3 4 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 145 19 C20140710_OR016_03 C20140710_OR016_03 TB432937.[MT7]-LALQEFSELNER.2b4_1.heavy 796.924 / 570.373 2503.0 39.90370178222656 47 17 10 10 10 3.0783119099052803 25.839424554853597 0.0 3 0.973608896326597 7.58008040391768 2503.0 14.285707434052757 0.0 - - - - - - - 243.25 5 4 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 147 19 C20140710_OR016_03 C20140710_OR016_03 TB432937.[MT7]-LALQEFSELNER.2y9_1.heavy 796.924 / 1151.53 3198.0 39.90370178222656 47 17 10 10 10 3.0783119099052803 25.839424554853597 0.0 3 0.973608896326597 7.58008040391768 3198.0 45.7843165467626 0.0 - - - - - - - 185.33333333333334 6 3 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 149 19 C20140710_OR016_03 C20140710_OR016_03 TB432937.[MT7]-LALQEFSELNER.2y7_1.heavy 796.924 / 894.432 3615.0 39.90370178222656 47 17 10 10 10 3.0783119099052803 25.839424554853597 0.0 3 0.973608896326597 7.58008040391768 3615.0 34.329496402877695 0.0 - - - - - - - 278.0 7 4 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 151 20 C20140710_OR016_03 C20140710_OR016_03 TB432938.[MT7]-DIHGFEFQWK[MT7].2y4_1.heavy 797.916 / 752.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF468 zinc finger protein 468 153 20 C20140710_OR016_03 C20140710_OR016_03 TB432938.[MT7]-DIHGFEFQWK[MT7].2y8_1.heavy 797.916 / 1222.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF468 zinc finger protein 468 155 20 C20140710_OR016_03 C20140710_OR016_03 TB432938.[MT7]-DIHGFEFQWK[MT7].2b4_1.heavy 797.916 / 567.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF468 zinc finger protein 468 157 20 C20140710_OR016_03 C20140710_OR016_03 TB432938.[MT7]-DIHGFEFQWK[MT7].2y7_1.heavy 797.916 / 1085.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF468 zinc finger protein 468 159 21 C20140710_OR016_03 C20140710_OR016_03 TB445083.[MT7]-RDTGHTHDDDILK[MT7].3y6_1.heavy 604.314 / 862.464 2585.0 19.230499267578125 47 17 10 10 10 3.9116009070405937 25.564980266777056 0.0 3 0.9777376354883829 8.255962554068551 2585.0 39.28519736842105 0.0 - - - - - - - 177.33333333333334 5 6 ADAM7 ADAM metallopeptidase domain 7 161 21 C20140710_OR016_03 C20140710_OR016_03 TB445083.[MT7]-RDTGHTHDDDILK[MT7].3b4_1.heavy 604.314 / 574.307 1064.0 19.230499267578125 47 17 10 10 10 3.9116009070405937 25.564980266777056 0.0 3 0.9777376354883829 8.255962554068551 1064.0 13.23 6.0 - - - - - - - 167.2 2 10 ADAM7 ADAM metallopeptidase domain 7 163 21 C20140710_OR016_03 C20140710_OR016_03 TB445083.[MT7]-RDTGHTHDDDILK[MT7].3b5_1.heavy 604.314 / 711.365 2433.0 19.230499267578125 47 17 10 10 10 3.9116009070405937 25.564980266777056 0.0 3 0.9777376354883829 8.255962554068551 2433.0 57.62368421052632 0.0 - - - - - - - 104.5 4 8 ADAM7 ADAM metallopeptidase domain 7 165 21 C20140710_OR016_03 C20140710_OR016_03 TB445083.[MT7]-RDTGHTHDDDILK[MT7].3y5_1.heavy 604.314 / 747.437 2433.0 19.230499267578125 47 17 10 10 10 3.9116009070405937 25.564980266777056 0.0 3 0.9777376354883829 8.255962554068551 2433.0 34.680921052631575 0.0 - - - - - - - 133.0 4 4 ADAM7 ADAM metallopeptidase domain 7 167 22 C20140710_OR016_03 C20140710_OR016_03 TB445086.[MT7]-ELDLMDLVGEDRK[MT7].4y5_1.heavy 455.997 / 748.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC24A3 solute carrier family 24 (sodium/potassium/calcium exchanger), member 3 169 22 C20140710_OR016_03 C20140710_OR016_03 TB445086.[MT7]-ELDLMDLVGEDRK[MT7].4b4_1.heavy 455.997 / 615.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC24A3 solute carrier family 24 (sodium/potassium/calcium exchanger), member 3 171 22 C20140710_OR016_03 C20140710_OR016_03 TB445086.[MT7]-ELDLMDLVGEDRK[MT7].4b6_1.heavy 455.997 / 861.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC24A3 solute carrier family 24 (sodium/potassium/calcium exchanger), member 3 173 22 C20140710_OR016_03 C20140710_OR016_03 TB445086.[MT7]-ELDLMDLVGEDRK[MT7].4b3_1.heavy 455.997 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC24A3 solute carrier family 24 (sodium/potassium/calcium exchanger), member 3 175 23 C20140710_OR016_03 C20140710_OR016_03 TB445085.[MT7]-LNLSPHGTFLGFVK[MT7].3b4_1.heavy 606.689 / 572.352 17013.0 40.60810089111328 45 15 10 10 10 2.2940217601219937 34.06864467785765 0.0 3 0.9504939675259182 5.523637106853974 17013.0 30.242114813045838 0.0 - - - - - - - 312.8333333333333 34 6 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 177 23 C20140710_OR016_03 C20140710_OR016_03 TB445085.[MT7]-LNLSPHGTFLGFVK[MT7].3y4_1.heavy 606.689 / 594.373 30507.0 40.60810089111328 45 15 10 10 10 2.2940217601219937 34.06864467785765 0.0 3 0.9504939675259182 5.523637106853974 30507.0 88.20016871225027 0.0 - - - - - - - 260.55555555555554 61 9 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 179 23 C20140710_OR016_03 C20140710_OR016_03 TB445085.[MT7]-LNLSPHGTFLGFVK[MT7].3y8_1.heavy 606.689 / 1012.59 8800.0 40.60810089111328 45 15 10 10 10 2.2940217601219937 34.06864467785765 0.0 3 0.9504939675259182 5.523637106853974 8800.0 105.52318603382432 0.0 - - - - - - - 201.14285714285714 17 7 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 181 23 C20140710_OR016_03 C20140710_OR016_03 TB445085.[MT7]-LNLSPHGTFLGFVK[MT7].3y5_1.heavy 606.689 / 707.457 10443.0 40.60810089111328 45 15 10 10 10 2.2940217601219937 34.06864467785765 0.0 3 0.9504939675259182 5.523637106853974 10443.0 104.90897392215962 0.0 - - - - - - - 164.0 20 5 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 183 24 C20140710_OR016_03 C20140710_OR016_03 TB423823.[MT7]-EVVETFANK[MT7].2y5_1.heavy 662.871 / 724.411 3629.0 29.06309938430786 47 20 10 7 10 8.849004874876817 11.300705719341359 0.028799057006835938 3 0.9965192212649425 20.91212215789089 3629.0 18.184523992568387 0.0 - - - - - - - 173.69230769230768 7 13 RGPD1;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 185 24 C20140710_OR016_03 C20140710_OR016_03 TB423823.[MT7]-EVVETFANK[MT7].2b4_1.heavy 662.871 / 601.331 3951.0 29.06309938430786 47 20 10 7 10 8.849004874876817 11.300705719341359 0.028799057006835938 3 0.9965192212649425 20.91212215789089 3951.0 27.613037596196264 0.0 - - - - - - - 260.94117647058823 7 17 RGPD1;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 187 24 C20140710_OR016_03 C20140710_OR016_03 TB423823.[MT7]-EVVETFANK[MT7].2y6_1.heavy 662.871 / 853.454 2903.0 29.06309938430786 47 20 10 7 10 8.849004874876817 11.300705719341359 0.028799057006835938 3 0.9965192212649425 20.91212215789089 2903.0 7.597107438016528 1.0 - - - - - - - 116.66666666666667 5 9 RGPD1;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 189 24 C20140710_OR016_03 C20140710_OR016_03 TB423823.[MT7]-EVVETFANK[MT7].2y7_1.heavy 662.871 / 952.522 3548.0 29.06309938430786 47 20 10 7 10 8.849004874876817 11.300705719341359 0.028799057006835938 3 0.9965192212649425 20.91212215789089 3548.0 9.462809917355372 0.0 - - - - - - - 194.91666666666666 7 12 RGPD1;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 191 25 C20140710_OR016_03 C20140710_OR016_03 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 102167.0 30.079465866088867 24 -3 10 7 10 null 0.0 0.027099609375 3 0.0 0.0 102167.0 1719.8448962804005 0.0 - - - - - - - 179.5 204 16 193 25 C20140710_OR016_03 C20140710_OR016_03 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 36538.0 30.079465866088867 24 -3 10 7 10 null 0.0 0.027099609375 3 0.0 0.0 36538.0 222.76393548387097 0.0 - - - - - - - 196.53333333333333 73 15 195 25 C20140710_OR016_03 C20140710_OR016_03 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 41736.0 30.079465866088867 24 -3 10 7 10 null 0.0 0.027099609375 3 0.0 0.0 41736.0 296.1909677419355 0.0 - - - - - - - 729.2 83 10 197 26 C20140710_OR016_03 C20140710_OR016_03 TB445088.[MT7]-NLELLSEIEQLIK[MT7].3b7_1.heavy 610.699 / 943.522 213.0 53.99044895172119 34 18 2 6 8 4.703689220251945 21.259907982322794 0.031803131103515625 4 0.9886394894440721 11.567817687101845 213.0 8.752201257861635 0.0 - - - - - - - 0.0 0 0 CDC42BPA CDC42 binding protein kinase alpha (DMPK-like) 199 26 C20140710_OR016_03 C20140710_OR016_03 TB445088.[MT7]-NLELLSEIEQLIK[MT7].3b4_1.heavy 610.699 / 614.363 400.0 53.99044895172119 34 18 2 6 8 4.703689220251945 21.259907982322794 0.031803131103515625 4 0.9886394894440721 11.567817687101845 400.0 6.7924528301886795 1.0 - - - - - - - 81.6875 2 16 CDC42BPA CDC42 binding protein kinase alpha (DMPK-like) 201 26 C20140710_OR016_03 C20140710_OR016_03 TB445088.[MT7]-NLELLSEIEQLIK[MT7].3b5_1.heavy 610.699 / 727.447 160.0 53.99044895172119 34 18 2 6 8 4.703689220251945 21.259907982322794 0.031803131103515625 4 0.9886394894440721 11.567817687101845 160.0 3.5555555555555554 7.0 - - - - - - - 0.0 0 0 CDC42BPA CDC42 binding protein kinase alpha (DMPK-like) 203 26 C20140710_OR016_03 C20140710_OR016_03 TB445088.[MT7]-NLELLSEIEQLIK[MT7].3b3_1.heavy 610.699 / 501.279 400.0 53.99044895172119 34 18 2 6 8 4.703689220251945 21.259907982322794 0.031803131103515625 4 0.9886394894440721 11.567817687101845 400.0 -0.5 1.0 - - - - - - - 0.0 0 0 CDC42BPA CDC42 binding protein kinase alpha (DMPK-like) 205 27 C20140710_OR016_03 C20140710_OR016_03 TB445185.[MT7]-LPDFQDSIFEYFNTAPLAHDLTFR.4y4_1.heavy 751.127 / 536.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 207 27 C20140710_OR016_03 C20140710_OR016_03 TB445185.[MT7]-LPDFQDSIFEYFNTAPLAHDLTFR.4y9_1.heavy 751.127 / 1069.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 209 27 C20140710_OR016_03 C20140710_OR016_03 TB445185.[MT7]-LPDFQDSIFEYFNTAPLAHDLTFR.4b4_1.heavy 751.127 / 617.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 211 27 C20140710_OR016_03 C20140710_OR016_03 TB445185.[MT7]-LPDFQDSIFEYFNTAPLAHDLTFR.4b6_1.heavy 751.127 / 860.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 213 28 C20140710_OR016_03 C20140710_OR016_03 TB423826.[MT7]-SVEELLPEK[MT7].2y4_1.heavy 666.387 / 630.394 3034.0 33.89074897766113 36 14 9 5 8 1.3191852912908364 49.41299553510424 0.040699005126953125 4 0.9376793348622549 4.917729631133742 3034.0 8.442848664688427 2.0 - - - - - - - 287.22222222222223 6 9 LMLN leishmanolysin-like (metallopeptidase M8 family) 215 28 C20140710_OR016_03 C20140710_OR016_03 TB423826.[MT7]-SVEELLPEK[MT7].2b4_1.heavy 666.387 / 589.295 5170.0 33.89074897766113 36 14 9 5 8 1.3191852912908364 49.41299553510424 0.040699005126953125 4 0.9376793348622549 4.917729631133742 5170.0 1.8804281003885186 1.0 - - - - - - - 318.5 10 6 LMLN leishmanolysin-like (metallopeptidase M8 family) 217 28 C20140710_OR016_03 C20140710_OR016_03 TB423826.[MT7]-SVEELLPEK[MT7].2y3_1.heavy 666.387 / 517.31 7980.0 33.89074897766113 36 14 9 5 8 1.3191852912908364 49.41299553510424 0.040699005126953125 4 0.9376793348622549 4.917729631133742 7980.0 9.939771283354512 3.0 - - - - - - - 296.27272727272725 17 11 LMLN leishmanolysin-like (metallopeptidase M8 family) 219 28 C20140710_OR016_03 C20140710_OR016_03 TB423826.[MT7]-SVEELLPEK[MT7].2b5_1.heavy 666.387 / 702.379 6631.0 33.89074897766113 36 14 9 5 8 1.3191852912908364 49.41299553510424 0.040699005126953125 4 0.9376793348622549 4.917729631133742 6631.0 2.089873988335668 1.0 - - - - - - - 134.6 13 5 LMLN leishmanolysin-like (metallopeptidase M8 family) 221 29 C20140710_OR016_03 C20140710_OR016_03 TB423962.[MT7]-HAMTVHPTDLNVR.4y5_1.heavy 409.469 / 616.341 695.0 24.556100845336914 37 9 10 10 8 0.7012252740375775 74.59758427907353 0.0 4 0.8080597743251637 2.770604757014376 695.0 4.891791170618192 5.0 - - - - - - - 347.5 5 2 ZNF654 zinc finger protein 654 223 29 C20140710_OR016_03 C20140710_OR016_03 TB423962.[MT7]-HAMTVHPTDLNVR.4y4_1.heavy 409.469 / 501.314 2681.0 24.556100845336914 37 9 10 10 8 0.7012252740375775 74.59758427907353 0.0 4 0.8080597743251637 2.770604757014376 2681.0 17.815504281973247 0.0 - - - - - - - 318.0 5 5 ZNF654 zinc finger protein 654 225 29 C20140710_OR016_03 C20140710_OR016_03 TB423962.[MT7]-HAMTVHPTDLNVR.4y7_1.heavy 409.469 / 814.442 794.0 24.556100845336914 37 9 10 10 8 0.7012252740375775 74.59758427907353 0.0 4 0.8080597743251637 2.770604757014376 794.0 10.444025489797301 0.0 - - - - - - - 0.0 1 0 ZNF654 zinc finger protein 654 227 29 C20140710_OR016_03 C20140710_OR016_03 TB423962.[MT7]-HAMTVHPTDLNVR.4y6_1.heavy 409.469 / 717.389 894.0 24.556100845336914 37 9 10 10 8 0.7012252740375775 74.59758427907353 0.0 4 0.8080597743251637 2.770604757014376 894.0 13.252990711131416 2.0 - - - - - - - 173.75 2 8 ZNF654 zinc finger protein 654 229 30 C20140710_OR016_03 C20140710_OR016_03 TB423961.[MT7]-HAMTVHPTDLNVR.3y7_1.heavy 545.623 / 814.442 6803.0 24.556100845336914 36 14 2 10 10 1.3189462464603658 58.543762634436376 0.0 3 0.9374926903569616 4.910303894880008 6803.0 36.214636666666664 0.0 - - - - - - - 100.0 13 3 ZNF654 zinc finger protein 654 231 30 C20140710_OR016_03 C20140710_OR016_03 TB423961.[MT7]-HAMTVHPTDLNVR.3y6_1.heavy 545.623 / 717.389 1401.0 24.556100845336914 36 14 2 10 10 1.3189462464603658 58.543762634436376 0.0 3 0.9374926903569616 4.910303894880008 1401.0 -0.3999999999999999 3.0 - - - - - - - 225.0 2 8 ZNF654 zinc finger protein 654 233 30 C20140710_OR016_03 C20140710_OR016_03 TB423961.[MT7]-HAMTVHPTDLNVR.3y4_1.heavy 545.623 / 501.314 N/A 24.556100845336914 36 14 2 10 10 1.3189462464603658 58.543762634436376 0.0 3 0.9374926903569616 4.910303894880008 4502.0 2.9417213796468253 4.0 - - - - - - - 288.8888888888889 27 9 ZNF654 zinc finger protein 654 235 30 C20140710_OR016_03 C20140710_OR016_03 TB423961.[MT7]-HAMTVHPTDLNVR.3y5_1.heavy 545.623 / 616.341 2901.0 24.556100845336914 36 14 2 10 10 1.3189462464603658 58.543762634436376 0.0 3 0.9374926903569616 4.910303894880008 2901.0 5.180357142857142 0.0 - - - - - - - 285.7142857142857 5 7 ZNF654 zinc finger protein 654 237 31 C20140710_OR016_03 C20140710_OR016_03 TB432920.[MT7]-ASRPVQEQGGAK[MT7].2y9_1.heavy 758.428 / 1057.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 239 31 C20140710_OR016_03 C20140710_OR016_03 TB432920.[MT7]-ASRPVQEQGGAK[MT7].2y6_1.heavy 758.428 / 733.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 241 31 C20140710_OR016_03 C20140710_OR016_03 TB432920.[MT7]-ASRPVQEQGGAK[MT7].2b7_1.heavy 758.428 / 912.502 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 243 31 C20140710_OR016_03 C20140710_OR016_03 TB432920.[MT7]-ASRPVQEQGGAK[MT7].2y7_1.heavy 758.428 / 861.455 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 245 32 C20140710_OR016_03 C20140710_OR016_03 TB432827.[MT7]-RDVDEHLR.2y4_1.heavy 592.319 / 554.305 N/A 16.88316599527995 36 20 0 6 10 11.037845317764761 9.05973920825434 0.03459930419921875 3 0.9982083355414021 29.152054461095677 2028.0 7.91219172612893 1.0 - - - - - - - 618.5714285714286 23 7 LMLN leishmanolysin-like (metallopeptidase M8 family) 247 32 C20140710_OR016_03 C20140710_OR016_03 TB432827.[MT7]-RDVDEHLR.2b5_1.heavy 592.319 / 759.375 493.0 16.88316599527995 36 20 0 6 10 11.037845317764761 9.05973920825434 0.03459930419921875 3 0.9982083355414021 29.152054461095677 493.0 5.746550435865505 0.0 - - - - - - - 0.0 0 0 LMLN leishmanolysin-like (metallopeptidase M8 family) 249 32 C20140710_OR016_03 C20140710_OR016_03 TB432827.[MT7]-RDVDEHLR.2b4_1.heavy 592.319 / 630.333 1261.0 16.88316599527995 36 20 0 6 10 11.037845317764761 9.05973920825434 0.03459930419921875 3 0.9982083355414021 29.152054461095677 1261.0 21.761017849730177 0.0 - - - - - - - 125.42857142857143 2 7 LMLN leishmanolysin-like (metallopeptidase M8 family) 251 32 C20140710_OR016_03 C20140710_OR016_03 TB432827.[MT7]-RDVDEHLR.2y7_1.heavy 592.319 / 883.427 329.0 16.88316599527995 36 20 0 6 10 11.037845317764761 9.05973920825434 0.03459930419921875 3 0.9982083355414021 29.152054461095677 329.0 5.503272727272727 4.0 - - - - - - - 0.0 0 0 LMLN leishmanolysin-like (metallopeptidase M8 family) 253 33 C20140710_OR016_03 C20140710_OR016_03 TB432828.[MT7]-IIATLHIK[MT7].2y5_1.heavy 598.902 / 755.49 3334.0 33.08907508850098 33 20 2 3 8 5.708556095633053 17.517564568822976 0.077301025390625 4 0.9903787531267949 12.571811776064992 3334.0 2.640792079207921 0.0 - - - - - - - 202.0 6 10 SLC30A10 solute carrier family 30, member 10 255 33 C20140710_OR016_03 C20140710_OR016_03 TB432828.[MT7]-IIATLHIK[MT7].2y3_1.heavy 598.902 / 541.358 4749.0 33.08907508850098 33 20 2 3 8 5.708556095633053 17.517564568822976 0.077301025390625 4 0.9903787531267949 12.571811776064992 4749.0 20.68871287128713 0.0 - - - - - - - 631.25 9 8 SLC30A10 solute carrier family 30, member 10 257 33 C20140710_OR016_03 C20140710_OR016_03 TB432828.[MT7]-IIATLHIK[MT7].2y6_1.heavy 598.902 / 826.527 3233.0 33.08907508850098 33 20 2 3 8 5.708556095633053 17.517564568822976 0.077301025390625 4 0.9903787531267949 12.571811776064992 3233.0 11.695045968882603 1.0 - - - - - - - 271.9230769230769 28 13 SLC30A10 solute carrier family 30, member 10 259 33 C20140710_OR016_03 C20140710_OR016_03 TB432828.[MT7]-IIATLHIK[MT7].2y7_1.heavy 598.902 / 939.611 4244.0 33.08907508850098 33 20 2 3 8 5.708556095633053 17.517564568822976 0.077301025390625 4 0.9903787531267949 12.571811776064992 4244.0 24.31145685997171 1.0 - - - - - - - 210.41666666666666 11 12 SLC30A10 solute carrier family 30, member 10 261 34 C20140710_OR016_03 C20140710_OR016_03 TB432789.[MT7]-ALQQEK[MT7].2y4_1.heavy 502.803 / 676.375 1060.0 17.93589973449707 46 16 10 10 10 1.8696832555187175 37.53560026582979 0.0 3 0.963454102253944 6.435932196631011 1060.0 8.242151980753809 1.0 - - - - - - - 99.6 2 5 SDCCAG1 serologically defined colon cancer antigen 1 263 34 C20140710_OR016_03 C20140710_OR016_03 TB432789.[MT7]-ALQQEK[MT7].2y5_1.heavy 502.803 / 789.459 1372.0 17.93589973449707 46 16 10 10 10 1.8696832555187175 37.53560026582979 0.0 3 0.963454102253944 6.435932196631011 1372.0 14.271048096385544 0.0 - - - - - - - 162.0 2 5 SDCCAG1 serologically defined colon cancer antigen 1 265 34 C20140710_OR016_03 C20140710_OR016_03 TB432789.[MT7]-ALQQEK[MT7].2b4_1.heavy 502.803 / 585.348 748.0 17.93589973449707 46 16 10 10 10 1.8696832555187175 37.53560026582979 0.0 3 0.963454102253944 6.435932196631011 748.0 6.7072 0.0 - - - - - - - 0.0 1 0 SDCCAG1 serologically defined colon cancer antigen 1 267 34 C20140710_OR016_03 C20140710_OR016_03 TB432789.[MT7]-ALQQEK[MT7].2y3_1.heavy 502.803 / 548.316 1434.0 17.93589973449707 46 16 10 10 10 1.8696832555187175 37.53560026582979 0.0 3 0.963454102253944 6.435932196631011 1434.0 9.899382771728625 0.0 - - - - - - - 149.6 2 10 SDCCAG1 serologically defined colon cancer antigen 1 269 35 C20140710_OR016_03 C20140710_OR016_03 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 18943.0 16.356332778930664 23 -3 10 6 10 null 0.0 0.03610038757324219 3 0.0 0.0 18943.0 39.422993306169964 0.0 - - - - - - - 257.6 37 10 271 35 C20140710_OR016_03 C20140710_OR016_03 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 27636.0 16.356332778930664 23 -3 10 6 10 null 0.0 0.03610038757324219 3 0.0 0.0 27636.0 375.5284364604125 0.0 - - - - - - - 100.875 55 8 273 35 C20140710_OR016_03 C20140710_OR016_03 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 18567.0 16.356332778930664 23 -3 10 6 10 null 0.0 0.03610038757324219 3 0.0 0.0 18567.0 99.17240011555684 0.0 - - - - - - - 198.07692307692307 37 13 275 36 C20140710_OR016_03 C20140710_OR016_03 TB432824.[MT7]-DAHQQRK[MT7].2y4_1.heavy 585.833 / 703.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 277 36 C20140710_OR016_03 C20140710_OR016_03 TB432824.[MT7]-DAHQQRK[MT7].2y5_1.heavy 585.833 / 840.492 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 279 36 C20140710_OR016_03 C20140710_OR016_03 TB432824.[MT7]-DAHQQRK[MT7].2b4_1.heavy 585.833 / 596.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 281 36 C20140710_OR016_03 C20140710_OR016_03 TB432824.[MT7]-DAHQQRK[MT7].2y6_1.heavy 585.833 / 911.529 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 283 37 C20140710_OR016_03 C20140710_OR016_03 TB432826.[MT7]-VQVSLYGK[MT7].2y4_1.heavy 591.36 / 624.384 2330.0 29.83139991760254 31 16 0 7 8 2.597180286703841 30.795306885268303 0.02700042724609375 4 0.9642569350435807 6.50825152327534 2330.0 6.1122271081115285 4.0 - - - - - - - 234.76923076923077 122 13 PTCH2 patched 2 285 37 C20140710_OR016_03 C20140710_OR016_03 TB432826.[MT7]-VQVSLYGK[MT7].2y5_1.heavy 591.36 / 711.416 5061.0 29.83139991760254 31 16 0 7 8 2.597180286703841 30.795306885268303 0.02700042724609375 4 0.9642569350435807 6.50825152327534 5061.0 11.813084112149532 1.0 - - - - - - - 261.125 10 16 PTCH2 patched 2 287 37 C20140710_OR016_03 C20140710_OR016_03 TB432826.[MT7]-VQVSLYGK[MT7].2y3_1.heavy 591.36 / 511.3 5061.0 29.83139991760254 31 16 0 7 8 2.597180286703841 30.795306885268303 0.02700042724609375 4 0.9642569350435807 6.50825152327534 5061.0 18.534867477558826 1.0 - - - - - - - 716.3333333333334 40 12 PTCH2 patched 2 289 37 C20140710_OR016_03 C20140710_OR016_03 TB432826.[MT7]-VQVSLYGK[MT7].2y6_1.heavy 591.36 / 810.484 3053.0 29.83139991760254 31 16 0 7 8 2.597180286703841 30.795306885268303 0.02700042724609375 4 0.9642569350435807 6.50825152327534 3053.0 7.139391862713806 0.0 - - - - - - - 733.125 6 8 PTCH2 patched 2 291 38 C20140710_OR016_03 C20140710_OR016_03 TB432820.[MT7]-GFFSLTAK[MT7].2y5_1.heavy 579.842 / 663.416 2804.0 37.6860237121582 41 18 10 5 8 4.249505543842316 18.808817155487077 0.0475006103515625 4 0.9851539933751152 10.116232018550864 2804.0 0.4610418165928366 4.0 - - - - - - - 258.375 5 8 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 293 38 C20140710_OR016_03 C20140710_OR016_03 TB432820.[MT7]-GFFSLTAK[MT7].2b4_1.heavy 579.842 / 583.3 1623.0 37.6860237121582 41 18 10 5 8 4.249505543842316 18.808817155487077 0.0475006103515625 4 0.9851539933751152 10.116232018550864 1623.0 4.3748367391782015 4.0 - - - - - - - 653.4285714285714 4 7 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 295 38 C20140710_OR016_03 C20140710_OR016_03 TB432820.[MT7]-GFFSLTAK[MT7].2y6_1.heavy 579.842 / 810.484 1771.0 37.6860237121582 41 18 10 5 8 4.249505543842316 18.808817155487077 0.0475006103515625 4 0.9851539933751152 10.116232018550864 1771.0 3.0383927642888167 1.0 - - - - - - - 295.2 3 5 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 297 38 C20140710_OR016_03 C20140710_OR016_03 TB432820.[MT7]-GFFSLTAK[MT7].2y7_1.heavy 579.842 / 957.553 738.0 37.6860237121582 41 18 10 5 8 4.249505543842316 18.808817155487077 0.0475006103515625 4 0.9851539933751152 10.116232018550864 738.0 0.30947622367078287 12.0 - - - - - - - 337.57142857142856 3 7 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 299 39 C20140710_OR016_03 C20140710_OR016_03 TB432821.[MT7]-TLDPLWK[MT7].2y4_1.heavy 580.849 / 687.431 15179.0 36.655999183654785 36 18 9 5 4 3.1351774842545295 23.525524188604507 0.046398162841796875 7 0.9858135985028361 10.349312070419524 15179.0 56.670361256544496 0.0 - - - - - - - 307.0 30 7 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 301 39 C20140710_OR016_03 C20140710_OR016_03 TB432821.[MT7]-TLDPLWK[MT7].2y3_1.heavy 580.849 / 590.378 1002.0 36.655999183654785 36 18 9 5 4 3.1351774842545295 23.525524188604507 0.046398162841796875 7 0.9858135985028361 10.349312070419524 1002.0 1.0854693560899922 21.0 - - - - - - - 310.1666666666667 36 6 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 303 39 C20140710_OR016_03 C20140710_OR016_03 TB432821.[MT7]-TLDPLWK[MT7].2y6_1.heavy 580.849 / 915.542 1289.0 36.655999183654785 36 18 9 5 4 3.1351774842545295 23.525524188604507 0.046398162841796875 7 0.9858135985028361 10.349312070419524 1289.0 7.0246202634574715 4.0 - - - - - - - 358.0 6 4 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 305 39 C20140710_OR016_03 C20140710_OR016_03 TB432821.[MT7]-TLDPLWK[MT7].2b5_1.heavy 580.849 / 684.405 2291.0 36.655999183654785 36 18 9 5 4 3.1351774842545295 23.525524188604507 0.046398162841796875 7 0.9858135985028361 10.349312070419524 2291.0 5.724806564880709 1.0 - - - - - - - 262.5 16 6 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 307 40 C20140710_OR016_03 C20140710_OR016_03 TB423710.[MT7]-YPLILK[MT7].2y4_1.heavy 517.846 / 630.467 2043.0 35.99769973754883 48 20 10 10 8 6.119333515592269 16.341648930426267 0.0 4 0.9979911977998672 27.53094091115127 2043.0 2.913921762355371 0.0 - - - - - - - 204.4 4 5 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 309 40 C20140710_OR016_03 C20140710_OR016_03 TB423710.[MT7]-YPLILK[MT7].2y5_1.heavy 517.846 / 727.52 18680.0 35.99769973754883 48 20 10 10 8 6.119333515592269 16.341648930426267 0.0 4 0.9979911977998672 27.53094091115127 18680.0 125.32232876712328 0.0 - - - - - - - 262.8 37 5 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 311 40 C20140710_OR016_03 C20140710_OR016_03 TB423710.[MT7]-YPLILK[MT7].2b4_1.heavy 517.846 / 631.394 1313.0 35.99769973754883 48 20 10 10 8 6.119333515592269 16.341648930426267 0.0 4 0.9979911977998672 27.53094091115127 1313.0 2.251819509535604 3.0 - - - - - - - 328.5 3 4 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 313 41 C20140710_OR016_03 C20140710_OR016_03 TB423712.[MT7]-GLNLSGGQR.2y8_1.heavy 523.297 / 844.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 315 41 C20140710_OR016_03 C20140710_OR016_03 TB423712.[MT7]-GLNLSGGQR.2y5_1.heavy 523.297 / 504.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 317 41 C20140710_OR016_03 C20140710_OR016_03 TB423712.[MT7]-GLNLSGGQR.2b7_1.heavy 523.297 / 743.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 319 41 C20140710_OR016_03 C20140710_OR016_03 TB423712.[MT7]-GLNLSGGQR.2y7_1.heavy 523.297 / 731.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 321 42 C20140710_OR016_03 C20140710_OR016_03 TB423819.[MT7]-LTEIVASAPK[MT7].3b4_1.heavy 439.606 / 601.368 10805.0 32.08505058288574 35 17 9 3 6 3.627568258424502 20.851828408332768 0.07210159301757812 5 0.9717132552925932 7.320517819692179 10805.0 223.1467391304348 0.0 - - - - - - - 171.42857142857142 21 7 SDCCAG1 serologically defined colon cancer antigen 1 323 42 C20140710_OR016_03 C20140710_OR016_03 TB423819.[MT7]-LTEIVASAPK[MT7].3b5_1.heavy 439.606 / 700.436 2401.0 32.08505058288574 35 17 9 3 6 3.627568258424502 20.851828408332768 0.07210159301757812 5 0.9717132552925932 7.320517819692179 2401.0 20.34794204312616 2.0 - - - - - - - 231.0 24 4 SDCCAG1 serologically defined colon cancer antigen 1 325 42 C20140710_OR016_03 C20140710_OR016_03 TB423819.[MT7]-LTEIVASAPK[MT7].3y4_1.heavy 439.606 / 546.337 2032.0 32.08505058288574 35 17 9 3 6 3.627568258424502 20.851828408332768 0.07210159301757812 5 0.9717132552925932 7.320517819692179 2032.0 16.05120750018311 0.0 - - - - - - - 209.8181818181818 4 11 SDCCAG1 serologically defined colon cancer antigen 1 327 42 C20140710_OR016_03 C20140710_OR016_03 TB423819.[MT7]-LTEIVASAPK[MT7].3b3_1.heavy 439.606 / 488.284 8958.0 32.08505058288574 35 17 9 3 6 3.627568258424502 20.851828408332768 0.07210159301757812 5 0.9717132552925932 7.320517819692179 8958.0 128.3172972972973 0.0 - - - - - - - 193.1818181818182 17 11 SDCCAG1 serologically defined colon cancer antigen 1 329 43 C20140710_OR016_03 C20140710_OR016_03 TB423718.[MT7]-GFFFFSR.2y4_1.heavy 526.278 / 556.288 1352.0 44.68565082550049 33 8 10 5 10 2.494712051861419 32.06426850539275 0.041797637939453125 3 0.7859431082344572 2.6183486087007406 1352.0 6.378666666666667 1.0 - - - - - - - 260.0 2 6 MMP27 matrix metallopeptidase 27 331 43 C20140710_OR016_03 C20140710_OR016_03 TB423718.[MT7]-GFFFFSR.2y5_1.heavy 526.278 / 703.356 1352.0 44.68565082550049 33 8 10 5 10 2.494712051861419 32.06426850539275 0.041797637939453125 3 0.7859431082344572 2.6183486087007406 1352.0 9.1 0.0 - - - - - - - 156.0 2 4 MMP27 matrix metallopeptidase 27 333 43 C20140710_OR016_03 C20140710_OR016_03 TB423718.[MT7]-GFFFFSR.2b4_1.heavy 526.278 / 643.336 208.0 44.68565082550049 33 8 10 5 10 2.494712051861419 32.06426850539275 0.041797637939453125 3 0.7859431082344572 2.6183486087007406 208.0 2.2 3.0 - - - - - - - 0.0 0 0 MMP27 matrix metallopeptidase 27 335 43 C20140710_OR016_03 C20140710_OR016_03 TB423718.[MT7]-GFFFFSR.2y6_1.heavy 526.278 / 850.425 1872.0 44.68565082550049 33 8 10 5 10 2.494712051861419 32.06426850539275 0.041797637939453125 3 0.7859431082344572 2.6183486087007406 1872.0 35.982 0.0 - - - - - - - 173.33333333333334 3 3 MMP27 matrix metallopeptidase 27 337 44 C20140710_OR016_03 C20140710_OR016_03 TB445079.[MT7]-VQVYPPVGAASTPTK[MT7].3b4_1.heavy 601.68 / 634.368 39091.0 30.00029945373535 45 18 10 7 10 6.532005265607315 15.309234443904337 0.02719879150390625 3 0.9872091738828899 10.900566468000765 39091.0 140.40182317343172 0.0 - - - - - - - 300.6666666666667 78 3 SAG S-antigen; retina and pineal gland (arrestin) 339 44 C20140710_OR016_03 C20140710_OR016_03 TB445079.[MT7]-VQVYPPVGAASTPTK[MT7].3y4_1.heavy 601.68 / 590.363 8847.0 30.00029945373535 45 18 10 7 10 6.532005265607315 15.309234443904337 0.02719879150390625 3 0.9872091738828899 10.900566468000765 8847.0 16.405875630522306 0.0 - - - - - - - 346.0 17 6 SAG S-antigen; retina and pineal gland (arrestin) 341 44 C20140710_OR016_03 C20140710_OR016_03 TB445079.[MT7]-VQVYPPVGAASTPTK[MT7].3y8_1.heavy 601.68 / 876.491 5688.0 30.00029945373535 45 18 10 7 10 6.532005265607315 15.309234443904337 0.02719879150390625 3 0.9872091738828899 10.900566468000765 5688.0 19.340036900369004 0.0 - - - - - - - 271.0 11 5 SAG S-antigen; retina and pineal gland (arrestin) 343 44 C20140710_OR016_03 C20140710_OR016_03 TB445079.[MT7]-VQVYPPVGAASTPTK[MT7].3y5_1.heavy 601.68 / 677.395 10472.0 30.00029945373535 45 18 10 7 10 6.532005265607315 15.309234443904337 0.02719879150390625 3 0.9872091738828899 10.900566468000765 10472.0 4.206107224221836 1.0 - - - - - - - 271.0 20 4 SAG S-antigen; retina and pineal gland (arrestin) 345 45 C20140710_OR016_03 C20140710_OR016_03 TB423815.[MT7]-SVELNPTQK[MT7].2y4_1.heavy 652.377 / 617.374 3264.0 24.733400344848633 38 9 9 10 10 7.597291480876638 13.162585673027404 0.0 3 0.809985631146217 2.7850907735633528 3264.0 29.595897435897434 3.0 - - - - - - - 170.0 10 6 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 347 45 C20140710_OR016_03 C20140710_OR016_03 TB423815.[MT7]-SVELNPTQK[MT7].2y5_1.heavy 652.377 / 731.417 4489.0 24.733400344848633 38 9 9 10 10 7.597291480876638 13.162585673027404 0.0 3 0.809985631146217 2.7850907735633528 4489.0 9.902205882352941 0.0 - - - - - - - 244.8 8 5 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 349 45 C20140710_OR016_03 C20140710_OR016_03 TB423815.[MT7]-SVELNPTQK[MT7].2b4_1.heavy 652.377 / 573.336 3774.0 24.733400344848633 38 9 9 10 10 7.597291480876638 13.162585673027404 0.0 3 0.809985631146217 2.7850907735633528 3774.0 48.593333333333334 0.0 - - - - - - - 204.0 7 2 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 351 45 C20140710_OR016_03 C20140710_OR016_03 TB423815.[MT7]-SVELNPTQK[MT7].2b5_1.heavy 652.377 / 687.379 4285.0 24.733400344848633 38 9 9 10 10 7.597291480876638 13.162585673027404 0.0 3 0.809985631146217 2.7850907735633528 4285.0 33.58683823529412 0.0 - - - - - - - 163.2 8 5 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 353 46 C20140710_OR016_03 C20140710_OR016_03 TB432783.[MT7]-HEWFEAILK[MT7].3y3_1.heavy 487.61 / 517.383 1278.0 39.82990074157715 39 16 10 5 8 4.733742530763553 21.12493430940149 0.049198150634765625 4 0.962733643295937 6.3730287339636345 1278.0 8.46 1.0 - - - - - - - 284.0 2 6 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 355 46 C20140710_OR016_03 C20140710_OR016_03 TB432783.[MT7]-HEWFEAILK[MT7].3b4_1.heavy 487.61 / 744.359 852.0 39.82990074157715 39 16 10 5 8 4.733742530763553 21.12493430940149 0.049198150634765625 4 0.962733643295937 6.3730287339636345 852.0 2.6799999999999997 2.0 - - - - - - - 236.66666666666666 2 3 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 357 46 C20140710_OR016_03 C20140710_OR016_03 TB432783.[MT7]-HEWFEAILK[MT7].3b5_1.heavy 487.61 / 873.401 568.0 39.82990074157715 39 16 10 5 8 4.733742530763553 21.12493430940149 0.049198150634765625 4 0.962733643295937 6.3730287339636345 568.0 3.8 2.0 - - - - - - - 0.0 1 0 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 359 46 C20140710_OR016_03 C20140710_OR016_03 TB432783.[MT7]-HEWFEAILK[MT7].3b3_1.heavy 487.61 / 597.29 1703.0 39.82990074157715 39 16 10 5 8 4.733742530763553 21.12493430940149 0.049198150634765625 4 0.962733643295937 6.3730287339636345 1703.0 17.629647887323944 0.0 - - - - - - - 284.0 3 4 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 361 47 C20140710_OR016_03 C20140710_OR016_03 TB423968.[MT7]-Y[MT7]VASVLGLTPSPR.3y7_1.heavy 549.994 / 727.41 5576.0 34.74392509460449 28 15 2 5 6 2.2894823856401243 34.42544201465314 0.04669952392578125 6 0.9545600493830022 5.767466008174876 5576.0 0.9945346628679961 3.0 - - - - - - - 322.4 22 10 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 363 47 C20140710_OR016_03 C20140710_OR016_03 TB423968.[MT7]-Y[MT7]VASVLGLTPSPR.3y4_1.heavy 549.994 / 456.257 6691.0 34.74392509460449 28 15 2 5 6 2.2894823856401243 34.42544201465314 0.04669952392578125 6 0.9545600493830022 5.767466008174876 6691.0 6.43355285726804 1.0 - - - - - - - 221.42857142857142 13 14 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 365 47 C20140710_OR016_03 C20140710_OR016_03 TB423968.[MT7]-Y[MT7]VASVLGLTPSPR.3y8_1.heavy 549.994 / 840.494 2726.0 34.74392509460449 28 15 2 5 6 2.2894823856401243 34.42544201465314 0.04669952392578125 6 0.9545600493830022 5.767466008174876 2726.0 5.497209768543831 1.0 - - - - - - - 279.0 32 4 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 367 47 C20140710_OR016_03 C20140710_OR016_03 TB423968.[MT7]-Y[MT7]VASVLGLTPSPR.3y5_1.heavy 549.994 / 557.304 3717.0 34.74392509460449 28 15 2 5 6 2.2894823856401243 34.42544201465314 0.04669952392578125 6 0.9545600493830022 5.767466008174876 3717.0 8.204845085470085 1.0 - - - - - - - 333.84615384615387 7 13 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 369 48 C20140710_OR016_03 C20140710_OR016_03 TB445076.[MT7]-HAFFEGLNWENIR.3y6_1.heavy 592.969 / 831.411 15952.0 41.30839920043945 43 18 10 5 10 3.7253354943881214 21.481271711077078 0.040802001953125 3 0.9873532708494996 10.962623416592193 15952.0 189.50229983720587 0.0 - - - - - - - 232.77777777777777 31 9 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 371 48 C20140710_OR016_03 C20140710_OR016_03 TB445076.[MT7]-HAFFEGLNWENIR.3y4_1.heavy 592.969 / 531.289 19678.0 41.30839920043945 43 18 10 5 10 3.7253354943881214 21.481271711077078 0.040802001953125 3 0.9873532708494996 10.962623416592193 19678.0 55.02524026435661 0.0 - - - - - - - 297.44444444444446 39 9 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 373 48 C20140710_OR016_03 C20140710_OR016_03 TB445076.[MT7]-HAFFEGLNWENIR.3b3_1.heavy 592.969 / 500.274 20610.0 41.30839920043945 43 18 10 5 10 3.7253354943881214 21.481271711077078 0.040802001953125 3 0.9873532708494996 10.962623416592193 20610.0 64.41391518997341 0.0 - - - - - - - 320.125 41 8 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 375 48 C20140710_OR016_03 C20140710_OR016_03 TB445076.[MT7]-HAFFEGLNWENIR.3y5_1.heavy 592.969 / 717.368 14206.0 41.30839920043945 43 18 10 5 10 3.7253354943881214 21.481271711077078 0.040802001953125 3 0.9873532708494996 10.962623416592193 14206.0 135.4208951684616 0.0 - - - - - - - 213.33333333333334 28 12 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 377 49 C20140710_OR016_03 C20140710_OR016_03 TB423965.[MT7]-TITPDVGLHQSLTSDPTVAVLR.3y7_1.heavy 822.122 / 755.477 18703.0 37.0 46 16 10 10 10 1.8741715583702006 42.20931478624261 0.0 3 0.9620831616337798 6.317778781768204 18703.0 140.90327204541904 0.0 - - - - - - - 340.6666666666667 37 6 CEMP1 cementum protein 1 379 49 C20140710_OR016_03 C20140710_OR016_03 TB423965.[MT7]-TITPDVGLHQSLTSDPTVAVLR.3b5_1.heavy 822.122 / 672.369 3799.0 37.0 46 16 10 10 10 1.8741715583702006 42.20931478624261 0.0 3 0.9620831616337798 6.317778781768204 3799.0 27.056386447538557 0.0 - - - - - - - 219.0 7 4 CEMP1 cementum protein 1 381 49 C20140710_OR016_03 C20140710_OR016_03 TB423965.[MT7]-TITPDVGLHQSLTSDPTVAVLR.3b7_1.heavy 822.122 / 828.458 6867.0 37.0 46 16 10 10 10 1.8741715583702006 42.20931478624261 0.0 3 0.9620831616337798 6.317778781768204 6867.0 37.62739726027397 0.0 - - - - - - - 208.57142857142858 13 7 CEMP1 cementum protein 1 383 49 C20140710_OR016_03 C20140710_OR016_03 TB423965.[MT7]-TITPDVGLHQSLTSDPTVAVLR.3y10_1.heavy 822.122 / 1058.58 9059.0 37.0 46 16 10 10 10 1.8741715583702006 42.20931478624261 0.0 3 0.9620831616337798 6.317778781768204 9059.0 49.638356164383566 0.0 - - - - - - - 250.28571428571428 18 7 CEMP1 cementum protein 1 385 50 C20140710_OR016_03 C20140710_OR016_03 TB423813.[MT7]-ERYPLDHAR.2y8_2.heavy 650.848 / 514.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 387 50 C20140710_OR016_03 C20140710_OR016_03 TB423813.[MT7]-ERYPLDHAR.2b6_1.heavy 650.848 / 918.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 389 50 C20140710_OR016_03 C20140710_OR016_03 TB423813.[MT7]-ERYPLDHAR.2y6_1.heavy 650.848 / 708.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 391 50 C20140710_OR016_03 C20140710_OR016_03 TB423813.[MT7]-ERYPLDHAR.2y7_1.heavy 650.848 / 871.442 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 393 51 C20140710_OR016_03 C20140710_OR016_03 TB444891.[MT7]-LYYEAK[MT7].2b3_1.heavy 537.807 / 584.32 1499.0 27.019399642944336 50 20 10 10 10 8.631853177035953 11.584997792367279 0.0 3 0.9978791739689695 26.793722924841013 1499.0 1.4699048656206082 1.0 - - - - - - - 281.14285714285717 4 7 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 395 51 C20140710_OR016_03 C20140710_OR016_03 TB444891.[MT7]-LYYEAK[MT7].2y4_1.heavy 537.807 / 654.358 6373.0 27.019399642944336 50 20 10 10 10 8.631853177035953 11.584997792367279 0.0 3 0.9978791739689695 26.793722924841013 6373.0 50.30830295900178 0.0 - - - - - - - 187.3 12 10 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 397 51 C20140710_OR016_03 C20140710_OR016_03 TB444891.[MT7]-LYYEAK[MT7].2y5_1.heavy 537.807 / 817.421 9465.0 27.019399642944336 50 20 10 10 10 8.631853177035953 11.584997792367279 0.0 3 0.9978791739689695 26.793722924841013 9465.0 77.89122024092717 0.0 - - - - - - - 177.0 18 9 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 399 51 C20140710_OR016_03 C20140710_OR016_03 TB444891.[MT7]-LYYEAK[MT7].2b4_1.heavy 537.807 / 713.363 2811.0 27.019399642944336 50 20 10 10 10 8.631853177035953 11.584997792367279 0.0 3 0.9978791739689695 26.793722924841013 2811.0 30.81972425531915 0.0 - - - - - - - 208.33333333333334 5 9 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 401 52 C20140710_OR016_03 C20140710_OR016_03 TB423973.[MT7]-NSIPEPIDPLFK[MT7].3y3_1.heavy 553.318 / 551.367 2639.0 40.1254997253418 41 18 10 5 8 3.7287696983108263 26.818497276809858 0.048797607421875 4 0.9803002477883225 8.778421728793202 2639.0 6.638393595041322 2.0 - - - - - - - 231.0 6 4 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 403 52 C20140710_OR016_03 C20140710_OR016_03 TB423973.[MT7]-NSIPEPIDPLFK[MT7].3b5_1.heavy 553.318 / 685.364 7390.0 40.1254997253418 41 18 10 5 8 3.7287696983108263 26.818497276809858 0.048797607421875 4 0.9803002477883225 8.778421728793202 7390.0 66.34204545454546 0.0 - - - - - - - 220.0 14 6 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 405 52 C20140710_OR016_03 C20140710_OR016_03 TB423973.[MT7]-NSIPEPIDPLFK[MT7].3y4_1.heavy 553.318 / 648.42 10557.0 40.1254997253418 41 18 10 5 8 3.7287696983108263 26.818497276809858 0.048797607421875 4 0.9803002477883225 8.778421728793202 10557.0 46.58676136363637 0.0 - - - - - - - 214.5 21 8 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 407 52 C20140710_OR016_03 C20140710_OR016_03 TB423973.[MT7]-NSIPEPIDPLFK[MT7].3y5_1.heavy 553.318 / 763.447 2375.0 40.1254997253418 41 18 10 5 8 3.7287696983108263 26.818497276809858 0.048797607421875 4 0.9803002477883225 8.778421728793202 2375.0 12.174873737373737 0.0 - - - - - - - 264.0 4 7 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 409 53 C20140710_OR016_03 C20140710_OR016_03 TB444893.[MT7]-QLVEASER.2y5_1.heavy 538.297 / 591.273 1445.0 21.49790048599243 46 20 10 6 10 6.995841948214052 14.294205149321407 0.03479957580566406 3 0.9937387216923461 15.588488319313853 1445.0 11.46716227177423 0.0 - - - - - - - 214.5 2 8 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 411 53 C20140710_OR016_03 C20140710_OR016_03 TB444893.[MT7]-QLVEASER.2b4_1.heavy 538.297 / 614.363 1355.0 21.49790048599243 46 20 10 6 10 6.995841948214052 14.294205149321407 0.03479957580566406 3 0.9937387216923461 15.588488319313853 1355.0 7.490335317794341 1.0 - - - - - - - 258.0 2 7 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 413 53 C20140710_OR016_03 C20140710_OR016_03 TB444893.[MT7]-QLVEASER.2y6_1.heavy 538.297 / 690.342 1625.0 21.49790048599243 46 20 10 6 10 6.995841948214052 14.294205149321407 0.03479957580566406 3 0.9937387216923461 15.588488319313853 1625.0 16.9682320441989 0.0 - - - - - - - 210.83333333333334 3 6 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 415 53 C20140710_OR016_03 C20140710_OR016_03 TB444893.[MT7]-QLVEASER.2y7_1.heavy 538.297 / 803.426 3522.0 21.49790048599243 46 20 10 6 10 6.995841948214052 14.294205149321407 0.03479957580566406 3 0.9937387216923461 15.588488319313853 3522.0 25.226391727374956 0.0 - - - - - - - 219.28571428571428 7 14 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 417 54 C20140710_OR016_03 C20140710_OR016_03 TB432917.[MT7]-DLLPDTNIIANR.3y6_1.heavy 500.283 / 700.41 1164.0 36.93506622314453 43 18 10 5 10 6.250064122147759 15.999835848985853 0.0493011474609375 3 0.9898629761541857 12.247278137701413 1164.0 9.838958026394156 0.0 - - - - - - - 146.0 2 4 ADAM7 ADAM metallopeptidase domain 7 419 54 C20140710_OR016_03 C20140710_OR016_03 TB432917.[MT7]-DLLPDTNIIANR.3y5_1.heavy 500.283 / 586.367 2474.0 36.93506622314453 43 18 10 5 10 6.250064122147759 15.999835848985853 0.0493011474609375 3 0.9898629761541857 12.247278137701413 2474.0 10.360228832951943 0.0 - - - - - - - 315.5 4 6 ADAM7 ADAM metallopeptidase domain 7 421 54 C20140710_OR016_03 C20140710_OR016_03 TB432917.[MT7]-DLLPDTNIIANR.3b7_1.heavy 500.283 / 913.475 N/A 36.93506622314453 43 18 10 5 10 6.250064122147759 15.999835848985853 0.0493011474609375 3 0.9898629761541857 12.247278137701413 146.0 0.6020126193390866 5.0 - - - - - - - 291.5 2 2 ADAM7 ADAM metallopeptidase domain 7 423 54 C20140710_OR016_03 C20140710_OR016_03 TB432917.[MT7]-DLLPDTNIIANR.3b5_1.heavy 500.283 / 698.384 1746.0 36.93506622314453 43 18 10 5 10 6.250064122147759 15.999835848985853 0.0493011474609375 3 0.9898629761541857 12.247278137701413 1746.0 8.790796338672768 0.0 - - - - - - - 255.0 3 4 ADAM7 ADAM metallopeptidase domain 7 425 55 C20140710_OR016_03 C20140710_OR016_03 TB432918.[MT7]-DLLPDTNIIANR.2y8_1.heavy 749.921 / 916.485 1889.0 36.951499938964844 47 17 10 10 10 3.8934614798576397 25.68408613192608 0.0 3 0.9731125135839169 7.509471002061954 1889.0 19.258443417466523 0.0 - - - - - - - 261.6 3 5 ADAM7 ADAM metallopeptidase domain 7 427 55 C20140710_OR016_03 C20140710_OR016_03 TB432918.[MT7]-DLLPDTNIIANR.2y9_1.heavy 749.921 / 1013.54 36188.0 36.951499938964844 47 17 10 10 10 3.8934614798576397 25.68408613192608 0.0 3 0.9731125135839169 7.509471002061954 36188.0 139.2657142857143 0.0 - - - - - - - 315.0 72 6 ADAM7 ADAM metallopeptidase domain 7 429 55 C20140710_OR016_03 C20140710_OR016_03 TB432918.[MT7]-DLLPDTNIIANR.2y10_1.heavy 749.921 / 1126.62 2907.0 36.951499938964844 47 17 10 10 10 3.8934614798576397 25.68408613192608 0.0 3 0.9731125135839169 7.509471002061954 2907.0 10.853912386110629 0.0 - - - - - - - 332.14285714285717 5 7 ADAM7 ADAM metallopeptidase domain 7 431 55 C20140710_OR016_03 C20140710_OR016_03 TB432918.[MT7]-DLLPDTNIIANR.2y7_1.heavy 749.921 / 801.458 6395.0 36.951499938964844 47 17 10 10 10 3.8934614798576397 25.68408613192608 0.0 3 0.9731125135839169 7.509471002061954 6395.0 35.00082553043917 0.0 - - - - - - - 290.75 12 4 ADAM7 ADAM metallopeptidase domain 7 433 56 C20140710_OR016_03 C20140710_OR016_03 TB432915.[MT7]-GYFDTFLLTK[MT7].3y3_1.heavy 498.281 / 505.347 11206.0 43.867801666259766 43 13 10 10 10 1.580193342545176 49.740746399977226 0.0 3 0.9066020579985264 4.006398240186112 11206.0 152.5544090909091 0.0 - - - - - - - 256.5 22 6 LOC100510144;LOC100510200;LILRA6 leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 435 56 C20140710_OR016_03 C20140710_OR016_03 TB432915.[MT7]-GYFDTFLLTK[MT7].3b4_1.heavy 498.281 / 627.289 6812.0 43.867801666259766 43 13 10 10 10 1.580193342545176 49.740746399977226 0.0 3 0.9066020579985264 4.006398240186112 6812.0 61.92727272727273 0.0 - - - - - - - 220.0 13 3 LOC100510144;LOC100510200;LILRA6 leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 437 56 C20140710_OR016_03 C20140710_OR016_03 TB432915.[MT7]-GYFDTFLLTK[MT7].3b5_1.heavy 498.281 / 728.337 4175.0 43.867801666259766 43 13 10 10 10 1.580193342545176 49.740746399977226 0.0 3 0.9066020579985264 4.006398240186112 4175.0 43.015151515151516 0.0 - - - - - - - 329.6666666666667 8 3 LOC100510144;LOC100510200;LILRA6 leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 439 56 C20140710_OR016_03 C20140710_OR016_03 TB432915.[MT7]-GYFDTFLLTK[MT7].3b3_1.heavy 498.281 / 512.263 3406.0 43.867801666259766 43 13 10 10 10 1.580193342545176 49.740746399977226 0.0 3 0.9066020579985264 4.006398240186112 3406.0 25.080545454545454 0.0 - - - - - - - 183.33333333333334 6 3 LOC100510144;LOC100510200;LILRA6 leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 441 57 C20140710_OR016_03 C20140710_OR016_03 TB432812.[MT7]-TTSNFSGK[MT7].2y4_1.heavy 565.308 / 582.337 766.0 19.500800609588623 35 14 10 3 8 1.136816227378743 52.84193638628682 0.0746002197265625 4 0.9358713474119525 4.847163171291239 766.0 6.61294964028777 1.0 - - - - - - - 0.0 1 0 SDCCAG1 serologically defined colon cancer antigen 1 443 57 C20140710_OR016_03 C20140710_OR016_03 TB432812.[MT7]-TTSNFSGK[MT7].2y5_1.heavy 565.308 / 696.38 696.0 19.500800609588623 35 14 10 3 8 1.136816227378743 52.84193638628682 0.0746002197265625 4 0.9358713474119525 4.847163171291239 696.0 2.664114832535885 1.0 - - - - - - - 0.0 1 0 SDCCAG1 serologically defined colon cancer antigen 1 445 57 C20140710_OR016_03 C20140710_OR016_03 TB432812.[MT7]-TTSNFSGK[MT7].2y6_1.heavy 565.308 / 783.412 1462.0 19.500800609588623 35 14 10 3 8 1.136816227378743 52.84193638628682 0.0746002197265625 4 0.9358713474119525 4.847163171291239 1462.0 24.393315105946687 0.0 - - - - - - - 160.69230769230768 2 13 SDCCAG1 serologically defined colon cancer antigen 1 447 57 C20140710_OR016_03 C20140710_OR016_03 TB432812.[MT7]-TTSNFSGK[MT7].2y7_1.heavy 565.308 / 884.459 1601.0 19.500800609588623 35 14 10 3 8 1.136816227378743 52.84193638628682 0.0746002197265625 4 0.9358713474119525 4.847163171291239 1601.0 17.852877697841727 0.0 - - - - - - - 149.14285714285714 3 7 SDCCAG1 serologically defined colon cancer antigen 1 449 58 C20140710_OR016_03 C20140710_OR016_03 TB432813.[MT7]-LLLELNK[MT7].2y4_1.heavy 565.873 / 647.385 15196.0 38.02320098876953 45 15 10 10 10 3.886845756790679 20.597759809169755 0.0 3 0.9571950759061029 5.943661115251486 15196.0 74.21060273972603 0.0 - - - - - - - 310.25 30 8 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 451 58 C20140710_OR016_03 C20140710_OR016_03 TB432813.[MT7]-LLLELNK[MT7].2y5_1.heavy 565.873 / 760.469 11251.0 38.02320098876953 45 15 10 10 10 3.886845756790679 20.597759809169755 0.0 3 0.9571950759061029 5.943661115251486 11251.0 42.89374160112506 0.0 - - - - - - - 208.57142857142858 22 7 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 453 58 C20140710_OR016_03 C20140710_OR016_03 TB432813.[MT7]-LLLELNK[MT7].2y3_1.heavy 565.873 / 518.342 12858.0 38.02320098876953 45 15 10 10 10 3.886845756790679 20.597759809169755 0.0 3 0.9571950759061029 5.943661115251486 12858.0 32.228290583698225 0.0 - - - - - - - 292.0 25 7 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 455 58 C20140710_OR016_03 C20140710_OR016_03 TB432813.[MT7]-LLLELNK[MT7].2y6_1.heavy 565.873 / 873.553 8328.0 38.02320098876953 45 15 10 10 10 3.886845756790679 20.597759809169755 0.0 3 0.9571950759061029 5.943661115251486 8328.0 25.522349428652817 1.0 - - - - - - - 262.8 22 5 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 457 59 C20140710_OR016_03 C20140710_OR016_03 TB432916.[MT7]-SINNASSVSTSQR.3y7_1.heavy 498.926 / 764.39 803.0 19.44445037841797 36 12 10 6 8 1.7407095766368859 44.968591912586234 0.03820037841796875 4 0.8991773018879343 3.853584902813262 803.0 8.189800995024875 2.0 - - - - - - - 180.3846153846154 3 13 ZNF28;ZNF468 zinc finger protein 28;zinc finger protein 468 459 59 C20140710_OR016_03 C20140710_OR016_03 TB432916.[MT7]-SINNASSVSTSQR.3b4_1.heavy 498.926 / 573.311 1741.0 19.44445037841797 36 12 10 6 8 1.7407095766368859 44.968591912586234 0.03820037841796875 4 0.8991773018879343 3.853584902813262 1741.0 8.336878109452735 0.0 - - - - - - - 171.6875 3 16 ZNF28;ZNF468 zinc finger protein 28;zinc finger protein 468 461 59 C20140710_OR016_03 C20140710_OR016_03 TB432916.[MT7]-SINNASSVSTSQR.3y8_1.heavy 498.926 / 851.422 603.0 19.44445037841797 36 12 10 6 8 1.7407095766368859 44.968591912586234 0.03820037841796875 4 0.8991773018879343 3.853584902813262 603.0 6.8100000000000005 1.0 - - - - - - - 0.0 1 0 ZNF28;ZNF468 zinc finger protein 28;zinc finger protein 468 463 59 C20140710_OR016_03 C20140710_OR016_03 TB432916.[MT7]-SINNASSVSTSQR.3y5_1.heavy 498.926 / 578.289 3884.0 19.44445037841797 36 12 10 6 8 1.7407095766368859 44.968591912586234 0.03820037841796875 4 0.8991773018879343 3.853584902813262 3884.0 61.83482587064677 0.0 - - - - - - - 227.8 7 10 ZNF28;ZNF468 zinc finger protein 28;zinc finger protein 468 465 60 C20140710_OR016_03 C20140710_OR016_03 TB432919.[MT7]-FIDWFC[CAM]GFK[MT7].3b4_1.heavy 503.26 / 706.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC5A3 solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 467 60 C20140710_OR016_03 C20140710_OR016_03 TB432919.[MT7]-FIDWFC[CAM]GFK[MT7].3b5_1.heavy 503.26 / 853.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC5A3 solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 469 60 C20140710_OR016_03 C20140710_OR016_03 TB432919.[MT7]-FIDWFC[CAM]GFK[MT7].3y4_1.heavy 503.26 / 655.335 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC5A3 solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 471 60 C20140710_OR016_03 C20140710_OR016_03 TB432919.[MT7]-FIDWFC[CAM]GFK[MT7].3b3_1.heavy 503.26 / 520.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC5A3 solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 473 61 C20140710_OR016_03 C20140710_OR016_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 162661.0 19.114599227905273 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 162661.0 1374.3877619473549 0.0 - - - - - - - 184.92857142857142 325 14 475 61 C20140710_OR016_03 C20140710_OR016_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 91851.0 19.114599227905273 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 91851.0 1688.308857142857 0.0 - - - - - - - 126.0 183 10 477 61 C20140710_OR016_03 C20140710_OR016_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 105761.0 19.114599227905273 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 105761.0 536.5199214989261 0.0 - - - - - - - 221.41666666666666 211 12 479 62 C20140710_OR016_03 C20140710_OR016_03 TB423702.[MT7]-GFYFAK[MT7].2y4_1.heavy 510.791 / 672.384 3535.0 33.3308744430542 40 16 10 6 8 3.510737729167753 28.484041735497502 0.039501190185546875 4 0.9662352152785411 6.697315423195468 3535.0 16.967416657410787 0.0 - - - - - - - 224.7 7 10 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 481 62 C20140710_OR016_03 C20140710_OR016_03 TB423702.[MT7]-GFYFAK[MT7].2y5_1.heavy 510.791 / 819.452 2785.0 33.3308744430542 40 16 10 6 8 3.510737729167753 28.484041735497502 0.039501190185546875 4 0.9662352152785411 6.697315423195468 2785.0 25.490836362674983 1.0 - - - - - - - 198.71428571428572 7 7 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 483 62 C20140710_OR016_03 C20140710_OR016_03 TB423702.[MT7]-GFYFAK[MT7].2b4_1.heavy 510.791 / 659.331 1071.0 33.3308744430542 40 16 10 6 8 3.510737729167753 28.484041735497502 0.039501190185546875 4 0.9662352152785411 6.697315423195468 1071.0 0.49959999999999993 3.0 - - - - - - - 222.91666666666666 2 12 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 485 62 C20140710_OR016_03 C20140710_OR016_03 TB423702.[MT7]-GFYFAK[MT7].2y3_1.heavy 510.791 / 509.32 10498.0 33.3308744430542 40 16 10 6 8 3.510737729167753 28.484041735497502 0.039501190185546875 4 0.9662352152785411 6.697315423195468 10498.0 47.63671900311526 0.0 - - - - - - - 214.0 20 9 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 487 63 C20140710_OR016_03 C20140710_OR016_03 TB424001.[MT7]-TLTLLPLLANNRER.3b4_1.heavy 590.024 / 573.373 9272.0 42.08060073852539 45 15 10 10 10 3.835741917304122 20.885896371384675 0.0 3 0.9554909234305838 5.827924708923881 9272.0 26.532743045225512 0.0 - - - - - - - 765.8888888888889 18 9 SAG S-antigen; retina and pineal gland (arrestin) 489 63 C20140710_OR016_03 C20140710_OR016_03 TB424001.[MT7]-TLTLLPLLANNRER.3b5_1.heavy 590.024 / 686.457 7252.0 42.08060073852539 45 15 10 10 10 3.835741917304122 20.885896371384675 0.0 3 0.9554909234305838 5.827924708923881 7252.0 47.22941176470587 0.0 - - - - - - - 238.0 14 8 SAG S-antigen; retina and pineal gland (arrestin) 491 63 C20140710_OR016_03 C20140710_OR016_03 TB424001.[MT7]-TLTLLPLLANNRER.3y9_2.heavy 590.024 / 541.807 10461.0 42.08060073852539 45 15 10 10 10 3.835741917304122 20.885896371384675 0.0 3 0.9554909234305838 5.827924708923881 10461.0 5.598394495412843 1.0 - - - - - - - 357.0 20 7 SAG S-antigen; retina and pineal gland (arrestin) 493 63 C20140710_OR016_03 C20140710_OR016_03 TB424001.[MT7]-TLTLLPLLANNRER.3y9_1.heavy 590.024 / 1082.61 7133.0 42.08060073852539 45 15 10 10 10 3.835741917304122 20.885896371384675 0.0 3 0.9554909234305838 5.827924708923881 7133.0 35.220956268942906 0.0 - - - - - - - 221.0 14 7 SAG S-antigen; retina and pineal gland (arrestin) 495 64 C20140710_OR016_03 C20140710_OR016_03 TB423706.[MT7]-EYDLAK[MT7].2y4_1.heavy 513.789 / 590.363 2413.0 24.600400924682617 50 20 10 10 10 14.2689102239991 7.008243687160387 0.0 3 0.9979932148473092 27.544777933839914 2413.0 9.593379679966613 0.0 - - - - - - - 212.33333333333334 4 9 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 497 64 C20140710_OR016_03 C20140710_OR016_03 TB423706.[MT7]-EYDLAK[MT7].2b3_1.heavy 513.789 / 552.242 7640.0 24.600400924682617 50 20 10 10 10 14.2689102239991 7.008243687160387 0.0 3 0.9979932148473092 27.544777933839914 7640.0 84.38961627506035 0.0 - - - - - - - 201.25 15 4 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 499 64 C20140710_OR016_03 C20140710_OR016_03 TB423706.[MT7]-EYDLAK[MT7].2y5_1.heavy 513.789 / 753.426 3921.0 24.600400924682617 50 20 10 10 10 14.2689102239991 7.008243687160387 0.0 3 0.9979932148473092 27.544777933839914 3921.0 7.624097971197309 1.0 - - - - - - - 273.0 9 7 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 501 64 C20140710_OR016_03 C20140710_OR016_03 TB423706.[MT7]-EYDLAK[MT7].2b4_1.heavy 513.789 / 665.326 1709.0 24.600400924682617 50 20 10 10 10 14.2689102239991 7.008243687160387 0.0 3 0.9979932148473092 27.544777933839914 1709.0 13.849763928700865 0.0 - - - - - - - 221.4 3 5 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 503 65 C20140710_OR016_03 C20140710_OR016_03 TB423808.[MT7]-DQDSVGEMK[MT7].3b6_1.heavy 432.883 / 746.344 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 505 65 C20140710_OR016_03 C20140710_OR016_03 TB423808.[MT7]-DQDSVGEMK[MT7].3b4_1.heavy 432.883 / 590.254 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 507 65 C20140710_OR016_03 C20140710_OR016_03 TB423808.[MT7]-DQDSVGEMK[MT7].3y4_1.heavy 432.883 / 608.319 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 509 65 C20140710_OR016_03 C20140710_OR016_03 TB423808.[MT7]-DQDSVGEMK[MT7].3b3_1.heavy 432.883 / 503.222 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 511 66 C20140710_OR016_03 C20140710_OR016_03 TB423979.[MT7]-AADPTAPGSDSAVTLR.3y6_1.heavy 558.292 / 646.388 3010.0 26.65542507171631 41 16 10 5 10 2.1582237029525455 37.1648726260872 0.044300079345703125 3 0.9657808589269317 6.652448822899544 3010.0 3.9750386115294027 0.0 - - - - - - - 368.6 6 10 SLC30A10 solute carrier family 30, member 10 513 66 C20140710_OR016_03 C20140710_OR016_03 TB423979.[MT7]-AADPTAPGSDSAVTLR.3y8_1.heavy 558.292 / 848.447 1456.0 26.65542507171631 41 16 10 5 10 2.1582237029525455 37.1648726260872 0.044300079345703125 3 0.9657808589269317 6.652448822899544 1456.0 21.01443298969072 0.0 - - - - - - - 176.36363636363637 2 11 SLC30A10 solute carrier family 30, member 10 515 66 C20140710_OR016_03 C20140710_OR016_03 TB423979.[MT7]-AADPTAPGSDSAVTLR.3y10_1.heavy 558.292 / 1002.52 2427.0 26.65542507171631 41 16 10 5 10 2.1582237029525455 37.1648726260872 0.044300079345703125 3 0.9657808589269317 6.652448822899544 2427.0 16.76381443298969 0.0 - - - - - - - 185.1818181818182 4 11 SLC30A10 solute carrier family 30, member 10 517 66 C20140710_OR016_03 C20140710_OR016_03 TB423979.[MT7]-AADPTAPGSDSAVTLR.3y9_1.heavy 558.292 / 905.469 2718.0 26.65542507171631 41 16 10 5 10 2.1582237029525455 37.1648726260872 0.044300079345703125 3 0.9657808589269317 6.652448822899544 2718.0 5.4041237113402065 1.0 - - - - - - - 235.57142857142858 5 7 SLC30A10 solute carrier family 30, member 10 519 67 C20140710_OR016_03 C20140710_OR016_03 TB432771.[MT7]-LVELYR.2y4_1.heavy 468.785 / 580.309 4220.0 33.09875011444092 43 17 10 6 10 2.6396323457347393 29.70326629434858 0.038600921630859375 3 0.978778641102185 8.456774346023916 4220.0 30.61898734177215 0.0 - - - - - - - 210.75 8 8 RGPD4;LIF;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;leukemia inhibitory factor (cholinergic differentiation factor);RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 521 67 C20140710_OR016_03 C20140710_OR016_03 TB432771.[MT7]-LVELYR.2b3_1.heavy 468.785 / 486.304 4114.0 33.09875011444092 43 17 10 6 10 2.6396323457347393 29.70326629434858 0.038600921630859375 3 0.978778641102185 8.456774346023916 4114.0 22.067183544303795 0.0 - - - - - - - 249.1818181818182 8 11 RGPD4;LIF;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;leukemia inhibitory factor (cholinergic differentiation factor);RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 523 67 C20140710_OR016_03 C20140710_OR016_03 TB432771.[MT7]-LVELYR.2y5_1.heavy 468.785 / 679.377 10971.0 33.09875011444092 43 17 10 6 10 2.6396323457347393 29.70326629434858 0.038600921630859375 3 0.978778641102185 8.456774346023916 10971.0 207.92657142857144 0.0 - - - - - - - 140.33333333333334 21 3 RGPD4;LIF;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;leukemia inhibitory factor (cholinergic differentiation factor);RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 525 67 C20140710_OR016_03 C20140710_OR016_03 TB432771.[MT7]-LVELYR.2b4_1.heavy 468.785 / 599.388 2426.0 33.09875011444092 43 17 10 6 10 2.6396323457347393 29.70326629434858 0.038600921630859375 3 0.978778641102185 8.456774346023916 2426.0 2.299526066350711 1.0 - - - - - - - 242.4 4 10 RGPD4;LIF;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;leukemia inhibitory factor (cholinergic differentiation factor);RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 527 68 C20140710_OR016_03 C20140710_OR016_03 TB423803.[MT7]-VPQLSSLELR.2y8_1.heavy 643.383 / 945.536 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNK interferon, kappa 529 68 C20140710_OR016_03 C20140710_OR016_03 TB423803.[MT7]-VPQLSSLELR.2y9_1.heavy 643.383 / 1042.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNK interferon, kappa 531 68 C20140710_OR016_03 C20140710_OR016_03 TB423803.[MT7]-VPQLSSLELR.2y6_1.heavy 643.383 / 704.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNK interferon, kappa 533 68 C20140710_OR016_03 C20140710_OR016_03 TB423803.[MT7]-VPQLSSLELR.2y7_1.heavy 643.383 / 817.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - IFNK interferon, kappa 535 69 C20140710_OR016_03 C20140710_OR016_03 TB423709.[MT7]-EILMLK[MT7].2b3_1.heavy 517.83 / 500.32 N/A 35.56949996948242 43 13 10 10 10 1.3766418160598168 49.6839671744999 0.0 3 0.929372371094247 4.616206205564837 3961.0 9.560672831757737 0.0 - - - - - - - 211.75 7 4 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 537 69 C20140710_OR016_03 C20140710_OR016_03 TB423709.[MT7]-EILMLK[MT7].2y4_1.heavy 517.83 / 648.424 3112.0 35.56949996948242 43 13 10 10 10 1.3766418160598168 49.6839671744999 0.0 3 0.929372371094247 4.616206205564837 3112.0 30.422777234794374 0.0 - - - - - - - 226.1 6 10 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 539 69 C20140710_OR016_03 C20140710_OR016_03 TB423709.[MT7]-EILMLK[MT7].2y5_1.heavy 517.83 / 761.508 2405.0 35.56949996948242 43 13 10 10 10 1.3766418160598168 49.6839671744999 0.0 3 0.929372371094247 4.616206205564837 2405.0 22.98844410194722 0.0 - - - - - - - 282.75 4 4 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 541 69 C20140710_OR016_03 C20140710_OR016_03 TB423709.[MT7]-EILMLK[MT7].2y3_1.heavy 517.83 / 535.339 1839.0 35.56949996948242 43 13 10 10 10 1.3766418160598168 49.6839671744999 0.0 3 0.929372371094247 4.616206205564837 1839.0 5.982972364824321 0.0 - - - - - - - 282.75 3 8 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 543 70 C20140710_OR016_03 C20140710_OR016_03 TB423801.[MT7]-YINYLQSLLYPDK[MT7].3y3_1.heavy 640.024 / 503.295 11242.0 48.822750091552734 35 11 10 6 8 0.9789321415929443 60.077631800178985 0.03710174560546875 4 0.8758706447086629 3.465986358180874 11242.0 101.76429153204899 0.0 - - - - - - - 217.0 22 8 ASCL3 achaete-scute complex homolog 3 (Drosophila) 545 70 C20140710_OR016_03 C20140710_OR016_03 TB423801.[MT7]-YINYLQSLLYPDK[MT7].3b4_1.heavy 640.024 / 698.363 4844.0 48.822750091552734 35 11 10 6 8 0.9789321415929443 60.077631800178985 0.03710174560546875 4 0.8758706447086629 3.465986358180874 4844.0 12.17617486338798 1.0 - - - - - - - 196.0 10 7 ASCL3 achaete-scute complex homolog 3 (Drosophila) 547 70 C20140710_OR016_03 C20140710_OR016_03 TB423801.[MT7]-YINYLQSLLYPDK[MT7].3b5_1.heavy 640.024 / 811.447 2285.0 48.822750091552734 35 11 10 6 8 0.9789321415929443 60.077631800178985 0.03710174560546875 4 0.8758706447086629 3.465986358180874 2285.0 23.1010989010989 1.0 - - - - - - - 208.85714285714286 5 7 ASCL3 achaete-scute complex homolog 3 (Drosophila) 549 70 C20140710_OR016_03 C20140710_OR016_03 TB423801.[MT7]-YINYLQSLLYPDK[MT7].3b3_1.heavy 640.024 / 535.3 4021.0 48.822750091552734 35 11 10 6 8 0.9789321415929443 60.077631800178985 0.03710174560546875 4 0.8758706447086629 3.465986358180874 4021.0 8.72829759299781 0.0 - - - - - - - 249.1818181818182 8 11 ASCL3 achaete-scute complex homolog 3 (Drosophila) 551 71 C20140710_OR016_03 C20140710_OR016_03 TB432909.[MT7]-LQIWDTAGQER.3y6_1.heavy 487.592 / 661.326 1831.0 35.47249984741211 45 15 10 10 10 1.5435788224891065 44.95728007191286 0.0 3 0.9563896430297998 5.8881174556167775 1831.0 16.203710985830007 0.0 - - - - - - - 261.5 3 4 RAB10;RAB35;RAB3C;RAB39B;RAB12;RAB30;RAB37;RAB43;RAB8A;RAB14;RAB8B;RAB4B;RAB1A;RAB3A;RAB3B;RAB4A;RAB1B;RAB3D RAB10, member RAS oncogene family;RAB35, member RAS oncogene family;RAB3C, member RAS oncogene family;RAB39B, member RAS oncogene family;RAB12, member RAS oncogene family;RAB30, member RAS oncogene family;RAB37, member RAS oncogene family;RAB43, member RAS oncogene family;RAB8A, member RAS oncogene family;RAB14, member RAS oncogene family;RAB8B, member RAS oncogene family;RAB4B, member RAS oncogene family;RAB1A, member RAS oncogene family;RAB3A, member RAS oncogene family;RAB3B, member RAS oncogene family;RAB4A, member RAS oncogene family;RAB1B, member RAS oncogene family;RAB3D, member RAS oncogene family 553 71 C20140710_OR016_03 C20140710_OR016_03 TB432909.[MT7]-LQIWDTAGQER.3b3_1.heavy 487.592 / 499.336 2747.0 35.47249984741211 45 15 10 10 10 1.5435788224891065 44.95728007191286 0.0 3 0.9563896430297998 5.8881174556167775 2747.0 10.08716298445984 0.0 - - - - - - - 218.11111111111111 5 9 RAB10;RAB35;RAB3C;RAB39B;RAB12;RAB30;RAB37;RAB43;RAB8A;RAB14;RAB8B;RAB4B;RAB1A;RAB3A;RAB3B;RAB4A;RAB1B;RAB3D RAB10, member RAS oncogene family;RAB35, member RAS oncogene family;RAB3C, member RAS oncogene family;RAB39B, member RAS oncogene family;RAB12, member RAS oncogene family;RAB30, member RAS oncogene family;RAB37, member RAS oncogene family;RAB43, member RAS oncogene family;RAB8A, member RAS oncogene family;RAB14, member RAS oncogene family;RAB8B, member RAS oncogene family;RAB4B, member RAS oncogene family;RAB1A, member RAS oncogene family;RAB3A, member RAS oncogene family;RAB3B, member RAS oncogene family;RAB4A, member RAS oncogene family;RAB1B, member RAS oncogene family;RAB3D, member RAS oncogene family 555 71 C20140710_OR016_03 C20140710_OR016_03 TB432909.[MT7]-LQIWDTAGQER.3y4_1.heavy 487.592 / 489.242 2747.0 35.47249984741211 45 15 10 10 10 1.5435788224891065 44.95728007191286 0.0 3 0.9563896430297998 5.8881174556167775 2747.0 17.771622137404577 0.0 - - - - - - - 262.0 5 3 RAB10;RAB35;RAB3C;RAB39B;RAB12;RAB30;RAB37;RAB43;RAB8A;RAB14;RAB8B;RAB4B;RAB1A;RAB3A;RAB3B;RAB4A;RAB1B;RAB3D RAB10, member RAS oncogene family;RAB35, member RAS oncogene family;RAB3C, member RAS oncogene family;RAB39B, member RAS oncogene family;RAB12, member RAS oncogene family;RAB30, member RAS oncogene family;RAB37, member RAS oncogene family;RAB43, member RAS oncogene family;RAB8A, member RAS oncogene family;RAB14, member RAS oncogene family;RAB8B, member RAS oncogene family;RAB4B, member RAS oncogene family;RAB1A, member RAS oncogene family;RAB3A, member RAS oncogene family;RAB3B, member RAS oncogene family;RAB4A, member RAS oncogene family;RAB1B, member RAS oncogene family;RAB3D, member RAS oncogene family 557 71 C20140710_OR016_03 C20140710_OR016_03 TB432909.[MT7]-LQIWDTAGQER.3y5_1.heavy 487.592 / 560.279 3008.0 35.47249984741211 45 15 10 10 10 1.5435788224891065 44.95728007191286 0.0 3 0.9563896430297998 5.8881174556167775 3008.0 14.10849161638721 0.0 - - - - - - - 235.8 6 5 RAB10;RAB35;RAB3C;RAB39B;RAB12;RAB30;RAB37;RAB43;RAB8A;RAB14;RAB8B;RAB4B;RAB1A;RAB3A;RAB3B;RAB4A;RAB1B;RAB3D RAB10, member RAS oncogene family;RAB35, member RAS oncogene family;RAB3C, member RAS oncogene family;RAB39B, member RAS oncogene family;RAB12, member RAS oncogene family;RAB30, member RAS oncogene family;RAB37, member RAS oncogene family;RAB43, member RAS oncogene family;RAB8A, member RAS oncogene family;RAB14, member RAS oncogene family;RAB8B, member RAS oncogene family;RAB4B, member RAS oncogene family;RAB1A, member RAS oncogene family;RAB3A, member RAS oncogene family;RAB3B, member RAS oncogene family;RAB4A, member RAS oncogene family;RAB1B, member RAS oncogene family;RAB3D, member RAS oncogene family 559 72 C20140710_OR016_03 C20140710_OR016_03 TB423683.[MT7]-YNLTYR.2y4_1.heavy 487.265 / 552.314 1153.0 26.97610092163086 48 18 10 10 10 8.187633903083645 12.213540710746457 0.0 3 0.9854601444716355 10.222443075979054 1153.0 10.636267954432888 1.0 - - - - - - - 192.0 2 4 MMP27 matrix metallopeptidase 27 561 72 C20140710_OR016_03 C20140710_OR016_03 TB423683.[MT7]-YNLTYR.2b3_1.heavy 487.265 / 535.3 1346.0 26.97610092163086 48 18 10 10 10 8.187633903083645 12.213540710746457 0.0 3 0.9854601444716355 10.222443075979054 1346.0 12.128020833333334 0.0 - - - - - - - 208.08333333333334 2 12 MMP27 matrix metallopeptidase 27 563 72 C20140710_OR016_03 C20140710_OR016_03 TB423683.[MT7]-YNLTYR.2y5_1.heavy 487.265 / 666.357 5094.0 26.97610092163086 48 18 10 10 10 8.187633903083645 12.213540710746457 0.0 3 0.9854601444716355 10.222443075979054 5094.0 28.476874999999996 0.0 - - - - - - - 216.0 10 8 MMP27 matrix metallopeptidase 27 565 72 C20140710_OR016_03 C20140710_OR016_03 TB423683.[MT7]-YNLTYR.2b4_1.heavy 487.265 / 636.347 1153.0 26.97610092163086 48 18 10 10 10 8.187633903083645 12.213540710746457 0.0 3 0.9854601444716355 10.222443075979054 1153.0 5.801039573227073 0.0 - - - - - - - 224.16666666666666 2 6 MMP27 matrix metallopeptidase 27 567 73 C20140710_OR016_03 C20140710_OR016_03 TB432908.[MT7]-LQIWDTAGQER.2y8_1.heavy 730.884 / 962.433 12556.0 35.47249984741211 43 15 10 10 8 3.4449349942990453 29.02812394587649 0.0 4 0.9525942176183702 5.6456757183379604 12556.0 97.45902854086644 0.0 - - - - - - - 196.25 25 4 RAB10;RAB35;RAB3C;RAB39B;RAB12;RAB30;RAB37;RAB43;RAB8A;RAB14;RAB8B;RAB4B;RAB1A;RAB3A;RAB3B;RAB4A;RAB1B;RAB3D RAB10, member RAS oncogene family;RAB35, member RAS oncogene family;RAB3C, member RAS oncogene family;RAB39B, member RAS oncogene family;RAB12, member RAS oncogene family;RAB30, member RAS oncogene family;RAB37, member RAS oncogene family;RAB43, member RAS oncogene family;RAB8A, member RAS oncogene family;RAB14, member RAS oncogene family;RAB8B, member RAS oncogene family;RAB4B, member RAS oncogene family;RAB1A, member RAS oncogene family;RAB3A, member RAS oncogene family;RAB3B, member RAS oncogene family;RAB4A, member RAS oncogene family;RAB1B, member RAS oncogene family;RAB3D, member RAS oncogene family 569 73 C20140710_OR016_03 C20140710_OR016_03 TB432908.[MT7]-LQIWDTAGQER.2y9_1.heavy 730.884 / 1075.52 7193.0 35.47249984741211 43 15 10 10 8 3.4449349942990453 29.02812394587649 0.0 4 0.9525942176183702 5.6456757183379604 7193.0 45.069708677364076 1.0 - - - - - - - 235.4 15 5 RAB10;RAB35;RAB3C;RAB39B;RAB12;RAB30;RAB37;RAB43;RAB8A;RAB14;RAB8B;RAB4B;RAB1A;RAB3A;RAB3B;RAB4A;RAB1B;RAB3D RAB10, member RAS oncogene family;RAB35, member RAS oncogene family;RAB3C, member RAS oncogene family;RAB39B, member RAS oncogene family;RAB12, member RAS oncogene family;RAB30, member RAS oncogene family;RAB37, member RAS oncogene family;RAB43, member RAS oncogene family;RAB8A, member RAS oncogene family;RAB14, member RAS oncogene family;RAB8B, member RAS oncogene family;RAB4B, member RAS oncogene family;RAB1A, member RAS oncogene family;RAB3A, member RAS oncogene family;RAB3B, member RAS oncogene family;RAB4A, member RAS oncogene family;RAB1B, member RAS oncogene family;RAB3D, member RAS oncogene family 571 73 C20140710_OR016_03 C20140710_OR016_03 TB432908.[MT7]-LQIWDTAGQER.2y6_1.heavy 730.884 / 661.326 10202.0 35.47249984741211 43 15 10 10 8 3.4449349942990453 29.02812394587649 0.0 4 0.9525942176183702 5.6456757183379604 10202.0 42.02000253638741 0.0 - - - - - - - 240.0 20 6 RAB10;RAB35;RAB3C;RAB39B;RAB12;RAB30;RAB37;RAB43;RAB8A;RAB14;RAB8B;RAB4B;RAB1A;RAB3A;RAB3B;RAB4A;RAB1B;RAB3D RAB10, member RAS oncogene family;RAB35, member RAS oncogene family;RAB3C, member RAS oncogene family;RAB39B, member RAS oncogene family;RAB12, member RAS oncogene family;RAB30, member RAS oncogene family;RAB37, member RAS oncogene family;RAB43, member RAS oncogene family;RAB8A, member RAS oncogene family;RAB14, member RAS oncogene family;RAB8B, member RAS oncogene family;RAB4B, member RAS oncogene family;RAB1A, member RAS oncogene family;RAB3A, member RAS oncogene family;RAB3B, member RAS oncogene family;RAB4A, member RAS oncogene family;RAB1B, member RAS oncogene family;RAB3D, member RAS oncogene family 573 73 C20140710_OR016_03 C20140710_OR016_03 TB432908.[MT7]-LQIWDTAGQER.2y10_1.heavy 730.884 / 1203.58 2223.0 35.47249984741211 43 15 10 10 8 3.4449349942990453 29.02812394587649 0.0 4 0.9525942176183702 5.6456757183379604 2223.0 11.269976242405358 0.0 - - - - - - - 196.4 4 10 RAB10;RAB35;RAB3C;RAB39B;RAB12;RAB30;RAB37;RAB43;RAB8A;RAB14;RAB8B;RAB4B;RAB1A;RAB3A;RAB3B;RAB4A;RAB1B;RAB3D RAB10, member RAS oncogene family;RAB35, member RAS oncogene family;RAB3C, member RAS oncogene family;RAB39B, member RAS oncogene family;RAB12, member RAS oncogene family;RAB30, member RAS oncogene family;RAB37, member RAS oncogene family;RAB43, member RAS oncogene family;RAB8A, member RAS oncogene family;RAB14, member RAS oncogene family;RAB8B, member RAS oncogene family;RAB4B, member RAS oncogene family;RAB1A, member RAS oncogene family;RAB3A, member RAS oncogene family;RAB3B, member RAS oncogene family;RAB4A, member RAS oncogene family;RAB1B, member RAS oncogene family;RAB3D, member RAS oncogene family 575 74 C20140710_OR016_03 C20140710_OR016_03 TB433089.[MT7]-LTVSGFLGELTSSEVATEVPFRLMHPQPEDPAK[MT7].4b5_1.heavy 968.51 / 602.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 577 74 C20140710_OR016_03 C20140710_OR016_03 TB433089.[MT7]-LTVSGFLGELTSSEVATEVPFRLMHPQPEDPAK[MT7].4y6_1.heavy 968.51 / 800.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 579 74 C20140710_OR016_03 C20140710_OR016_03 TB433089.[MT7]-LTVSGFLGELTSSEVATEVPFRLMHPQPEDPAK[MT7].4b9_1.heavy 968.51 / 1048.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 581 74 C20140710_OR016_03 C20140710_OR016_03 TB433089.[MT7]-LTVSGFLGELTSSEVATEVPFRLMHPQPEDPAK[MT7].4b6_1.heavy 968.51 / 749.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 583 75 C20140710_OR016_03 C20140710_OR016_03 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 109150.0 38.02320098876953 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 109150.0 85.95215918712955 0.0 - - - - - - - 328.0 218 2 585 75 C20140710_OR016_03 C20140710_OR016_03 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 97868.0 38.02320098876953 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 97868.0 184.92391619047618 0.0 - - - - - - - 295.0 195 4 587 75 C20140710_OR016_03 C20140710_OR016_03 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 157953.0 38.02320098876953 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 157953.0 101.79923076923076 0.0 - - - - - - - 306.3333333333333 315 3 589 76 C20140710_OR016_03 C20140710_OR016_03 TB433086.[MT7]-DYK[MT7]PTC[CAM]MLNIPFPYNFHDFQFC[CAM]GNK[MT7].4y5_1.heavy 897.183 / 769.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM7 ADAM metallopeptidase domain 7 591 76 C20140710_OR016_03 C20140710_OR016_03 TB433086.[MT7]-DYK[MT7]PTC[CAM]MLNIPFPYNFHDFQFC[CAM]GNK[MT7].4y7_1.heavy 897.183 / 1044.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM7 ADAM metallopeptidase domain 7 593 76 C20140710_OR016_03 C20140710_OR016_03 TB433086.[MT7]-DYK[MT7]PTC[CAM]MLNIPFPYNFHDFQFC[CAM]GNK[MT7].4b9_2.heavy 897.183 / 706.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM7 ADAM metallopeptidase domain 7 595 76 C20140710_OR016_03 C20140710_OR016_03 TB433086.[MT7]-DYK[MT7]PTC[CAM]MLNIPFPYNFHDFQFC[CAM]GNK[MT7].4b6_2.heavy 897.183 / 527.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM7 ADAM metallopeptidase domain 7 597 77 C20140710_OR016_03 C20140710_OR016_03 TB423686.[MT7]-GIHDEK[MT7].2y4_1.heavy 493.779 / 672.343 682.0 15.403099775314331 42 16 10 6 10 1.9787026977659317 34.1337520812944 0.03519916534423828 3 0.9623601580536745 6.341131271980429 682.0 6.82 0.0 - - - - - - - 0.0 1 0 ADAM7 ADAM metallopeptidase domain 7 599 77 C20140710_OR016_03 C20140710_OR016_03 TB423686.[MT7]-GIHDEK[MT7].2b4_1.heavy 493.779 / 567.301 922.0 15.403099775314331 42 16 10 6 10 1.9787026977659317 34.1337520812944 0.03519916534423828 3 0.9623601580536745 6.341131271980429 922.0 16.901735966735966 0.0 - - - - - - - 0.0 1 0 ADAM7 ADAM metallopeptidase domain 7 601 77 C20140710_OR016_03 C20140710_OR016_03 TB423686.[MT7]-GIHDEK[MT7].2y3_1.heavy 493.779 / 535.284 1003.0 15.403099775314331 42 16 10 6 10 1.9787026977659317 34.1337520812944 0.03519916534423828 3 0.9623601580536745 6.341131271980429 1003.0 8.358333333333333 0.0 - - - - - - - 124.55555555555556 2 9 ADAM7 ADAM metallopeptidase domain 7 603 77 C20140710_OR016_03 C20140710_OR016_03 TB423686.[MT7]-GIHDEK[MT7].2b5_1.heavy 493.779 / 696.343 160.0 15.403099775314331 42 16 10 6 10 1.9787026977659317 34.1337520812944 0.03519916534423828 3 0.9623601580536745 6.341131271980429 160.0 2.453333333333333 8.0 - - - - - - - 0.0 0 0 ADAM7 ADAM metallopeptidase domain 7 605 78 C20140710_OR016_03 C20140710_OR016_03 TB424111.[MT7]-AHRFLGLLYELEENTEK[MT7].3b6_1.heavy 784.093 / 826.48 501.0 42.68174934387207 32 9 10 3 10 1.0990534830754561 55.52765965147451 0.07740020751953125 3 0.8075637805458773 2.766908787550341 501.0 3.26652 17.0 - - - - - - - 0.0 1 0 RGPD4;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 607 78 C20140710_OR016_03 C20140710_OR016_03 TB424111.[MT7]-AHRFLGLLYELEENTEK[MT7].3b8_1.heavy 784.093 / 1052.65 3130.0 42.68174934387207 32 9 10 3 10 1.0990534830754561 55.52765965147451 0.07740020751953125 3 0.8075637805458773 2.766908787550341 3130.0 30.115927659574467 0.0 - - - - - - - 150.0 6 5 RGPD4;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 609 78 C20140710_OR016_03 C20140710_OR016_03 TB424111.[MT7]-AHRFLGLLYELEENTEK[MT7].3b7_1.heavy 784.093 / 939.565 3380.0 42.68174934387207 32 9 10 3 10 1.0990534830754561 55.52765965147451 0.07740020751953125 3 0.8075637805458773 2.766908787550341 3380.0 6.882299299165247 0.0 - - - - - - - 125.0 6 2 RGPD4;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 611 78 C20140710_OR016_03 C20140710_OR016_03 TB424111.[MT7]-AHRFLGLLYELEENTEK[MT7].3b8_2.heavy 784.093 / 526.828 6760.0 42.68174934387207 32 9 10 3 10 1.0990534830754561 55.52765965147451 0.07740020751953125 3 0.8075637805458773 2.766908787550341 6760.0 10.124478316095082 0.0 - - - - - - - 501.0 13 1 RGPD4;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 613 79 C20140710_OR016_03 C20140710_OR016_03 TB432903.[MT7]-ELAGSTGQHDQR.2y9_1.heavy 721.859 / 985.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF468 zinc finger protein 468 615 79 C20140710_OR016_03 C20140710_OR016_03 TB432903.[MT7]-ELAGSTGQHDQR.2y10_1.heavy 721.859 / 1056.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF468 zinc finger protein 468 617 79 C20140710_OR016_03 C20140710_OR016_03 TB432903.[MT7]-ELAGSTGQHDQR.2y11_1.heavy 721.859 / 1169.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF468 zinc finger protein 468 619 79 C20140710_OR016_03 C20140710_OR016_03 TB432903.[MT7]-ELAGSTGQHDQR.2b10_1.heavy 721.859 / 1140.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF468 zinc finger protein 468 621 80 C20140710_OR016_03 C20140710_OR016_03 TB433080.[MT7]-VVEEC[CAM]LHPEPNAQQEVGTC[CAM]FLHFK[MT7].4b4_1.heavy 789.893 / 601.331 2519.0 36.71480178833008 43 13 10 10 10 3.5460023945565387 28.20077057858444 0.0 3 0.9258272290103566 4.503171089228974 2519.0 6.453962264150943 1.0 - - - - - - - 221.22222222222223 5 9 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 623 80 C20140710_OR016_03 C20140710_OR016_03 TB433080.[MT7]-VVEEC[CAM]LHPEPNAQQEVGTC[CAM]FLHFK[MT7].4b5_1.heavy 789.893 / 761.362 8751.0 36.71480178833008 43 13 10 10 10 3.5460023945565387 28.20077057858444 0.0 3 0.9258272290103566 4.503171089228974 8751.0 50.828317056983025 0.0 - - - - - - - 298.25 17 4 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 625 80 C20140710_OR016_03 C20140710_OR016_03 TB433080.[MT7]-VVEEC[CAM]LHPEPNAQQEVGTC[CAM]FLHFK[MT7].4y3_1.heavy 789.893 / 575.342 11138.0 36.71480178833008 43 13 10 10 10 3.5460023945565387 28.20077057858444 0.0 3 0.9258272290103566 4.503171089228974 11138.0 82.46954098749272 0.0 - - - - - - - 238.8 22 5 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 627 80 C20140710_OR016_03 C20140710_OR016_03 TB433080.[MT7]-VVEEC[CAM]LHPEPNAQQEVGTC[CAM]FLHFK[MT7].4b6_1.heavy 789.893 / 874.446 3713.0 36.71480178833008 43 13 10 10 10 3.5460023945565387 28.20077057858444 0.0 3 0.9258272290103566 4.503171089228974 3713.0 11.41922641509434 0.0 - - - - - - - 265.0 7 2 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 629 81 C20140710_OR016_03 C20140710_OR016_03 TB424114.[MT7]-ADAQPPGSASTNVVLRHDGAVR.4y16_2.heavy 591.314 / 819.937 2401.0 24.992000579833984 48 18 10 10 10 2.068592574709299 36.49688466438021 0.0 3 0.9813655891099801 9.02667525148642 2401.0 11.780906666666667 0.0 - - - - - - - 214.28571428571428 4 7 CHRNA10 cholinergic receptor, nicotinic, alpha 10 631 81 C20140710_OR016_03 C20140710_OR016_03 TB424114.[MT7]-ADAQPPGSASTNVVLRHDGAVR.4b4_1.heavy 591.314 / 530.269 10805.0 24.992000579833984 48 18 10 10 10 2.068592574709299 36.49688466438021 0.0 3 0.9813655891099801 9.02667525148642 10805.0 27.40876045681656 0.0 - - - - - - - 240.0 21 5 CHRNA10 cholinergic receptor, nicotinic, alpha 10 633 81 C20140710_OR016_03 C20140710_OR016_03 TB424114.[MT7]-ADAQPPGSASTNVVLRHDGAVR.4y13_2.heavy 591.314 / 712.392 3602.0 24.992000579833984 48 18 10 10 10 2.068592574709299 36.49688466438021 0.0 3 0.9813655891099801 9.02667525148642 3602.0 5.04208031968032 0.0 - - - - - - - 218.1818181818182 7 11 CHRNA10 cholinergic receptor, nicotinic, alpha 10 635 81 C20140710_OR016_03 C20140710_OR016_03 TB424114.[MT7]-ADAQPPGSASTNVVLRHDGAVR.4y6_1.heavy 591.314 / 654.332 700.0 24.992000579833984 48 18 10 10 10 2.068592574709299 36.49688466438021 0.0 3 0.9813655891099801 9.02667525148642 700.0 1.088 8.0 - - - - - - - 0.0 1 0 CHRNA10 cholinergic receptor, nicotinic, alpha 10 637 82 C20140710_OR016_03 C20140710_OR016_03 TB423690.[MT7]-LTTFPK[MT7].2y4_1.heavy 497.812 / 636.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 639 82 C20140710_OR016_03 C20140710_OR016_03 TB423690.[MT7]-LTTFPK[MT7].2y5_1.heavy 497.812 / 737.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 641 82 C20140710_OR016_03 C20140710_OR016_03 TB423690.[MT7]-LTTFPK[MT7].2b4_1.heavy 497.812 / 607.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 643 82 C20140710_OR016_03 C20140710_OR016_03 TB423690.[MT7]-LTTFPK[MT7].2y3_1.heavy 497.812 / 535.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 645 83 C20140710_OR016_03 C20140710_OR016_03 TB424094.[MT7]-DIPC[CAM]IFRVTASLLGAPSK[MT7].4b8_1.heavy 559.071 / 1145.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 647 83 C20140710_OR016_03 C20140710_OR016_03 TB424094.[MT7]-DIPC[CAM]IFRVTASLLGAPSK[MT7].4y5_1.heavy 559.071 / 603.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 649 83 C20140710_OR016_03 C20140710_OR016_03 TB424094.[MT7]-DIPC[CAM]IFRVTASLLGAPSK[MT7].4b11_2.heavy 559.071 / 702.875 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 651 83 C20140710_OR016_03 C20140710_OR016_03 TB424094.[MT7]-DIPC[CAM]IFRVTASLLGAPSK[MT7].4b10_2.heavy 559.071 / 659.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 653 84 C20140710_OR016_03 C20140710_OR016_03 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 936648.0 34.990699768066406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 936648.0 1111.0739763395673 0.0 - - - - - - - 256.3 1873 10 655 84 C20140710_OR016_03 C20140710_OR016_03 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 182292.0 34.990699768066406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 182292.0 176.07204199065563 1.0 - - - - - - - 234.83333333333334 407 12 657 84 C20140710_OR016_03 C20140710_OR016_03 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 339715.0 34.990699768066406 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 339715.0 357.4344225432467 0.0 - - - - - - - 622.7142857142857 679 7 659 85 C20140710_OR016_03 C20140710_OR016_03 TB444912.[MT7]-YLIEPVK[MT7].2y4_1.heavy 575.36 / 616.379 10539.0 32.92474937438965 40 14 10 6 10 1.7774566084385028 37.50677588986738 0.03859710693359375 3 0.933996994111512 4.777078101368399 10539.0 28.36546968521392 0.0 - - - - - - - 241.42857142857142 21 7 ADAM7 ADAM metallopeptidase domain 7 661 85 C20140710_OR016_03 C20140710_OR016_03 TB444912.[MT7]-YLIEPVK[MT7].2b3_1.heavy 575.36 / 534.341 8067.0 32.92474937438965 40 14 10 6 10 1.7774566084385028 37.50677588986738 0.03859710693359375 3 0.933996994111512 4.777078101368399 8067.0 9.414015343784897 0.0 - - - - - - - 1210.0 16 10 ADAM7 ADAM metallopeptidase domain 7 663 85 C20140710_OR016_03 C20140710_OR016_03 TB444912.[MT7]-YLIEPVK[MT7].2y5_1.heavy 575.36 / 729.463 4294.0 32.92474937438965 40 14 10 6 10 1.7774566084385028 37.50677588986738 0.03859710693359375 3 0.933996994111512 4.777078101368399 4294.0 36.8529010989011 3.0 - - - - - - - 182.0 21 5 ADAM7 ADAM metallopeptidase domain 7 665 85 C20140710_OR016_03 C20140710_OR016_03 TB444912.[MT7]-YLIEPVK[MT7].2b4_1.heavy 575.36 / 663.383 15743.0 32.92474937438965 40 14 10 6 10 1.7774566084385028 37.50677588986738 0.03859710693359375 3 0.933996994111512 4.777078101368399 15743.0 64.7885 0.0 - - - - - - - 278.57142857142856 31 7 ADAM7 ADAM metallopeptidase domain 7 667 86 C20140710_OR016_03 C20140710_OR016_03 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 18268.0 22.82939910888672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 18268.0 101.87028765421229 0.0 - - - - - - - 225.66666666666666 36 9 669 86 C20140710_OR016_03 C20140710_OR016_03 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 15869.0 22.82939910888672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 15869.0 80.43282848564998 1.0 - - - - - - - 211.0 31 7 671 86 C20140710_OR016_03 C20140710_OR016_03 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 44194.0 22.82939910888672 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 44194.0 297.94405542004097 0.0 - - - - - - - 145.0 88 7 673 87 C20140710_OR016_03 C20140710_OR016_03 TB424102.[MT7]-LFDEPQLASLC[CAM]LENIDK[MT7].3y7_1.heavy 765.071 / 1035.53 2013.0 44.8401985168457 43 13 10 10 10 4.509178540248476 22.176988359944062 0.0 3 0.9249608565903309 4.47676734943272 2013.0 24.130679245283016 1.0 - - - - - - - 238.5 4 8 BTBD2 BTB (POZ) domain containing 2 675 87 C20140710_OR016_03 C20140710_OR016_03 TB424102.[MT7]-LFDEPQLASLC[CAM]LENIDK[MT7].3b6_1.heavy 765.071 / 874.443 1590.0 44.8401985168457 43 13 10 10 10 4.509178540248476 22.176988359944062 0.0 3 0.9249608565903309 4.47676734943272 1590.0 -0.3125491545418796 2.0 - - - - - - - 188.44444444444446 5 9 BTBD2 BTB (POZ) domain containing 2 677 87 C20140710_OR016_03 C20140710_OR016_03 TB424102.[MT7]-LFDEPQLASLC[CAM]LENIDK[MT7].3b4_1.heavy 765.071 / 649.331 5511.0 44.8401985168457 43 13 10 10 10 4.509178540248476 22.176988359944062 0.0 3 0.9249608565903309 4.47676734943272 5511.0 50.74279245283019 0.0 - - - - - - - 181.71428571428572 11 7 BTBD2 BTB (POZ) domain containing 2 679 87 C20140710_OR016_03 C20140710_OR016_03 TB424102.[MT7]-LFDEPQLASLC[CAM]LENIDK[MT7].3y5_1.heavy 765.071 / 762.411 2331.0 44.8401985168457 43 13 10 10 10 4.509178540248476 22.176988359944062 0.0 3 0.9249608565903309 4.47676734943272 2331.0 5.853488850771869 0.0 - - - - - - - 251.75 4 8 BTBD2 BTB (POZ) domain containing 2 681 88 C20140710_OR016_03 C20140710_OR016_03 TB444928.[MT7]-NVTEETVK[MT7].2y4_1.heavy 604.342 / 620.374 3173.0 20.883949279785156 44 18 10 6 10 4.147089596399989 19.154817356690486 0.031299591064453125 3 0.988974895464268 11.742787205246811 3173.0 41.58511904761905 0.0 - - - - - - - 146.5 6 4 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 683 88 C20140710_OR016_03 C20140710_OR016_03 TB444928.[MT7]-NVTEETVK[MT7].2y5_1.heavy 604.342 / 749.416 3257.0 20.883949279785156 44 18 10 6 10 4.147089596399989 19.154817356690486 0.031299591064453125 3 0.988974895464268 11.742787205246811 3257.0 11.701796407185629 1.0 - - - - - - - 131.57142857142858 6 7 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 685 88 C20140710_OR016_03 C20140710_OR016_03 TB444928.[MT7]-NVTEETVK[MT7].2y6_1.heavy 604.342 / 850.464 7933.0 20.883949279785156 44 18 10 6 10 4.147089596399989 19.154817356690486 0.031299591064453125 3 0.988974895464268 11.742787205246811 7933.0 141.84902972626176 0.0 - - - - - - - 146.5 15 4 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 687 88 C20140710_OR016_03 C20140710_OR016_03 TB444928.[MT7]-NVTEETVK[MT7].2y7_1.heavy 604.342 / 949.532 4175.0 20.883949279785156 44 18 10 6 10 4.147089596399989 19.154817356690486 0.031299591064453125 3 0.988974895464268 11.742787205246811 4175.0 30.635458167330675 0.0 - - - - - - - 167.25 8 4 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 689 89 C20140710_OR016_03 C20140710_OR016_03 TB424109.[MT7]-DHENRLEALQQAQEIDK[MT7].4b8_2.heavy 582.056 / 555.276 17389.0 28.287350177764893 39 13 10 6 10 1.5805831230893113 41.929229736990834 0.03579902648925781 3 0.9132404789834304 4.159227658532664 17389.0 25.896943817052517 0.0 - - - - - - - 329.6666666666667 34 12 SDCCAG1 serologically defined colon cancer antigen 1 691 89 C20140710_OR016_03 C20140710_OR016_03 TB424109.[MT7]-DHENRLEALQQAQEIDK[MT7].4b7_1.heavy 582.056 / 1038.51 1840.0 28.287350177764893 39 13 10 6 10 1.5805831230893113 41.929229736990834 0.03579902648925781 3 0.9132404789834304 4.159227658532664 1840.0 14.133333333333333 2.0 - - - - - - - 161.0 3 12 SDCCAG1 serologically defined colon cancer antigen 1 693 89 C20140710_OR016_03 C20140710_OR016_03 TB424109.[MT7]-DHENRLEALQQAQEIDK[MT7].4b10_2.heavy 582.056 / 675.848 12144.0 28.287350177764893 39 13 10 6 10 1.5805831230893113 41.929229736990834 0.03579902648925781 3 0.9132404789834304 4.159227658532664 12144.0 89.76 0.0 - - - - - - - 202.4 24 15 SDCCAG1 serologically defined colon cancer antigen 1 695 89 C20140710_OR016_03 C20140710_OR016_03 TB424109.[MT7]-DHENRLEALQQAQEIDK[MT7].4b9_2.heavy 582.056 / 611.818 18217.0 28.287350177764893 39 13 10 6 10 1.5805831230893113 41.929229736990834 0.03579902648925781 3 0.9132404789834304 4.159227658532664 18217.0 47.52260869565218 1.0 - - - - - - - 230.0 36 14 SDCCAG1 serologically defined colon cancer antigen 1 697 90 C20140710_OR016_03 C20140710_OR016_03 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 91680.0 32.359100341796875 23 -3 10 6 10 null 0.0 0.0363006591796875 3 0.0 0.0 91680.0 492.0297765767326 0.0 - - - - - - - 228.5 183 8 699 90 C20140710_OR016_03 C20140710_OR016_03 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 79432.0 32.359100341796875 23 -3 10 6 10 null 0.0 0.0363006591796875 3 0.0 0.0 79432.0 296.0693279099029 0.0 - - - - - - - 233.44444444444446 158 9 701 90 C20140710_OR016_03 C20140710_OR016_03 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 160326.0 32.359100341796875 23 -3 10 6 10 null 0.0 0.0363006591796875 3 0.0 0.0 160326.0 269.5182267069031 0.0 - - - - - - - 174.45454545454547 320 11 703 91 C20140710_OR016_03 C20140710_OR016_03 TB423907.[MT7]-LELQSALEAEIR.2b3_1.heavy 758.429 / 500.32 1791.0 41.399800300598145 40 15 10 5 10 5.69663428800455 17.554224993970706 0.040401458740234375 3 0.9577889786860464 5.985629210139895 1791.0 11.7534375 0.0 - - - - - - - 208.0 3 8 CDC42BPG;CDC42BPB CDC42 binding protein kinase gamma (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 705 91 C20140710_OR016_03 C20140710_OR016_03 TB423907.[MT7]-LELQSALEAEIR.2y8_1.heavy 758.429 / 888.479 2558.0 41.399800300598145 40 15 10 5 10 5.69663428800455 17.554224993970706 0.040401458740234375 3 0.9577889786860464 5.985629210139895 2558.0 17.38640625 0.0 - - - - - - - 298.6666666666667 5 9 CDC42BPG;CDC42BPB CDC42 binding protein kinase gamma (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 707 91 C20140710_OR016_03 C20140710_OR016_03 TB423907.[MT7]-LELQSALEAEIR.2y9_1.heavy 758.429 / 1016.54 2174.0 41.399800300598145 40 15 10 5 10 5.69663428800455 17.554224993970706 0.040401458740234375 3 0.9577889786860464 5.985629210139895 2174.0 9.625462912684622 0.0 - - - - - - - 213.33333333333334 4 9 CDC42BPG;CDC42BPB CDC42 binding protein kinase gamma (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 709 91 C20140710_OR016_03 C20140710_OR016_03 TB423907.[MT7]-LELQSALEAEIR.2y10_1.heavy 758.429 / 1129.62 895.0 41.399800300598145 40 15 10 5 10 5.69663428800455 17.554224993970706 0.040401458740234375 3 0.9577889786860464 5.985629210139895 895.0 1.7831786870723363 2.0 - - - - - - - 209.45454545454547 2 11 CDC42BPG;CDC42BPB CDC42 binding protein kinase gamma (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 711 92 C20140710_OR016_03 C20140710_OR016_03 TB445112.[MT7]-TAPLPGPAQAGAGQPLPK[MT7].4b8_1.heavy 490.537 / 849.495 83.0 30.108825206756592 21 8 2 7 4 1.094173439735776 80.84768178663693 0.027101516723632812 7 0.7907226249663296 2.649223703306892 83.0 -0.6011976047904192 24.0 - - - - - - - 0.0 1 0 CEMP1 cementum protein 1 713 92 C20140710_OR016_03 C20140710_OR016_03 TB445112.[MT7]-TAPLPGPAQAGAGQPLPK[MT7].4y4_1.heavy 490.537 / 598.404 1836.0 30.108825206756592 21 8 2 7 4 1.094173439735776 80.84768178663693 0.027101516723632812 7 0.7907226249663296 2.649223703306892 1836.0 4.161925965379494 3.0 - - - - - - - 219.9090909090909 16 11 CEMP1 cementum protein 1 715 92 C20140710_OR016_03 C20140710_OR016_03 TB445112.[MT7]-TAPLPGPAQAGAGQPLPK[MT7].4b4_1.heavy 490.537 / 527.331 2671.0 30.108825206756592 21 8 2 7 4 1.094173439735776 80.84768178663693 0.027101516723632812 7 0.7907226249663296 2.649223703306892 2671.0 8.364317425539198 3.0 - - - - - - - 740.875 10 8 CEMP1 cementum protein 1 717 92 C20140710_OR016_03 C20140710_OR016_03 TB445112.[MT7]-TAPLPGPAQAGAGQPLPK[MT7].4b3_1.heavy 490.537 / 414.247 2170.0 30.108825206756592 21 8 2 7 4 1.094173439735776 80.84768178663693 0.027101516723632812 7 0.7907226249663296 2.649223703306892 2170.0 -0.7859498297571915 3.0 - - - - - - - 189.54545454545453 4 11 CEMP1 cementum protein 1 719 93 C20140710_OR016_03 C20140710_OR016_03 TB424059.[MT7]-IREMQAFFGLTVTGK[MT7].4b7_1.heavy 497.283 / 1020.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP27 matrix metallopeptidase 27 721 93 C20140710_OR016_03 C20140710_OR016_03 TB424059.[MT7]-IREMQAFFGLTVTGK[MT7].4b9_1.heavy 497.283 / 1224.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP27 matrix metallopeptidase 27 723 93 C20140710_OR016_03 C20140710_OR016_03 TB424059.[MT7]-IREMQAFFGLTVTGK[MT7].4b9_2.heavy 497.283 / 612.819 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP27 matrix metallopeptidase 27 725 93 C20140710_OR016_03 C20140710_OR016_03 TB424059.[MT7]-IREMQAFFGLTVTGK[MT7].4b6_1.heavy 497.283 / 873.473 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP27 matrix metallopeptidase 27 727 94 C20140710_OR016_03 C20140710_OR016_03 TB445114.[MT7]-ESYQDANLVFEEFAR.2b3_1.heavy 981.472 / 524.247 2752.0 43.57670021057129 40 14 10 6 10 1.8497546349568064 42.94325536543468 0.039798736572265625 3 0.9401439945243856 5.019010123909117 2752.0 14.833819607843138 0.0 - - - - - - - 255.0 5 6 SAG S-antigen; retina and pineal gland (arrestin) 729 94 C20140710_OR016_03 C20140710_OR016_03 TB445114.[MT7]-ESYQDANLVFEEFAR.2b7_1.heavy 981.472 / 952.413 2243.0 43.57670021057129 40 14 10 6 10 1.8497546349568064 42.94325536543468 0.039798736572265625 3 0.9401439945243856 5.019010123909117 2243.0 7.536354341736694 0.0 - - - - - - - 238.0 4 9 SAG S-antigen; retina and pineal gland (arrestin) 731 94 C20140710_OR016_03 C20140710_OR016_03 TB445114.[MT7]-ESYQDANLVFEEFAR.2y10_1.heavy 981.472 / 1195.61 2956.0 43.57670021057129 40 14 10 6 10 1.8497546349568064 42.94325536543468 0.039798736572265625 3 0.9401439945243856 5.019010123909117 2956.0 16.602730771697992 0.0 - - - - - - - 212.5 5 12 SAG S-antigen; retina and pineal gland (arrestin) 733 94 C20140710_OR016_03 C20140710_OR016_03 TB445114.[MT7]-ESYQDANLVFEEFAR.2b5_1.heavy 981.472 / 767.333 4791.0 43.57670021057129 40 14 10 6 10 1.8497546349568064 42.94325536543468 0.039798736572265625 3 0.9401439945243856 5.019010123909117 4791.0 67.63764705882353 0.0 - - - - - - - 185.45454545454547 9 11 SAG S-antigen; retina and pineal gland (arrestin) 735 95 C20140710_OR016_03 C20140710_OR016_03 TB424057.[MT7]-EQLLDC[CAM]EGEDGWNK[MT7].3b4_1.heavy 660.979 / 628.379 2624.0 32.67387390136719 42 16 10 6 10 2.051907126508285 38.53819064066178 0.03790283203125 3 0.9648975859744713 6.567728982010624 2624.0 0.0 3.0 - - - - - - - 1137.75 8 8 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 737 95 C20140710_OR016_03 C20140710_OR016_03 TB424057.[MT7]-EQLLDC[CAM]EGEDGWNK[MT7].3b5_1.heavy 660.979 / 743.406 2706.0 32.67387390136719 42 16 10 6 10 2.051907126508285 38.53819064066178 0.03790283203125 3 0.9648975859744713 6.567728982010624 2706.0 3.228 1.0 - - - - - - - 358.75 5 8 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 739 95 C20140710_OR016_03 C20140710_OR016_03 TB424057.[MT7]-EQLLDC[CAM]EGEDGWNK[MT7].3y4_1.heavy 660.979 / 648.359 3362.0 32.67387390136719 42 16 10 6 10 2.051907126508285 38.53819064066178 0.03790283203125 3 0.9648975859744713 6.567728982010624 3362.0 2.542 0.0 - - - - - - - 319.8 6 10 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 741 95 C20140710_OR016_03 C20140710_OR016_03 TB424057.[MT7]-EQLLDC[CAM]EGEDGWNK[MT7].3b3_1.heavy 660.979 / 515.295 4756.0 32.67387390136719 42 16 10 6 10 2.051907126508285 38.53819064066178 0.03790283203125 3 0.9648975859744713 6.567728982010624 4756.0 0.0 1.0 - - - - - - - 874.6666666666666 9 9 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 743 96 C20140710_OR016_03 C20140710_OR016_03 TB445116.[MT7]-VFFLFDNLLVYC[CAM]K[MT7].2b3_1.heavy 983.541 / 538.315 1952.0 54.04610061645508 46 16 10 10 10 2.0112552362158835 34.93951454203327 0.0 3 0.9667688508573589 6.751178947283731 1952.0 53.21032863849764 0.0 - - - - - - - 105.6875 3 16 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 745 96 C20140710_OR016_03 C20140710_OR016_03 TB445116.[MT7]-VFFLFDNLLVYC[CAM]K[MT7].2b4_1.heavy 983.541 / 651.399 1809.0 54.04610061645508 46 16 10 10 10 2.0112552362158835 34.93951454203327 0.0 3 0.9667688508573589 6.751178947283731 1809.0 45.69055147058823 0.0 - - - - - - - 88.33333333333333 3 21 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 747 96 C20140710_OR016_03 C20140710_OR016_03 TB445116.[MT7]-VFFLFDNLLVYC[CAM]K[MT7].2y3_1.heavy 983.541 / 614.309 1690.0 54.04610061645508 46 16 10 10 10 2.0112552362158835 34.93951454203327 0.0 3 0.9667688508573589 6.751178947283731 1690.0 24.316653934300994 0.0 - - - - - - - 103.58823529411765 3 17 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 749 96 C20140710_OR016_03 C20140710_OR016_03 TB445116.[MT7]-VFFLFDNLLVYC[CAM]K[MT7].2b7_1.heavy 983.541 / 1027.54 381.0 54.04610061645508 46 16 10 10 10 2.0112552362158835 34.93951454203327 0.0 3 0.9667688508573589 6.751178947283731 381.0 8.97888098802395 6.0 - - - - - - - 0.0 1 0 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 751 97 C20140710_OR016_03 C20140710_OR016_03 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 213916.0 26.666500091552734 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 213916.0 405.5390357011622 0.0 - - - - - - - 996.0 427 1 753 97 C20140710_OR016_03 C20140710_OR016_03 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 255033.0 26.666500091552734 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 255033.0 307.5245935966405 0.0 - - - - - - - 1766.0 510 2 755 97 C20140710_OR016_03 C20140710_OR016_03 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 350398.0 26.666500091552734 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 350398.0 492.22172196107084 0.0 - - - - - - - 2853.0 700 2 757 98 C20140710_OR016_03 C20140710_OR016_03 TB445014.[MT7]-VNNVYDVDNK[MT7].3b6_1.heavy 489.928 / 849.422 1232.0 25.659700393676758 36 18 0 10 8 3.8486404568470194 25.983201372342414 0.0 4 0.9853627384588316 10.188289708085916 1232.0 13.28528700391756 0.0 - - - - - - - 103.0 2 4 SDCCAG1 serologically defined colon cancer antigen 1 759 98 C20140710_OR016_03 C20140710_OR016_03 TB445014.[MT7]-VNNVYDVDNK[MT7].3y3_1.heavy 489.928 / 520.285 3696.0 25.659700393676758 36 18 0 10 8 3.8486404568470194 25.983201372342414 0.0 4 0.9853627384588316 10.188289708085916 3696.0 0.8567057513156038 2.0 - - - - - - - 176.0 40 7 SDCCAG1 serologically defined colon cancer antigen 1 761 98 C20140710_OR016_03 C20140710_OR016_03 TB445014.[MT7]-VNNVYDVDNK[MT7].3b4_1.heavy 489.928 / 571.332 3799.0 25.659700393676758 36 18 0 10 8 3.8486404568470194 25.983201372342414 0.0 4 0.9853627384588316 10.188289708085916 3799.0 25.270529681928398 0.0 - - - - - - - 182.66666666666666 7 9 SDCCAG1 serologically defined colon cancer antigen 1 763 98 C20140710_OR016_03 C20140710_OR016_03 TB445014.[MT7]-VNNVYDVDNK[MT7].3y4_1.heavy 489.928 / 619.353 1027.0 25.659700393676758 36 18 0 10 8 3.8486404568470194 25.983201372342414 0.0 4 0.9853627384588316 10.188289708085916 1027.0 4.002925245486221 2.0 - - - - - - - 190.71428571428572 12 7 SDCCAG1 serologically defined colon cancer antigen 1 765 99 C20140710_OR016_03 C20140710_OR016_03 TB444846.[MT7]-ANHVVK[MT7].2y4_1.heavy 478.3 / 626.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMLN leishmanolysin-like (metallopeptidase M8 family) 767 99 C20140710_OR016_03 C20140710_OR016_03 TB444846.[MT7]-ANHVVK[MT7].2y5_1.heavy 478.3 / 740.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMLN leishmanolysin-like (metallopeptidase M8 family) 769 99 C20140710_OR016_03 C20140710_OR016_03 TB444846.[MT7]-ANHVVK[MT7].2b4_1.heavy 478.3 / 566.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMLN leishmanolysin-like (metallopeptidase M8 family) 771 99 C20140710_OR016_03 C20140710_OR016_03 TB444846.[MT7]-ANHVVK[MT7].2y3_1.heavy 478.3 / 489.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMLN leishmanolysin-like (metallopeptidase M8 family) 773 100 C20140710_OR016_03 C20140710_OR016_03 TB424053.[MT7]-NTDVPLEGYLVTPIQR.2y4_1.heavy 980.037 / 513.314 2684.0 41.154775619506836 34 12 10 2 10 2.2974314644492155 43.52686970097449 0.0829010009765625 3 0.8945515528058873 3.766604059337474 2684.0 38.5825 0.0 - - - - - - - 191.875 5 8 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 775 100 C20140710_OR016_03 C20140710_OR016_03 TB424053.[MT7]-NTDVPLEGYLVTPIQR.2y10_1.heavy 980.037 / 1175.64 639.0 41.154775619506836 34 12 10 2 10 2.2974314644492155 43.52686970097449 0.0829010009765625 3 0.8945515528058873 3.766604059337474 639.0 4.014474747062663 9.0 - - - - - - - 182.71428571428572 2 7 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 777 100 C20140710_OR016_03 C20140710_OR016_03 TB424053.[MT7]-NTDVPLEGYLVTPIQR.2b4_1.heavy 980.037 / 574.295 9970.0 41.154775619506836 34 12 10 2 10 2.2974314644492155 43.52686970097449 0.0829010009765625 3 0.8945515528058873 3.766604059337474 9970.0 7.825184114507551 0.0 - - - - - - - 287.5 19 8 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 779 100 C20140710_OR016_03 C20140710_OR016_03 TB424053.[MT7]-NTDVPLEGYLVTPIQR.2y9_1.heavy 980.037 / 1046.6 3707.0 41.154775619506836 34 12 10 2 10 2.2974314644492155 43.52686970097449 0.0829010009765625 3 0.8945515528058873 3.766604059337474 3707.0 29.091792787286064 0.0 - - - - - - - 219.28571428571428 7 7 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 781 101 C20140710_OR016_03 C20140710_OR016_03 TB444849.[MT7]-GIALDGK[MT7].2y4_1.heavy 481.3 / 576.347 1690.0 25.659700393676758 44 16 10 10 8 2.5524734178095962 39.177685182639415 0.0 4 0.9652204121365572 6.5983194126572196 1690.0 5.941233305875521 2.0 - - - - - - - 198.6 5 5 SAG S-antigen; retina and pineal gland (arrestin) 783 101 C20140710_OR016_03 C20140710_OR016_03 TB444849.[MT7]-GIALDGK[MT7].2y5_1.heavy 481.3 / 647.385 5567.0 25.659700393676758 44 16 10 10 8 2.5524734178095962 39.177685182639415 0.0 4 0.9652204121365572 6.5983194126572196 5567.0 36.615167785234895 0.0 - - - - - - - 198.625 11 8 SAG S-antigen; retina and pineal gland (arrestin) 785 101 C20140710_OR016_03 C20140710_OR016_03 TB444849.[MT7]-GIALDGK[MT7].2y6_1.heavy 481.3 / 760.469 895.0 25.659700393676758 44 16 10 10 8 2.5524734178095962 39.177685182639415 0.0 4 0.9652204121365572 6.5983194126572196 895.0 5.098158578125527 3.0 - - - - - - - 0.0 1 0 SAG S-antigen; retina and pineal gland (arrestin) 787 101 C20140710_OR016_03 C20140710_OR016_03 TB444849.[MT7]-GIALDGK[MT7].2b5_1.heavy 481.3 / 614.363 5070.0 25.659700393676758 44 16 10 10 8 2.5524734178095962 39.177685182639415 0.0 4 0.9652204121365572 6.5983194126572196 5070.0 24.856215463281316 1.0 - - - - - - - 255.57142857142858 10 7 SAG S-antigen; retina and pineal gland (arrestin) 789 102 C20140710_OR016_03 C20140710_OR016_03 TB424050.[MT7]-HSDYAAVMEALQAMK[MT7].4b7_1.heavy 489.001 / 888.433 741.0 42.672149658203125 36 10 10 6 10 0.7691759262880293 74.54675942888036 0.03900146484375 3 0.8259111560752577 2.9138359116158257 741.0 6.024390243902439 0.0 - - - - - - - 0.0 1 0 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 791 102 C20140710_OR016_03 C20140710_OR016_03 TB424050.[MT7]-HSDYAAVMEALQAMK[MT7].4b5_1.heavy 489.001 / 718.328 3580.0 42.672149658203125 36 10 10 6 10 0.7691759262880293 74.54675942888036 0.03900146484375 3 0.8259111560752577 2.9138359116158257 3580.0 57.33821138211382 0.0 - - - - - - - 154.0 7 4 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 793 102 C20140710_OR016_03 C20140710_OR016_03 TB424050.[MT7]-HSDYAAVMEALQAMK[MT7].4y3_1.heavy 489.001 / 493.293 5802.0 42.672149658203125 36 10 10 6 10 0.7691759262880293 74.54675942888036 0.03900146484375 3 0.8259111560752577 2.9138359116158257 5802.0 29.845049439683585 0.0 - - - - - - - 246.66666666666666 11 3 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 795 102 C20140710_OR016_03 C20140710_OR016_03 TB424050.[MT7]-HSDYAAVMEALQAMK[MT7].4b6_1.heavy 489.001 / 789.365 2839.0 42.672149658203125 36 10 10 6 10 0.7691759262880293 74.54675942888036 0.03900146484375 3 0.8259111560752577 2.9138359116158257 2839.0 28.45238189408921 0.0 - - - - - - - 308.5 5 4 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 797 103 C20140710_OR016_03 C20140710_OR016_03 TB424156.[MT7]-ASVIMVDELLSAYPHQLSFSEAGLR.4y10_1.heavy 720.129 / 1107.58 718.0 49.36470031738281 42 18 10 10 4 2.3918740770461855 32.51012421509051 0.0 10 0.9851218219202262 10.105261569143979 718.0 6.91605121850475 2.0 - - - - - - - 0.0 1 0 SLC24A3 solute carrier family 24 (sodium/potassium/calcium exchanger), member 3 799 103 C20140710_OR016_03 C20140710_OR016_03 TB424156.[MT7]-ASVIMVDELLSAYPHQLSFSEAGLR.4y9_1.heavy 720.129 / 979.521 359.0 49.36470031738281 42 18 10 10 4 2.3918740770461855 32.51012421509051 0.0 10 0.9851218219202262 10.105261569143979 359.0 2.593333333333333 17.0 - - - - - - - 0.0 1 0 SLC24A3 solute carrier family 24 (sodium/potassium/calcium exchanger), member 3 801 103 C20140710_OR016_03 C20140710_OR016_03 TB424156.[MT7]-ASVIMVDELLSAYPHQLSFSEAGLR.4b4_1.heavy 720.129 / 515.331 1257.0 49.36470031738281 42 18 10 10 4 2.3918740770461855 32.51012421509051 0.0 10 0.9851218219202262 10.105261569143979 1257.0 15.563340668523677 0.0 - - - - - - - 224.5 2 8 SLC24A3 solute carrier family 24 (sodium/potassium/calcium exchanger), member 3 803 103 C20140710_OR016_03 C20140710_OR016_03 TB424156.[MT7]-ASVIMVDELLSAYPHQLSFSEAGLR.4b5_1.heavy 720.129 / 646.371 N/A 49.36470031738281 42 18 10 10 4 2.3918740770461855 32.51012421509051 0.0 10 0.9851218219202262 10.105261569143979 629.0 0.12732793522267205 11.0 - - - - - - - 0.0 1 0 SLC24A3 solute carrier family 24 (sodium/potassium/calcium exchanger), member 3 805 104 C20140710_OR016_03 C20140710_OR016_03 TB423636.[MT7]-AIQVVR.2y4_1.heavy 415.272 / 501.314 2345.0 23.7185001373291 43 13 10 10 10 0.9913507257258006 58.87632036896929 0.0 3 0.9097479071390004 4.076730157202972 2345.0 15.288480392156861 2.0 - - - - - - - 244.8 4 10 SDCCAG1 serologically defined colon cancer antigen 1 807 104 C20140710_OR016_03 C20140710_OR016_03 TB423636.[MT7]-AIQVVR.2b3_1.heavy 415.272 / 457.289 4282.0 23.7185001373291 43 13 10 10 10 0.9913507257258006 58.87632036896929 0.0 3 0.9097479071390004 4.076730157202972 4282.0 48.86517647058823 0.0 - - - - - - - 234.6 8 10 SDCCAG1 serologically defined colon cancer antigen 1 809 104 C20140710_OR016_03 C20140710_OR016_03 TB423636.[MT7]-AIQVVR.2y5_1.heavy 415.272 / 614.398 4180.0 23.7185001373291 43 13 10 10 10 0.9913507257258006 58.87632036896929 0.0 3 0.9097479071390004 4.076730157202972 4180.0 40.93941176470588 0.0 - - - - - - - 127.5 8 8 SDCCAG1 serologically defined colon cancer antigen 1 811 104 C20140710_OR016_03 C20140710_OR016_03 TB423636.[MT7]-AIQVVR.2b4_1.heavy 415.272 / 556.357 6117.0 23.7185001373291 43 13 10 10 10 0.9913507257258006 58.87632036896929 0.0 3 0.9097479071390004 4.076730157202972 6117.0 49.37578431372549 0.0 - - - - - - - 233.14285714285714 12 7 SDCCAG1 serologically defined colon cancer antigen 1 813 105 C20140710_OR016_03 C20140710_OR016_03 TB444840.[MT7]-NIAHAK[MT7].2y4_1.heavy 471.292 / 570.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC5A3 solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 815 105 C20140710_OR016_03 C20140710_OR016_03 TB444840.[MT7]-NIAHAK[MT7].2y5_1.heavy 471.292 / 683.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC5A3 solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 817 105 C20140710_OR016_03 C20140710_OR016_03 TB444840.[MT7]-NIAHAK[MT7].2b4_1.heavy 471.292 / 580.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC5A3 solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 819 105 C20140710_OR016_03 C20140710_OR016_03 TB444840.[MT7]-NIAHAK[MT7].2y3_1.heavy 471.292 / 499.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC5A3 solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 821 106 C20140710_OR016_03 C20140710_OR016_03 TB433048.[MT7]-AAEPLLTLERLTEIVASAPK[MT7].4y4_1.heavy 603.359 / 546.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 823 106 C20140710_OR016_03 C20140710_OR016_03 TB433048.[MT7]-AAEPLLTLERLTEIVASAPK[MT7].4y5_1.heavy 603.359 / 617.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 825 106 C20140710_OR016_03 C20140710_OR016_03 TB433048.[MT7]-AAEPLLTLERLTEIVASAPK[MT7].4b13_2.heavy 603.359 / 791.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 827 106 C20140710_OR016_03 C20140710_OR016_03 TB433048.[MT7]-AAEPLLTLERLTEIVASAPK[MT7].4b5_1.heavy 603.359 / 626.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 829 107 C20140710_OR016_03 C20140710_OR016_03 TB433049.[MT7]-LTVDTLPPLSTYDSSDTNAK[MT7].3y7_1.heavy 809.423 / 866.434 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 831 107 C20140710_OR016_03 C20140710_OR016_03 TB433049.[MT7]-LTVDTLPPLSTYDSSDTNAK[MT7].3b6_1.heavy 809.423 / 787.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 833 107 C20140710_OR016_03 C20140710_OR016_03 TB433049.[MT7]-LTVDTLPPLSTYDSSDTNAK[MT7].3b4_1.heavy 809.423 / 573.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 835 107 C20140710_OR016_03 C20140710_OR016_03 TB433049.[MT7]-LTVDTLPPLSTYDSSDTNAK[MT7].3b5_1.heavy 809.423 / 674.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 837 108 C20140710_OR016_03 C20140710_OR016_03 TB432874.[MT7]-SVEELLPEK[MT7].3y3_1.heavy 444.594 / 517.31 11919.0 33.952598571777344 44 14 10 10 10 2.1704084937497603 35.85773102573727 0.0 3 0.941858987970509 5.093239370286814 11919.0 53.435949482198644 1.0 - - - - - - - 245.2 23 5 LMLN leishmanolysin-like (metallopeptidase M8 family) 839 108 C20140710_OR016_03 C20140710_OR016_03 TB432874.[MT7]-SVEELLPEK[MT7].3b4_1.heavy 444.594 / 589.295 7241.0 33.952598571777344 44 14 10 10 10 2.1704084937497603 35.85773102573727 0.0 3 0.941858987970509 5.093239370286814 7241.0 21.06737499828718 1.0 - - - - - - - 166.75 14 4 LMLN leishmanolysin-like (metallopeptidase M8 family) 841 108 C20140710_OR016_03 C20140710_OR016_03 TB432874.[MT7]-SVEELLPEK[MT7].3b5_1.heavy 444.594 / 702.379 3787.0 33.952598571777344 44 14 10 10 10 2.1704084937497603 35.85773102573727 0.0 3 0.941858987970509 5.093239370286814 3787.0 10.810287253141832 0.0 - - - - - - - 254.57142857142858 7 7 LMLN leishmanolysin-like (metallopeptidase M8 family) 843 108 C20140710_OR016_03 C20140710_OR016_03 TB432874.[MT7]-SVEELLPEK[MT7].3b3_1.heavy 444.594 / 460.252 3787.0 33.952598571777344 44 14 10 10 10 2.1704084937497603 35.85773102573727 0.0 3 0.941858987970509 5.093239370286814 3787.0 4.42349398938551 1.0 - - - - - - - 204.16666666666666 8 6 LMLN leishmanolysin-like (metallopeptidase M8 family) 845 109 C20140710_OR016_03 C20140710_OR016_03 TB424152.[MT7]-RNVMETFAK[MT7]PEIGDLGMLSMK[MT7].4y4_1.heavy 700.629 / 622.371 24804.0 41.03990173339844 46 16 10 10 10 1.7796520910351006 44.52016878286079 0.0 3 0.9651880954731711 6.59523802709793 24804.0 102.31380304903172 0.0 - - - - - - - 236.0 49 12 GALP galanin-like peptide 847 109 C20140710_OR016_03 C20140710_OR016_03 TB424152.[MT7]-RNVMETFAK[MT7]PEIGDLGMLSMK[MT7].4b16_2.heavy 700.629 / 1024.05 49070.0 41.03990173339844 46 16 10 10 10 1.7796520910351006 44.52016878286079 0.0 3 0.9651880954731711 6.59523802709793 49070.0 142.65218477327184 0.0 - - - - - - - 269.6 98 5 GALP galanin-like peptide 849 109 C20140710_OR016_03 C20140710_OR016_03 TB424152.[MT7]-RNVMETFAK[MT7]PEIGDLGMLSMK[MT7].4b14_2.heavy 700.629 / 938.995 31814.0 41.03990173339844 46 16 10 10 10 1.7796520910351006 44.52016878286079 0.0 3 0.9651880954731711 6.59523802709793 31814.0 151.9827227722772 0.0 - - - - - - - 269.6666666666667 63 6 GALP galanin-like peptide 851 109 C20140710_OR016_03 C20140710_OR016_03 TB424152.[MT7]-RNVMETFAK[MT7]PEIGDLGMLSMK[MT7].4y3_1.heavy 700.629 / 509.287 66190.0 41.03990173339844 46 16 10 10 10 1.7796520910351006 44.52016878286079 0.0 3 0.9651880954731711 6.59523802709793 66190.0 525.385721908349 0.0 - - - - - - - 269.6 132 5 GALP galanin-like peptide 853 110 C20140710_OR016_03 C20140710_OR016_03 TB432875.[MT7]-IINYTPDMAR.2y8_1.heavy 669.354 / 967.43 16359.0 32.769948959350586 46 20 10 6 10 8.767913286991234 11.40522228343292 0.03859710693359375 3 0.994600394089021 16.787488405236058 16359.0 253.99499999999995 0.0 - - - - - - - 190.1 32 10 MMP27 matrix metallopeptidase 27 855 110 C20140710_OR016_03 C20140710_OR016_03 TB432875.[MT7]-IINYTPDMAR.2y5_1.heavy 669.354 / 589.276 8465.0 32.769948959350586 46 20 10 6 10 8.767913286991234 11.40522228343292 0.03859710693359375 3 0.994600394089021 16.787488405236058 8465.0 64.37855263157894 0.0 - - - - - - - 250.63636363636363 16 11 MMP27 matrix metallopeptidase 27 857 110 C20140710_OR016_03 C20140710_OR016_03 TB432875.[MT7]-IINYTPDMAR.2y9_1.heavy 669.354 / 1080.51 26441.0 32.769948959350586 46 20 10 6 10 8.767913286991234 11.40522228343292 0.03859710693359375 3 0.994600394089021 16.787488405236058 26441.0 196.91586842105266 0.0 - - - - - - - 207.36363636363637 52 11 MMP27 matrix metallopeptidase 27 859 110 C20140710_OR016_03 C20140710_OR016_03 TB432875.[MT7]-IINYTPDMAR.2y7_1.heavy 669.354 / 853.387 5326.0 32.769948959350586 46 20 10 6 10 8.767913286991234 11.40522228343292 0.03859710693359375 3 0.994600394089021 16.787488405236058 5326.0 34.57228070175439 0.0 - - - - - - - 237.5 10 4 MMP27 matrix metallopeptidase 27 861 111 C20140710_OR016_03 C20140710_OR016_03 TB432876.[MT7]-VMLDIVAMFR.2b4_1.heavy 669.873 / 603.329 32414.0 52.88959884643555 50 20 10 10 10 4.641345795040984 17.178621745617544 0.0 3 0.9914788656658564 13.359948707042902 32414.0 -9.922653061224509 0.0 - - - - - - - 163.5 64 6 S100A7L2 S100 calcium binding protein A7-like 2 863 111 C20140710_OR016_03 C20140710_OR016_03 TB432876.[MT7]-VMLDIVAMFR.2y9_1.heavy 669.873 / 1095.57 38832.0 52.88959884643555 50 20 10 10 10 4.641345795040984 17.178621745617544 0.0 3 0.9914788656658564 13.359948707042902 38832.0 -23.896615384615416 0.0 - - - - - - - 143.8 77 5 S100A7L2 S100 calcium binding protein A7-like 2 865 111 C20140710_OR016_03 C20140710_OR016_03 TB432876.[MT7]-VMLDIVAMFR.2y6_1.heavy 669.873 / 736.417 30188.0 52.88959884643555 50 20 10 10 10 4.641345795040984 17.178621745617544 0.0 3 0.9914788656658564 13.359948707042902 30188.0 0.0 0.0 - - - - - - - 147.0 60 4 S100A7L2 S100 calcium binding protein A7-like 2 867 111 C20140710_OR016_03 C20140710_OR016_03 TB432876.[MT7]-VMLDIVAMFR.2y7_1.heavy 669.873 / 851.444 25997.0 52.88959884643555 50 20 10 10 10 4.641345795040984 17.178621745617544 0.0 3 0.9914788656658564 13.359948707042902 25997.0 -0.399953846153835 0.0 - - - - - - - 196.0 51 3 S100A7L2 S100 calcium binding protein A7-like 2 869 112 C20140710_OR016_03 C20140710_OR016_03 TB433044.[MT7]-TERDYVGTLEFLVSAFLHR.4b8_2.heavy 600.073 / 533.768 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 871 112 C20140710_OR016_03 C20140710_OR016_03 TB433044.[MT7]-TERDYVGTLEFLVSAFLHR.4y7_1.heavy 600.073 / 829.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 873 112 C20140710_OR016_03 C20140710_OR016_03 TB433044.[MT7]-TERDYVGTLEFLVSAFLHR.4y6_1.heavy 600.073 / 730.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 875 112 C20140710_OR016_03 C20140710_OR016_03 TB433044.[MT7]-TERDYVGTLEFLVSAFLHR.4b10_2.heavy 600.073 / 654.831 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 877 113 C20140710_OR016_03 C20140710_OR016_03 TB444940.[MT7]-SRFSTIDLR.3b5_1.heavy 413.571 / 723.391 1256.0 28.779249668121338 33 14 10 3 6 1.8007232296206082 44.72120025006652 0.05840110778808594 6 0.9496248823178095 5.4753781865966165 1256.0 8.000816326530613 0.0 - - - - - - - 211.7 2 10 SDCCAG1 serologically defined colon cancer antigen 1 879 113 C20140710_OR016_03 C20140710_OR016_03 TB444940.[MT7]-SRFSTIDLR.3y4_1.heavy 413.571 / 516.314 1884.0 28.779249668121338 33 14 10 3 6 1.8007232296206082 44.72120025006652 0.05840110778808594 6 0.9496248823178095 5.4753781865966165 1884.0 11.057142857142855 3.0 - - - - - - - 207.52941176470588 11 17 SDCCAG1 serologically defined colon cancer antigen 1 881 113 C20140710_OR016_03 C20140710_OR016_03 TB444940.[MT7]-SRFSTIDLR.3y5_1.heavy 413.571 / 617.362 785.0 28.779249668121338 33 14 10 3 6 1.8007232296206082 44.72120025006652 0.05840110778808594 6 0.9496248823178095 5.4753781865966165 785.0 4.377620396600567 3.0 - - - - - - - 0.0 1 0 SDCCAG1 serologically defined colon cancer antigen 1 883 113 C20140710_OR016_03 C20140710_OR016_03 TB444940.[MT7]-SRFSTIDLR.3b7_2.heavy 413.571 / 476.254 28097.0 28.779249668121338 33 14 10 3 6 1.8007232296206082 44.72120025006652 0.05840110778808594 6 0.9496248823178095 5.4753781865966165 28097.0 192.31918633961243 0.0 - - - - - - - 254.875 56 16 SDCCAG1 serologically defined colon cancer antigen 1 885 114 C20140710_OR016_03 C20140710_OR016_03 TB433045.[MT7]-TERDYVGTLEFLVSAFLHR.3y7_1.heavy 799.761 / 829.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 887 114 C20140710_OR016_03 C20140710_OR016_03 TB433045.[MT7]-TERDYVGTLEFLVSAFLHR.3y6_1.heavy 799.761 / 730.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 889 114 C20140710_OR016_03 C20140710_OR016_03 TB433045.[MT7]-TERDYVGTLEFLVSAFLHR.3b10_2.heavy 799.761 / 654.831 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 891 114 C20140710_OR016_03 C20140710_OR016_03 TB433045.[MT7]-TERDYVGTLEFLVSAFLHR.3y8_1.heavy 799.761 / 942.552 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 893 115 C20140710_OR016_03 C20140710_OR016_03 TB424151.[MT7]-QEGENILTPEALGLHLQAALTASK[MT7].3b6_1.heavy 931.518 / 815.402 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTCH2 patched 2 895 115 C20140710_OR016_03 C20140710_OR016_03 TB424151.[MT7]-QEGENILTPEALGLHLQAALTASK[MT7].3b4_1.heavy 931.518 / 588.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTCH2 patched 2 897 115 C20140710_OR016_03 C20140710_OR016_03 TB424151.[MT7]-QEGENILTPEALGLHLQAALTASK[MT7].3b5_1.heavy 931.518 / 702.318 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTCH2 patched 2 899 115 C20140710_OR016_03 C20140710_OR016_03 TB424151.[MT7]-QEGENILTPEALGLHLQAALTASK[MT7].3b8_1.heavy 931.518 / 1029.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTCH2 patched 2 901 116 C20140710_OR016_03 C20140710_OR016_03 TB432884.[MT7]-K[MT7]LTAENEK[MT7].2y5_1.heavy 682.909 / 734.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 903 116 C20140710_OR016_03 C20140710_OR016_03 TB432884.[MT7]-K[MT7]LTAENEK[MT7].2b6_1.heavy 682.909 / 945.561 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 905 116 C20140710_OR016_03 C20140710_OR016_03 TB432884.[MT7]-K[MT7]LTAENEK[MT7].2y6_1.heavy 682.909 / 835.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 907 116 C20140710_OR016_03 C20140710_OR016_03 TB432884.[MT7]-K[MT7]LTAENEK[MT7].2y7_1.heavy 682.909 / 948.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 909 117 C20140710_OR016_03 C20140710_OR016_03 TB423918.[MT7]-DTSFLGSDDIGK[MT7].3b9_1.heavy 514.935 / 1082.48 92.0 32.712175369262695 36 13 10 3 10 2.8261295382524376 35.3840822391446 0.07660293579101562 3 0.929374709279346 4.61628354256458 92.0 1.1989189189189189 17.0 - - - - - - - 0.0 0 0 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 911 117 C20140710_OR016_03 C20140710_OR016_03 TB423918.[MT7]-DTSFLGSDDIGK[MT7].3b4_1.heavy 514.935 / 595.284 4802.0 32.712175369262695 36 13 10 3 10 2.8261295382524376 35.3840822391446 0.07660293579101562 3 0.929374709279346 4.61628354256458 4802.0 20.4672136616673 0.0 - - - - - - - 291.15384615384613 9 13 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 913 117 C20140710_OR016_03 C20140710_OR016_03 TB423918.[MT7]-DTSFLGSDDIGK[MT7].3b5_1.heavy 514.935 / 708.369 2863.0 32.712175369262695 36 13 10 3 10 2.8261295382524376 35.3840822391446 0.07660293579101562 3 0.929374709279346 4.61628354256458 2863.0 27.670816864295123 0.0 - - - - - - - 230.7 5 10 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 915 117 C20140710_OR016_03 C20140710_OR016_03 TB423918.[MT7]-DTSFLGSDDIGK[MT7].3y4_1.heavy 514.935 / 576.347 3140.0 32.712175369262695 36 13 10 3 10 2.8261295382524376 35.3840822391446 0.07660293579101562 3 0.929374709279346 4.61628354256458 3140.0 16.498877833543677 0.0 - - - - - - - 260.1818181818182 6 11 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 917 118 C20140710_OR016_03 C20140710_OR016_03 TB444937.[MT7]-RPAGTILLSR.3b6_1.heavy 409.927 / 740.453 2499.0 26.97610092163086 45 17 10 10 8 5.304526276011107 18.8518247995555 0.0 4 0.9730360118793102 7.498762289372197 2499.0 46.486774193548385 0.0 - - - - - - - 169.83333333333334 4 6 LMLN leishmanolysin-like (metallopeptidase M8 family) 919 118 C20140710_OR016_03 C20140710_OR016_03 TB444937.[MT7]-RPAGTILLSR.3b4_1.heavy 409.927 / 526.322 3795.0 26.97610092163086 45 17 10 10 8 5.304526276011107 18.8518247995555 0.0 4 0.9730360118793102 7.498762289372197 3795.0 22.132308855291576 1.0 - - - - - - - 220.0 9 8 LMLN leishmanolysin-like (metallopeptidase M8 family) 921 118 C20140710_OR016_03 C20140710_OR016_03 TB444937.[MT7]-RPAGTILLSR.3b5_1.heavy 409.927 / 627.37 5183.0 26.97610092163086 45 17 10 10 8 5.304526276011107 18.8518247995555 0.0 4 0.9730360118793102 7.498762289372197 5183.0 60.331264748619596 0.0 - - - - - - - 220.125 10 8 LMLN leishmanolysin-like (metallopeptidase M8 family) 923 118 C20140710_OR016_03 C20140710_OR016_03 TB444937.[MT7]-RPAGTILLSR.3y4_1.heavy 409.927 / 488.319 28694.0 26.97610092163086 45 17 10 10 8 5.304526276011107 18.8518247995555 0.0 4 0.9730360118793102 7.498762289372197 28694.0 203.18454054054055 0.0 - - - - - - - 222.2 57 10 LMLN leishmanolysin-like (metallopeptidase M8 family) 925 119 C20140710_OR016_03 C20140710_OR016_03 TB432880.[MT7]-NEMQDVISK[MT7].3y3_1.heavy 451.242 / 491.331 1359.0 28.432849884033203 31 11 8 6 6 1.101005856113399 52.363758376178545 0.032100677490234375 5 0.8682223009750395 3.361650983213887 1359.0 7.705670103092784 2.0 - - - - - - - 256.35714285714283 2 14 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 927 119 C20140710_OR016_03 C20140710_OR016_03 TB432880.[MT7]-NEMQDVISK[MT7].3b4_1.heavy 451.242 / 647.294 777.0 28.432849884033203 31 11 8 6 6 1.101005856113399 52.363758376178545 0.032100677490234375 5 0.8682223009750395 3.361650983213887 777.0 0.5340206185567009 2.0 - - - - - - - 0.0 1 0 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 929 119 C20140710_OR016_03 C20140710_OR016_03 TB432880.[MT7]-NEMQDVISK[MT7].3b5_1.heavy 451.242 / 762.321 874.0 28.432849884033203 31 11 8 6 6 1.101005856113399 52.363758376178545 0.032100677490234375 5 0.8682223009750395 3.361650983213887 874.0 4.4601030927835055 2.0 - - - - - - - 194.0 3 4 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 931 119 C20140710_OR016_03 C20140710_OR016_03 TB432880.[MT7]-NEMQDVISK[MT7].3b3_1.heavy 451.242 / 519.235 971.0 28.432849884033203 31 11 8 6 6 1.101005856113399 52.363758376178545 0.032100677490234375 5 0.8682223009750395 3.361650983213887 971.0 -0.5 3.0 - - - - - - - 0.0 1 0 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 933 120 C20140710_OR016_03 C20140710_OR016_03 TB424067.[MT7]-YVELFIVADDTVYRR.3b4_1.heavy 668.362 / 649.368 3987.0 45.13987445831299 30 18 4 2 6 3.8329933345845935 20.471227956114834 0.08380126953125 5 0.9829331937819815 9.433364832582553 3987.0 6.581714285714286 1.0 - - - - - - - 300.0 13 7 ADAM7 ADAM metallopeptidase domain 7 935 120 C20140710_OR016_03 C20140710_OR016_03 TB424067.[MT7]-YVELFIVADDTVYRR.3b5_1.heavy 668.362 / 796.436 1679.0 45.13987445831299 30 18 4 2 6 3.8329933345845935 20.471227956114834 0.08380126953125 5 0.9829331937819815 9.433364832582553 1679.0 7.462222222222222 0.0 - - - - - - - 315.0 3 8 ADAM7 ADAM metallopeptidase domain 7 937 120 C20140710_OR016_03 C20140710_OR016_03 TB424067.[MT7]-YVELFIVADDTVYRR.3y14_2.heavy 668.362 / 848.457 944.0 45.13987445831299 30 18 4 2 6 3.8329933345845935 20.471227956114834 0.08380126953125 5 0.9829331937819815 9.433364832582553 944.0 3.746031746031746 2.0 - - - - - - - 218.75 3 12 ADAM7 ADAM metallopeptidase domain 7 939 120 C20140710_OR016_03 C20140710_OR016_03 TB424067.[MT7]-YVELFIVADDTVYRR.3b3_1.heavy 668.362 / 536.284 2728.0 45.13987445831299 30 18 4 2 6 3.8329933345845935 20.471227956114834 0.08380126953125 5 0.9829331937819815 9.433364832582553 2728.0 6.6203753708595805 2.0 - - - - - - - 285.0 14 7 ADAM7 ADAM metallopeptidase domain 7 941 121 C20140710_OR016_03 C20140710_OR016_03 TB444838.[MT7]-YDVGAIR.2y5_1.heavy 469.265 / 515.33 4123.0 27.030224800109863 45 20 10 5 10 6.497635112441404 15.39021478884281 0.043300628662109375 3 0.9934240722829603 15.210573050236393 4123.0 13.58081896010645 0.0 - - - - - - - 246.9090909090909 8 11 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 943 121 C20140710_OR016_03 C20140710_OR016_03 TB444838.[MT7]-YDVGAIR.2b4_1.heavy 469.265 / 579.289 1406.0 27.030224800109863 45 20 10 5 10 6.497635112441404 15.39021478884281 0.043300628662109375 3 0.9934240722829603 15.210573050236393 1406.0 6.925352399965281 1.0 - - - - - - - 253.0 2 10 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 945 121 C20140710_OR016_03 C20140710_OR016_03 TB444838.[MT7]-YDVGAIR.2y6_1.heavy 469.265 / 630.357 2343.0 27.030224800109863 45 20 10 5 10 6.497635112441404 15.39021478884281 0.043300628662109375 3 0.9934240722829603 15.210573050236393 2343.0 17.541176470588233 0.0 - - - - - - - 196.7 4 10 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 947 121 C20140710_OR016_03 C20140710_OR016_03 TB444838.[MT7]-YDVGAIR.2b5_1.heavy 469.265 / 650.327 1687.0 27.030224800109863 45 20 10 5 10 6.497635112441404 15.39021478884281 0.043300628662109375 3 0.9934240722829603 15.210573050236393 1687.0 5.82425805424099 0.0 - - - - - - - 234.5 3 10 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 949 122 C20140710_OR016_03 C20140710_OR016_03 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 185541.0 37.697898864746094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 185541.0 93.63626010201331 0.0 - - - - - - - 243.77777777777777 371 9 951 122 C20140710_OR016_03 C20140710_OR016_03 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 411028.0 37.697898864746094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 411028.0 188.71119787799344 0.0 - - - - - - - 234.1 822 10 953 122 C20140710_OR016_03 C20140710_OR016_03 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 445268.0 37.697898864746094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 445268.0 248.3966587699317 0.0 - - - - - - - 334.57142857142856 890 7 955 123 C20140710_OR016_03 C20140710_OR016_03 TB423912.[MT7]-ILENQPEIFK[MT7].3y3_1.heavy 506.964 / 551.367 3063.0 36.06864929199219 40 17 10 5 8 4.310253930293327 18.559855546506498 0.04730224609375 4 0.9718164466919564 7.333970991905339 3063.0 11.05643451778501 2.0 - - - - - - - 278.14285714285717 6 7 LMLN leishmanolysin-like (metallopeptidase M8 family) 957 123 C20140710_OR016_03 C20140710_OR016_03 TB423912.[MT7]-ILENQPEIFK[MT7].3b4_1.heavy 506.964 / 614.363 2228.0 36.06864929199219 40 17 10 5 8 4.310253930293327 18.559855546506498 0.04730224609375 4 0.9718164466919564 7.333970991905339 2228.0 2.3995897435897433 0.0 - - - - - - - 262.77777777777777 4 9 LMLN leishmanolysin-like (metallopeptidase M8 family) 959 123 C20140710_OR016_03 C20140710_OR016_03 TB423912.[MT7]-ILENQPEIFK[MT7].3b3_1.heavy 506.964 / 500.32 2228.0 36.06864929199219 40 17 10 5 8 4.310253930293327 18.559855546506498 0.04730224609375 4 0.9718164466919564 7.333970991905339 2228.0 12.81075074868335 1.0 - - - - - - - 278.22222222222223 6 9 LMLN leishmanolysin-like (metallopeptidase M8 family) 961 123 C20140710_OR016_03 C20140710_OR016_03 TB423912.[MT7]-ILENQPEIFK[MT7].3y5_1.heavy 506.964 / 777.463 975.0 36.06864929199219 40 17 10 5 8 4.310253930293327 18.559855546506498 0.04730224609375 4 0.9718164466919564 7.333970991905339 975.0 2.4881623815760836 2.0 - - - - - - - 139.0 2 5 LMLN leishmanolysin-like (metallopeptidase M8 family) 963 124 C20140710_OR016_03 C20140710_OR016_03 TB424062.[MT7]-STLNIPTEEQSHARK[MT7].4y5_1.heavy 500.526 / 742.444 634.0 23.24970054626465 50 20 10 10 10 13.845085132474427 7.222779711584753 0.0 3 0.9928076379976111 14.54340025216969 634.0 6.970112318620607 8.0 - - - - - - - 147.375 11 8 BRS3 bombesin-like receptor 3 965 124 C20140710_OR016_03 C20140710_OR016_03 TB424062.[MT7]-STLNIPTEEQSHARK[MT7].4y10_2.heavy 500.526 / 663.848 1992.0 23.24970054626465 50 20 10 10 10 13.845085132474427 7.222779711584753 0.0 3 0.9928076379976111 14.54340025216969 1992.0 9.628246427908703 0.0 - - - - - - - 170.125 3 8 BRS3 bombesin-like receptor 3 967 124 C20140710_OR016_03 C20140710_OR016_03 TB424062.[MT7]-STLNIPTEEQSHARK[MT7].4y9_2.heavy 500.526 / 615.321 2535.0 23.24970054626465 50 20 10 10 10 13.845085132474427 7.222779711584753 0.0 3 0.9928076379976111 14.54340025216969 2535.0 10.852176665368134 0.0 - - - - - - - 196.33333333333334 5 12 BRS3 bombesin-like receptor 3 969 124 C20140710_OR016_03 C20140710_OR016_03 TB424062.[MT7]-STLNIPTEEQSHARK[MT7].4b4_1.heavy 500.526 / 560.316 7877.0 23.24970054626465 50 20 10 10 10 13.845085132474427 7.222779711584753 0.0 3 0.9928076379976111 14.54340025216969 7877.0 77.95221905166657 0.0 - - - - - - - 191.44444444444446 15 9 BRS3 bombesin-like receptor 3 971 125 C20140710_OR016_03 C20140710_OR016_03 TB445004.[MT7]-GVNMEELMSK[MT7].2b4_1.heavy 713.37 / 546.283 N/A 35.85609817504883 39 13 10 10 6 1.11790989370504 56.528331441280216 0.0 5 0.928460033944534 4.586318840482521 2654.0 1.6705638829407565 2.0 - - - - - - - 270.1666666666667 5 6 SLC30A10 solute carrier family 30, member 10 973 125 C20140710_OR016_03 C20140710_OR016_03 TB445004.[MT7]-GVNMEELMSK[MT7].2y3_1.heavy 713.37 / 509.287 1032.0 35.85609817504883 39 13 10 10 6 1.11790989370504 56.528331441280216 0.0 5 0.928460033944534 4.586318840482521 1032.0 7.952756487210269 5.0 - - - - - - - 273.42857142857144 3 7 SLC30A10 solute carrier family 30, member 10 975 125 C20140710_OR016_03 C20140710_OR016_03 TB445004.[MT7]-GVNMEELMSK[MT7].2b6_1.heavy 713.37 / 804.368 2212.0 35.85609817504883 39 13 10 10 6 1.11790989370504 56.528331441280216 0.0 5 0.928460033944534 4.586318840482521 2212.0 15.229975786924939 0.0 - - - - - - - 221.0 4 6 SLC30A10 solute carrier family 30, member 10 977 125 C20140710_OR016_03 C20140710_OR016_03 TB445004.[MT7]-GVNMEELMSK[MT7].2b5_1.heavy 713.37 / 675.325 2949.0 35.85609817504883 39 13 10 10 6 1.11790989370504 56.528331441280216 0.0 5 0.928460033944534 4.586318840482521 2949.0 4.998305084745763 0.0 - - - - - - - 294.5 5 2 SLC30A10 solute carrier family 30, member 10 979 126 C20140710_OR016_03 C20140710_OR016_03 TB445003.[MT7]-TALNSFMHSK[MT7].3y3_1.heavy 475.258 / 515.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 981 126 C20140710_OR016_03 C20140710_OR016_03 TB445003.[MT7]-TALNSFMHSK[MT7].3b4_1.heavy 475.258 / 544.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 983 126 C20140710_OR016_03 C20140710_OR016_03 TB445003.[MT7]-TALNSFMHSK[MT7].3b5_1.heavy 475.258 / 631.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 985 126 C20140710_OR016_03 C20140710_OR016_03 TB445003.[MT7]-TALNSFMHSK[MT7].3y4_1.heavy 475.258 / 646.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - SDCCAG1 serologically defined colon cancer antigen 1 987 127 C20140710_OR016_03 C20140710_OR016_03 TB423910.[MT7]-DFDHVVLLSGK[MT7].3y5_1.heavy 506.624 / 661.437 5349.0 34.17680104573568 42 17 10 5 10 3.8447674785413937 26.009375224412125 0.04380035400390625 3 0.9766614099549044 8.06263079186875 5349.0 9.723655667357207 0.0 - - - - - - - 265.85714285714283 10 7 ADAM7 ADAM metallopeptidase domain 7 989 127 C20140710_OR016_03 C20140710_OR016_03 TB423910.[MT7]-DFDHVVLLSGK[MT7].3b4_1.heavy 506.624 / 659.291 N/A 34.17680104573568 42 17 10 5 10 3.8447674785413937 26.009375224412125 0.04380035400390625 3 0.9766614099549044 8.06263079186875 14536.0 14.726910199065353 0.0 - - - - - - - 310.3333333333333 29 3 ADAM7 ADAM metallopeptidase domain 7 991 127 C20140710_OR016_03 C20140710_OR016_03 TB423910.[MT7]-DFDHVVLLSGK[MT7].3b3_1.heavy 506.624 / 522.232 11396.0 34.17680104573568 42 17 10 5 10 3.8447674785413937 26.009375224412125 0.04380035400390625 3 0.9766614099549044 8.06263079186875 11396.0 29.37230107526882 0.0 - - - - - - - 299.0 22 7 ADAM7 ADAM metallopeptidase domain 7 993 127 C20140710_OR016_03 C20140710_OR016_03 TB423910.[MT7]-DFDHVVLLSGK[MT7].3y4_1.heavy 506.624 / 548.352 5349.0 34.17680104573568 42 17 10 5 10 3.8447674785413937 26.009375224412125 0.04380035400390625 3 0.9766614099549044 8.06263079186875 5349.0 18.647421203438395 0.0 - - - - - - - 305.375 10 8 ADAM7 ADAM metallopeptidase domain 7 995 128 C20140710_OR016_03 C20140710_OR016_03 TB445001.[MT7]-EVQTVTSIQK[MT7].3b4_1.heavy 474.28 / 602.327 1219.0 25.729599952697754 31 18 2 5 6 4.631145823357798 21.592928362487903 0.04659843444824219 5 0.9821715414869521 9.229073815376989 1219.0 0.40049261083743837 3.0 - - - - - - - 270.9166666666667 10 12 SDCCAG1 serologically defined colon cancer antigen 1 997 128 C20140710_OR016_03 C20140710_OR016_03 TB445001.[MT7]-EVQTVTSIQK[MT7].3y4_1.heavy 474.28 / 619.39 812.0 25.729599952697754 31 18 2 5 6 4.631145823357798 21.592928362487903 0.04659843444824219 5 0.9821715414869521 9.229073815376989 812.0 4.72 9.0 - - - - - - - 246.57142857142858 5 7 SDCCAG1 serologically defined colon cancer antigen 1 999 128 C20140710_OR016_03 C20140710_OR016_03 TB445001.[MT7]-EVQTVTSIQK[MT7].3b3_1.heavy 474.28 / 501.279 2133.0 25.729599952697754 31 18 2 5 6 4.631145823357798 21.592928362487903 0.04659843444824219 5 0.9821715414869521 9.229073815376989 2133.0 13.575546798029556 1.0 - - - - - - - 295.45454545454544 4 11 SDCCAG1 serologically defined colon cancer antigen 1 1001 128 C20140710_OR016_03 C20140710_OR016_03 TB445001.[MT7]-EVQTVTSIQK[MT7].3y5_1.heavy 474.28 / 720.437 914.0 25.729599952697754 31 18 2 5 6 4.631145823357798 21.592928362487903 0.04659843444824219 5 0.9821715414869521 9.229073815376989 914.0 12.925158891142663 2.0 - - - - - - - 232.14285714285714 2 7 SDCCAG1 serologically defined colon cancer antigen 1 1003 129 C20140710_OR016_03 C20140710_OR016_03 TB445000.[MT7]-VTHESPTTGAK[MT7].3y6_1.heavy 472.596 / 718.422 416.0 16.77215003967285 44 18 10 6 10 4.480033543414684 22.321261443899807 0.03730010986328125 3 0.9883274111447116 11.411833416396021 416.0 4.630696884814531 2.0 - - - - - - - 0.0 0 0 BTBD2 BTB (POZ) domain containing 2 1005 129 C20140710_OR016_03 C20140710_OR016_03 TB445000.[MT7]-VTHESPTTGAK[MT7].3y5_1.heavy 472.596 / 621.369 1188.0 16.77215003967285 44 18 10 6 10 4.480033543414684 22.321261443899807 0.03730010986328125 3 0.9883274111447116 11.411833416396021 1188.0 36.64677966101695 0.0 - - - - - - - 103.75 2 8 BTBD2 BTB (POZ) domain containing 2 1007 129 C20140710_OR016_03 C20140710_OR016_03 TB445000.[MT7]-VTHESPTTGAK[MT7].3y4_1.heavy 472.596 / 520.321 1841.0 16.77215003967285 44 18 10 6 10 4.480033543414684 22.321261443899807 0.03730010986328125 3 0.9883274111447116 11.411833416396021 1841.0 19.62629035452565 0.0 - - - - - - - 200.5 3 8 BTBD2 BTB (POZ) domain containing 2 1009 129 C20140710_OR016_03 C20140710_OR016_03 TB445000.[MT7]-VTHESPTTGAK[MT7].3b3_1.heavy 472.596 / 482.284 535.0 16.77215003967285 44 18 10 6 10 4.480033543414684 22.321261443899807 0.03730010986328125 3 0.9883274111447116 11.411833416396021 535.0 3.825393258426966 2.0 - - - - - - - 0.0 1 0 BTBD2 BTB (POZ) domain containing 2 1011 130 C20140710_OR016_03 C20140710_OR016_03 TB423762.[MT7]-DAGEAEEGK[MT7].2y8_1.heavy 597.298 / 934.46 1988.0 15.918533643086752 39 13 10 6 10 1.160489948730925 49.91690185396785 0.039099693298339844 3 0.9143933135651688 4.1875548771962166 1988.0 59.601653348029764 0.0 - - - - - - - 162.625 3 8 SAG S-antigen; retina and pineal gland (arrestin) 1013 130 C20140710_OR016_03 C20140710_OR016_03 TB423762.[MT7]-DAGEAEEGK[MT7].2y5_1.heavy 597.298 / 677.359 917.0 15.918533643086752 39 13 10 6 10 1.160489948730925 49.91690185396785 0.039099693298339844 3 0.9143933135651688 4.1875548771962166 917.0 21.11513157894737 0.0 - - - - - - - 0.0 1 0 SAG S-antigen; retina and pineal gland (arrestin) 1015 130 C20140710_OR016_03 C20140710_OR016_03 TB423762.[MT7]-DAGEAEEGK[MT7].2b4_1.heavy 597.298 / 517.237 1300.0 15.918533643086752 39 13 10 6 10 1.160489948730925 49.91690185396785 0.039099693298339844 3 0.9143933135651688 4.1875548771962166 1300.0 16.72984293193717 0.0 - - - - - - - 133.77777777777777 2 18 SAG S-antigen; retina and pineal gland (arrestin) 1017 130 C20140710_OR016_03 C20140710_OR016_03 TB423762.[MT7]-DAGEAEEGK[MT7].2b5_1.heavy 597.298 / 588.275 N/A 15.918533643086752 39 13 10 6 10 1.160489948730925 49.91690185396785 0.039099693298339844 3 0.9143933135651688 4.1875548771962166 2255.0 1.311046511627907 0.0 - - - - - - - 677.1428571428571 4 7 SAG S-antigen; retina and pineal gland (arrestin) 1019 131 C20140710_OR016_03 C20140710_OR016_03 TB433057.[MT7]-VNYSEFLSLLGDITIDHHK[MT7].4y9_2.heavy 623.087 / 590.316 54142.0 49.75784873962402 39 14 10 5 10 2.6368858539453344 37.92352249543871 0.040699005126953125 3 0.9415738478550998 5.080672401591927 54142.0 226.660355535024 0.0 - - - - - - - 284.3333333333333 108 12 S100A7L2 S100 calcium binding protein A7-like 2 1021 131 C20140710_OR016_03 C20140710_OR016_03 TB433057.[MT7]-VNYSEFLSLLGDITIDHHK[MT7].4b5_1.heavy 623.087 / 737.359 59170.0 49.75784873962402 39 14 10 5 10 2.6368858539453344 37.92352249543871 0.040699005126953125 3 0.9415738478550998 5.080672401591927 59170.0 370.4933737871618 0.0 - - - - - - - 215.6 118 10 S100A7L2 S100 calcium binding protein A7-like 2 1023 131 C20140710_OR016_03 C20140710_OR016_03 TB433057.[MT7]-VNYSEFLSLLGDITIDHHK[MT7].4b6_1.heavy 623.087 / 884.427 24153.0 49.75784873962402 39 14 10 5 10 2.6368858539453344 37.92352249543871 0.040699005126953125 3 0.9415738478550998 5.080672401591927 24153.0 274.755314439946 0.0 - - - - - - - 139.0 48 11 S100A7L2 S100 calcium binding protein A7-like 2 1025 131 C20140710_OR016_03 C20140710_OR016_03 TB433057.[MT7]-VNYSEFLSLLGDITIDHHK[MT7].4b3_1.heavy 623.087 / 521.284 13917.0 49.75784873962402 39 14 10 5 10 2.6368858539453344 37.92352249543871 0.040699005126953125 3 0.9415738478550998 5.080672401591927 13917.0 148.37068333333332 0.0 - - - - - - - 239.41666666666666 27 12 S100A7L2 S100 calcium binding protein A7-like 2 1027 132 C20140710_OR016_03 C20140710_OR016_03 TB424160.[MT7]-DYIDHVSQVQPVDGVVLVDPDLVK[MT7].4y5_1.heavy 735.151 / 715.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 1029 132 C20140710_OR016_03 C20140710_OR016_03 TB424160.[MT7]-DYIDHVSQVQPVDGVVLVDPDLVK[MT7].4b5_1.heavy 735.151 / 788.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 1031 132 C20140710_OR016_03 C20140710_OR016_03 TB424160.[MT7]-DYIDHVSQVQPVDGVVLVDPDLVK[MT7].4y3_1.heavy 735.151 / 503.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 1033 132 C20140710_OR016_03 C20140710_OR016_03 TB424160.[MT7]-DYIDHVSQVQPVDGVVLVDPDLVK[MT7].4b10_2.heavy 735.151 / 665.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 1035 133 C20140710_OR016_03 C20140710_OR016_03 TB424161.[MT7]-IREIFHHAGIHNVTIQFENVDLK[MT7].4b12_2.heavy 755.418 / 785.43 2842.0 35.950401306152344 41 11 10 10 10 0.9548152600546331 69.82153454779525 0.0 3 0.8504917214583971 3.151114075631588 2842.0 21.22128118061904 0.0 - - - - - - - 267.8333333333333 5 6 SLC30A10 solute carrier family 30, member 10 1037 133 C20140710_OR016_03 C20140710_OR016_03 TB424161.[MT7]-IREIFHHAGIHNVTIQFENVDLK[MT7].4y3_1.heavy 755.418 / 519.326 4695.0 35.950401306152344 41 11 10 10 10 0.9548152600546331 69.82153454779525 0.0 3 0.8504917214583971 3.151114075631588 4695.0 20.62762803234501 0.0 - - - - - - - 278.25 9 12 SLC30A10 solute carrier family 30, member 10 1039 133 C20140710_OR016_03 C20140710_OR016_03 TB424161.[MT7]-IREIFHHAGIHNVTIQFENVDLK[MT7].4b9_2.heavy 755.418 / 603.337 1236.0 35.950401306152344 41 11 10 10 10 0.9548152600546331 69.82153454779525 0.0 3 0.8504917214583971 3.151114075631588 1236.0 3.3028340080971654 1.0 - - - - - - - 210.2 2 10 SLC30A10 solute carrier family 30, member 10 1041 133 C20140710_OR016_03 C20140710_OR016_03 TB424161.[MT7]-IREIFHHAGIHNVTIQFENVDLK[MT7].4b6_1.heavy 755.418 / 940.549 2595.0 35.950401306152344 41 11 10 10 10 0.9548152600546331 69.82153454779525 0.0 3 0.8504917214583971 3.151114075631588 2595.0 13.8592375350568 0.0 - - - - - - - 212.0 5 7 SLC30A10 solute carrier family 30, member 10 1043 134 C20140710_OR016_03 C20140710_OR016_03 TB423761.[MT7]-GLQAQGYGVR.2y8_1.heavy 596.831 / 878.448 1233.0 25.2947998046875 45 15 10 10 10 2.5907826435084607 25.763476297746003 0.0 3 0.9593430560882986 6.0997563579207155 1233.0 7.646201298701298 0.0 - - - - - - - 220.14285714285714 2 7 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1045 134 C20140710_OR016_03 C20140710_OR016_03 TB423761.[MT7]-GLQAQGYGVR.2y9_1.heavy 596.831 / 991.532 1336.0 25.2947998046875 45 15 10 10 10 2.5907826435084607 25.763476297746003 0.0 3 0.9593430560882986 6.0997563579207155 1336.0 4.541383790423546 0.0 - - - - - - - 257.25 2 4 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1047 134 C20140710_OR016_03 C20140710_OR016_03 TB423761.[MT7]-GLQAQGYGVR.2y6_1.heavy 596.831 / 679.352 617.0 25.2947998046875 45 15 10 10 10 2.5907826435084607 25.763476297746003 0.0 3 0.9593430560882986 6.0997563579207155 617.0 5.519149438945677 7.0 - - - - - - - 171.5 2 6 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1049 134 C20140710_OR016_03 C20140710_OR016_03 TB423761.[MT7]-GLQAQGYGVR.2y7_1.heavy 596.831 / 750.389 1439.0 25.2947998046875 45 15 10 10 10 2.5907826435084607 25.763476297746003 0.0 3 0.9593430560882986 6.0997563579207155 1439.0 20.746747572815533 0.0 - - - - - - - 180.0 2 4 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1051 135 C20140710_OR016_03 C20140710_OR016_03 TB433054.[MT7]-LFPC[CAM]VILTPLDC[CAM]FWEGAK[MT7].2y4_1.heavy 1227.64 / 548.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTCH2 patched 2 1053 135 C20140710_OR016_03 C20140710_OR016_03 TB433054.[MT7]-LFPC[CAM]VILTPLDC[CAM]FWEGAK[MT7].2b4_1.heavy 1227.64 / 662.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTCH2 patched 2 1055 135 C20140710_OR016_03 C20140710_OR016_03 TB433054.[MT7]-LFPC[CAM]VILTPLDC[CAM]FWEGAK[MT7].2y3_1.heavy 1227.64 / 419.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTCH2 patched 2 1057 135 C20140710_OR016_03 C20140710_OR016_03 TB433054.[MT7]-LFPC[CAM]VILTPLDC[CAM]FWEGAK[MT7].2b5_1.heavy 1227.64 / 761.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTCH2 patched 2 1059 136 C20140710_OR016_03 C20140710_OR016_03 TB424078.[MT7]-DDSDVTEVMWQPALRR.3b4_1.heavy 688.01 / 577.222 6202.0 35.92665100097656 40 15 10 5 10 1.9686603768683746 41.38272999553512 0.0475006103515625 3 0.9515879453253889 5.586216457342538 6202.0 8.84881313131313 0.0 - - - - - - - 697.7142857142857 12 7 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1061 136 C20140710_OR016_03 C20140710_OR016_03 TB424078.[MT7]-DDSDVTEVMWQPALRR.3b5_1.heavy 688.01 / 676.291 1452.0 35.92665100097656 40 15 10 5 10 1.9686603768683746 41.38272999553512 0.0475006103515625 3 0.9515879453253889 5.586216457342538 1452.0 11.513333333333332 2.0 - - - - - - - 184.8 2 5 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1063 136 C20140710_OR016_03 C20140710_OR016_03 TB424078.[MT7]-DDSDVTEVMWQPALRR.3y5_1.heavy 688.01 / 612.394 3431.0 35.92665100097656 40 15 10 5 10 1.9686603768683746 41.38272999553512 0.0475006103515625 3 0.9515879453253889 5.586216457342538 3431.0 12.476363636363637 0.0 - - - - - - - 205.33333333333334 6 9 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1065 136 C20140710_OR016_03 C20140710_OR016_03 TB424078.[MT7]-DDSDVTEVMWQPALRR.3b7_1.heavy 688.01 / 906.381 2903.0 35.92665100097656 40 15 10 5 10 1.9686603768683746 41.38272999553512 0.0475006103515625 3 0.9515879453253889 5.586216457342538 2903.0 10.336439393939393 0.0 - - - - - - - 205.33333333333334 5 9 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1067 137 C20140710_OR016_03 C20140710_OR016_03 TB444969.[MT7]-EVVETFANK[MT7].3y3_1.heavy 442.25 / 476.295 9615.0 29.041499614715576 41 18 10 3 10 5.178632525272563 19.310117007141145 0.05760002136230469 3 0.987085931902141 10.848316504809967 9615.0 46.00725806451613 0.0 - - - - - - - 260.0 19 17 RGPD1;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1069 137 C20140710_OR016_03 C20140710_OR016_03 TB444969.[MT7]-EVVETFANK[MT7].3b4_1.heavy 442.25 / 601.331 4652.0 29.041499614715576 41 18 10 3 10 5.178632525272563 19.310117007141145 0.05760002136230469 3 0.987085931902141 10.848316504809967 4652.0 34.81496774193548 0.0 - - - - - - - 161.75 9 12 RGPD1;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1071 137 C20140710_OR016_03 C20140710_OR016_03 TB444969.[MT7]-EVVETFANK[MT7].3b5_1.heavy 442.25 / 702.379 2404.0 29.041499614715576 41 18 10 3 10 5.178632525272563 19.310117007141145 0.05760002136230469 3 0.987085931902141 10.848316504809967 2404.0 25.001866260556554 0.0 - - - - - - - 217.4 4 5 RGPD1;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1073 137 C20140710_OR016_03 C20140710_OR016_03 TB444969.[MT7]-EVVETFANK[MT7].3b3_1.heavy 442.25 / 472.289 6436.0 29.041499614715576 41 18 10 3 10 5.178632525272563 19.310117007141145 0.05760002136230469 3 0.987085931902141 10.848316504809967 6436.0 38.67124463519313 0.0 - - - - - - - 212.06666666666666 12 15 RGPD1;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1075 138 C20140710_OR016_03 C20140710_OR016_03 TB432992.[MT7]-ELEAQLDDAVAEASK[MT7].2b3_1.heavy 938.991 / 516.279 2952.0 38.76850128173828 43 13 10 10 10 0.9151169152961075 65.24985765362399 0.0 3 0.9183143476388104 4.288326854273605 2952.0 1.2228834610207764 1.0 - - - - - - - 324.8 5 5 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1077 138 C20140710_OR016_03 C20140710_OR016_03 TB432992.[MT7]-ELEAQLDDAVAEASK[MT7].2y9_1.heavy 938.991 / 1049.52 3099.0 38.76850128173828 43 13 10 10 10 0.9151169152961075 65.24985765362399 0.0 3 0.9183143476388104 4.288326854273605 3099.0 9.594742929877786 1.0 - - - - - - - 197.0 7 6 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1079 138 C20140710_OR016_03 C20140710_OR016_03 TB432992.[MT7]-ELEAQLDDAVAEASK[MT7].2b4_1.heavy 938.991 / 587.316 2214.0 38.76850128173828 43 13 10 10 10 0.9151169152961075 65.24985765362399 0.0 3 0.9183143476388104 4.288326854273605 2214.0 11.502431801660482 0.0 - - - - - - - 240.0 4 8 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1081 138 C20140710_OR016_03 C20140710_OR016_03 TB432992.[MT7]-ELEAQLDDAVAEASK[MT7].2b5_1.heavy 938.991 / 715.374 2066.0 38.76850128173828 43 13 10 10 10 0.9151169152961075 65.24985765362399 0.0 3 0.9183143476388104 4.288326854273605 2066.0 19.983321117727897 0.0 - - - - - - - 221.5 4 2 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1083 139 C20140710_OR016_03 C20140710_OR016_03 TB424072.[MT7]-AAVDEAIQEGLEVWSK[MT7].3y3_1.heavy 678.365 / 564.326 29231.0 46.65775108337402 39 13 10 6 10 1.5644825663744109 43.268373967063894 0.039699554443359375 3 0.9292516240382934 4.612217608873514 29231.0 122.87100486758519 0.0 - - - - - - - 174.85714285714286 58 7 MMP27 matrix metallopeptidase 27 1085 139 C20140710_OR016_03 C20140710_OR016_03 TB424072.[MT7]-AAVDEAIQEGLEVWSK[MT7].3b6_1.heavy 678.365 / 701.359 27296.0 46.65775108337402 39 13 10 6 10 1.5644825663744109 43.268373967063894 0.039699554443359375 3 0.9292516240382934 4.612217608873514 27296.0 103.91879844135163 0.0 - - - - - - - 215.22222222222223 54 9 MMP27 matrix metallopeptidase 27 1087 139 C20140710_OR016_03 C20140710_OR016_03 TB424072.[MT7]-AAVDEAIQEGLEVWSK[MT7].3b4_1.heavy 678.365 / 501.279 11000.0 46.65775108337402 39 13 10 6 10 1.5644825663744109 43.268373967063894 0.039699554443359375 3 0.9292516240382934 4.612217608873514 11000.0 37.165617895877475 0.0 - - - - - - - 271.77777777777777 22 9 MMP27 matrix metallopeptidase 27 1089 139 C20140710_OR016_03 C20140710_OR016_03 TB424072.[MT7]-AAVDEAIQEGLEVWSK[MT7].3b5_1.heavy 678.365 / 630.321 16907.0 46.65775108337402 39 13 10 6 10 1.5644825663744109 43.268373967063894 0.039699554443359375 3 0.9292516240382934 4.612217608873514 16907.0 88.40261437908497 0.0 - - - - - - - 244.8 33 10 MMP27 matrix metallopeptidase 27 1091 140 C20140710_OR016_03 C20140710_OR016_03 TB432994.[MT7]-AIDGLPYSHPPQPSK[MT7].3y6_1.heavy 632.347 / 797.464 22269.0 29.157899856567383 46 16 10 10 10 2.144304695128333 38.20839886876262 0.0 3 0.9654844055069479 6.6236526432001375 22269.0 30.65884677453603 0.0 - - - - - - - 317.25 44 8 GALP galanin-like peptide 1093 140 C20140710_OR016_03 C20140710_OR016_03 TB432994.[MT7]-AIDGLPYSHPPQPSK[MT7].3b4_1.heavy 632.347 / 501.279 13719.0 29.157899856567383 46 16 10 10 10 2.144304695128333 38.20839886876262 0.0 3 0.9654844055069479 6.6236526432001375 13719.0 17.00367813607582 0.0 - - - - - - - 1139.5 27 8 GALP galanin-like peptide 1095 140 C20140710_OR016_03 C20140710_OR016_03 TB432994.[MT7]-AIDGLPYSHPPQPSK[MT7].3b5_1.heavy 632.347 / 614.363 30444.0 29.157899856567383 46 16 10 10 10 2.144304695128333 38.20839886876262 0.0 3 0.9654844055069479 6.6236526432001375 30444.0 17.462259288846965 0.0 - - - - - - - 1771.5714285714287 60 7 GALP galanin-like peptide 1097 140 C20140710_OR016_03 C20140710_OR016_03 TB432994.[MT7]-AIDGLPYSHPPQPSK[MT7].3y5_1.heavy 632.347 / 700.411 11745.0 29.157899856567383 46 16 10 10 10 2.144304695128333 38.20839886876262 0.0 3 0.9654844055069479 6.6236526432001375 11745.0 28.654468085106384 0.0 - - - - - - - 333.27272727272725 23 11 GALP galanin-like peptide 1099 141 C20140710_OR016_03 C20140710_OR016_03 TB424075.[MT7]-AIDGLPY[MT7]SHPPQPSK[MT7].4y5_1.heavy 510.538 / 700.411 1845.0 26.470149993896484 27 18 0 5 4 5.793692024533894 17.260151139643128 0.04309844970703125 8 0.9888001104254777 11.650627768472665 1845.0 9.63 1.0 - - - - - - - 743.0 4 8 GALP galanin-like peptide 1101 141 C20140710_OR016_03 C20140710_OR016_03 TB424075.[MT7]-AIDGLPY[MT7]SHPPQPSK[MT7].4b4_1.heavy 510.538 / 501.279 6457.0 26.470149993896484 27 18 0 5 4 5.793692024533894 17.260151139643128 0.04309844970703125 8 0.9888001104254777 11.650627768472665 6457.0 3.399778868173388 3.0 - - - - - - - 410.0 82 1 GALP galanin-like peptide 1103 141 C20140710_OR016_03 C20140710_OR016_03 TB424075.[MT7]-AIDGLPY[MT7]SHPPQPSK[MT7].4b5_1.heavy 510.538 / 614.363 4202.0 26.470149993896484 27 18 0 5 4 5.793692024533894 17.260151139643128 0.04309844970703125 8 0.9888001104254777 11.650627768472665 4202.0 2.719523602382599 2.0 - - - - - - - 369.0 11 5 GALP galanin-like peptide 1105 141 C20140710_OR016_03 C20140710_OR016_03 TB424075.[MT7]-AIDGLPY[MT7]SHPPQPSK[MT7].4y6_1.heavy 510.538 / 797.464 1127.0 26.470149993896484 27 18 0 5 4 5.793692024533894 17.260151139643128 0.04309844970703125 8 0.9888001104254777 11.650627768472665 1127.0 2.0432397103658535 1.0 - - - - - - - 263.42857142857144 2 7 GALP galanin-like peptide 1107 142 C20140710_OR016_03 C20140710_OR016_03 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 93407.0 40.474998474121094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 93407.0 741.9356168513542 0.0 - - - - - - - 284.1666666666667 186 6 1109 142 C20140710_OR016_03 C20140710_OR016_03 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 149819.0 40.474998474121094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 149819.0 1291.7547736804133 0.0 - - - - - - - 218.44444444444446 299 9 1111 142 C20140710_OR016_03 C20140710_OR016_03 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 181436.0 40.474998474121094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 181436.0 717.4151324175726 0.0 - - - - - - - 328.0 362 2 1113 143 C20140710_OR016_03 C20140710_OR016_03 TB424073.[MT7]-AAVDEAIQEGLEVWSK[MT7].4b5_1.heavy 509.025 / 630.321 1223.0 46.65775108337402 34 8 10 6 10 0.9884003665487905 59.830644752576276 0.039699554443359375 3 0.7802644120590598 2.58296423650008 1223.0 11.990196078431373 0.0 - - - - - - - 145.71428571428572 2 7 MMP27 matrix metallopeptidase 27 1115 143 C20140710_OR016_03 C20140710_OR016_03 TB424073.[MT7]-AAVDEAIQEGLEVWSK[MT7].4y3_1.heavy 509.025 / 564.326 1631.0 46.65775108337402 34 8 10 6 10 0.9884003665487905 59.830644752576276 0.039699554443359375 3 0.7802644120590598 2.58296423650008 1631.0 22.86598039215686 0.0 - - - - - - - 189.42857142857142 3 7 MMP27 matrix metallopeptidase 27 1117 143 C20140710_OR016_03 C20140710_OR016_03 TB424073.[MT7]-AAVDEAIQEGLEVWSK[MT7].4b6_1.heavy 509.025 / 701.359 1223.0 46.65775108337402 34 8 10 6 10 0.9884003665487905 59.830644752576276 0.039699554443359375 3 0.7802644120590598 2.58296423650008 1223.0 14.388235294117646 0.0 - - - - - - - 102.0 2 1 MMP27 matrix metallopeptidase 27 1119 143 C20140710_OR016_03 C20140710_OR016_03 TB424073.[MT7]-AAVDEAIQEGLEVWSK[MT7].4b4_1.heavy 509.025 / 501.279 306.0 46.65775108337402 34 8 10 6 10 0.9884003665487905 59.830644752576276 0.039699554443359375 3 0.7802644120590598 2.58296423650008 306.0 0.0 3.0 - - - - - - - 0.0 1 0 MMP27 matrix metallopeptidase 27 1121 144 C20140710_OR016_03 C20140710_OR016_03 TB424138.[MT7]-FAFLFNNEVLC[CAM]DVHFLVGK[MT7].3b4_1.heavy 853.122 / 623.367 1622.0 53.52755165100098 37 13 10 6 8 1.4890197362918516 45.3469539832484 0.03459930419921875 4 0.9191245077741237 4.3100521705931865 1622.0 -0.04505555555555496 0.0 - - - - - - - 150.0 3 4 BTBD2 BTB (POZ) domain containing 2 1123 144 C20140710_OR016_03 C20140710_OR016_03 TB424138.[MT7]-FAFLFNNEVLC[CAM]DVHFLVGK[MT7].3y4_1.heavy 853.122 / 560.389 1502.0 53.52755165100098 37 13 10 6 8 1.4890197362918516 45.3469539832484 0.03459930419921875 4 0.9191245077741237 4.3100521705931865 1502.0 -2.0026666666666664 1.0 - - - - - - - 154.28571428571428 3 7 BTBD2 BTB (POZ) domain containing 2 1125 144 C20140710_OR016_03 C20140710_OR016_03 TB424138.[MT7]-FAFLFNNEVLC[CAM]DVHFLVGK[MT7].3b3_1.heavy 853.122 / 510.283 1261.0 53.52755165100098 37 13 10 6 8 1.4890197362918516 45.3469539832484 0.03459930419921875 4 0.9191245077741237 4.3100521705931865 1261.0 -1.0508333333333333 0.0 - - - - - - - 144.0 2 5 BTBD2 BTB (POZ) domain containing 2 1127 144 C20140710_OR016_03 C20140710_OR016_03 TB424138.[MT7]-FAFLFNNEVLC[CAM]DVHFLVGK[MT7].3b8_1.heavy 853.122 / 1127.56 420.0 53.52755165100098 37 13 10 6 8 1.4890197362918516 45.3469539832484 0.03459930419921875 4 0.9191245077741237 4.3100521705931865 420.0 -0.34999999999999987 12.0 - - - - - - - 0.0 1 0 BTBD2 BTB (POZ) domain containing 2 1129 145 C20140710_OR016_03 C20140710_OR016_03 TB423892.[MT7]-TLTLLPLLANNR.2y8_1.heavy 741.96 / 910.547 3608.0 45.89590072631836 41 15 10 6 10 2.033972448337896 39.330518272872766 0.0391998291015625 3 0.9517325012328197 5.594643872272469 3608.0 34.29387420247912 1.0 - - - - - - - 227.88888888888889 7 9 SAG S-antigen; retina and pineal gland (arrestin) 1131 145 C20140710_OR016_03 C20140710_OR016_03 TB423892.[MT7]-TLTLLPLLANNR.2b4_1.heavy 741.96 / 573.373 6047.0 45.89590072631836 41 15 10 6 10 2.033972448337896 39.330518272872766 0.0391998291015625 3 0.9517325012328197 5.594643872272469 6047.0 71.64951386708529 0.0 - - - - - - - 237.0 12 7 SAG S-antigen; retina and pineal gland (arrestin) 1133 145 C20140710_OR016_03 C20140710_OR016_03 TB423892.[MT7]-TLTLLPLLANNR.2y10_1.heavy 741.96 / 1124.68 1268.0 45.89590072631836 41 15 10 6 10 2.033972448337896 39.330518272872766 0.0391998291015625 3 0.9517325012328197 5.594643872272469 1268.0 2.390491803278689 1.0 - - - - - - - 264.85714285714283 4 7 SAG S-antigen; retina and pineal gland (arrestin) 1135 145 C20140710_OR016_03 C20140710_OR016_03 TB423892.[MT7]-TLTLLPLLANNR.2y7_1.heavy 741.96 / 797.463 9363.0 45.89590072631836 41 15 10 6 10 2.033972448337896 39.330518272872766 0.0391998291015625 3 0.9517325012328197 5.594643872272469 9363.0 29.60948717948718 0.0 - - - - - - - 231.875 18 8 SAG S-antigen; retina and pineal gland (arrestin) 1137 146 C20140710_OR016_03 C20140710_OR016_03 TB433061.[MT7]-ALSELAALC[CAM]YLIAFQVPRPK[MT7].4b7_1.heavy 637.87 / 800.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1139 146 C20140710_OR016_03 C20140710_OR016_03 TB433061.[MT7]-ALSELAALC[CAM]YLIAFQVPRPK[MT7].4b4_1.heavy 637.87 / 545.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1141 146 C20140710_OR016_03 C20140710_OR016_03 TB433061.[MT7]-ALSELAALC[CAM]YLIAFQVPRPK[MT7].4b5_1.heavy 637.87 / 658.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1143 146 C20140710_OR016_03 C20140710_OR016_03 TB433061.[MT7]-ALSELAALC[CAM]YLIAFQVPRPK[MT7].4b6_1.heavy 637.87 / 729.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1145 147 C20140710_OR016_03 C20140710_OR016_03 TB423891.[MT7]-LFLYDLPEGK[MT7].3b4_1.heavy 494.953 / 681.409 480.0 42.051950454711914 41 15 10 6 10 1.85358793830783 37.83605598885467 0.03820037841796875 3 0.9592302232937145 6.091251645222403 480.0 4.0 3.0 - - - - - - - 0.0 0 0 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1147 147 C20140710_OR016_03 C20140710_OR016_03 TB423891.[MT7]-LFLYDLPEGK[MT7].3b5_1.heavy 494.953 / 796.436 1561.0 42.051950454711914 41 15 10 6 10 1.85358793830783 37.83605598885467 0.03820037841796875 3 0.9592302232937145 6.091251645222403 1561.0 7.805 2.0 - - - - - - - 360.0 3 3 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1149 147 C20140710_OR016_03 C20140710_OR016_03 TB423891.[MT7]-LFLYDLPEGK[MT7].3b3_1.heavy 494.953 / 518.346 1801.0 42.051950454711914 41 15 10 6 10 1.85358793830783 37.83605598885467 0.03820037841796875 3 0.9592302232937145 6.091251645222403 1801.0 7.0038888888888895 0.0 - - - - - - - 300.0 3 6 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1151 147 C20140710_OR016_03 C20140710_OR016_03 TB423891.[MT7]-LFLYDLPEGK[MT7].3y4_1.heavy 494.953 / 574.332 2642.0 42.051950454711914 41 15 10 6 10 1.85358793830783 37.83605598885467 0.03820037841796875 3 0.9592302232937145 6.091251645222403 2642.0 22.383611111111108 1.0 - - - - - - - 274.2857142857143 5 7 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1153 148 C20140710_OR016_03 C20140710_OR016_03 TB432997.[MT7]-C[CAM]SQNQY[MT7]HQYLK[MT7].4b5_1.heavy 475.998 / 762.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM7 ADAM metallopeptidase domain 7 1155 148 C20140710_OR016_03 C20140710_OR016_03 TB432997.[MT7]-C[CAM]SQNQY[MT7]HQYLK[MT7].4y3_1.heavy 475.998 / 567.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM7 ADAM metallopeptidase domain 7 1157 148 C20140710_OR016_03 C20140710_OR016_03 TB432997.[MT7]-C[CAM]SQNQY[MT7]HQYLK[MT7].4b3_1.heavy 475.998 / 520.231 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM7 ADAM metallopeptidase domain 7 1159 148 C20140710_OR016_03 C20140710_OR016_03 TB432997.[MT7]-C[CAM]SQNQY[MT7]HQYLK[MT7].4b6_2.heavy 475.998 / 535.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - ADAM7 ADAM metallopeptidase domain 7 1161 149 C20140710_OR016_03 C20140710_OR016_03 TB424133.[MT7]-NTDVPLEGYLVTPIQRIC[CAM]K[MT7].3y7_1.heavy 835.464 / 1058.63 4217.0 40.9984016418457 46 16 10 10 10 14.54215341667935 6.87656065334199 0.0 3 0.9643947068895027 6.520906806686272 4217.0 32.527256902235216 0.0 - - - - - - - 282.2857142857143 8 7 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1163 149 C20140710_OR016_03 C20140710_OR016_03 TB424133.[MT7]-NTDVPLEGYLVTPIQRIC[CAM]K[MT7].3b4_1.heavy 835.464 / 574.295 5008.0 40.9984016418457 46 16 10 10 10 14.54215341667935 6.87656065334199 0.0 3 0.9643947068895027 6.520906806686272 5008.0 35.63981157968918 1.0 - - - - - - - 241.66666666666666 10 6 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1165 149 C20140710_OR016_03 C20140710_OR016_03 TB424133.[MT7]-NTDVPLEGYLVTPIQRIC[CAM]K[MT7].3b8_1.heavy 835.464 / 970.496 1318.0 40.9984016418457 46 16 10 10 10 14.54215341667935 6.87656065334199 0.0 3 0.9643947068895027 6.520906806686272 1318.0 1.8331859606531737 0.0 - - - - - - - 198.0 2 12 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1167 149 C20140710_OR016_03 C20140710_OR016_03 TB424133.[MT7]-NTDVPLEGYLVTPIQRIC[CAM]K[MT7].3y8_1.heavy 835.464 / 1159.67 791.0 40.9984016418457 46 16 10 10 10 14.54215341667935 6.87656065334199 0.0 3 0.9643947068895027 6.520906806686272 791.0 -0.06276454468802695 2.0 - - - - - - - 188.57142857142858 4 7 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1169 150 C20140710_OR016_03 C20140710_OR016_03 TB433063.[MT7]-DVQENRELLESFDSALQSAK[MT7].4b11_2.heavy 642.585 / 729.371 3309.0 41.738375663757324 33 13 4 6 10 1.2283359323316123 57.85780375596241 0.039501190185546875 3 0.9059823539260397 3.992959024166693 3309.0 10.008317580340265 1.0 - - - - - - - 680.5714285714286 6 7 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1171 150 C20140710_OR016_03 C20140710_OR016_03 TB433063.[MT7]-DVQENRELLESFDSALQSAK[MT7].4y12_2.heavy 642.585 / 720.379 2383.0 41.738375663757324 33 13 4 6 10 1.2283359323316123 57.85780375596241 0.039501190185546875 3 0.9059823539260397 3.992959024166693 2383.0 12.56474435625683 3.0 - - - - - - - 297.75 20 12 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1173 150 C20140710_OR016_03 C20140710_OR016_03 TB433063.[MT7]-DVQENRELLESFDSALQSAK[MT7].4b13_2.heavy 642.585 / 860.419 3177.0 41.738375663757324 33 13 4 6 10 1.2283359323316123 57.85780375596241 0.039501190185546875 3 0.9059823539260397 3.992959024166693 3177.0 -0.5 1.0 - - - - - - - 317.5 6 10 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1175 150 C20140710_OR016_03 C20140710_OR016_03 TB433063.[MT7]-DVQENRELLESFDSALQSAK[MT7].4b10_2.heavy 642.585 / 685.855 5427.0 41.738375663757324 33 13 4 6 10 1.2283359323316123 57.85780375596241 0.039501190185546875 3 0.9059823539260397 3.992959024166693 5427.0 24.574804265326847 0.0 - - - - - - - 238.1 10 10 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1177 151 C20140710_OR016_03 C20140710_OR016_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 80957.0 35.42279815673828 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 80957.0 179.30940669431894 1.0 - - - - - - - 273.57142857142856 172 7 1179 151 C20140710_OR016_03 C20140710_OR016_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 25364.0 35.42279815673828 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 25364.0 111.32615384615384 1.0 - - - - - - - 311.1111111111111 58 9 1181 151 C20140710_OR016_03 C20140710_OR016_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 21530.0 35.42279815673828 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 21530.0 81.50406971393512 0.0 - - - - - - - 280.0 43 10 1183 152 C20140710_OR016_03 C20140710_OR016_03 TB423793.[MT7]-AAEPLLTLER.2y8_1.heavy 628.87 / 970.557 4733.0 35.99769973754883 39 18 10 1 10 8.635994404577005 11.579442426109129 0.09459686279296875 3 0.9897467055914823 12.177520722768929 4733.0 47.605623644648034 0.0 - - - - - - - 238.83333333333334 9 6 SDCCAG1 serologically defined colon cancer antigen 1 1185 152 C20140710_OR016_03 C20140710_OR016_03 TB423793.[MT7]-AAEPLLTLER.2b5_1.heavy 628.87 / 626.363 3586.0 35.99769973754883 39 18 10 1 10 8.635994404577005 11.579442426109129 0.09459686279296875 3 0.9897467055914823 12.177520722768929 3586.0 11.560116528802602 0.0 - - - - - - - 204.71428571428572 7 7 SDCCAG1 serologically defined colon cancer antigen 1 1187 152 C20140710_OR016_03 C20140710_OR016_03 TB423793.[MT7]-AAEPLLTLER.2y9_1.heavy 628.87 / 1041.59 17068.0 35.99769973754883 39 18 10 1 10 8.635994404577005 11.579442426109129 0.09459686279296875 3 0.9897467055914823 12.177520722768929 17068.0 39.080004373624135 0.0 - - - - - - - 214.75 34 4 SDCCAG1 serologically defined colon cancer antigen 1 1189 152 C20140710_OR016_03 C20140710_OR016_03 TB423793.[MT7]-AAEPLLTLER.2y7_1.heavy 628.87 / 841.514 27968.0 35.99769973754883 39 18 10 1 10 8.635994404577005 11.579442426109129 0.09459686279296875 3 0.9897467055914823 12.177520722768929 27968.0 179.30703832752613 0.0 - - - - - - - 251.0 55 4 SDCCAG1 serologically defined colon cancer antigen 1 1191 153 C20140710_OR016_03 C20140710_OR016_03 TB423792.[MT7]-AMLFDENK[MT7].2y4_1.heavy 628.333 / 649.327 3097.0 31.551174640655518 46 20 10 6 10 37.23606954891239 2.6855680852309733 0.03270149230957031 3 0.9912438051317779 13.179145523205374 3097.0 5.2216860465116275 0.0 - - - - - - - 634.25 6 8 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1193 153 C20140710_OR016_03 C20140710_OR016_03 TB423792.[MT7]-AMLFDENK[MT7].2y5_1.heavy 628.333 / 796.396 3097.0 31.551174640655518 46 20 10 6 10 37.23606954891239 2.6855680852309733 0.03270149230957031 3 0.9912438051317779 13.179145523205374 3097.0 7.202325581395349 1.0 - - - - - - - 200.66666666666666 6 18 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1195 153 C20140710_OR016_03 C20140710_OR016_03 TB423792.[MT7]-AMLFDENK[MT7].2y3_1.heavy 628.333 / 534.3 3957.0 31.551174640655518 46 20 10 6 10 37.23606954891239 2.6855680852309733 0.03270149230957031 3 0.9912438051317779 13.179145523205374 3957.0 16.4875 0.0 - - - - - - - 626.5714285714286 7 7 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1197 153 C20140710_OR016_03 C20140710_OR016_03 TB423792.[MT7]-AMLFDENK[MT7].2b5_1.heavy 628.333 / 722.366 2495.0 31.551174640655518 46 20 10 6 10 37.23606954891239 2.6855680852309733 0.03270149230957031 3 0.9912438051317779 13.179145523205374 2495.0 16.439922480620154 0.0 - - - - - - - 245.71428571428572 4 14 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1199 154 C20140710_OR016_03 C20140710_OR016_03 TB423791.[MT7]-DENFWMIR.2b3_1.heavy 627.807 / 503.222 2279.0 40.42900085449219 46 16 10 10 10 4.135604822829525 19.066376420248645 0.0 3 0.9657145705277551 6.645977516576698 2279.0 3.843686567164179 3.0 - - - - - - - 223.33333333333334 4 9 MMP27 matrix metallopeptidase 27 1201 154 C20140710_OR016_03 C20140710_OR016_03 TB423791.[MT7]-DENFWMIR.2b4_1.heavy 627.807 / 650.29 3753.0 40.42900085449219 46 16 10 10 10 4.135604822829525 19.066376420248645 0.0 3 0.9657145705277551 6.645977516576698 3753.0 20.865559701492536 0.0 - - - - - - - 193.55555555555554 7 9 MMP27 matrix metallopeptidase 27 1203 154 C20140710_OR016_03 C20140710_OR016_03 TB423791.[MT7]-DENFWMIR.2y6_1.heavy 627.807 / 866.434 2413.0 40.42900085449219 46 16 10 10 10 4.135604822829525 19.066376420248645 0.0 3 0.9657145705277551 6.645977516576698 2413.0 7.013507257587211 1.0 - - - - - - - 208.44444444444446 5 9 MMP27 matrix metallopeptidase 27 1205 154 C20140710_OR016_03 C20140710_OR016_03 TB423791.[MT7]-DENFWMIR.2y7_1.heavy 627.807 / 995.477 4155.0 40.42900085449219 46 16 10 10 10 4.135604822829525 19.066376420248645 0.0 3 0.9657145705277551 6.645977516576698 4155.0 13.63553171641791 0.0 - - - - - - - 201.0 8 6 MMP27 matrix metallopeptidase 27 1207 155 C20140710_OR016_03 C20140710_OR016_03 TB433068.[MT7]-LLIQTGDAQEPLDFSQLTTRK[MT7].3b4_1.heavy 888.16 / 612.42 4778.0 40.53127670288086 38 13 10 5 10 2.5560788484983465 39.12242380893231 0.0438995361328125 3 0.9163309472491372 4.236471699481445 4778.0 65.56671532846715 0.0 - - - - - - - 137.0 9 7 PTCH2 patched 2 1209 155 C20140710_OR016_03 C20140710_OR016_03 TB433068.[MT7]-LLIQTGDAQEPLDFSQLTTRK[MT7].3y8_1.heavy 888.16 / 1124.65 2184.0 40.53127670288086 38 13 10 5 10 2.5560788484983465 39.12242380893231 0.0438995361328125 3 0.9163309472491372 4.236471699481445 2184.0 5.119999999999999 0.0 - - - - - - - 137.0 4 2 PTCH2 patched 2 1211 155 C20140710_OR016_03 C20140710_OR016_03 TB433068.[MT7]-LLIQTGDAQEPLDFSQLTTRK[MT7].3b7_1.heavy 888.16 / 885.516 1911.0 40.53127670288086 38 13 10 5 10 2.5560788484983465 39.12242380893231 0.0438995361328125 3 0.9163309472491372 4.236471699481445 1911.0 11.159878048780488 0.0 - - - - - - - 341.5 3 4 PTCH2 patched 2 1213 155 C20140710_OR016_03 C20140710_OR016_03 TB433068.[MT7]-LLIQTGDAQEPLDFSQLTTRK[MT7].3y9_1.heavy 888.16 / 1239.68 956.0 40.53127670288086 38 13 10 5 10 2.5560788484983465 39.12242380893231 0.0438995361328125 3 0.9163309472491372 4.236471699481445 956.0 1.2505494505494505 3.0 - - - - - - - 0.0 1 0 PTCH2 patched 2 1215 156 C20140710_OR016_03 C20140710_OR016_03 TB423797.[MT7]-TEIEEDSFR.2y8_1.heavy 635.308 / 1024.46 3083.0 27.58924961090088 40 14 10 6 10 7.938238040408988 12.59725388568064 0.037799835205078125 3 0.9400736686162737 5.0160341979567225 3083.0 9.424122017481992 0.0 - - - - - - - 246.78571428571428 6 14 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1217 156 C20140710_OR016_03 C20140710_OR016_03 TB423797.[MT7]-TEIEEDSFR.2b6_1.heavy 635.308 / 861.396 1775.0 27.58924961090088 40 14 10 6 10 7.938238040408988 12.59725388568064 0.037799835205078125 3 0.9400736686162737 5.0160341979567225 1775.0 4.738877577719995 0.0 - - - - - - - 233.41666666666666 3 12 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1219 156 C20140710_OR016_03 C20140710_OR016_03 TB423797.[MT7]-TEIEEDSFR.2y6_1.heavy 635.308 / 782.331 841.0 27.58924961090088 40 14 10 6 10 7.938238040408988 12.59725388568064 0.037799835205078125 3 0.9400736686162737 5.0160341979567225 841.0 1.1706772844411193 2.0 - - - - - - - 0.0 1 0 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1221 156 C20140710_OR016_03 C20140710_OR016_03 TB423797.[MT7]-TEIEEDSFR.2y7_1.heavy 635.308 / 895.416 2149.0 27.58924961090088 40 14 10 6 10 7.938238040408988 12.59725388568064 0.037799835205078125 3 0.9400736686162737 5.0160341979567225 2149.0 1.1500764525993883 0.0 - - - - - - - 737.0 4 9 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1223 157 C20140710_OR016_03 C20140710_OR016_03 TB423795.[MT7]-VLWDEEVAR.2y8_1.heavy 630.839 / 1017.5 18393.0 35.47249984741211 48 18 10 10 10 2.654885964838697 29.757284231214292 0.0 3 0.9834327992024228 9.574947144619724 18393.0 160.97665634302723 0.0 - - - - - - - 198.33333333333334 36 6 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1225 157 C20140710_OR016_03 C20140710_OR016_03 TB423795.[MT7]-VLWDEEVAR.2y5_1.heavy 630.839 / 603.31 7939.0 35.47249984741211 48 18 10 10 10 2.654885964838697 29.757284231214292 0.0 3 0.9834327992024228 9.574947144619724 7939.0 21.30393494594001 0.0 - - - - - - - 264.7 15 10 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1227 157 C20140710_OR016_03 C20140710_OR016_03 TB423795.[MT7]-VLWDEEVAR.2y6_1.heavy 630.839 / 718.337 4896.0 35.47249984741211 48 18 10 10 10 2.654885964838697 29.757284231214292 0.0 3 0.9834327992024228 9.574947144619724 4896.0 13.502132514260639 0.0 - - - - - - - 211.6 9 10 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1229 157 C20140710_OR016_03 C20140710_OR016_03 TB423795.[MT7]-VLWDEEVAR.2y7_1.heavy 630.839 / 904.416 13100.0 35.47249984741211 48 18 10 10 10 2.654885964838697 29.757284231214292 0.0 3 0.9834327992024228 9.574947144619724 13100.0 136.77478559176672 0.0 - - - - - - - 245.85714285714286 26 7 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1231 158 C20140710_OR016_03 C20140710_OR016_03 TB445120.[MT7]-LPDFQDSIFEYFNTAPLAHDLTFR.3y4_1.heavy 1001.17 / 536.319 787.0 54.10072422027588 38 16 10 6 6 11.420006208621311 8.75656266495783 0.030300140380859375 5 0.9694949463449183 7.0480054577897695 787.0 3.5748392084106366 1.0 - - - - - - - 145.375 2 24 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1233 158 C20140710_OR016_03 C20140710_OR016_03 TB445120.[MT7]-LPDFQDSIFEYFNTAPLAHDLTFR.3b8_1.heavy 1001.17 / 1060.54 818.0 54.10072422027588 38 16 10 6 6 11.420006208621311 8.75656266495783 0.030300140380859375 5 0.9694949463449183 7.0480054577897695 818.0 9.116514690982775 2.0 - - - - - - - 145.41666666666666 2 24 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1235 158 C20140710_OR016_03 C20140710_OR016_03 TB445120.[MT7]-LPDFQDSIFEYFNTAPLAHDLTFR.3b7_1.heavy 1001.17 / 947.459 567.0 54.10072422027588 38 16 10 6 6 11.420006208621311 8.75656266495783 0.030300140380859375 5 0.9694949463449183 7.0480054577897695 567.0 2.40850312006616 1.0 - - - - - - - 0.0 1 0 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1237 158 C20140710_OR016_03 C20140710_OR016_03 TB445120.[MT7]-LPDFQDSIFEYFNTAPLAHDLTFR.3y9_1.heavy 1001.17 / 1069.58 2298.0 54.10072422027588 38 16 10 6 6 11.420006208621311 8.75656266495783 0.030300140380859375 5 0.9694949463449183 7.0480054577897695 2298.0 17.143809523809523 0.0 - - - - - - - 145.55555555555554 4 27 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1239 159 C20140710_OR016_03 C20140710_OR016_03 TB444810.[MT7]-LSTLAR.2b3_1.heavy 402.757 / 446.273 14783.0 27.083849906921387 37 14 10 5 8 1.9185717486813845 52.12210597217906 0.04229927062988281 4 0.9401145255983205 5.017762474772916 14783.0 0.4376892514462674 2.0 - - - - - - - 226.375 29 8 ZNF28;ZNF468 zinc finger protein 28;zinc finger protein 468 1241 159 C20140710_OR016_03 C20140710_OR016_03 TB444810.[MT7]-LSTLAR.2b5_1.heavy 402.757 / 630.394 1106.0 27.083849906921387 37 14 10 5 8 1.9185717486813845 52.12210597217906 0.04229927062988281 4 0.9401145255983205 5.017762474772916 1106.0 5.847330958842153 3.0 - - - - - - - 268.1666666666667 3 6 ZNF28;ZNF468 zinc finger protein 28;zinc finger protein 468 1243 159 C20140710_OR016_03 C20140710_OR016_03 TB444810.[MT7]-LSTLAR.2y5_1.heavy 402.757 / 547.32 22224.0 27.083849906921387 37 14 10 5 8 1.9185717486813845 52.12210597217906 0.04229927062988281 4 0.9401145255983205 5.017762474772916 22224.0 178.6282099436592 0.0 - - - - - - - 238.875 44 8 ZNF28;ZNF468 zinc finger protein 28;zinc finger protein 468 1245 159 C20140710_OR016_03 C20140710_OR016_03 TB444810.[MT7]-LSTLAR.2b4_1.heavy 402.757 / 559.357 1508.0 27.083849906921387 37 14 10 5 8 1.9185717486813845 52.12210597217906 0.04229927062988281 4 0.9401145255983205 5.017762474772916 1508.0 3.8012603648424546 0.0 - - - - - - - 201.28571428571428 3 7 ZNF28;ZNF468 zinc finger protein 28;zinc finger protein 468 1247 160 C20140710_OR016_03 C20140710_OR016_03 TB424082.[MT7]-VWSHPSDPLEILPSGVSR.3y7_1.heavy 707.38 / 715.41 2417.0 39.3026008605957 43 18 10 5 10 5.079508320171745 19.68694481764701 0.04779815673828125 3 0.9829952470918398 9.450610333180663 2417.0 7.53720044099248 0.0 - - - - - - - 255.6 4 10 LOC100510144;LOC100510200;LILRA6 leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 1249 160 C20140710_OR016_03 C20140710_OR016_03 TB424082.[MT7]-VWSHPSDPLEILPSGVSR.3y6_1.heavy 707.38 / 602.326 5687.0 39.3026008605957 43 18 10 5 10 5.079508320171745 19.68694481764701 0.04779815673828125 3 0.9829952470918398 9.450610333180663 5687.0 29.119146142231244 0.0 - - - - - - - 307.6666666666667 11 6 LOC100510144;LOC100510200;LILRA6 leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 1251 160 C20140710_OR016_03 C20140710_OR016_03 TB424082.[MT7]-VWSHPSDPLEILPSGVSR.3b4_1.heavy 707.38 / 654.348 1564.0 39.3026008605957 43 18 10 5 10 5.079508320171745 19.68694481764701 0.04779815673828125 3 0.9829952470918398 9.450610333180663 1564.0 11.068912755335885 2.0 - - - - - - - 202.85714285714286 3 7 LOC100510144;LOC100510200;LILRA6 leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 1253 160 C20140710_OR016_03 C20140710_OR016_03 TB424082.[MT7]-VWSHPSDPLEILPSGVSR.3b7_1.heavy 707.38 / 953.46 1137.0 39.3026008605957 43 18 10 5 10 5.079508320171745 19.68694481764701 0.04779815673828125 3 0.9829952470918398 9.450610333180663 1137.0 7.006338028169013 3.0 - - - - - - - 170.4 2 5 LOC100510144;LOC100510200;LILRA6 leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 1255 161 C20140710_OR016_03 C20140710_OR016_03 TB444815.[MT7]-GAFGEVAVVK[MT7].3b6_1.heavy 422.255 / 705.369 5427.0 32.15599822998047 42 14 10 10 8 1.5771910920629524 52.92009577341244 0.0 4 0.9377880326401372 4.92206955491764 5427.0 50.89728813559323 0.0 - - - - - - - 295.0 10 4 CDC42BPA;CDC42BPB CDC42 binding protein kinase alpha (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 1257 161 C20140710_OR016_03 C20140710_OR016_03 TB444815.[MT7]-GAFGEVAVVK[MT7].3b4_1.heavy 422.255 / 477.258 4837.0 32.15599822998047 42 14 10 10 8 1.5771910920629524 52.92009577341244 0.0 4 0.9377880326401372 4.92206955491764 4837.0 22.114927966101696 0.0 - - - - - - - 212.4 9 5 CDC42BPA;CDC42BPB CDC42 binding protein kinase alpha (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 1259 161 C20140710_OR016_03 C20140710_OR016_03 TB444815.[MT7]-GAFGEVAVVK[MT7].3b5_1.heavy 422.255 / 606.3 10383.0 32.15599822998047 42 14 10 10 8 1.5771910920629524 52.92009577341244 0.0 4 0.9377880326401372 4.92206955491764 10383.0 52.26696610169492 0.0 - - - - - - - 295.0 20 2 CDC42BPA;CDC42BPB CDC42 binding protein kinase alpha (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 1261 161 C20140710_OR016_03 C20140710_OR016_03 TB444815.[MT7]-GAFGEVAVVK[MT7].3y4_1.heavy 422.255 / 560.389 6607.0 32.15599822998047 42 14 10 10 8 1.5771910920629524 52.92009577341244 0.0 4 0.9377880326401372 4.92206955491764 6607.0 17.946001738374623 1.0 - - - - - - - 252.85714285714286 14 7 CDC42BPA;CDC42BPB CDC42 binding protein kinase alpha (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 1263 162 C20140710_OR016_03 C20140710_OR016_03 TB424087.[MT7]-SALANQIDWTEIGLIVK[MT7].3y3_1.heavy 720.415 / 503.367 2109.0 47.45126724243164 44 20 8 6 10 7.024048742102996 14.236803255733113 0.038600921630859375 3 0.9934790020400396 15.27457207665404 2109.0 7.8478530178837556 0.0 - - - - - - - 227.875 4 8 SDCCAG1 serologically defined colon cancer antigen 1 1265 162 C20140710_OR016_03 C20140710_OR016_03 TB424087.[MT7]-SALANQIDWTEIGLIVK[MT7].3b6_1.heavy 720.415 / 729.401 1821.0 47.45126724243164 44 20 8 6 10 7.024048742102996 14.236803255733113 0.038600921630859375 3 0.9934790020400396 15.27457207665404 1821.0 17.735781250000002 0.0 - - - - - - - 164.57142857142858 3 7 SDCCAG1 serologically defined colon cancer antigen 1 1267 162 C20140710_OR016_03 C20140710_OR016_03 TB424087.[MT7]-SALANQIDWTEIGLIVK[MT7].3b5_1.heavy 720.415 / 601.343 N/A 47.45126724243164 44 20 8 6 10 7.024048742102996 14.236803255733113 0.038600921630859375 3 0.9934790020400396 15.27457207665404 863.0 1.2101413665432514 4.0 - - - - - - - 223.88888888888889 5 9 SDCCAG1 serologically defined colon cancer antigen 1 1269 162 C20140710_OR016_03 C20140710_OR016_03 TB424087.[MT7]-SALANQIDWTEIGLIVK[MT7].3b8_1.heavy 720.415 / 957.512 2109.0 47.45126724243164 44 20 8 6 10 7.024048742102996 14.236803255733113 0.038600921630859375 3 0.9934790020400396 15.27457207665404 2109.0 19.771874999999998 0.0 - - - - - - - 227.875 4 8 SDCCAG1 serologically defined colon cancer antigen 1 1271 163 C20140710_OR016_03 C20140710_OR016_03 TB423884.[MT7]-QMESELEALK[MT7].2b3_1.heavy 733.394 / 533.251 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1273 163 C20140710_OR016_03 C20140710_OR016_03 TB423884.[MT7]-QMESELEALK[MT7].2y9_1.heavy 733.394 / 1193.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1275 163 C20140710_OR016_03 C20140710_OR016_03 TB423884.[MT7]-QMESELEALK[MT7].2b7_1.heavy 733.394 / 991.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1277 163 C20140710_OR016_03 C20140710_OR016_03 TB423884.[MT7]-QMESELEALK[MT7].2b5_1.heavy 733.394 / 749.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1279 164 C20140710_OR016_03 C20140710_OR016_03 TB423886.[MT7]-VNNVYDVDNK[MT7].2y4_1.heavy 734.388 / 619.353 618.0 25.706300735473633 38 15 9 10 4 3.1125803279779274 32.12768489896757 0.0 8 0.9532502873038665 5.685468755732588 618.0 1.3714285714285712 10.0 - - - - - - - 206.0 4 10 SDCCAG1 serologically defined colon cancer antigen 1 1281 164 C20140710_OR016_03 C20140710_OR016_03 TB423886.[MT7]-VNNVYDVDNK[MT7].2b4_1.heavy 734.388 / 571.332 1750.0 25.706300735473633 38 15 9 10 4 3.1125803279779274 32.12768489896757 0.0 8 0.9532502873038665 5.685468755732588 1750.0 16.140776699029125 0.0 - - - - - - - 220.71428571428572 3 7 SDCCAG1 serologically defined colon cancer antigen 1 1283 164 C20140710_OR016_03 C20140710_OR016_03 TB423886.[MT7]-VNNVYDVDNK[MT7].2y3_1.heavy 734.388 / 520.285 412.0 25.706300735473633 38 15 9 10 4 3.1125803279779274 32.12768489896757 0.0 8 0.9532502873038665 5.685468755732588 412.0 2.466 9.0 - - - - - - - 0.0 1 0 SDCCAG1 serologically defined colon cancer antigen 1 1285 164 C20140710_OR016_03 C20140710_OR016_03 TB423886.[MT7]-VNNVYDVDNK[MT7].2y6_1.heavy 734.388 / 897.443 926.0 25.706300735473633 38 15 9 10 4 3.1125803279779274 32.12768489896757 0.0 8 0.9532502873038665 5.685468755732588 926.0 5.84368932038835 0.0 - - - - - - - 0.0 1 0 SDCCAG1 serologically defined colon cancer antigen 1 1287 165 C20140710_OR016_03 C20140710_OR016_03 TB423880.[MT7]-YK[MT7]YEEC[CAM]K[MT7].2y4_1.heavy 726.382 / 709.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - NBPF10;LOC100506032;KIAA1245;NBPF11;NBPF15;NBPF7;NBPF9;NBPF1;NBPF24;NBPF16 neuroblastoma breakpoint family, member 10;neuroblastoma breakpoint family member 20-like;KIAA1245;neuroblastoma breakpoint family, member 11;neuroblastoma breakpoint family, member 15;neuroblastoma breakpoint family, member 7;neuroblastoma breakpoint family, member 9;neuroblastoma breakpoint family, member 1;neuroblastoma breakpoint family, member 24;neuroblastoma breakpoint family, member 16 1289 165 C20140710_OR016_03 C20140710_OR016_03 TB423880.[MT7]-YK[MT7]YEEC[CAM]K[MT7].2y6_1.heavy 726.382 / 1144.59 N/A N/A - - - - - - - - - 0.0 - - - - - - - NBPF10;LOC100506032;KIAA1245;NBPF11;NBPF15;NBPF7;NBPF9;NBPF1;NBPF24;NBPF16 neuroblastoma breakpoint family, member 10;neuroblastoma breakpoint family member 20-like;KIAA1245;neuroblastoma breakpoint family, member 11;neuroblastoma breakpoint family, member 15;neuroblastoma breakpoint family, member 7;neuroblastoma breakpoint family, member 9;neuroblastoma breakpoint family, member 1;neuroblastoma breakpoint family, member 24;neuroblastoma breakpoint family, member 16 1291 165 C20140710_OR016_03 C20140710_OR016_03 TB423880.[MT7]-YK[MT7]YEEC[CAM]K[MT7].2b5_1.heavy 726.382 / 1001.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - NBPF10;LOC100506032;KIAA1245;NBPF11;NBPF15;NBPF7;NBPF9;NBPF1;NBPF24;NBPF16 neuroblastoma breakpoint family, member 10;neuroblastoma breakpoint family member 20-like;KIAA1245;neuroblastoma breakpoint family, member 11;neuroblastoma breakpoint family, member 15;neuroblastoma breakpoint family, member 7;neuroblastoma breakpoint family, member 9;neuroblastoma breakpoint family, member 1;neuroblastoma breakpoint family, member 24;neuroblastoma breakpoint family, member 16 1293 165 C20140710_OR016_03 C20140710_OR016_03 TB423880.[MT7]-YK[MT7]YEEC[CAM]K[MT7].2y6_2.heavy 726.382 / 572.799 N/A N/A - - - - - - - - - 0.0 - - - - - - - NBPF10;LOC100506032;KIAA1245;NBPF11;NBPF15;NBPF7;NBPF9;NBPF1;NBPF24;NBPF16 neuroblastoma breakpoint family, member 10;neuroblastoma breakpoint family member 20-like;KIAA1245;neuroblastoma breakpoint family, member 11;neuroblastoma breakpoint family, member 15;neuroblastoma breakpoint family, member 7;neuroblastoma breakpoint family, member 9;neuroblastoma breakpoint family, member 1;neuroblastoma breakpoint family, member 24;neuroblastoma breakpoint family, member 16 1295 166 C20140710_OR016_03 C20140710_OR016_03 TB424143.[MT7]-LLIQTGDAQEPLDFSQLTTRK[MT7].4y8_2.heavy 666.372 / 562.831 4191.0 40.497650146484375 38 13 10 5 10 2.1229041176565877 37.38240984953351 0.0453033447265625 3 0.9192685225838989 4.313948112792814 4191.0 34.336245841035115 0.0 - - - - - - - 338.1666666666667 8 6 PTCH2 patched 2 1297 166 C20140710_OR016_03 C20140710_OR016_03 TB424143.[MT7]-LLIQTGDAQEPLDFSQLTTRK[MT7].4b7_1.heavy 666.372 / 885.516 2974.0 40.497650146484375 38 13 10 5 10 2.1229041176565877 37.38240984953351 0.0453033447265625 3 0.9192685225838989 4.313948112792814 2974.0 15.624216383871556 1.0 - - - - - - - 285.3333333333333 7 9 PTCH2 patched 2 1299 166 C20140710_OR016_03 C20140710_OR016_03 TB424143.[MT7]-LLIQTGDAQEPLDFSQLTTRK[MT7].4y11_2.heavy 666.372 / 725.413 9328.0 40.497650146484375 38 13 10 5 10 2.1229041176565877 37.38240984953351 0.0453033447265625 3 0.9192685225838989 4.313948112792814 9328.0 50.58334223317588 0.0 - - - - - - - 202.66666666666666 18 6 PTCH2 patched 2 1301 166 C20140710_OR016_03 C20140710_OR016_03 TB424143.[MT7]-LLIQTGDAQEPLDFSQLTTRK[MT7].4b4_1.heavy 666.372 / 612.42 5002.0 40.497650146484375 38 13 10 5 10 2.1229041176565877 37.38240984953351 0.0453033447265625 3 0.9192685225838989 4.313948112792814 5002.0 19.13939742536291 0.0 - - - - - - - 247.66666666666666 10 6 PTCH2 patched 2 1303 167 C20140710_OR016_03 C20140710_OR016_03 TB433074.[MT7]-YNLRVPYGANYSC[CAM]TELNFTRK[MT7].4b8_2.heavy 714.369 / 554.307 890.0 34.990699768066406 40 10 10 10 10 1.7298135463315611 57.80969874589741 0.0 3 0.8231982556489326 2.8906951508758536 890.0 7.444714290670645 7.0 - - - - - - - 222.58333333333334 2 12 ADAM7 ADAM metallopeptidase domain 7 1305 167 C20140710_OR016_03 C20140710_OR016_03 TB433074.[MT7]-YNLRVPYGANYSC[CAM]TELNFTRK[MT7].4y7_1.heavy 714.369 / 1051.6 1446.0 34.990699768066406 40 10 10 10 10 1.7298135463315611 57.80969874589741 0.0 3 0.8231982556489326 2.8906951508758536 1446.0 0.1624719101123595 2.0 - - - - - - - 180.75 3 8 ADAM7 ADAM metallopeptidase domain 7 1307 167 C20140710_OR016_03 C20140710_OR016_03 TB433074.[MT7]-YNLRVPYGANYSC[CAM]TELNFTRK[MT7].4y6_1.heavy 714.369 / 922.559 1224.0 34.990699768066406 40 10 10 10 10 1.7298135463315611 57.80969874589741 0.0 3 0.8231982556489326 2.8906951508758536 1224.0 6.865303572328312 1.0 - - - - - - - 248.30769230769232 2 13 ADAM7 ADAM metallopeptidase domain 7 1309 167 C20140710_OR016_03 C20140710_OR016_03 TB433074.[MT7]-YNLRVPYGANYSC[CAM]TELNFTRK[MT7].4b10_2.heavy 714.369 / 646.847 5007.0 34.990699768066406 40 10 10 10 10 1.7298135463315611 57.80969874589741 0.0 3 0.8231982556489326 2.8906951508758536 5007.0 20.65769073411599 0.0 - - - - - - - 222.6 10 5 ADAM7 ADAM metallopeptidase domain 7 1311 168 C20140710_OR016_03 C20140710_OR016_03 TB433077.[MT7]-TLDSQQLHSGGFQALFPVGPVTPSHR.4y8_1.heavy 730.885 / 850.453 3319.0 39.22007465362549 36 11 10 5 10 1.555885426561133 46.33779919155863 0.046901702880859375 3 0.85984839514361 3.2572828330502284 3319.0 23.484748345935728 0.0 - - - - - - - 240.66666666666666 6 9 LOC100510144;LOC100510200;LILRA6 leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 1313 168 C20140710_OR016_03 C20140710_OR016_03 TB433077.[MT7]-TLDSQQLHSGGFQALFPVGPVTPSHR.4y10_1.heavy 730.885 / 1046.57 5051.0 39.22007465362549 36 11 10 5 10 1.555885426561133 46.33779919155863 0.046901702880859375 3 0.85984839514361 3.2572828330502284 5051.0 42.07646892451376 0.0 - - - - - - - 144.0 10 4 LOC100510144;LOC100510200;LILRA6 leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 1315 168 C20140710_OR016_03 C20140710_OR016_03 TB433077.[MT7]-TLDSQQLHSGGFQALFPVGPVTPSHR.4b13_2.heavy 730.885 / 772.385 6061.0 39.22007465362549 36 11 10 5 10 1.555885426561133 46.33779919155863 0.046901702880859375 3 0.85984839514361 3.2572828330502284 6061.0 50.28000998940882 0.0 - - - - - - - 164.71428571428572 12 7 LOC100510144;LOC100510200;LILRA6 leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 1317 168 C20140710_OR016_03 C20140710_OR016_03 TB433077.[MT7]-TLDSQQLHSGGFQALFPVGPVTPSHR.4b6_1.heavy 730.885 / 817.417 722.0 39.22007465362549 36 11 10 5 10 1.555885426561133 46.33779919155863 0.046901702880859375 3 0.85984839514361 3.2572828330502284 722.0 0.08351631637721593 7.0 - - - - - - - 0.0 1 0 LOC100510144;LOC100510200;LILRA6 leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor subfamily B member 3-like;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 1319 169 C20140710_OR016_03 C20140710_OR016_03 TB423783.[MT7]-GYLQALASK[MT7].3y3_1.heavy 413.583 / 449.284 3619.0 34.035499572753906 34 16 2 10 6 2.4053806312436508 33.11979963446963 0.0 5 0.9631046966715745 6.405195894259024 3619.0 29.838067846607668 0.0 - - - - - - - 248.6 7 5 CDC42BPA;CDC42BPB CDC42 binding protein kinase alpha (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 1321 169 C20140710_OR016_03 C20140710_OR016_03 TB423783.[MT7]-GYLQALASK[MT7].3b4_1.heavy 413.583 / 606.337 4411.0 34.035499572753906 34 16 2 10 6 2.4053806312436508 33.11979963446963 0.0 5 0.9631046966715745 6.405195894259024 4411.0 54.6495575221239 0.0 - - - - - - - 226.0 8 5 CDC42BPA;CDC42BPB CDC42 binding protein kinase alpha (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 1323 169 C20140710_OR016_03 C20140710_OR016_03 TB423783.[MT7]-GYLQALASK[MT7].3b5_1.heavy 413.583 / 677.374 1357.0 34.035499572753906 34 16 2 10 6 2.4053806312436508 33.11979963446963 0.0 5 0.9631046966715745 6.405195894259024 1357.0 -1.2008849557522119 0.0 - - - - - - - 188.33333333333334 2 3 CDC42BPA;CDC42BPB CDC42 binding protein kinase alpha (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 1325 169 C20140710_OR016_03 C20140710_OR016_03 TB423783.[MT7]-GYLQALASK[MT7].3b3_1.heavy 413.583 / 478.278 3054.0 34.035499572753906 34 16 2 10 6 2.4053806312436508 33.11979963446963 0.0 5 0.9631046966715745 6.405195894259024 3054.0 34.684070796460176 2.0 - - - - - - - 226.0 27 8 CDC42BPA;CDC42BPB CDC42 binding protein kinase alpha (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 1327 170 C20140710_OR016_03 C20140710_OR016_03 TB423879.[MT7]-QTISLPVSTSK[MT7].3b4_1.heavy 483.624 / 574.332 1245.0 30.600399494171143 42 18 9 7 8 8.566132263209 11.673879987762241 0.029600143432617188 4 0.9847669618910208 9.986567857006815 1245.0 5.340247660351518 3.0 - - - - - - - 242.64705882352942 2 17 ZNF654 zinc finger protein 654 1329 170 C20140710_OR016_03 C20140710_OR016_03 TB423879.[MT7]-QTISLPVSTSK[MT7].3b5_1.heavy 483.624 / 687.416 934.0 30.600399494171143 42 18 9 7 8 8.566132263209 11.673879987762241 0.029600143432617188 4 0.9847669618910208 9.986567857006815 934.0 0.14275229357798164 2.0 - - - - - - - 0.0 1 0 ZNF654 zinc finger protein 654 1331 170 C20140710_OR016_03 C20140710_OR016_03 TB423879.[MT7]-QTISLPVSTSK[MT7].3y4_1.heavy 483.624 / 566.327 2489.0 30.600399494171143 42 18 9 7 8 8.566132263209 11.673879987762241 0.029600143432617188 4 0.9847669618910208 9.986567857006815 2489.0 -1.3329764453961457 2.0 - - - - - - - 229.61904761904762 6 21 ZNF654 zinc finger protein 654 1333 170 C20140710_OR016_03 C20140710_OR016_03 TB423879.[MT7]-QTISLPVSTSK[MT7].3y5_1.heavy 483.624 / 665.395 934.0 30.600399494171143 42 18 9 7 8 8.566132263209 11.673879987762241 0.029600143432617188 4 0.9847669618910208 9.986567857006815 934.0 -1.7980789842526175 0.0 - - - - - - - 0.0 1 0 ZNF654 zinc finger protein 654 1335 171 C20140710_OR016_03 C20140710_OR016_03 TB445059.[MT7]-SDMDYLSNALEK[MT7].2y8_1.heavy 837.418 / 1081.6 5525.0 36.926849365234375 36 11 10 5 10 1.5419465320120582 64.8530918056619 0.0493011474609375 3 0.8665166881087045 3.339605672977249 5525.0 32.12474226804124 0.0 - - - - - - - 232.6 11 5 S100A7L2 S100 calcium binding protein A7-like 2 1337 171 C20140710_OR016_03 C20140710_OR016_03 TB445059.[MT7]-SDMDYLSNALEK[MT7].2b4_1.heavy 837.418 / 593.236 7415.0 36.926849365234375 36 11 10 5 10 1.5419465320120582 64.8530918056619 0.0493011474609375 3 0.8665166881087045 3.339605672977249 7415.0 58.07932748458777 0.0 - - - - - - - 145.0 14 4 S100A7L2 S100 calcium binding protein A7-like 2 1339 171 C20140710_OR016_03 C20140710_OR016_03 TB445059.[MT7]-SDMDYLSNALEK[MT7].2y6_1.heavy 837.418 / 805.454 5816.0 36.926849365234375 36 11 10 5 10 1.5419465320120582 64.8530918056619 0.0493011474609375 3 0.8665166881087045 3.339605672977249 5816.0 22.198952678205494 0.0 - - - - - - - 348.8 11 5 S100A7L2 S100 calcium binding protein A7-like 2 1341 171 C20140710_OR016_03 C20140710_OR016_03 TB445059.[MT7]-SDMDYLSNALEK[MT7].2b5_1.heavy 837.418 / 756.299 4071.0 36.926849365234375 36 11 10 5 10 1.5419465320120582 64.8530918056619 0.0493011474609375 3 0.8665166881087045 3.339605672977249 4071.0 32.61575790970494 0.0 - - - - - - - 218.0 8 6 S100A7L2 S100 calcium binding protein A7-like 2 1343 172 C20140710_OR016_03 C20140710_OR016_03 TB423672.[MT7]-NSSFGFDINK[MT7].3y3_1.heavy 472.917 / 518.342 1219.0 33.89074897766113 32 15 6 5 6 3.059324478784575 32.686954487328045 0.040699005126953125 5 0.9572841963004427 5.94990307585877 1219.0 7.841532074242917 1.0 - - - - - - - 277.0 4 8 MMP27 matrix metallopeptidase 27 1345 172 C20140710_OR016_03 C20140710_OR016_03 TB423672.[MT7]-NSSFGFDINK[MT7].3b5_1.heavy 472.917 / 637.306 1330.0 33.89074897766113 32 15 6 5 6 3.059324478784575 32.686954487328045 0.040699005126953125 5 0.9572841963004427 5.94990307585877 1330.0 23.364864864864863 0.0 - - - - - - - 138.75 2 4 MMP27 matrix metallopeptidase 27 1347 172 C20140710_OR016_03 C20140710_OR016_03 TB423672.[MT7]-NSSFGFDINK[MT7].3y4_1.heavy 472.917 / 633.369 887.0 33.89074897766113 32 15 6 5 6 3.059324478784575 32.686954487328045 0.040699005126953125 5 0.9572841963004427 5.94990307585877 887.0 4.9888334418756095 2.0 - - - - - - - 152.5 2 8 MMP27 matrix metallopeptidase 27 1349 172 C20140710_OR016_03 C20140710_OR016_03 TB423672.[MT7]-NSSFGFDINK[MT7].3b7_1.heavy 472.917 / 899.402 665.0 33.89074897766113 32 15 6 5 6 3.059324478784575 32.686954487328045 0.040699005126953125 5 0.9572841963004427 5.94990307585877 665.0 6.410360360360359 0.0 - - - - - - - 0.0 1 0 MMP27 matrix metallopeptidase 27 1351 173 C20140710_OR016_03 C20140710_OR016_03 TB423944.[MT7]-AVLAELNASLLGMR.3y7_1.heavy 534.644 / 747.418 1993.0 47.4480504989624 44 18 10 6 10 2.4490123355358833 31.483967757438222 0.038600921630859375 3 0.9832047593602073 9.50954053627314 1993.0 27.971929824561403 0.0 - - - - - - - 237.5 3 2 SDCCAG1 serologically defined colon cancer antigen 1 1353 173 C20140710_OR016_03 C20140710_OR016_03 TB423944.[MT7]-AVLAELNASLLGMR.3y6_1.heavy 534.644 / 676.381 2658.0 47.4480504989624 44 18 10 6 10 2.4490123355358833 31.483967757438222 0.038600921630859375 3 0.9832047593602073 9.50954053627314 2658.0 6.028421052631578 1.0 - - - - - - - 237.5 5 4 SDCCAG1 serologically defined colon cancer antigen 1 1355 173 C20140710_OR016_03 C20140710_OR016_03 TB423944.[MT7]-AVLAELNASLLGMR.3b5_1.heavy 534.644 / 628.379 9017.0 47.4480504989624 44 18 10 6 10 2.4490123355358833 31.483967757438222 0.038600921630859375 3 0.9832047593602073 9.50954053627314 9017.0 120.06847368421055 0.0 - - - - - - - 190.0 18 6 SDCCAG1 serologically defined colon cancer antigen 1 1357 173 C20140710_OR016_03 C20140710_OR016_03 TB423944.[MT7]-AVLAELNASLLGMR.3y5_1.heavy 534.644 / 589.349 3512.0 47.4480504989624 44 18 10 6 10 2.4490123355358833 31.483967757438222 0.038600921630859375 3 0.9832047593602073 9.50954053627314 3512.0 20.332631578947368 0.0 - - - - - - - 213.75 7 4 SDCCAG1 serologically defined colon cancer antigen 1 1359 174 C20140710_OR016_03 C20140710_OR016_03 TB423947.[MT7]-VQHAPLEMGPQPR.4y4_1.heavy 401.718 / 497.283 1125.0 27.062700271606445 37 9 10 10 8 1.8439943395134744 43.113134173005335 0.0 4 0.810883823601336 2.791921455240601 1125.0 3.468092909535452 2.0 - - - - - - - 235.4 3 10 SAG S-antigen; retina and pineal gland (arrestin) 1361 174 C20140710_OR016_03 C20140710_OR016_03 TB423947.[MT7]-VQHAPLEMGPQPR.4b3_2.heavy 401.718 / 255.151 2660.0 27.062700271606445 37 9 10 10 8 1.8439943395134744 43.113134173005335 0.0 4 0.810883823601336 2.791921455240601 2660.0 1.1996013152954295 3.0 - - - - - - - 261.44444444444446 7 9 SAG S-antigen; retina and pineal gland (arrestin) 1363 174 C20140710_OR016_03 C20140710_OR016_03 TB423947.[MT7]-VQHAPLEMGPQPR.4b4_1.heavy 401.718 / 580.332 716.0 27.062700271606445 37 9 10 10 8 1.8439943395134744 43.113134173005335 0.0 4 0.810883823601336 2.791921455240601 716.0 10.330637015781923 2.0 - - - - - - - 0.0 1 0 SAG S-antigen; retina and pineal gland (arrestin) 1365 174 C20140710_OR016_03 C20140710_OR016_03 TB423947.[MT7]-VQHAPLEMGPQPR.4b3_1.heavy 401.718 / 509.295 3478.0 27.062700271606445 37 9 10 10 8 1.8439943395134744 43.113134173005335 0.0 4 0.810883823601336 2.791921455240601 3478.0 9.070578647106766 0.0 - - - - - - - 227.33333333333334 6 9 SAG S-antigen; retina and pineal gland (arrestin) 1367 175 C20140710_OR016_03 C20140710_OR016_03 TB432970.[MT7]-ENFPNFLSGC[CAM]EK[MT7].2y4_1.heavy 865.427 / 637.31 2212.0 37.93320083618164 37 7 10 10 10 0.8143237712214494 81.35624061111795 0.0 3 0.7406263980090693 2.3688151606995342 2212.0 4.45420814479638 1.0 - - - - - - - 231.42857142857142 4 7 S100A7L2 S100 calcium binding protein A7-like 2 1369 175 C20140710_OR016_03 C20140710_OR016_03 TB432970.[MT7]-ENFPNFLSGC[CAM]EK[MT7].2b3_1.heavy 865.427 / 535.263 15484.0 37.93320083618164 37 7 10 10 10 0.8143237712214494 81.35624061111795 0.0 3 0.7406263980090693 2.3688151606995342 15484.0 151.50503954802258 0.0 - - - - - - - 220.875 30 8 S100A7L2 S100 calcium binding protein A7-like 2 1371 175 C20140710_OR016_03 C20140710_OR016_03 TB432970.[MT7]-ENFPNFLSGC[CAM]EK[MT7].2y5_1.heavy 865.427 / 724.342 3392.0 37.93320083618164 37 7 10 10 10 0.8143237712214494 81.35624061111795 0.0 3 0.7406263980090693 2.3688151606995342 3392.0 27.598958352571795 0.0 - - - - - - - 294.5 6 2 S100A7L2 S100 calcium binding protein A7-like 2 1373 175 C20140710_OR016_03 C20140710_OR016_03 TB432970.[MT7]-ENFPNFLSGC[CAM]EK[MT7].2y9_1.heavy 865.427 / 1195.59 3687.0 37.93320083618164 37 7 10 10 10 0.8143237712214494 81.35624061111795 0.0 3 0.7406263980090693 2.3688151606995342 3687.0 7.811440677966102 0.0 - - - - - - - 281.27272727272725 7 11 S100A7L2 S100 calcium binding protein A7-like 2 1375 176 C20140710_OR016_03 C20140710_OR016_03 TB444889.[MT7]-MLSLVSK[MT7].2y4_1.heavy 533.333 / 590.399 2526.0 34.162200927734375 48 18 10 10 10 5.0627408054466105 15.828149229784728 0.0 3 0.9876043135188847 11.073309541253522 2526.0 8.671088476441163 1.0 - - - - - - - 300.7142857142857 7 7 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1377 176 C20140710_OR016_03 C20140710_OR016_03 TB444889.[MT7]-MLSLVSK[MT7].2y5_1.heavy 533.333 / 677.431 8983.0 34.162200927734375 48 18 10 10 10 5.0627408054466105 15.828149229784728 0.0 3 0.9876043135188847 11.073309541253522 8983.0 32.81110187384534 1.0 - - - - - - - 280.625 17 8 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1379 176 C20140710_OR016_03 C20140710_OR016_03 TB444889.[MT7]-MLSLVSK[MT7].2y3_1.heavy 533.333 / 477.315 7158.0 34.162200927734375 48 18 10 10 10 5.0627408054466105 15.828149229784728 0.0 3 0.9876043135188847 11.073309541253522 7158.0 8.984536694029758 2.0 - - - - - - - 862.0 14 7 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1381 176 C20140710_OR016_03 C20140710_OR016_03 TB444889.[MT7]-MLSLVSK[MT7].2y6_1.heavy 533.333 / 790.516 5333.0 34.162200927734375 48 18 10 10 10 5.0627408054466105 15.828149229784728 0.0 3 0.9876043135188847 11.073309541253522 5333.0 47.194474326385354 0.0 - - - - - - - 260.57142857142856 10 7 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1383 177 C20140710_OR016_03 C20140710_OR016_03 TB445051.[MT7]-LRVC[CAM]VLSELQK[MT7].4b4_1.heavy 408.998 / 673.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1385 177 C20140710_OR016_03 C20140710_OR016_03 TB445051.[MT7]-LRVC[CAM]VLSELQK[MT7].4b5_1.heavy 408.998 / 772.462 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1387 177 C20140710_OR016_03 C20140710_OR016_03 TB445051.[MT7]-LRVC[CAM]VLSELQK[MT7].4b3_1.heavy 408.998 / 513.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1389 177 C20140710_OR016_03 C20140710_OR016_03 TB445051.[MT7]-LRVC[CAM]VLSELQK[MT7].4b6_1.heavy 408.998 / 885.546 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1391 178 C20140710_OR016_03 C20140710_OR016_03 TB444988.[MT7]-RVEHHGTEK[MT7].2b8_1.heavy 690.883 / 1090.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1393 178 C20140710_OR016_03 C20140710_OR016_03 TB444988.[MT7]-RVEHHGTEK[MT7].2y4_1.heavy 690.883 / 578.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1395 178 C20140710_OR016_03 C20140710_OR016_03 TB444988.[MT7]-RVEHHGTEK[MT7].2y5_1.heavy 690.883 / 715.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1397 178 C20140710_OR016_03 C20140710_OR016_03 TB444988.[MT7]-RVEHHGTEK[MT7].2b4_1.heavy 690.883 / 666.38 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1399 179 C20140710_OR016_03 C20140710_OR016_03 TB444989.[MT7]-LFPGSPAIYK[MT7].3y3_1.heavy 460.943 / 567.362 5151.0 36.655999183654785 39 14 10 5 10 3.73936738743982 26.742491346501687 0.046398162841796875 3 0.9397322008492882 5.001658442916802 5151.0 51.870209790209785 0.0 - - - - - - - 178.75 10 4 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1401 179 C20140710_OR016_03 C20140710_OR016_03 TB444989.[MT7]-LFPGSPAIYK[MT7].3b4_1.heavy 460.943 / 559.336 2146.0 36.655999183654785 39 14 10 5 10 3.73936738743982 26.742491346501687 0.046398162841796875 3 0.9397322008492882 5.001658442916802 2146.0 13.956503496503496 0.0 - - - - - - - 232.375 4 8 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1403 179 C20140710_OR016_03 C20140710_OR016_03 TB444989.[MT7]-LFPGSPAIYK[MT7].3b5_1.heavy 460.943 / 646.368 1574.0 36.655999183654785 39 14 10 5 10 3.73936738743982 26.742491346501687 0.046398162841796875 3 0.9397322008492882 5.001658442916802 1574.0 5.303496503496503 1.0 - - - - - - - 250.25 3 4 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1405 179 C20140710_OR016_03 C20140710_OR016_03 TB444989.[MT7]-LFPGSPAIYK[MT7].3y4_1.heavy 460.943 / 638.399 3721.0 36.655999183654785 39 14 10 5 10 3.73936738743982 26.742491346501687 0.046398162841796875 3 0.9397322008492882 5.001658442916802 3721.0 51.83379020979021 0.0 - - - - - - - 214.5 7 2 LOC100510476;RGPD4;RGPD1;RANBP2;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1407 180 C20140710_OR016_03 C20140710_OR016_03 TB424013.[MT7]-TFLLNC[CAM]MLLGGRK[MT7].4y5_1.heavy 453.512 / 674.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1409 180 C20140710_OR016_03 C20140710_OR016_03 TB424013.[MT7]-TFLLNC[CAM]MLLGGRK[MT7].4y4_1.heavy 453.512 / 561.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1411 180 C20140710_OR016_03 C20140710_OR016_03 TB424013.[MT7]-TFLLNC[CAM]MLLGGRK[MT7].4y6_1.heavy 453.512 / 787.527 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1413 180 C20140710_OR016_03 C20140710_OR016_03 TB424013.[MT7]-TFLLNC[CAM]MLLGGRK[MT7].4b3_1.heavy 453.512 / 506.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1415 181 C20140710_OR016_03 C20140710_OR016_03 TB424014.[MT7]-DQPEDGADGRLPSSAR.3y6_1.heavy 605.63 / 630.357 1742.0 21.342224597930908 39 13 10 6 10 0.9737293514712344 59.696713216705724 0.03429985046386719 3 0.9048681138373411 3.969124350895969 1742.0 7.060088105726872 0.0 - - - - - - - 606.0 3 7 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1417 181 C20140710_OR016_03 C20140710_OR016_03 TB424014.[MT7]-DQPEDGADGRLPSSAR.3y11_2.heavy 605.63 / 543.786 6515.0 21.342224597930908 39 13 10 6 10 0.9737293514712344 59.696713216705724 0.03429985046386719 3 0.9048681138373411 3.969124350895969 6515.0 12.953816698220294 0.0 - - - - - - - 790.0 13 7 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1419 181 C20140710_OR016_03 C20140710_OR016_03 TB424014.[MT7]-DQPEDGADGRLPSSAR.3y14_2.heavy 605.63 / 714.347 5606.0 21.342224597930908 39 13 10 6 10 0.9737293514712344 59.696713216705724 0.03429985046386719 3 0.9048681138373411 3.969124350895969 5606.0 32.69848258665115 0.0 - - - - - - - 209.84615384615384 11 13 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1421 181 C20140710_OR016_03 C20140710_OR016_03 TB424014.[MT7]-DQPEDGADGRLPSSAR.3y5_1.heavy 605.63 / 517.273 2349.0 21.342224597930908 39 13 10 6 10 0.9737293514712344 59.696713216705724 0.03429985046386719 3 0.9048681138373411 3.969124350895969 2349.0 7.847208791208792 0.0 - - - - - - - 223.47368421052633 4 19 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1423 182 C20140710_OR016_03 C20140710_OR016_03 TB433008.[MT7]-TAPLPGPAQAGAGQPLPK[MT7].3b4_1.heavy 653.714 / 527.331 81986.0 29.5179500579834 42 18 10 6 8 6.88845417224739 14.517045116288338 0.030101776123046875 4 0.9807100939785613 8.871492847899788 81986.0 337.2976576616022 0.0 - - - - - - - 273.9230769230769 163 13 CEMP1 cementum protein 1 1425 182 C20140710_OR016_03 C20140710_OR016_03 TB433008.[MT7]-TAPLPGPAQAGAGQPLPK[MT7].3b10_2.heavy 653.714 / 524.799 13416.0 29.5179500579834 42 18 10 6 8 6.88845417224739 14.517045116288338 0.030101776123046875 4 0.9807100939785613 8.871492847899788 13416.0 37.694501510574014 1.0 - - - - - - - 197.46153846153845 30 13 CEMP1 cementum protein 1 1427 182 C20140710_OR016_03 C20140710_OR016_03 TB433008.[MT7]-TAPLPGPAQAGAGQPLPK[MT7].3y4_1.heavy 653.714 / 598.404 43229.0 29.5179500579834 42 18 10 6 8 6.88845417224739 14.517045116288338 0.030101776123046875 4 0.9807100939785613 8.871492847899788 43229.0 80.26498465701897 0.0 - - - - - - - 222.5625 86 16 CEMP1 cementum protein 1 1429 182 C20140710_OR016_03 C20140710_OR016_03 TB433008.[MT7]-TAPLPGPAQAGAGQPLPK[MT7].3b8_1.heavy 653.714 / 849.495 5383.0 29.5179500579834 42 18 10 6 8 6.88845417224739 14.517045116288338 0.030101776123046875 4 0.9807100939785613 8.871492847899788 5383.0 45.28319186109999 0.0 - - - - - - - 200.57894736842104 10 19 CEMP1 cementum protein 1 1431 183 C20140710_OR016_03 C20140710_OR016_03 TB423734.[MT7]-TLVLHLLR.2y5_1.heavy 554.87 / 651.43 10919.0 36.71480178833008 40 14 10 10 6 2.1673799480953013 36.5080359313863 0.0 5 0.9437560354230181 5.1792580423292005 10919.0 34.147563768112775 0.0 - - - - - - - 337.42857142857144 21 7 ADAM7 ADAM metallopeptidase domain 7 1433 183 C20140710_OR016_03 C20140710_OR016_03 TB423734.[MT7]-TLVLHLLR.2b4_1.heavy 554.87 / 571.394 3541.0 36.71480178833008 40 14 10 10 6 2.1673799480953013 36.5080359313863 0.0 5 0.9437560354230181 5.1792580423292005 3541.0 16.618266013266016 1.0 - - - - - - - 337.57142857142856 10 7 ADAM7 ADAM metallopeptidase domain 7 1435 183 C20140710_OR016_03 C20140710_OR016_03 TB423734.[MT7]-TLVLHLLR.2y6_1.heavy 554.87 / 750.498 4869.0 36.71480178833008 40 14 10 10 6 2.1673799480953013 36.5080359313863 0.0 5 0.9437560354230181 5.1792580423292005 4869.0 12.201019930628199 2.0 - - - - - - - 251.0 17 10 ADAM7 ADAM metallopeptidase domain 7 1437 183 C20140710_OR016_03 C20140710_OR016_03 TB423734.[MT7]-TLVLHLLR.2y7_1.heavy 554.87 / 863.583 6640.0 36.71480178833008 40 14 10 10 6 2.1673799480953013 36.5080359313863 0.0 5 0.9437560354230181 5.1792580423292005 6640.0 16.494960451977402 0.0 - - - - - - - 295.25 13 4 ADAM7 ADAM metallopeptidase domain 7 1439 184 C20140710_OR016_03 C20140710_OR016_03 TB424012.[MT7]-TFLLNC[CAM]MLLGGRK[MT7].3y6_1.heavy 604.347 / 787.527 5456.0 41.7581262588501 40 14 10 6 10 1.5465232218688767 44.78766441840791 0.039501190185546875 3 0.9407433427503763 5.044586106450001 5456.0 13.58076923076923 0.0 - - - - - - - 248.0 10 12 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1441 184 C20140710_OR016_03 C20140710_OR016_03 TB424012.[MT7]-TFLLNC[CAM]MLLGGRK[MT7].3y4_1.heavy 604.347 / 561.359 13391.0 41.7581262588501 40 14 10 6 10 1.5465232218688767 44.78766441840791 0.039501190185546875 3 0.9407433427503763 5.044586106450001 13391.0 25.19811827956989 0.0 - - - - - - - 289.3333333333333 26 6 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1443 184 C20140710_OR016_03 C20140710_OR016_03 TB424012.[MT7]-TFLLNC[CAM]MLLGGRK[MT7].3b3_1.heavy 604.347 / 506.31 11531.0 41.7581262588501 40 14 10 6 10 1.5465232218688767 44.78766441840791 0.039501190185546875 3 0.9407433427503763 5.044586106450001 11531.0 33.570088709677414 0.0 - - - - - - - 292.2857142857143 23 14 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1445 184 C20140710_OR016_03 C20140710_OR016_03 TB424012.[MT7]-TFLLNC[CAM]MLLGGRK[MT7].3y5_1.heavy 604.347 / 674.443 8431.0 41.7581262588501 40 14 10 6 10 1.5465232218688767 44.78766441840791 0.039501190185546875 3 0.9407433427503763 5.044586106450001 8431.0 15.893114919354836 0.0 - - - - - - - 334.8 16 10 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1447 185 C20140710_OR016_03 C20140710_OR016_03 TB433003.[MT7]-MLFSNIEDILAVHK[MT7].3b5_1.heavy 640.029 / 737.377 25914.0 47.41869926452637 40 14 10 6 10 1.1040844180520089 54.59571512242797 0.039402008056640625 3 0.9304810201060623 4.653310187889378 25914.0 151.1844153871669 0.0 - - - - - - - 220.16666666666666 51 12 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1449 185 C20140710_OR016_03 C20140710_OR016_03 TB433003.[MT7]-MLFSNIEDILAVHK[MT7].3y4_1.heavy 640.029 / 598.379 32270.0 47.41869926452637 40 14 10 6 10 1.1040844180520089 54.59571512242797 0.039402008056640625 3 0.9304810201060623 4.653310187889378 32270.0 103.93967778669702 0.0 - - - - - - - 254.3 64 10 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1451 185 C20140710_OR016_03 C20140710_OR016_03 TB433003.[MT7]-MLFSNIEDILAVHK[MT7].3b3_1.heavy 640.029 / 536.302 16135.0 47.41869926452637 40 14 10 6 10 1.1040844180520089 54.59571512242797 0.039402008056640625 3 0.9304810201060623 4.653310187889378 16135.0 185.1304973183813 0.0 - - - - - - - 204.54545454545453 32 11 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1453 185 C20140710_OR016_03 C20140710_OR016_03 TB433003.[MT7]-MLFSNIEDILAVHK[MT7].3b8_1.heavy 640.029 / 1094.53 25327.0 47.41869926452637 40 14 10 6 10 1.1040844180520089 54.59571512242797 0.039402008056640625 3 0.9304810201060623 4.653310187889378 25327.0 376.02841836734694 0.0 - - - - - - - 171.25 50 8 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1455 186 C20140710_OR016_03 C20140710_OR016_03 TB433002.[MT7]-MLFSNIEDILAVHK[MT7].2b8_1.heavy 959.539 / 1094.53 2149.0 47.41869926452637 40 14 10 6 10 9.839669719048366 10.162942746585543 0.039402008056640625 3 0.9407628742947649 5.045426078192338 2149.0 8.031245733788396 0.0 - - - - - - - 239.72727272727272 4 11 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1457 186 C20140710_OR016_03 C20140710_OR016_03 TB433002.[MT7]-MLFSNIEDILAVHK[MT7].2y4_1.heavy 959.539 / 598.379 1563.0 47.41869926452637 40 14 10 6 10 9.839669719048366 10.162942746585543 0.039402008056640625 3 0.9407628742947649 5.045426078192338 1563.0 10.93990574954056 0.0 - - - - - - - 293.0 3 6 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1459 186 C20140710_OR016_03 C20140710_OR016_03 TB433002.[MT7]-MLFSNIEDILAVHK[MT7].2b3_1.heavy 959.539 / 536.302 1953.0 47.41869926452637 40 14 10 6 10 9.839669719048366 10.162942746585543 0.039402008056640625 3 0.9407628742947649 5.045426078192338 1953.0 10.077563873152764 0.0 - - - - - - - 216.35714285714286 3 14 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1461 186 C20140710_OR016_03 C20140710_OR016_03 TB433002.[MT7]-MLFSNIEDILAVHK[MT7].2b5_1.heavy 959.539 / 737.377 977.0 47.41869926452637 40 14 10 6 10 9.839669719048366 10.162942746585543 0.039402008056640625 3 0.9407628742947649 5.045426078192338 977.0 19.859020408163264 1.0 - - - - - - - 0.0 1 0 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1463 187 C20140710_OR016_03 C20140710_OR016_03 TB433004.[MT7]-YINYLQSLLYPDK[MT7].2b3_1.heavy 959.532 / 535.3 1846.0 48.841450691223145 39 16 10 3 10 4.090635802293805 24.44607753736606 0.07480239868164062 3 0.967422447731921 6.818942338485621 1846.0 7.1058015742847225 0.0 - - - - - - - 249.1 3 10 ASCL3 achaete-scute complex homolog 3 (Drosophila) 1465 187 C20140710_OR016_03 C20140710_OR016_03 TB433004.[MT7]-YINYLQSLLYPDK[MT7].2b4_1.heavy 959.532 / 698.363 1569.0 48.841450691223145 39 16 10 3 10 4.090635802293805 24.44607753736606 0.07480239868164062 3 0.967422447731921 6.818942338485621 1569.0 9.615463947702214 0.0 - - - - - - - 288.375 3 8 ASCL3 achaete-scute complex homolog 3 (Drosophila) 1467 187 C20140710_OR016_03 C20140710_OR016_03 TB433004.[MT7]-YINYLQSLLYPDK[MT7].2y3_1.heavy 959.532 / 503.295 3692.0 48.841450691223145 39 16 10 3 10 4.090635802293805 24.44607753736606 0.07480239868164062 3 0.967422447731921 6.818942338485621 3692.0 37.74358189929892 1.0 - - - - - - - 199.83333333333334 7 6 ASCL3 achaete-scute complex homolog 3 (Drosophila) 1469 187 C20140710_OR016_03 C20140710_OR016_03 TB433004.[MT7]-YINYLQSLLYPDK[MT7].2b7_1.heavy 959.532 / 1026.54 1015.0 48.841450691223145 39 16 10 3 10 4.090635802293805 24.44607753736606 0.07480239868164062 3 0.967422447731921 6.818942338485621 1015.0 0.0 2.0 - - - - - - - 230.5 2 8 ASCL3 achaete-scute complex homolog 3 (Drosophila) 1471 188 C20140710_OR016_03 C20140710_OR016_03 TB423870.[MT7]-DRGYQDASTK[MT7].2y4_1.heavy 714.87 / 550.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC30A10 solute carrier family 30, member 10 1473 188 C20140710_OR016_03 C20140710_OR016_03 TB423870.[MT7]-DRGYQDASTK[MT7].2y5_1.heavy 714.87 / 665.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC30A10 solute carrier family 30, member 10 1475 188 C20140710_OR016_03 C20140710_OR016_03 TB423870.[MT7]-DRGYQDASTK[MT7].2y9_2.heavy 714.87 / 585.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC30A10 solute carrier family 30, member 10 1477 188 C20140710_OR016_03 C20140710_OR016_03 TB423870.[MT7]-DRGYQDASTK[MT7].2b6_1.heavy 714.87 / 879.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC30A10 solute carrier family 30, member 10 1479 189 C20140710_OR016_03 C20140710_OR016_03 TB423871.[MT7]-SFEC[CAM]IQSFK[MT7].3y3_1.heavy 478.583 / 525.315 6964.0 33.8296012878418 43 13 10 10 10 1.4308324286704321 57.74263086108169 0.0 3 0.9179339207981394 4.278235943352402 6964.0 29.016666666666666 0.0 - - - - - - - 242.66666666666666 13 6 ZNF468 zinc finger protein 468 1481 189 C20140710_OR016_03 C20140710_OR016_03 TB423871.[MT7]-SFEC[CAM]IQSFK[MT7].3b4_1.heavy 478.583 / 668.283 3534.0 33.8296012878418 43 13 10 10 10 1.4308324286704321 57.74263086108169 0.0 3 0.9179339207981394 4.278235943352402 3534.0 43.60865384615385 0.0 - - - - - - - 145.6 7 5 ZNF468 zinc finger protein 468 1483 189 C20140710_OR016_03 C20140710_OR016_03 TB423871.[MT7]-SFEC[CAM]IQSFK[MT7].3y4_1.heavy 478.583 / 653.374 520.0 33.8296012878418 43 13 10 10 10 1.4308324286704321 57.74263086108169 0.0 3 0.9179339207981394 4.278235943352402 520.0 2.5 2.0 - - - - - - - 0.0 1 0 ZNF468 zinc finger protein 468 1485 189 C20140710_OR016_03 C20140710_OR016_03 TB423871.[MT7]-SFEC[CAM]IQSFK[MT7].3b3_1.heavy 478.583 / 508.252 1871.0 33.8296012878418 43 13 10 10 10 1.4308324286704321 57.74263086108169 0.0 3 0.9179339207981394 4.278235943352402 1871.0 -0.3154493554892818 2.0 - - - - - - - 242.66666666666666 5 9 ZNF468 zinc finger protein 468 1487 190 C20140710_OR016_03 C20140710_OR016_03 TB423874.[MT7]-DAVAHC[CAM]HEAER.3y6_1.heavy 480.225 / 801.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510476;RANBP2;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RAN binding protein 2;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1489 190 C20140710_OR016_03 C20140710_OR016_03 TB423874.[MT7]-DAVAHC[CAM]HEAER.3b4_1.heavy 480.225 / 501.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510476;RANBP2;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RAN binding protein 2;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1491 190 C20140710_OR016_03 C20140710_OR016_03 TB423874.[MT7]-DAVAHC[CAM]HEAER.3y4_1.heavy 480.225 / 504.241 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510476;RANBP2;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RAN binding protein 2;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1493 190 C20140710_OR016_03 C20140710_OR016_03 TB423874.[MT7]-DAVAHC[CAM]HEAER.3y5_1.heavy 480.225 / 641.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510476;RANBP2;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RAN binding protein 2;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1495 191 C20140710_OR016_03 C20140710_OR016_03 TB432977.[MT7]-RETALEILDLWK[MT7].3y3_1.heavy 592.348 / 590.378 9907.0 45.507598876953125 43 13 10 10 10 2.1893188755799233 45.676306505835626 0.0 3 0.9238795132602393 4.444443875103761 9907.0 75.57349221150466 0.0 - - - - - - - 243.44444444444446 19 9 GALP galanin-like peptide 1497 191 C20140710_OR016_03 C20140710_OR016_03 TB432977.[MT7]-RETALEILDLWK[MT7].3b6_1.heavy 592.348 / 844.464 14183.0 45.507598876953125 43 13 10 10 10 2.1893188755799233 45.676306505835626 0.0 3 0.9238795132602393 4.444443875103761 14183.0 72.50095846645368 0.0 - - - - - - - 223.57142857142858 28 7 GALP galanin-like peptide 1499 191 C20140710_OR016_03 C20140710_OR016_03 TB432977.[MT7]-RETALEILDLWK[MT7].3b4_1.heavy 592.348 / 602.338 1773.0 45.507598876953125 43 13 10 10 10 2.1893188755799233 45.676306505835626 0.0 3 0.9238795132602393 4.444443875103761 1773.0 25.17495229112992 1.0 - - - - - - - 208.71428571428572 3 7 GALP galanin-like peptide 1501 191 C20140710_OR016_03 C20140710_OR016_03 TB432977.[MT7]-RETALEILDLWK[MT7].3y4_1.heavy 592.348 / 705.405 10116.0 45.507598876953125 43 13 10 10 10 2.1893188755799233 45.676306505835626 0.0 3 0.9238795132602393 4.444443875103761 10116.0 69.75214897938108 0.0 - - - - - - - 208.625 20 8 GALP galanin-like peptide 1503 192 C20140710_OR016_03 C20140710_OR016_03 TB423956.[MT7]-ETALEILDLWK[MT7].3y3_1.heavy 540.315 / 590.378 2207.0 50.12644958496094 21 8 2 5 6 0.6383199439932902 79.47344161560099 0.0417022705078125 5 0.7713890247437978 2.530286673447802 2207.0 12.245816077042063 1.0 - - - - - - - 327.0 4 5 GALP galanin-like peptide 1505 192 C20140710_OR016_03 C20140710_OR016_03 TB423956.[MT7]-ETALEILDLWK[MT7].3b4_1.heavy 540.315 / 559.321 1471.0 50.12644958496094 21 8 2 5 6 0.6383199439932902 79.47344161560099 0.0417022705078125 5 0.7713890247437978 2.530286673447802 1471.0 17.498227290457287 1.0 - - - - - - - 163.4 2 5 GALP galanin-like peptide 1507 192 C20140710_OR016_03 C20140710_OR016_03 TB423956.[MT7]-ETALEILDLWK[MT7].3b5_1.heavy 540.315 / 688.363 1798.0 50.12644958496094 21 8 2 5 6 0.6383199439932902 79.47344161560099 0.0417022705078125 5 0.7713890247437978 2.530286673447802 1798.0 18.31429698259672 0.0 - - - - - - - 217.66666666666666 3 3 GALP galanin-like peptide 1509 192 C20140710_OR016_03 C20140710_OR016_03 TB423956.[MT7]-ETALEILDLWK[MT7].3y4_1.heavy 540.315 / 705.405 2289.0 50.12644958496094 21 8 2 5 6 0.6383199439932902 79.47344161560099 0.0417022705078125 5 0.7713890247437978 2.530286673447802 2289.0 0.0 2.0 - - - - - - - 184.0 11 4 GALP galanin-like peptide 1511 193 C20140710_OR016_03 C20140710_OR016_03 TB423660.[MT7]-SEPNHVIFK[MT7].3y3_1.heavy 453.594 / 551.367 18416.0 25.405099868774414 43 18 10 5 10 6.5304375283169955 15.312909673568486 0.045398712158203125 3 0.9845582370226051 9.918670972368151 18416.0 347.2220582524272 0.0 - - - - - - - 154.5 36 8 SAG S-antigen; retina and pineal gland (arrestin) 1513 193 C20140710_OR016_03 C20140710_OR016_03 TB423660.[MT7]-SEPNHVIFK[MT7].3b4_1.heavy 453.594 / 572.28 19239.0 25.405099868774414 43 18 10 5 10 6.5304375283169955 15.312909673568486 0.045398712158203125 3 0.9845582370226051 9.918670972368151 19239.0 107.55783980582524 0.0 - - - - - - - 194.55555555555554 38 9 SAG S-antigen; retina and pineal gland (arrestin) 1515 193 C20140710_OR016_03 C20140710_OR016_03 TB423660.[MT7]-SEPNHVIFK[MT7].3b5_1.heavy 453.594 / 709.339 1955.0 25.405099868774414 43 18 10 5 10 6.5304375283169955 15.312909673568486 0.045398712158203125 3 0.9845582370226051 9.918670972368151 1955.0 37.96116504854369 0.0 - - - - - - - 128.75 3 4 SAG S-antigen; retina and pineal gland (arrestin) 1517 193 C20140710_OR016_03 C20140710_OR016_03 TB423660.[MT7]-SEPNHVIFK[MT7].3y4_1.heavy 453.594 / 650.436 2984.0 25.405099868774414 43 18 10 5 10 6.5304375283169955 15.312909673568486 0.045398712158203125 3 0.9845582370226051 9.918670972368151 2984.0 57.36233009708738 0.0 - - - - - - - 180.25 5 4 SAG S-antigen; retina and pineal gland (arrestin) 1519 194 C20140710_OR016_03 C20140710_OR016_03 TB432790.[MT7]-GYIIQK[MT7].2y4_1.heavy 505.318 / 645.442 927.0 26.688599586486816 41 18 10 5 8 4.374498659169763 22.859762407374703 0.04419898986816406 4 0.9835534274560028 9.61009416300263 927.0 8.955 2.0 - - - - - - - 188.83333333333334 2 6 SDCCAG1 serologically defined colon cancer antigen 1 1521 194 C20140710_OR016_03 C20140710_OR016_03 TB432790.[MT7]-GYIIQK[MT7].2y5_1.heavy 505.318 / 808.505 927.0 26.688599586486816 41 18 10 5 8 4.374498659169763 22.859762407374703 0.04419898986816406 4 0.9835534274560028 9.61009416300263 927.0 1.9499999999999997 1.0 - - - - - - - 274.6666666666667 2 6 SDCCAG1 serologically defined colon cancer antigen 1 1523 194 C20140710_OR016_03 C20140710_OR016_03 TB432790.[MT7]-GYIIQK[MT7].2b4_1.heavy 505.318 / 591.362 1855.0 26.688599586486816 41 18 10 5 8 4.374498659169763 22.859762407374703 0.04419898986816406 4 0.9835534274560028 9.61009416300263 1855.0 6.023139158576051 1.0 - - - - - - - 283.25 3 4 SDCCAG1 serologically defined colon cancer antigen 1 1525 194 C20140710_OR016_03 C20140710_OR016_03 TB432790.[MT7]-GYIIQK[MT7].2y3_1.heavy 505.318 / 532.357 3400.0 26.688599586486816 41 18 10 5 8 4.374498659169763 22.859762407374703 0.04419898986816406 4 0.9835534274560028 9.61009416300263 3400.0 33.55987055016181 0.0 - - - - - - - 252.8181818181818 6 11 SDCCAG1 serologically defined colon cancer antigen 1 1527 195 C20140710_OR016_03 C20140710_OR016_03 TB423866.[MT7]-GYAVLPDYPK[MT7].3y3_1.heavy 470.934 / 551.331 1929.0 33.10840034484863 37 14 9 6 8 2.6866405908171562 37.221204928488206 0.038600921630859375 4 0.9344401224320863 4.793376772015011 1929.0 11.711785714285714 1.0 - - - - - - - 725.1428571428571 5 7 MMP27 matrix metallopeptidase 27 1529 195 C20140710_OR016_03 C20140710_OR016_03 TB423866.[MT7]-GYAVLPDYPK[MT7].3b4_1.heavy 470.934 / 535.3 2538.0 33.10840034484863 37 14 9 6 8 2.6866405908171562 37.221204928488206 0.038600921630859375 4 0.9344401224320863 4.793376772015011 2538.0 -0.5 2.0 - - - - - - - 225.77777777777777 5 9 MMP27 matrix metallopeptidase 27 1531 195 C20140710_OR016_03 C20140710_OR016_03 TB423866.[MT7]-GYAVLPDYPK[MT7].3b5_1.heavy 470.934 / 648.384 1320.0 33.10840034484863 37 14 9 6 8 2.6866405908171562 37.221204928488206 0.038600921630859375 4 0.9344401224320863 4.793376772015011 1320.0 0.0 0.0 - - - - - - - 189.73333333333332 2 15 MMP27 matrix metallopeptidase 27 1533 195 C20140710_OR016_03 C20140710_OR016_03 TB423866.[MT7]-GYAVLPDYPK[MT7].3y5_1.heavy 470.934 / 763.411 711.0 33.10840034484863 37 14 9 6 8 2.6866405908171562 37.221204928488206 0.038600921630859375 4 0.9344401224320863 4.793376772015011 711.0 7.9030472516875605 1.0 - - - - - - - 0.0 1 0 MMP27 matrix metallopeptidase 27 1535 196 C20140710_OR016_03 C20140710_OR016_03 TB423955.[MT7]-ETALEILDLWK[MT7].2b4_1.heavy 809.968 / 559.321 733.0 50.12644958496094 32 17 2 5 8 2.9656623417479597 33.71928037534443 0.0417022705078125 4 0.9789169977626939 8.484576241610386 733.0 1.5302829321234228 0.0 - - - - - - - 0.0 1 0 GALP galanin-like peptide 1537 196 C20140710_OR016_03 C20140710_OR016_03 TB423955.[MT7]-ETALEILDLWK[MT7].2y3_1.heavy 809.968 / 590.378 978.0 50.12644958496094 32 17 2 5 8 2.9656623417479597 33.71928037534443 0.0417022705078125 4 0.9789169977626939 8.484576241610386 978.0 8.00655737704918 1.0 - - - - - - - 0.0 1 0 GALP galanin-like peptide 1539 196 C20140710_OR016_03 C20140710_OR016_03 TB423955.[MT7]-ETALEILDLWK[MT7].2b5_1.heavy 809.968 / 688.363 1059.0 50.12644958496094 32 17 2 5 8 2.9656623417479597 33.71928037534443 0.0417022705078125 4 0.9789169977626939 8.484576241610386 1059.0 4.342888108409581 1.0 - - - - - - - 187.69230769230768 4 13 GALP galanin-like peptide 1541 196 C20140710_OR016_03 C20140710_OR016_03 TB423955.[MT7]-ETALEILDLWK[MT7].2y7_1.heavy 809.968 / 1060.62 815.0 50.12644958496094 32 17 2 5 8 2.9656623417479597 33.71928037534443 0.0417022705078125 4 0.9789169977626939 8.484576241610386 815.0 5.55 1.0 - - - - - - - 0.0 1 0 GALP galanin-like peptide 1543 197 C20140710_OR016_03 C20140710_OR016_03 TB445048.[MT7]-VQHAPLEMGPQPR.2b3_1.heavy 802.428 / 509.295 1417.0 25.752899169921875 46 16 10 10 10 2.974251128836446 33.621908732071624 0.0 3 0.9648875292690313 6.566782794440351 1417.0 16.128962229556286 0.0 - - - - - - - 242.8 2 5 SAG S-antigen; retina and pineal gland (arrestin) 1545 197 C20140710_OR016_03 C20140710_OR016_03 TB445048.[MT7]-VQHAPLEMGPQPR.2y9_1.heavy 802.428 / 1024.52 3340.0 25.752899169921875 46 16 10 10 10 2.974251128836446 33.621908732071624 0.0 3 0.9648875292690313 6.566782794440351 3340.0 33.036237623762375 0.0 - - - - - - - 168.33333333333334 6 3 SAG S-antigen; retina and pineal gland (arrestin) 1547 197 C20140710_OR016_03 C20140710_OR016_03 TB445048.[MT7]-VQHAPLEMGPQPR.2y10_1.heavy 802.428 / 1095.56 1822.0 25.752899169921875 46 16 10 10 10 2.974251128836446 33.621908732071624 0.0 3 0.9648875292690313 6.566782794440351 1822.0 7.9737901616248585 1.0 - - - - - - - 202.0 5 2 SAG S-antigen; retina and pineal gland (arrestin) 1549 197 C20140710_OR016_03 C20140710_OR016_03 TB445048.[MT7]-VQHAPLEMGPQPR.2y11_1.heavy 802.428 / 1232.62 506.0 25.752899169921875 46 16 10 10 10 2.974251128836446 33.621908732071624 0.0 3 0.9648875292690313 6.566782794440351 506.0 2.9138564002599088 2.0 - - - - - - - 0.0 1 0 SAG S-antigen; retina and pineal gland (arrestin) 1551 198 C20140710_OR016_03 C20140710_OR016_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 96712.0 43.998034159342446 21 -3 10 6 8 null 0.0 0.03910064697265625 4 0.0 0.0 96712.0 590.1834782608696 0.0 - - - - - - - 232.41666666666666 193 12 1553 198 C20140710_OR016_03 C20140710_OR016_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 129236.0 43.998034159342446 21 -3 10 6 8 null 0.0 0.03910064697265625 4 0.0 0.0 129236.0 74.16634362259755 1.0 - - - - - - - 281.75 258 8 1555 198 C20140710_OR016_03 C20140710_OR016_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 119790.0 43.998034159342446 21 -3 10 6 8 null 0.0 0.03910064697265625 4 0.0 0.0 119790.0 167.59964515192362 1.0 - - - - - - - 628.8571428571429 250 7 1557 199 C20140710_OR016_03 C20140710_OR016_03 TB445140.[MT7]-C[CAM]FVTQLAC[CAM]FLANQQNK[MT7].3b6_1.heavy 744.05 / 893.467 2463.0 46.875999450683594 47 17 10 10 10 2.0867930448970187 37.71381763734432 0.0 3 0.9755529312414396 7.876988499625607 2463.0 11.335397727272728 0.0 - - - - - - - 232.0 4 11 NBPF1 neuroblastoma breakpoint family, member 1 1559 199 C20140710_OR016_03 C20140710_OR016_03 TB445140.[MT7]-C[CAM]FVTQLAC[CAM]FLANQQNK[MT7].3b5_1.heavy 744.05 / 780.383 5629.0 46.875999450683594 47 17 10 10 10 2.0867930448970187 37.71381763734432 0.0 3 0.9755529312414396 7.876988499625607 5629.0 69.7228409090909 0.0 - - - - - - - 213.71428571428572 11 7 NBPF1 neuroblastoma breakpoint family, member 1 1561 199 C20140710_OR016_03 C20140710_OR016_03 TB445140.[MT7]-C[CAM]FVTQLAC[CAM]FLANQQNK[MT7].3b3_1.heavy 744.05 / 551.277 3078.0 46.875999450683594 47 17 10 10 10 2.0867930448970187 37.71381763734432 0.0 3 0.9755529312414396 7.876988499625607 3078.0 18.363068181818182 0.0 - - - - - - - 211.2 6 15 NBPF1 neuroblastoma breakpoint family, member 1 1563 199 C20140710_OR016_03 C20140710_OR016_03 TB445140.[MT7]-C[CAM]FVTQLAC[CAM]FLANQQNK[MT7].3b7_1.heavy 744.05 / 964.504 3782.0 46.875999450683594 47 17 10 10 10 2.0867930448970187 37.71381763734432 0.0 3 0.9755529312414396 7.876988499625607 3782.0 14.1825 0.0 - - - - - - - 213.71428571428572 7 7 NBPF1 neuroblastoma breakpoint family, member 1 1565 200 C20140710_OR016_03 C20140710_OR016_03 TB445045.[MT7]-DIHGFEFQWK[MT7].3b6_1.heavy 532.28 / 843.412 1822.0 37.93320083618164 45 15 10 10 10 3.7821688347822855 26.439856169391852 0.0 3 0.9557708452166952 5.846476428492445 1822.0 12.861305025788653 1.0 - - - - - - - 770.5 4 2 ZNF468 zinc finger protein 468 1567 200 C20140710_OR016_03 C20140710_OR016_03 TB445045.[MT7]-DIHGFEFQWK[MT7].3b4_1.heavy 532.28 / 567.301 7566.0 37.93320083618164 45 15 10 10 10 3.7821688347822855 26.439856169391852 0.0 3 0.9557708452166952 5.846476428492445 7566.0 59.98757142857143 0.0 - - - - - - - 196.0 15 5 ZNF468 zinc finger protein 468 1569 200 C20140710_OR016_03 C20140710_OR016_03 TB445045.[MT7]-DIHGFEFQWK[MT7].3y4_1.heavy 532.28 / 752.421 6165.0 37.93320083618164 45 15 10 10 10 3.7821688347822855 26.439856169391852 0.0 3 0.9557708452166952 5.846476428492445 6165.0 18.78333531510107 0.0 - - - - - - - 233.33333333333334 12 3 ZNF468 zinc finger protein 468 1571 200 C20140710_OR016_03 C20140710_OR016_03 TB445045.[MT7]-DIHGFEFQWK[MT7].3b3_1.heavy 532.28 / 510.279 7286.0 37.93320083618164 45 15 10 10 10 3.7821688347822855 26.439856169391852 0.0 3 0.9557708452166952 5.846476428492445 7286.0 20.56249890782001 0.0 - - - - - - - 308.0 14 5 ZNF468 zinc finger protein 468 1573 201 C20140710_OR016_03 C20140710_OR016_03 TB432794.[MT7]-TVEAAEK[MT7].2y4_1.heavy 518.3 / 562.332 3583.0 18.067699432373047 46 16 10 10 10 1.8918000553443668 42.006529194554275 0.0 3 0.9626394342259471 6.364937826454814 3583.0 29.24013195893674 0.0 - - - - - - - 180.75 7 8 SDCCAG1 serologically defined colon cancer antigen 1 1575 201 C20140710_OR016_03 C20140710_OR016_03 TB432794.[MT7]-TVEAAEK[MT7].2y5_1.heavy 518.3 / 691.374 1886.0 18.067699432373047 46 16 10 10 10 1.8918000553443668 42.006529194554275 0.0 3 0.9626394342259471 6.364937826454814 1886.0 28.724079365079366 0.0 - - - - - - - 134.85714285714286 3 7 SDCCAG1 serologically defined colon cancer antigen 1 1577 201 C20140710_OR016_03 C20140710_OR016_03 TB432794.[MT7]-TVEAAEK[MT7].2b4_1.heavy 518.3 / 545.305 1069.0 18.067699432373047 46 16 10 10 10 1.8918000553443668 42.006529194554275 0.0 3 0.9626394342259471 6.364937826454814 1069.0 12.464725108225107 0.0 - - - - - - - 205.8181818181818 2 11 SDCCAG1 serologically defined colon cancer antigen 1 1579 201 C20140710_OR016_03 C20140710_OR016_03 TB432794.[MT7]-TVEAAEK[MT7].2y6_1.heavy 518.3 / 790.443 3143.0 18.067699432373047 46 16 10 10 10 1.8918000553443668 42.006529194554275 0.0 3 0.9626394342259471 6.364937826454814 3143.0 28.27037037037037 0.0 - - - - - - - 188.8 6 5 SDCCAG1 serologically defined colon cancer antigen 1 1581 202 C20140710_OR016_03 C20140710_OR016_03 TB423663.[MT7]-AISAYVR.2y5_1.heavy 462.275 / 595.32 9645.0 27.57979965209961 46 16 10 10 10 3.229576836665829 24.67074713013756 0.0 3 0.9635499878275949 6.44444402714545 9645.0 116.83684835644581 0.0 - - - - - - - 249.0 19 11 CLLU1OS chronic lymphocytic leukemia up-regulated 1 opposite strand 1583 202 C20140710_OR016_03 C20140710_OR016_03 TB423663.[MT7]-AISAYVR.2b4_1.heavy 462.275 / 487.3 6725.0 27.57979965209961 46 16 10 10 10 3.229576836665829 24.67074713013756 0.0 3 0.9635499878275949 6.44444402714545 6725.0 74.62656068027677 0.0 - - - - - - - 190.23076923076923 13 13 CLLU1OS chronic lymphocytic leukemia up-regulated 1 opposite strand 1585 202 C20140710_OR016_03 C20140710_OR016_03 TB423663.[MT7]-AISAYVR.2y6_1.heavy 462.275 / 708.404 7433.0 27.57979965209961 46 16 10 10 10 3.229576836665829 24.67074713013756 0.0 3 0.9635499878275949 6.44444402714545 7433.0 61.62868990512739 0.0 - - - - - - - 206.16666666666666 14 6 CLLU1OS chronic lymphocytic leukemia up-regulated 1 opposite strand 1587 202 C20140710_OR016_03 C20140710_OR016_03 TB423663.[MT7]-AISAYVR.2b5_1.heavy 462.275 / 650.363 5220.0 27.57979965209961 46 16 10 10 10 3.229576836665829 24.67074713013756 0.0 3 0.9635499878275949 6.44444402714545 5220.0 26.12769000690237 0.0 - - - - - - - 186.55555555555554 10 9 CLLU1OS chronic lymphocytic leukemia up-regulated 1 opposite strand 1589 203 C20140710_OR016_03 C20140710_OR016_03 TB432793.[MT7]-EPLEQK[MT7].2y4_1.heavy 516.302 / 661.4 1796.0 20.600500106811523 50 20 10 10 10 28.792888864334664 3.473079775745203 0.0 3 0.9996723981280015 68.18319144562939 1796.0 10.591794871794873 1.0 - - - - - - - 138.66666666666666 3 9 SLC30A10 solute carrier family 30, member 10 1591 203 C20140710_OR016_03 C20140710_OR016_03 TB432793.[MT7]-EPLEQK[MT7].2y5_1.heavy 516.302 / 758.453 10387.0 20.600500106811523 50 20 10 10 10 28.792888864334664 3.473079775745203 0.0 3 0.9996723981280015 68.18319144562939 10387.0 73.13069444444443 0.0 - - - - - - - 239.71428571428572 20 14 SLC30A10 solute carrier family 30, member 10 1593 203 C20140710_OR016_03 C20140710_OR016_03 TB432793.[MT7]-EPLEQK[MT7].2b4_1.heavy 516.302 / 613.331 937.0 20.600500106811523 50 20 10 10 10 28.792888864334664 3.473079775745203 0.0 3 0.9996723981280015 68.18319144562939 937.0 2.2869013578337163 1.0 - - - - - - - 182.11111111111111 3 9 SLC30A10 solute carrier family 30, member 10 1595 203 C20140710_OR016_03 C20140710_OR016_03 TB432793.[MT7]-EPLEQK[MT7].2y3_1.heavy 516.302 / 548.316 2499.0 20.600500106811523 50 20 10 10 10 28.792888864334664 3.473079775745203 0.0 3 0.9996723981280015 68.18319144562939 2499.0 9.606412307692308 1.0 - - - - - - - 205.72727272727272 4 11 SLC30A10 solute carrier family 30, member 10 1597 204 C20140710_OR016_03 C20140710_OR016_03 TB423959.[MT7]-SEPNHVIFK[MT7]K[MT7].4y5_2.heavy 408.496 / 461.82 2796.0 22.745100021362305 37 9 10 10 8 0.688462433109067 85.76836366052905 0.0 4 0.8008953685474134 2.7185503091632133 2796.0 20.1312 0.0 - - - - - - - 192.3 5 10 SAG S-antigen; retina and pineal gland (arrestin) 1599 204 C20140710_OR016_03 C20140710_OR016_03 TB423959.[MT7]-SEPNHVIFK[MT7]K[MT7].4y4_2.heavy 408.496 / 412.286 1311.0 22.745100021362305 37 9 10 10 8 0.688462433109067 85.76836366052905 0.0 4 0.8008953685474134 2.7185503091632133 1311.0 1.5581349084899307 2.0 - - - - - - - 174.83333333333334 2 6 SAG S-antigen; retina and pineal gland (arrestin) 1601 204 C20140710_OR016_03 C20140710_OR016_03 TB423959.[MT7]-SEPNHVIFK[MT7]K[MT7].4b4_1.heavy 408.496 / 572.28 1486.0 22.745100021362305 37 9 10 10 8 0.688462433109067 85.76836366052905 0.0 4 0.8008953685474134 2.7185503091632133 1486.0 -0.25674206254476006 5.0 - - - - - - - 200.8 4 10 SAG S-antigen; retina and pineal gland (arrestin) 1603 204 C20140710_OR016_03 C20140710_OR016_03 TB423959.[MT7]-SEPNHVIFK[MT7]K[MT7].4y3_1.heavy 408.496 / 710.48 961.0 22.745100021362305 37 9 10 10 8 0.688462433109067 85.76836366052905 0.0 4 0.8008953685474134 2.7185503091632133 961.0 8.828349565675177 1.0 - - - - - - - 0.0 1 0 SAG S-antigen; retina and pineal gland (arrestin) 1605 205 C20140710_OR016_03 C20140710_OR016_03 TB445046.[MT7]-AVLAELNASLLGMR.2y8_1.heavy 801.462 / 861.461 2460.0 47.45770072937012 40 14 10 6 10 1.5466356257375928 44.53307175731486 0.038600921630859375 3 0.9395039599448196 4.992117231067129 2460.0 20.985 0.0 - - - - - - - 246.0 4 6 SDCCAG1 serologically defined colon cancer antigen 1 1607 205 C20140710_OR016_03 C20140710_OR016_03 TB445046.[MT7]-AVLAELNASLLGMR.2y9_1.heavy 801.462 / 974.545 4674.0 47.45770072937012 40 14 10 6 10 1.5466356257375928 44.53307175731486 0.038600921630859375 3 0.9395039599448196 4.992117231067129 4674.0 21.069642857142856 0.0 - - - - - - - 216.1818181818182 9 11 SDCCAG1 serologically defined colon cancer antigen 1 1609 205 C20140710_OR016_03 C20140710_OR016_03 TB445046.[MT7]-AVLAELNASLLGMR.2y10_1.heavy 801.462 / 1103.59 3854.0 47.45770072937012 40 14 10 6 10 1.5466356257375928 44.53307175731486 0.038600921630859375 3 0.9395039599448196 4.992117231067129 3854.0 31.254999999999995 0.0 - - - - - - - 114.8 7 5 SDCCAG1 serologically defined colon cancer antigen 1 1611 205 C20140710_OR016_03 C20140710_OR016_03 TB445046.[MT7]-AVLAELNASLLGMR.2y11_1.heavy 801.462 / 1174.62 3690.0 47.45770072937012 40 14 10 6 10 1.5466356257375928 44.53307175731486 0.038600921630859375 3 0.9395039599448196 4.992117231067129 3690.0 29.474999999999994 0.0 - - - - - - - 205.0 7 12 SDCCAG1 serologically defined colon cancer antigen 1 1613 206 C20140710_OR016_03 C20140710_OR016_03 TB432983.[MT7]-NRELLEEMEILK[MT7].3b6_1.heavy 602.341 / 899.507 1902.0 39.09109878540039 41 11 10 10 10 0.7489954990737506 69.53630366102757 0.0 3 0.8668492508233718 3.343871103671443 1902.0 16.02257097388211 1.0 - - - - - - - 229.85714285714286 3 7 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1615 206 C20140710_OR016_03 C20140710_OR016_03 TB432983.[MT7]-NRELLEEMEILK[MT7].3y3_1.heavy 602.341 / 517.383 10974.0 39.09109878540039 41 11 10 10 10 0.7489954990737506 69.53630366102757 0.0 3 0.8668492508233718 3.343871103671443 10974.0 84.53102212855637 0.0 - - - - - - - 773.4285714285714 21 7 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1617 206 C20140710_OR016_03 C20140710_OR016_03 TB432983.[MT7]-NRELLEEMEILK[MT7].3b7_1.heavy 602.341 / 1028.55 4097.0 39.09109878540039 41 11 10 10 10 0.7489954990737506 69.53630366102757 0.0 3 0.8668492508233718 3.343871103671443 4097.0 10.078669977718858 0.0 - - - - - - - 341.5 8 6 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1619 206 C20140710_OR016_03 C20140710_OR016_03 TB432983.[MT7]-NRELLEEMEILK[MT7].3b7_2.heavy 602.341 / 514.778 11560.0 39.09109878540039 41 11 10 10 10 0.7489954990737506 69.53630366102757 0.0 3 0.8668492508233718 3.343871103671443 11560.0 40.80879868553718 0.0 - - - - - - - 274.375 23 8 CDC42BPB CDC42 binding protein kinase beta (DMPK-like) 1621 207 C20140710_OR016_03 C20140710_OR016_03 TB432795.[MT7]-IDNFLK[MT7].2y4_1.heavy 519.315 / 665.41 6220.0 33.952598571777344 43 17 6 10 10 2.009354024100969 34.19359353230213 0.0 3 0.9711361452431954 7.24661209574567 6220.0 17.66711728012131 0.0 - - - - - - - 240.8181818181818 12 11 IFNK interferon, kappa 1623 207 C20140710_OR016_03 C20140710_OR016_03 TB432795.[MT7]-IDNFLK[MT7].2y5_1.heavy 519.315 / 780.437 5644.0 33.952598571777344 43 17 6 10 10 2.009354024100969 34.19359353230213 0.0 3 0.9711361452431954 7.24661209574567 5644.0 28.383121387283236 0.0 - - - - - - - 215.875 11 8 IFNK interferon, kappa 1625 207 C20140710_OR016_03 C20140710_OR016_03 TB432795.[MT7]-IDNFLK[MT7].2b4_1.heavy 519.315 / 634.332 3455.0 33.952598571777344 43 17 6 10 10 2.009354024100969 34.19359353230213 0.0 3 0.9711361452431954 7.24661209574567 3455.0 26.43408816425121 0.0 - - - - - - - 256.0 6 9 IFNK interferon, kappa 1627 207 C20140710_OR016_03 C20140710_OR016_03 TB432795.[MT7]-IDNFLK[MT7].2y3_1.heavy 519.315 / 551.367 3455.0 33.952598571777344 43 17 6 10 10 2.009354024100969 34.19359353230213 0.0 3 0.9711361452431954 7.24661209574567 3455.0 11.958376482737847 1.0 - - - - - - - 243.22222222222223 20 9 IFNK interferon, kappa 1629 208 C20140710_OR016_03 C20140710_OR016_03 TB423957.[MT7]-TVLGILVSYQIK[MT7].3b6_1.heavy 541.343 / 741.499 2499.0 47.075801849365234 50 20 10 10 10 16.0436732082652 6.232986592402238 0.0 3 0.9988442712692696 36.29882598222117 2499.0 14.193003787878787 0.0 - - - - - - - 192.2 4 5 SAG S-antigen; retina and pineal gland (arrestin) 1631 208 C20140710_OR016_03 C20140710_OR016_03 TB423957.[MT7]-TVLGILVSYQIK[MT7].3b4_1.heavy 541.343 / 515.331 10382.0 47.075801849365234 50 20 10 10 10 16.0436732082652 6.232986592402238 0.0 3 0.9988442712692696 36.29882598222117 10382.0 59.226981334752445 0.0 - - - - - - - 156.125 20 8 SAG S-antigen; retina and pineal gland (arrestin) 1633 208 C20140710_OR016_03 C20140710_OR016_03 TB423957.[MT7]-TVLGILVSYQIK[MT7].3b5_1.heavy 541.343 / 628.415 5864.0 47.075801849365234 50 20 10 10 10 16.0436732082652 6.232986592402238 0.0 3 0.9988442712692696 36.29882598222117 5864.0 30.325257142857144 0.0 - - - - - - - 256.3333333333333 11 9 SAG S-antigen; retina and pineal gland (arrestin) 1635 208 C20140710_OR016_03 C20140710_OR016_03 TB423957.[MT7]-TVLGILVSYQIK[MT7].3y5_1.heavy 541.343 / 782.453 1826.0 47.075801849365234 50 20 10 10 10 16.0436732082652 6.232986592402238 0.0 3 0.9988442712692696 36.29882598222117 1826.0 7.46219487795118 1.0 - - - - - - - 164.57142857142858 4 7 SAG S-antigen; retina and pineal gland (arrestin) 1637 209 C20140710_OR016_03 C20140710_OR016_03 TB444976.[MT7]-VMLDIVAMFR.3b4_1.heavy 446.918 / 603.329 5100.0 52.89854907989502 42 16 10 6 10 2.4166690505147175 35.772908190319654 0.035800933837890625 3 0.9668971134741708 6.764318774711411 5100.0 174.14634146341464 0.0 - - - - - - - 71.75 10 4 S100A7L2 S100 calcium binding protein A7-like 2 1639 209 C20140710_OR016_03 C20140710_OR016_03 TB444976.[MT7]-VMLDIVAMFR.3b5_1.heavy 446.918 / 716.413 1481.0 52.89854907989502 42 16 10 6 10 2.4166690505147175 35.772908190319654 0.035800933837890625 3 0.9668971134741708 6.764318774711411 1481.0 33.23219512195122 0.0 - - - - - - - 154.0 2 4 S100A7L2 S100 calcium binding protein A7-like 2 1641 209 C20140710_OR016_03 C20140710_OR016_03 TB444976.[MT7]-VMLDIVAMFR.3y4_1.heavy 446.918 / 524.265 5224.0 52.89854907989502 42 16 10 6 10 2.4166690505147175 35.772908190319654 0.035800933837890625 3 0.9668971134741708 6.764318774711411 5224.0 31.66060606060606 0.0 - - - - - - - 140.85714285714286 10 7 S100A7L2 S100 calcium binding protein A7-like 2 1643 209 C20140710_OR016_03 C20140710_OR016_03 TB444976.[MT7]-VMLDIVAMFR.3y5_1.heavy 446.918 / 623.333 2591.0 52.89854907989502 42 16 10 6 10 2.4166690505147175 35.772908190319654 0.035800933837890625 3 0.9668971134741708 6.764318774711411 2591.0 52.409821138211385 0.0 - - - - - - - 150.66666666666666 5 3 S100A7L2 S100 calcium binding protein A7-like 2 1645 210 C20140710_OR016_03 C20140710_OR016_03 TB423727.[MT7]-IGNQVEK[MT7].2b4_1.heavy 538.321 / 557.316 1176.0 20.984299182891846 42 17 10 7 8 2.09811230453084 37.46020892167546 0.029600143432617188 4 0.9723359063533117 7.402830965104596 1176.0 3.0153846153846144 0.0 - - - - - - - 156.54545454545453 2 11 ZNF813;ZNF321;ZNF701;ZNF28;ZNF468;ZNF845 zinc finger protein 813;zinc finger protein 321;zinc finger protein 701;zinc finger protein 28;zinc finger protein 468;zinc finger protein 845 1647 210 C20140710_OR016_03 C20140710_OR016_03 TB423727.[MT7]-IGNQVEK[MT7].2b6_1.heavy 538.321 / 785.427 470.0 20.984299182891846 42 17 10 7 8 2.09811230453084 37.46020892167546 0.029600143432617188 4 0.9723359063533117 7.402830965104596 470.0 5.423076923076923 4.0 - - - - - - - 0.0 1 0 ZNF813;ZNF321;ZNF701;ZNF28;ZNF468;ZNF845 zinc finger protein 813;zinc finger protein 321;zinc finger protein 701;zinc finger protein 28;zinc finger protein 468;zinc finger protein 845 1649 210 C20140710_OR016_03 C20140710_OR016_03 TB423727.[MT7]-IGNQVEK[MT7].2y3_1.heavy 538.321 / 519.326 1959.0 20.984299182891846 42 17 10 7 8 2.09811230453084 37.46020892167546 0.029600143432617188 4 0.9723359063533117 7.402830965104596 1959.0 13.727750513382757 1.0 - - - - - - - 185.36363636363637 5 11 ZNF813;ZNF321;ZNF701;ZNF28;ZNF468;ZNF845 zinc finger protein 813;zinc finger protein 321;zinc finger protein 701;zinc finger protein 28;zinc finger protein 468;zinc finger protein 845 1651 210 C20140710_OR016_03 C20140710_OR016_03 TB423727.[MT7]-IGNQVEK[MT7].2y6_1.heavy 538.321 / 818.449 2821.0 20.984299182891846 42 17 10 7 8 2.09811230453084 37.46020892167546 0.029600143432617188 4 0.9723359063533117 7.402830965104596 2821.0 36.360581560283684 0.0 - - - - - - - 126.38461538461539 5 13 ZNF813;ZNF321;ZNF701;ZNF28;ZNF468;ZNF845 zinc finger protein 813;zinc finger protein 321;zinc finger protein 701;zinc finger protein 28;zinc finger protein 468;zinc finger protein 845 1653 211 C20140710_OR016_03 C20140710_OR016_03 TB423726.[MT7]-VLVSLQK[MT7].2y4_1.heavy 537.86 / 619.39 12326.0 31.416924953460693 43 17 10 6 10 3.906100351500565 25.600980773979366 0.03330039978027344 3 0.974497681212338 7.711613041364005 12326.0 42.11728599439776 0.0 - - - - - - - 724.2857142857143 24 7 SDCCAG1 serologically defined colon cancer antigen 1 1655 211 C20140710_OR016_03 C20140710_OR016_03 TB423726.[MT7]-VLVSLQK[MT7].2y5_1.heavy 537.86 / 718.458 4895.0 31.416924953460693 43 17 10 6 10 3.906100351500565 25.600980773979366 0.03330039978027344 3 0.974497681212338 7.711613041364005 4895.0 23.540839694656487 0.0 - - - - - - - 174.73333333333332 9 15 SDCCAG1 serologically defined colon cancer antigen 1 1657 211 C20140710_OR016_03 C20140710_OR016_03 TB423726.[MT7]-VLVSLQK[MT7].2y3_1.heavy 537.86 / 532.357 3147.0 31.416924953460693 43 17 10 6 10 3.906100351500565 25.600980773979366 0.03330039978027344 3 0.974497681212338 7.711613041364005 3147.0 4.227414854124623 3.0 - - - - - - - 797.75 6 8 SDCCAG1 serologically defined colon cancer antigen 1 1659 211 C20140710_OR016_03 C20140710_OR016_03 TB423726.[MT7]-VLVSLQK[MT7].2y6_1.heavy 537.86 / 831.542 6469.0 31.416924953460693 43 17 10 6 10 3.906100351500565 25.600980773979366 0.03330039978027344 3 0.974497681212338 7.711613041364005 6469.0 46.22830643402399 0.0 - - - - - - - 174.66666666666666 12 12 SDCCAG1 serologically defined colon cancer antigen 1 1661 212 C20140710_OR016_03 C20140710_OR016_03 TB432840.[MT7]-ATLLLESGIR.2b4_1.heavy 608.873 / 543.362 8989.0 37.28110122680664 46 16 10 10 10 2.2126492837700336 35.97529997108479 0.0 3 0.9646628195251209 6.545746170749601 8989.0 34.77828634608993 0.0 - - - - - - - 324.2 17 5 SDCCAG1 serologically defined colon cancer antigen 1 1663 212 C20140710_OR016_03 C20140710_OR016_03 TB432840.[MT7]-ATLLLESGIR.2y9_1.heavy 608.873 / 1001.6 13115.0 37.28110122680664 46 16 10 10 10 2.2126492837700336 35.97529997108479 0.0 3 0.9646628195251209 6.545746170749601 13115.0 131.45243283754178 0.0 - - - - - - - 273.7142857142857 26 7 SDCCAG1 serologically defined colon cancer antigen 1 1665 212 C20140710_OR016_03 C20140710_OR016_03 TB432840.[MT7]-ATLLLESGIR.2y6_1.heavy 608.873 / 674.383 6484.0 37.28110122680664 46 16 10 10 10 2.2126492837700336 35.97529997108479 0.0 3 0.9646628195251209 6.545746170749601 6484.0 27.25895490191569 0.0 - - - - - - - 276.25 12 8 SDCCAG1 serologically defined colon cancer antigen 1 1667 212 C20140710_OR016_03 C20140710_OR016_03 TB432840.[MT7]-ATLLLESGIR.2y7_1.heavy 608.873 / 787.467 6779.0 37.28110122680664 46 16 10 10 10 2.2126492837700336 35.97529997108479 0.0 3 0.9646628195251209 6.545746170749601 6779.0 36.09418475343201 0.0 - - - - - - - 294.8333333333333 13 6 SDCCAG1 serologically defined colon cancer antigen 1 1669 213 C20140710_OR016_03 C20140710_OR016_03 TB424023.[MT7]-YVELFIVADDTVYR.3y6_1.heavy 616.328 / 768.352 2774.0 48.31449890136719 40 17 9 6 8 2.358911516549645 34.00127109695529 0.0373992919921875 4 0.9757731784270954 7.912859069292638 2774.0 18.189347090521743 0.0 - - - - - - - 236.22222222222223 5 9 ADAM7 ADAM metallopeptidase domain 7 1671 213 C20140710_OR016_03 C20140710_OR016_03 TB424023.[MT7]-YVELFIVADDTVYR.3b4_1.heavy 616.328 / 649.368 2774.0 48.31449890136719 40 17 9 6 8 2.358911516549645 34.00127109695529 0.0373992919921875 4 0.9757731784270954 7.912859069292638 2774.0 2.2512173128944997 1.0 - - - - - - - 277.2 6 10 ADAM7 ADAM metallopeptidase domain 7 1673 213 C20140710_OR016_03 C20140710_OR016_03 TB424023.[MT7]-YVELFIVADDTVYR.3b5_1.heavy 616.328 / 796.436 1849.0 48.31449890136719 40 17 9 6 8 2.358911516549645 34.00127109695529 0.0373992919921875 4 0.9757731784270954 7.912859069292638 1849.0 21.693471673254283 0.0 - - - - - - - 175.4 3 10 ADAM7 ADAM metallopeptidase domain 7 1675 213 C20140710_OR016_03 C20140710_OR016_03 TB424023.[MT7]-YVELFIVADDTVYR.3b3_1.heavy 616.328 / 536.284 2681.0 48.31449890136719 40 17 9 6 8 2.358911516549645 34.00127109695529 0.0373992919921875 4 0.9757731784270954 7.912859069292638 2681.0 16.955513513513516 0.0 - - - - - - - 246.33333333333334 5 6 ADAM7 ADAM metallopeptidase domain 7 1677 214 C20140710_OR016_03 C20140710_OR016_03 TB433017.[MT7]-AAVDEAIQEGLEVWSK[MT7].2y9_1.heavy 1017.04 / 1219.64 1220.0 46.6776008605957 37 14 10 3 10 2.2071592479232285 36.15334806625286 0.07939910888671875 3 0.9437226099904273 5.177705000913904 1220.0 3.6476658476658477 1.0 - - - - - - - 267.0 2 8 MMP27 matrix metallopeptidase 27 1679 214 C20140710_OR016_03 C20140710_OR016_03 TB433017.[MT7]-AAVDEAIQEGLEVWSK[MT7].2b4_1.heavy 1017.04 / 501.279 2134.0 46.6776008605957 37 14 10 3 10 2.2071592479232285 36.15334806625286 0.07939910888671875 3 0.9437226099904273 5.177705000913904 2134.0 19.973399014778323 0.0 - - - - - - - 216.0 4 8 MMP27 matrix metallopeptidase 27 1681 214 C20140710_OR016_03 C20140710_OR016_03 TB433017.[MT7]-AAVDEAIQEGLEVWSK[MT7].2b6_1.heavy 1017.04 / 701.359 2033.0 46.6776008605957 37 14 10 3 10 2.2071592479232285 36.15334806625286 0.07939910888671875 3 0.9437226099904273 5.177705000913904 2033.0 10.004927723491884 0.0 - - - - - - - 188.71428571428572 4 7 MMP27 matrix metallopeptidase 27 1683 214 C20140710_OR016_03 C20140710_OR016_03 TB433017.[MT7]-AAVDEAIQEGLEVWSK[MT7].2b5_1.heavy 1017.04 / 630.321 2643.0 46.6776008605957 37 14 10 3 10 2.2071592479232285 36.15334806625286 0.07939910888671875 3 0.9437226099904273 5.177705000913904 2643.0 6.065901639344262 0.0 - - - - - - - 188.85714285714286 5 7 MMP27 matrix metallopeptidase 27 1685 215 C20140710_OR016_03 C20140710_OR016_03 TB423725.[MT7]-GATGPEEQSDSLK[MT7].3b6_1.heavy 536.277 / 657.332 2623.0 21.550849437713623 40 16 10 6 8 3.7338842928713176 21.748266096953046 0.03579902648925781 4 0.9682788210603711 6.910873551113506 2623.0 15.507044025157231 1.0 - - - - - - - 218.375 5 8 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1687 215 C20140710_OR016_03 C20140710_OR016_03 TB423725.[MT7]-GATGPEEQSDSLK[MT7].3y5_1.heavy 536.277 / 693.39 1907.0 21.550849437713623 40 16 10 6 8 3.7338842928713176 21.748266096953046 0.03579902648925781 4 0.9682788210603711 6.910873551113506 1907.0 13.432955974842768 0.0 - - - - - - - 220.55555555555554 3 9 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1689 215 C20140710_OR016_03 C20140710_OR016_03 TB423725.[MT7]-GATGPEEQSDSLK[MT7].3b7_1.heavy 536.277 / 786.375 636.0 21.550849437713623 40 16 10 6 8 3.7338842928713176 21.748266096953046 0.03579902648925781 4 0.9682788210603711 6.910873551113506 636.0 0.0 1.0 - - - - - - - 0.0 1 0 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1691 215 C20140710_OR016_03 C20140710_OR016_03 TB423725.[MT7]-GATGPEEQSDSLK[MT7].3y4_1.heavy 536.277 / 606.358 1351.0 21.550849437713623 40 16 10 6 8 3.7338842928713176 21.748266096953046 0.03579902648925781 4 0.9682788210603711 6.910873551113506 1351.0 7.314435812060673 1.0 - - - - - - - 225.92307692307693 2 13 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1693 216 C20140710_OR016_03 C20140710_OR016_03 TB432847.[MT7]-GIADIMIAFR.2y8_1.heavy 625.856 / 936.497 3936.0 46.637901306152344 50 20 10 10 10 16.20883564336625 6.169474612504122 0.0 3 0.998691120051444 34.108693237556075 3936.0 -0.5 1.0 - - - - - - - 281.2857142857143 7 7 MMP27 matrix metallopeptidase 27 1695 216 C20140710_OR016_03 C20140710_OR016_03 TB432847.[MT7]-GIADIMIAFR.2b4_1.heavy 625.856 / 501.279 8757.0 46.637901306152344 50 20 10 10 10 16.20883564336625 6.169474612504122 0.0 3 0.998691120051444 34.108693237556075 8757.0 47.61011305170782 0.0 - - - - - - - 250.36363636363637 17 11 MMP27 matrix metallopeptidase 27 1697 216 C20140710_OR016_03 C20140710_OR016_03 TB432847.[MT7]-GIADIMIAFR.2y6_1.heavy 625.856 / 750.433 5608.0 46.637901306152344 50 20 10 10 10 16.20883564336625 6.169474612504122 0.0 3 0.998691120051444 34.108693237556075 5608.0 40.92011356792567 0.0 - - - - - - - 196.625 11 8 MMP27 matrix metallopeptidase 27 1699 216 C20140710_OR016_03 C20140710_OR016_03 TB432847.[MT7]-GIADIMIAFR.2b5_1.heavy 625.856 / 614.363 3542.0 46.637901306152344 50 20 10 10 10 16.20883564336625 6.169474612504122 0.0 3 0.998691120051444 34.108693237556075 3542.0 9.891442022205357 1.0 - - - - - - - 315.1 7 10 MMP27 matrix metallopeptidase 27 1701 217 C20140710_OR016_03 C20140710_OR016_03 TB423720.[MT7]-AVPGNLAK[MT7].2y5_1.heavy 529.334 / 646.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1703 217 C20140710_OR016_03 C20140710_OR016_03 TB423720.[MT7]-AVPGNLAK[MT7].2y6_1.heavy 529.334 / 743.453 N/A N/A - - - - - - - - - 0.0 - - - - - - - RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1705 217 C20140710_OR016_03 C20140710_OR016_03 TB423720.[MT7]-AVPGNLAK[MT7].2b5_1.heavy 529.334 / 583.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1707 217 C20140710_OR016_03 C20140710_OR016_03 TB423720.[MT7]-AVPGNLAK[MT7].2y7_1.heavy 529.334 / 842.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1709 218 C20140710_OR016_03 C20140710_OR016_03 TB432846.[MT7]-NRSLIDDK[MT7].3b6_2.heavy 416.91 / 422.244 3171.0 21.84327507019043 30 13 8 3 6 1.4036309387469315 56.053947199274965 0.0718994140625 5 0.9179123233923431 4.27766516206188 3171.0 12.345466942826675 1.0 - - - - - - - 274.14285714285717 9 7 MMP27 matrix metallopeptidase 27 1711 218 C20140710_OR016_03 C20140710_OR016_03 TB432846.[MT7]-NRSLIDDK[MT7].3y3_1.heavy 416.91 / 521.269 3671.0 21.84327507019043 30 13 8 3 6 1.4036309387469315 56.053947199274965 0.0718994140625 5 0.9179123233923431 4.27766516206188 3671.0 48.609381410534226 0.0 - - - - - - - 222.16666666666666 7 6 MMP27 matrix metallopeptidase 27 1713 218 C20140710_OR016_03 C20140710_OR016_03 TB432846.[MT7]-NRSLIDDK[MT7].3b4_1.heavy 416.91 / 615.37 1418.0 21.84327507019043 30 13 8 3 6 1.4036309387469315 56.053947199274965 0.0718994140625 5 0.9179123233923431 4.27766516206188 1418.0 3.9624750499001995 3.0 - - - - - - - 201.5 5 12 MMP27 matrix metallopeptidase 27 1715 218 C20140710_OR016_03 C20140710_OR016_03 TB432846.[MT7]-NRSLIDDK[MT7].3y4_1.heavy 416.91 / 634.353 918.0 21.84327507019043 30 13 8 3 6 1.4036309387469315 56.053947199274965 0.0718994140625 5 0.9179123233923431 4.27766516206188 918.0 11.59007286631556 0.0 - - - - - - - 0.0 1 0 MMP27 matrix metallopeptidase 27 1717 219 C20140710_OR016_03 C20140710_OR016_03 TB433013.[MT7]-FLGLLYELEENTEK[MT7].3b4_1.heavy 662.694 / 575.367 8723.0 51.73609924316406 40 15 10 5 10 2.1877816165545627 45.70840126058168 0.04180145263671875 3 0.9587236657856554 6.053499829683382 8723.0 50.53521303258145 0.0 - - - - - - - 206.0 17 7 RGPD4;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1719 219 C20140710_OR016_03 C20140710_OR016_03 TB433013.[MT7]-FLGLLYELEENTEK[MT7].3b5_1.heavy 662.694 / 688.451 8268.0 51.73609924316406 40 15 10 5 10 2.1877816165545627 45.70840126058168 0.04180145263671875 3 0.9587236657856554 6.053499829683382 8268.0 112.13573736321 0.0 - - - - - - - 216.71428571428572 16 7 RGPD4;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1721 219 C20140710_OR016_03 C20140710_OR016_03 TB433013.[MT7]-FLGLLYELEENTEK[MT7].3b7_1.heavy 662.694 / 980.557 5841.0 51.73609924316406 40 15 10 5 10 2.1877816165545627 45.70840126058168 0.04180145263671875 3 0.9587236657856554 6.053499829683382 5841.0 99.91184210526316 0.0 - - - - - - - 152.0 11 2 RGPD4;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1723 219 C20140710_OR016_03 C20140710_OR016_03 TB433013.[MT7]-FLGLLYELEENTEK[MT7].3b8_2.heavy 662.694 / 547.324 3945.0 51.73609924316406 40 15 10 5 10 2.1877816165545627 45.70840126058168 0.04180145263671875 3 0.9587236657856554 6.053499829683382 3945.0 23.89512434933488 0.0 - - - - - - - 269.0 7 11 RGPD4;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 1725 220 C20140710_OR016_03 C20140710_OR016_03 TB433012.[MT7]-VFFLFDNLLVYC[CAM]K[MT7].3y3_1.heavy 656.03 / 614.309 8057.0 54.02225112915039 43 17 10 6 10 3.053063863646691 26.10589768593821 0.03179931640625 3 0.971662632335857 7.313944891730708 8057.0 -21.77567567567568 0.0 - - - - - - - 89.2 16 5 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1727 220 C20140710_OR016_03 C20140710_OR016_03 TB433012.[MT7]-VFFLFDNLLVYC[CAM]K[MT7].3b4_1.heavy 656.03 / 651.399 5556.0 54.02225112915039 43 17 10 6 10 3.053063863646691 26.10589768593821 0.03179931640625 3 0.971662632335857 7.313944891730708 5556.0 -39.68571428571428 0.0 - - - - - - - 93.0 11 3 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1729 220 C20140710_OR016_03 C20140710_OR016_03 TB433012.[MT7]-VFFLFDNLLVYC[CAM]K[MT7].3y4_1.heavy 656.03 / 713.377 5223.0 54.02225112915039 43 17 10 6 10 3.053063863646691 26.10589768593821 0.03179931640625 3 0.971662632335857 7.313944891730708 5223.0 -0.047054054054051164 0.0 - - - - - - - 111.0 10 2 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1731 220 C20140710_OR016_03 C20140710_OR016_03 TB433012.[MT7]-VFFLFDNLLVYC[CAM]K[MT7].3b3_1.heavy 656.03 / 538.315 5890.0 54.02225112915039 43 17 10 6 10 3.053063863646691 26.10589768593821 0.03179931640625 3 0.971662632335857 7.313944891730708 5890.0 -15.91891891891892 0.0 - - - - - - - 122.4 11 5 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1733 221 C20140710_OR016_03 C20140710_OR016_03 TB432842.[MT7]-SIHTLGFPGR.3y7_1.heavy 410.235 / 747.415 782.0 29.49537420272827 40 18 10 6 6 6.781392504829545 14.746233893522962 0.030099868774414062 5 0.9853874461215132 10.196920622443871 782.0 8.616547186932848 2.0 - - - - - - - 195.58333333333334 2 12 MMP27 matrix metallopeptidase 27 1735 221 C20140710_OR016_03 C20140710_OR016_03 TB432842.[MT7]-SIHTLGFPGR.3y6_1.heavy 410.235 / 646.367 2084.0 29.49537420272827 40 18 10 6 6 6.781392504829545 14.746233893522962 0.030099868774414062 5 0.9853874461215132 10.196920622443871 2084.0 3.45439429436278 0.0 - - - - - - - 188.16666666666666 4 6 MMP27 matrix metallopeptidase 27 1737 221 C20140710_OR016_03 C20140710_OR016_03 TB432842.[MT7]-SIHTLGFPGR.3y5_1.heavy 410.235 / 533.283 7903.0 29.49537420272827 40 18 10 6 6 6.781392504829545 14.746233893522962 0.030099868774414062 5 0.9853874461215132 10.196920622443871 7903.0 68.12931034482759 1.0 - - - - - - - 211.14285714285714 15 14 MMP27 matrix metallopeptidase 27 1739 221 C20140710_OR016_03 C20140710_OR016_03 TB432842.[MT7]-SIHTLGFPGR.3y4_1.heavy 410.235 / 476.262 1216.0 29.49537420272827 40 18 10 6 6 6.781392504829545 14.746233893522962 0.030099868774414062 5 0.9853874461215132 10.196920622443871 1216.0 0.7451545652090812 4.0 - - - - - - - 227.61904761904762 2 21 MMP27 matrix metallopeptidase 27 1741 222 C20140710_OR016_03 C20140710_OR016_03 TB432797.[MT7]-C[CAM]NEC[CAM]GK[MT7].2y4_1.heavy 528.246 / 637.31 702.0 13.73490047454834 50 20 10 10 10 7.892890157513851 12.669630262724773 0.0 3 0.9954377261539609 18.264443422464613 702.0 35.02762886597938 0.0 - - - - - - - 0.0 1 0 ZNF197;ZNF234;ZNF273;ZNF501;ZNF354B;ZNF816;ZNF813;ZNF792;ZFP28;ZNF480;ZNF534;ZNF578;ZNF569;ZNF836;ZNF610;ZNF600;ZNF320;ZNF433;ZNF721;ZNF585A;ZNF485;ZNF510;ZKSCAN5;ZNF473;ZNF615;ZNF841;ZNF852;ZNF660;ZNF454;ZNF181;ZNF546;ZNF677;ZNF860;ZNF879;ZNF391;ZNF81;ZNF713;ZNF429;ZNF568;ZNF808;ZNF888;ZNF761;ZNF880;ZNF727;ZNF701;ZNF83;ZNF415;ZNF167;ZNF248;ZNF286A;ZNF287;ZNF624;RBAK;ZNF250;ZNF674;ZNF323;ZFP62;ZNF389;ZNF354A;ZNF286B;ZFP37;ZNF7;ZNF182;ZNF28;ZNF33A;ZNF33B;ZNF74;ZNF79;ZNF134;ZNF184;ZNF202;ZNF226;ZNF329;ZNF665;ZNF606;ZFP2;ZNF436;ZNF611;ZNF397;ZNF347;ZNF514;ZNF616;ZNF766;ZNF468;ZNF160;ZNF502;ZNF765;ZNF845;ZNF585B;ZNF264;ZSCAN12;ZBTB24 zinc finger protein 197;zinc finger protein 234;zinc finger protein 273;zinc finger protein 501;zinc finger protein 354B;zinc finger protein 816;zinc finger protein 813;zinc finger protein 792;zinc finger protein 28 homolog (mouse);zinc finger protein 480;zinc finger protein 534;zinc finger protein 578;zinc finger protein 569;zinc finger protein 836;zinc finger protein 610;zinc finger protein 600;zinc finger protein 320;zinc finger protein 433;zinc finger protein 721;zinc finger protein 585A;zinc finger protein 485;zinc finger protein 510;zinc finger with KRAB and SCAN domains 5;zinc finger protein 473;zinc finger protein 615;zinc finger protein 841;zinc finger protein 852;zinc finger protein 660;zinc finger protein 454;zinc finger protein 181;zinc finger protein 546;zinc finger protein 677;zinc finger protein 860;zinc finger protein 879;zinc finger protein 391;zinc finger protein 81;zinc finger protein 713;zinc finger protein 429;zinc finger protein 568;zinc finger protein 808;zinc finger protein 888;zinc finger protein 761;zinc finger protein 880;zinc finger protein 727;zinc finger protein 701;zinc finger protein 83;zinc finger protein 415;zinc finger protein 167;zinc finger protein 248;zinc finger protein 286A;zinc finger protein 287;zinc finger protein 624;RB-associated KRAB zinc finger;zinc finger protein 250;zinc finger protein 674;zinc finger protein 323;zinc finger protein 62 homolog (mouse);zinc finger protein 389;zinc finger protein 354A;zinc finger protein 286B;zinc finger protein 37 homolog (mouse);zinc finger protein 7;zinc finger protein 182;zinc finger protein 28;zinc finger protein 33A;zinc finger protein 33B;zinc finger protein 74;zinc finger protein 79;zinc finger protein 134;zinc finger protein 184;zinc finger protein 202;zinc finger protein 226;zinc finger protein 329;zinc finger protein 665;zinc finger protein 606;zinc finger protein 2 homolog (mouse);zinc finger protein 436;zinc finger protein 611;zinc finger protein 397;zinc finger protein 347;zinc finger protein 514;zinc finger protein 616;zinc finger protein 766;zinc finger protein 468;zinc finger protein 160;zinc finger protein 502;zinc finger protein 765;zinc finger protein 845;zinc finger protein 585B;zinc finger protein 264;zinc finger and SCAN domain containing 12;zinc finger and BTB domain containing 24 1743 222 C20140710_OR016_03 C20140710_OR016_03 TB432797.[MT7]-C[CAM]NEC[CAM]GK[MT7].2b3_1.heavy 528.246 / 548.226 1284.0 13.73490047454834 50 20 10 10 10 7.892890157513851 12.669630262724773 0.0 3 0.9954377261539609 18.264443422464613 1284.0 26.639690721649487 0.0 - - - - - - - 87.2 2 15 ZNF197;ZNF234;ZNF273;ZNF501;ZNF354B;ZNF816;ZNF813;ZNF792;ZFP28;ZNF480;ZNF534;ZNF578;ZNF569;ZNF836;ZNF610;ZNF600;ZNF320;ZNF433;ZNF721;ZNF585A;ZNF485;ZNF510;ZKSCAN5;ZNF473;ZNF615;ZNF841;ZNF852;ZNF660;ZNF454;ZNF181;ZNF546;ZNF677;ZNF860;ZNF879;ZNF391;ZNF81;ZNF713;ZNF429;ZNF568;ZNF808;ZNF888;ZNF761;ZNF880;ZNF727;ZNF701;ZNF83;ZNF415;ZNF167;ZNF248;ZNF286A;ZNF287;ZNF624;RBAK;ZNF250;ZNF674;ZNF323;ZFP62;ZNF389;ZNF354A;ZNF286B;ZFP37;ZNF7;ZNF182;ZNF28;ZNF33A;ZNF33B;ZNF74;ZNF79;ZNF134;ZNF184;ZNF202;ZNF226;ZNF329;ZNF665;ZNF606;ZFP2;ZNF436;ZNF611;ZNF397;ZNF347;ZNF514;ZNF616;ZNF766;ZNF468;ZNF160;ZNF502;ZNF765;ZNF845;ZNF585B;ZNF264;ZSCAN12;ZBTB24 zinc finger protein 197;zinc finger protein 234;zinc finger protein 273;zinc finger protein 501;zinc finger protein 354B;zinc finger protein 816;zinc finger protein 813;zinc finger protein 792;zinc finger protein 28 homolog (mouse);zinc finger protein 480;zinc finger protein 534;zinc finger protein 578;zinc finger protein 569;zinc finger protein 836;zinc finger protein 610;zinc finger protein 600;zinc finger protein 320;zinc finger protein 433;zinc finger protein 721;zinc finger protein 585A;zinc finger protein 485;zinc finger protein 510;zinc finger with KRAB and SCAN domains 5;zinc finger protein 473;zinc finger protein 615;zinc finger protein 841;zinc finger protein 852;zinc finger protein 660;zinc finger protein 454;zinc finger protein 181;zinc finger protein 546;zinc finger protein 677;zinc finger protein 860;zinc finger protein 879;zinc finger protein 391;zinc finger protein 81;zinc finger protein 713;zinc finger protein 429;zinc finger protein 568;zinc finger protein 808;zinc finger protein 888;zinc finger protein 761;zinc finger protein 880;zinc finger protein 727;zinc finger protein 701;zinc finger protein 83;zinc finger protein 415;zinc finger protein 167;zinc finger protein 248;zinc finger protein 286A;zinc finger protein 287;zinc finger protein 624;RB-associated KRAB zinc finger;zinc finger protein 250;zinc finger protein 674;zinc finger protein 323;zinc finger protein 62 homolog (mouse);zinc finger protein 389;zinc finger protein 354A;zinc finger protein 286B;zinc finger protein 37 homolog (mouse);zinc finger protein 7;zinc finger protein 182;zinc finger protein 28;zinc finger protein 33A;zinc finger protein 33B;zinc finger protein 74;zinc finger protein 79;zinc finger protein 134;zinc finger protein 184;zinc finger protein 202;zinc finger protein 226;zinc finger protein 329;zinc finger protein 665;zinc finger protein 606;zinc finger protein 2 homolog (mouse);zinc finger protein 436;zinc finger protein 611;zinc finger protein 397;zinc finger protein 347;zinc finger protein 514;zinc finger protein 616;zinc finger protein 766;zinc finger protein 468;zinc finger protein 160;zinc finger protein 502;zinc finger protein 765;zinc finger protein 845;zinc finger protein 585B;zinc finger protein 264;zinc finger and SCAN domain containing 12;zinc finger and BTB domain containing 24 1745 222 C20140710_OR016_03 C20140710_OR016_03 TB432797.[MT7]-C[CAM]NEC[CAM]GK[MT7].2y5_1.heavy 528.246 / 751.352 1792.0 13.73490047454834 50 20 10 10 10 7.892890157513851 12.669630262724773 0.0 3 0.9954377261539609 18.264443422464613 1792.0 83.54027548209366 0.0 - - - - - - - 86.9 3 10 ZNF197;ZNF234;ZNF273;ZNF501;ZNF354B;ZNF816;ZNF813;ZNF792;ZFP28;ZNF480;ZNF534;ZNF578;ZNF569;ZNF836;ZNF610;ZNF600;ZNF320;ZNF433;ZNF721;ZNF585A;ZNF485;ZNF510;ZKSCAN5;ZNF473;ZNF615;ZNF841;ZNF852;ZNF660;ZNF454;ZNF181;ZNF546;ZNF677;ZNF860;ZNF879;ZNF391;ZNF81;ZNF713;ZNF429;ZNF568;ZNF808;ZNF888;ZNF761;ZNF880;ZNF727;ZNF701;ZNF83;ZNF415;ZNF167;ZNF248;ZNF286A;ZNF287;ZNF624;RBAK;ZNF250;ZNF674;ZNF323;ZFP62;ZNF389;ZNF354A;ZNF286B;ZFP37;ZNF7;ZNF182;ZNF28;ZNF33A;ZNF33B;ZNF74;ZNF79;ZNF134;ZNF184;ZNF202;ZNF226;ZNF329;ZNF665;ZNF606;ZFP2;ZNF436;ZNF611;ZNF397;ZNF347;ZNF514;ZNF616;ZNF766;ZNF468;ZNF160;ZNF502;ZNF765;ZNF845;ZNF585B;ZNF264;ZSCAN12;ZBTB24 zinc finger protein 197;zinc finger protein 234;zinc finger protein 273;zinc finger protein 501;zinc finger protein 354B;zinc finger protein 816;zinc finger protein 813;zinc finger protein 792;zinc finger protein 28 homolog (mouse);zinc finger protein 480;zinc finger protein 534;zinc finger protein 578;zinc finger protein 569;zinc finger protein 836;zinc finger protein 610;zinc finger protein 600;zinc finger protein 320;zinc finger protein 433;zinc finger protein 721;zinc finger protein 585A;zinc finger protein 485;zinc finger protein 510;zinc finger with KRAB and SCAN domains 5;zinc finger protein 473;zinc finger protein 615;zinc finger protein 841;zinc finger protein 852;zinc finger protein 660;zinc finger protein 454;zinc finger protein 181;zinc finger protein 546;zinc finger protein 677;zinc finger protein 860;zinc finger protein 879;zinc finger protein 391;zinc finger protein 81;zinc finger protein 713;zinc finger protein 429;zinc finger protein 568;zinc finger protein 808;zinc finger protein 888;zinc finger protein 761;zinc finger protein 880;zinc finger protein 727;zinc finger protein 701;zinc finger protein 83;zinc finger protein 415;zinc finger protein 167;zinc finger protein 248;zinc finger protein 286A;zinc finger protein 287;zinc finger protein 624;RB-associated KRAB zinc finger;zinc finger protein 250;zinc finger protein 674;zinc finger protein 323;zinc finger protein 62 homolog (mouse);zinc finger protein 389;zinc finger protein 354A;zinc finger protein 286B;zinc finger protein 37 homolog (mouse);zinc finger protein 7;zinc finger protein 182;zinc finger protein 28;zinc finger protein 33A;zinc finger protein 33B;zinc finger protein 74;zinc finger protein 79;zinc finger protein 134;zinc finger protein 184;zinc finger protein 202;zinc finger protein 226;zinc finger protein 329;zinc finger protein 665;zinc finger protein 606;zinc finger protein 2 homolog (mouse);zinc finger protein 436;zinc finger protein 611;zinc finger protein 397;zinc finger protein 347;zinc finger protein 514;zinc finger protein 616;zinc finger protein 766;zinc finger protein 468;zinc finger protein 160;zinc finger protein 502;zinc finger protein 765;zinc finger protein 845;zinc finger protein 585B;zinc finger protein 264;zinc finger and SCAN domain containing 12;zinc finger and BTB domain containing 24 1747 222 C20140710_OR016_03 C20140710_OR016_03 TB432797.[MT7]-C[CAM]NEC[CAM]GK[MT7].2y3_1.heavy 528.246 / 508.267 2228.0 13.73490047454834 50 20 10 10 10 7.892890157513851 12.669630262724773 0.0 3 0.9954377261539609 18.264443422464613 2228.0 12.257196002396041 0.0 - - - - - - - 108.36842105263158 4 19 ZNF197;ZNF234;ZNF273;ZNF501;ZNF354B;ZNF816;ZNF813;ZNF792;ZFP28;ZNF480;ZNF534;ZNF578;ZNF569;ZNF836;ZNF610;ZNF600;ZNF320;ZNF433;ZNF721;ZNF585A;ZNF485;ZNF510;ZKSCAN5;ZNF473;ZNF615;ZNF841;ZNF852;ZNF660;ZNF454;ZNF181;ZNF546;ZNF677;ZNF860;ZNF879;ZNF391;ZNF81;ZNF713;ZNF429;ZNF568;ZNF808;ZNF888;ZNF761;ZNF880;ZNF727;ZNF701;ZNF83;ZNF415;ZNF167;ZNF248;ZNF286A;ZNF287;ZNF624;RBAK;ZNF250;ZNF674;ZNF323;ZFP62;ZNF389;ZNF354A;ZNF286B;ZFP37;ZNF7;ZNF182;ZNF28;ZNF33A;ZNF33B;ZNF74;ZNF79;ZNF134;ZNF184;ZNF202;ZNF226;ZNF329;ZNF665;ZNF606;ZFP2;ZNF436;ZNF611;ZNF397;ZNF347;ZNF514;ZNF616;ZNF766;ZNF468;ZNF160;ZNF502;ZNF765;ZNF845;ZNF585B;ZNF264;ZSCAN12;ZBTB24 zinc finger protein 197;zinc finger protein 234;zinc finger protein 273;zinc finger protein 501;zinc finger protein 354B;zinc finger protein 816;zinc finger protein 813;zinc finger protein 792;zinc finger protein 28 homolog (mouse);zinc finger protein 480;zinc finger protein 534;zinc finger protein 578;zinc finger protein 569;zinc finger protein 836;zinc finger protein 610;zinc finger protein 600;zinc finger protein 320;zinc finger protein 433;zinc finger protein 721;zinc finger protein 585A;zinc finger protein 485;zinc finger protein 510;zinc finger with KRAB and SCAN domains 5;zinc finger protein 473;zinc finger protein 615;zinc finger protein 841;zinc finger protein 852;zinc finger protein 660;zinc finger protein 454;zinc finger protein 181;zinc finger protein 546;zinc finger protein 677;zinc finger protein 860;zinc finger protein 879;zinc finger protein 391;zinc finger protein 81;zinc finger protein 713;zinc finger protein 429;zinc finger protein 568;zinc finger protein 808;zinc finger protein 888;zinc finger protein 761;zinc finger protein 880;zinc finger protein 727;zinc finger protein 701;zinc finger protein 83;zinc finger protein 415;zinc finger protein 167;zinc finger protein 248;zinc finger protein 286A;zinc finger protein 287;zinc finger protein 624;RB-associated KRAB zinc finger;zinc finger protein 250;zinc finger protein 674;zinc finger protein 323;zinc finger protein 62 homolog (mouse);zinc finger protein 389;zinc finger protein 354A;zinc finger protein 286B;zinc finger protein 37 homolog (mouse);zinc finger protein 7;zinc finger protein 182;zinc finger protein 28;zinc finger protein 33A;zinc finger protein 33B;zinc finger protein 74;zinc finger protein 79;zinc finger protein 134;zinc finger protein 184;zinc finger protein 202;zinc finger protein 226;zinc finger protein 329;zinc finger protein 665;zinc finger protein 606;zinc finger protein 2 homolog (mouse);zinc finger protein 436;zinc finger protein 611;zinc finger protein 397;zinc finger protein 347;zinc finger protein 514;zinc finger protein 616;zinc finger protein 766;zinc finger protein 468;zinc finger protein 160;zinc finger protein 502;zinc finger protein 765;zinc finger protein 845;zinc finger protein 585B;zinc finger protein 264;zinc finger and SCAN domain containing 12;zinc finger and BTB domain containing 24 1749 223 C20140710_OR016_03 C20140710_OR016_03 TB444874.[MT7]-DEPLLFR.2y5_1.heavy 517.294 / 645.408 6283.0 35.92665100097656 43 18 10 5 10 8.564608871897443 11.675956426699674 0.0475006103515625 3 0.9868554795976421 10.752591099199167 6283.0 49.56414894215093 0.0 - - - - - - - 292.0 12 10 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1751 223 C20140710_OR016_03 C20140710_OR016_03 TB444874.[MT7]-DEPLLFR.2b4_1.heavy 517.294 / 599.316 3507.0 35.92665100097656 43 18 10 5 10 8.564608871897443 11.675956426699674 0.0475006103515625 3 0.9868554795976421 10.752591099199167 3507.0 13.583619863013698 0.0 - - - - - - - 401.5 7 4 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1753 223 C20140710_OR016_03 C20140710_OR016_03 TB444874.[MT7]-DEPLLFR.2y6_1.heavy 517.294 / 774.451 4237.0 35.92665100097656 43 18 10 5 10 8.564608871897443 11.675956426699674 0.0475006103515625 3 0.9868554795976421 10.752591099199167 4237.0 35.73880479452055 0.0 - - - - - - - 146.0 8 3 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1755 223 C20140710_OR016_03 C20140710_OR016_03 TB444874.[MT7]-DEPLLFR.2b5_1.heavy 517.294 / 712.4 2192.0 35.92665100097656 43 18 10 5 10 8.564608871897443 11.675956426699674 0.0475006103515625 3 0.9868554795976421 10.752591099199167 2192.0 11.980931506849315 0.0 - - - - - - - 389.3333333333333 4 3 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1757 224 C20140710_OR016_03 C20140710_OR016_03 TB432985.[MT7]-LNLSPHGTFLGFVK[MT7].4y4_1.heavy 455.268 / 594.373 955.0 40.586151123046875 20 7 4 5 4 0.7326029088632566 72.66386190772965 0.0438995361328125 9 0.7278248152084341 2.3097008192885284 955.0 13.693014705882353 0.0 - - - - - - - 0.0 1 0 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1759 224 C20140710_OR016_03 C20140710_OR016_03 TB432985.[MT7]-LNLSPHGTFLGFVK[MT7].4b8_2.heavy 455.268 / 482.77 2591.0 40.586151123046875 20 7 4 5 4 0.7326029088632566 72.66386190772965 0.0438995361328125 9 0.7278248152084341 2.3097008192885284 2591.0 18.902257358933795 0.0 - - - - - - - 136.0 5 1 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1761 224 C20140710_OR016_03 C20140710_OR016_03 TB432985.[MT7]-LNLSPHGTFLGFVK[MT7].4b4_1.heavy 455.268 / 572.352 409.0 40.586151123046875 20 7 4 5 4 0.7326029088632566 72.66386190772965 0.0438995361328125 9 0.7278248152084341 2.3097008192885284 409.0 6.014705882352941 1.0 - - - - - - - 0.0 1 0 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1763 224 C20140710_OR016_03 C20140710_OR016_03 TB432985.[MT7]-LNLSPHGTFLGFVK[MT7].4b3_1.heavy 455.268 / 485.32 682.0 40.586151123046875 20 7 4 5 4 0.7326029088632566 72.66386190772965 0.0438995361328125 9 0.7278248152084341 2.3097008192885284 682.0 4.3452610384006904 8.0 - - - - - - - 214.14285714285714 9 7 TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1765 225 C20140710_OR016_03 C20140710_OR016_03 TB423860.[MT7]-AVC[CAM]SNINEAK[MT7].3b4_1.heavy 465.25 / 562.278 473.0 21.480725288391113 40 14 10 6 10 1.4082294741155406 43.07604522714567 0.033901214599609375 3 0.9390135558703712 4.971797588273688 473.0 0.0 4.0 - - - - - - - 0.0 1 0 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1767 225 C20140710_OR016_03 C20140710_OR016_03 TB423860.[MT7]-AVC[CAM]SNINEAK[MT7].3b5_1.heavy 465.25 / 676.32 3076.0 21.480725288391113 40 14 10 6 10 1.4082294741155406 43.07604522714567 0.033901214599609375 3 0.9390135558703712 4.971797588273688 3076.0 20.899689784275274 0.0 - - - - - - - 210.33333333333334 6 9 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1769 225 C20140710_OR016_03 C20140710_OR016_03 TB423860.[MT7]-AVC[CAM]SNINEAK[MT7].3b3_1.heavy 465.25 / 475.246 2129.0 21.480725288391113 40 14 10 6 10 1.4082294741155406 43.07604522714567 0.033901214599609375 3 0.9390135558703712 4.971797588273688 2129.0 7.704003852504127 0.0 - - - - - - - 242.21428571428572 4 14 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1771 225 C20140710_OR016_03 C20140710_OR016_03 TB423860.[MT7]-AVC[CAM]SNINEAK[MT7].3y4_1.heavy 465.25 / 605.338 3312.0 21.480725288391113 40 14 10 6 10 1.4082294741155406 43.07604522714567 0.033901214599609375 3 0.9390135558703712 4.971797588273688 3312.0 8.402536997885836 0.0 - - - - - - - 254.11111111111111 6 9 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1773 226 C20140710_OR016_03 C20140710_OR016_03 TB423951.[MT7]-QYSGDDGRMDMPGLVNLMK[MT7].3y18_2.heavy 805.728 / 1072.01 5256.0 39.94127559661865 36 13 10 3 10 3.971190847557266 25.181363434474918 0.050098419189453125 3 0.9233031193138971 4.427493069251711 5256.0 30.8174750119612 0.0 - - - - - - - 276.7142857142857 10 7 S100A7L2 S100 calcium binding protein A7-like 2 1775 226 C20140710_OR016_03 C20140710_OR016_03 TB423951.[MT7]-QYSGDDGRMDMPGLVNLMK[MT7].3y4_1.heavy 805.728 / 649.382 2904.0 39.94127559661865 36 13 10 3 10 3.971190847557266 25.181363434474918 0.050098419189453125 3 0.9233031193138971 4.427493069251711 2904.0 9.228432931079038 0.0 - - - - - - - 253.66666666666666 5 6 S100A7L2 S100 calcium binding protein A7-like 2 1777 226 C20140710_OR016_03 C20140710_OR016_03 TB423951.[MT7]-QYSGDDGRMDMPGLVNLMK[MT7].3y8_1.heavy 805.728 / 1015.61 3181.0 39.94127559661865 36 13 10 3 10 3.971190847557266 25.181363434474918 0.050098419189453125 3 0.9233031193138971 4.427493069251711 3181.0 30.232830539549504 0.0 - - - - - - - 215.0 6 9 S100A7L2 S100 calcium binding protein A7-like 2 1779 226 C20140710_OR016_03 C20140710_OR016_03 TB423951.[MT7]-QYSGDDGRMDMPGLVNLMK[MT7].3y9_1.heavy 805.728 / 1146.65 1245.0 39.94127559661865 36 13 10 3 10 3.971190847557266 25.181363434474918 0.050098419189453125 3 0.9233031193138971 4.427493069251711 1245.0 9.29134832872581 0.0 - - - - - - - 184.33333333333334 2 3 S100A7L2 S100 calcium binding protein A7-like 2 1781 227 C20140710_OR016_03 C20140710_OR016_03 TB423952.[MT7]-YSDEGEHLVFK[MT7].3y3_1.heavy 537.947 / 537.352 N/A 30.520700454711914 47 17 10 10 10 2.4221214689667936 33.06465499360448 0.0 3 0.970656048794554 7.186796058610245 37269.0 14.288432724311997 0.0 - - - - - - - 468.0 74 1 ADAM7 ADAM metallopeptidase domain 7 1783 227 C20140710_OR016_03 C20140710_OR016_03 TB423952.[MT7]-YSDEGEHLVFK[MT7].3b6_1.heavy 537.947 / 825.338 17621.0 30.520700454711914 47 17 10 10 10 2.4221214689667936 33.06465499360448 0.0 3 0.970656048794554 7.186796058610245 17621.0 60.457887667887675 0.0 - - - - - - - 185.25 35 16 ADAM7 ADAM metallopeptidase domain 7 1785 227 C20140710_OR016_03 C20140710_OR016_03 TB423952.[MT7]-YSDEGEHLVFK[MT7].3y4_1.heavy 537.947 / 650.436 15204.0 30.520700454711914 47 17 10 10 10 2.4221214689667936 33.06465499360448 0.0 3 0.970656048794554 7.186796058610245 15204.0 65.62410256410256 0.0 - - - - - - - 205.26315789473685 30 19 ADAM7 ADAM metallopeptidase domain 7 1787 227 C20140710_OR016_03 C20140710_OR016_03 TB423952.[MT7]-YSDEGEHLVFK[MT7].3b3_1.heavy 537.947 / 510.232 14034.0 30.520700454711914 47 17 10 10 10 2.4221214689667936 33.06465499360448 0.0 3 0.970656048794554 7.186796058610245 14034.0 54.27679487179488 0.0 - - - - - - - 757.7142857142857 28 7 ADAM7 ADAM metallopeptidase domain 7 1789 228 C20140710_OR016_03 C20140710_OR016_03 TB445171.[MT7]-FAFLFNNEVLC[CAM]DVHFLVGK[MT7].4y4_1.heavy 640.093 / 560.389 2838.0 53.51890182495117 45 15 10 10 10 1.5138606426596362 44.03751890236269 0.0 3 0.9507437571039231 5.537742605293302 2838.0 81.55694634146342 0.0 - - - - - - - 82.22222222222223 5 9 BTBD2 BTB (POZ) domain containing 2 1791 228 C20140710_OR016_03 C20140710_OR016_03 TB445171.[MT7]-FAFLFNNEVLC[CAM]DVHFLVGK[MT7].4y5_1.heavy 640.093 / 707.457 4031.0 53.51890182495117 45 15 10 10 10 1.5138606426596362 44.03751890236269 0.0 3 0.9507437571039231 5.537742605293302 4031.0 16.23458495575221 0.0 - - - - - - - 199.64285714285714 8 14 BTBD2 BTB (POZ) domain containing 2 1793 228 C20140710_OR016_03 C20140710_OR016_03 TB445171.[MT7]-FAFLFNNEVLC[CAM]DVHFLVGK[MT7].4b4_1.heavy 640.093 / 623.367 3743.0 53.51890182495117 45 15 10 10 10 1.5138606426596362 44.03751890236269 0.0 3 0.9507437571039231 5.537742605293302 3743.0 46.91429539295394 0.0 - - - - - - - 164.5 7 10 BTBD2 BTB (POZ) domain containing 2 1795 228 C20140710_OR016_03 C20140710_OR016_03 TB445171.[MT7]-FAFLFNNEVLC[CAM]DVHFLVGK[MT7].4b3_1.heavy 640.093 / 510.283 3537.0 53.51890182495117 45 15 10 10 10 1.5138606426596362 44.03751890236269 0.0 3 0.9507437571039231 5.537742605293302 3537.0 34.48109570761361 0.0 - - - - - - - 185.0 7 14 BTBD2 BTB (POZ) domain containing 2 1797 229 C20140710_OR016_03 C20140710_OR016_03 TB423654.[MT7]-ASTDGHR.2y5_1.heavy 444.226 / 585.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1799 229 C20140710_OR016_03 C20140710_OR016_03 TB423654.[MT7]-ASTDGHR.2b4_1.heavy 444.226 / 519.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1801 229 C20140710_OR016_03 C20140710_OR016_03 TB423654.[MT7]-ASTDGHR.2y6_1.heavy 444.226 / 672.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1803 229 C20140710_OR016_03 C20140710_OR016_03 TB423654.[MT7]-ASTDGHR.2b5_1.heavy 444.226 / 576.275 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1805 230 C20140710_OR016_03 C20140710_OR016_03 TB445172.[MT7]-AFYEMSLQAFNIFSQHTFK[MT7].4b4_1.heavy 650.083 / 655.321 43334.0 51.7151985168457 50 20 10 10 10 10.811615445401934 9.249311585765748 0.0 3 0.9926525582604522 14.388914186084039 43334.0 281.74604840382113 0.0 - - - - - - - 191.84615384615384 86 13 IFNK interferon, kappa 1807 230 C20140710_OR016_03 C20140710_OR016_03 TB445172.[MT7]-AFYEMSLQAFNIFSQHTFK[MT7].4b5_1.heavy 650.083 / 786.361 13093.0 51.7151985168457 50 20 10 10 10 10.811615445401934 9.249311585765748 0.0 3 0.9926525582604522 14.388914186084039 13093.0 259.6025862068966 0.0 - - - - - - - 137.0909090909091 26 11 IFNK interferon, kappa 1809 230 C20140710_OR016_03 C20140710_OR016_03 TB445172.[MT7]-AFYEMSLQAFNIFSQHTFK[MT7].4y3_1.heavy 650.083 / 539.331 23057.0 51.7151985168457 50 20 10 10 10 10.811615445401934 9.249311585765748 0.0 3 0.9926525582604522 14.388914186084039 23057.0 123.23568965517242 0.0 - - - - - - - 188.5 46 16 IFNK interferon, kappa 1811 230 C20140710_OR016_03 C20140710_OR016_03 TB445172.[MT7]-AFYEMSLQAFNIFSQHTFK[MT7].4b3_1.heavy 650.083 / 526.278 23115.0 51.7151985168457 50 20 10 10 10 10.811615445401934 9.249311585765748 0.0 3 0.9926525582604522 14.388914186084039 23115.0 154.76422413793102 0.0 - - - - - - - 198.16666666666666 46 12 IFNK interferon, kappa 1813 231 C20140710_OR016_03 C20140710_OR016_03 TB423859.[MT7]-AVC[CAM]SNINEAK[MT7].2y4_1.heavy 697.371 / 605.338 1422.0 21.489200592041016 44 14 10 10 10 1.5435626721185494 46.283549661545564 0.0 3 0.9485945739529374 5.419755290463302 1422.0 34.92 0.0 - - - - - - - 217.25 2 4 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1815 231 C20140710_OR016_03 C20140710_OR016_03 TB423859.[MT7]-AVC[CAM]SNINEAK[MT7].2y8_1.heavy 697.371 / 1079.53 1580.0 21.489200592041016 44 14 10 10 10 1.5435626721185494 46.283549661545564 0.0 3 0.9485945739529374 5.419755290463302 1580.0 7.5 1.0 - - - - - - - 167.875 3 8 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1817 231 C20140710_OR016_03 C20140710_OR016_03 TB423859.[MT7]-AVC[CAM]SNINEAK[MT7].2b5_1.heavy 697.371 / 676.32 1264.0 21.489200592041016 44 14 10 10 10 1.5435626721185494 46.283549661545564 0.0 3 0.9485945739529374 5.419755290463302 1264.0 2.4 0.0 - - - - - - - 210.66666666666666 2 9 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1819 231 C20140710_OR016_03 C20140710_OR016_03 TB423859.[MT7]-AVC[CAM]SNINEAK[MT7].2y7_1.heavy 697.371 / 919.497 1659.0 21.489200592041016 44 14 10 10 10 1.5435626721185494 46.283549661545564 0.0 3 0.9485945739529374 5.419755290463302 1659.0 41.894999999999996 0.0 - - - - - - - 138.25 3 4 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 1821 232 C20140710_OR016_03 C20140710_OR016_03 TB445174.[MT7]-ALTANLWHWINEAC[CAM]GRLSGDK[MT7].4y4_1.heavy 675.853 / 550.295 720.0 47.31840133666992 46 20 10 10 6 9.89205024431521 10.109127787484528 0.0 6 0.9933598713827939 15.136780617913653 720.0 3.7333333333333334 2.0 - - - - - - - 196.36363636363637 5 11 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1823 232 C20140710_OR016_03 C20140710_OR016_03 TB445174.[MT7]-ALTANLWHWINEAC[CAM]GRLSGDK[MT7].4b4_1.heavy 675.853 / 501.315 1079.0 47.31840133666992 46 20 10 10 6 9.89205024431521 10.109127787484528 0.0 6 0.9933598713827939 15.136780617913653 1079.0 2.877333333333333 3.0 - - - - - - - 276.9230769230769 3 13 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1825 232 C20140710_OR016_03 C20140710_OR016_03 TB445174.[MT7]-ALTANLWHWINEAC[CAM]GRLSGDK[MT7].4b5_1.heavy 675.853 / 615.358 2878.0 47.31840133666992 46 20 10 10 6 9.89205024431521 10.109127787484528 0.0 6 0.9933598713827939 15.136780617913653 2878.0 11.725185185185186 0.0 - - - - - - - 198.0 5 10 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1827 232 C20140710_OR016_03 C20140710_OR016_03 TB445174.[MT7]-ALTANLWHWINEAC[CAM]GRLSGDK[MT7].4b6_1.heavy 675.853 / 728.442 1889.0 47.31840133666992 46 20 10 10 6 9.89205024431521 10.109127787484528 0.0 6 0.9933598713827939 15.136780617913653 1889.0 21.129139017608892 0.0 - - - - - - - 170.0 3 9 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1829 233 C20140710_OR016_03 C20140710_OR016_03 TB424032.[MT7]-FILGVEGQQLVRPK[MT7].4y8_2.heavy 468.788 / 535.334 9487.0 36.57389831542969 46 16 10 10 10 2.9339542405038723 34.083694496484775 0.0 3 0.9682247801921935 6.904962844496884 9487.0 87.89354537251869 0.0 - - - - - - - 144.0 18 1 ADAM7 ADAM metallopeptidase domain 7 1831 233 C20140710_OR016_03 C20140710_OR016_03 TB424032.[MT7]-FILGVEGQQLVRPK[MT7].4y9_2.heavy 468.788 / 599.855 4743.0 36.57389831542969 46 16 10 10 10 2.9339542405038723 34.083694496484775 0.0 3 0.9682247801921935 6.904962844496884 4743.0 10.839637762080281 1.0 - - - - - - - 790.5 11 2 ADAM7 ADAM metallopeptidase domain 7 1833 233 C20140710_OR016_03 C20140710_OR016_03 TB424032.[MT7]-FILGVEGQQLVRPK[MT7].4b4_1.heavy 468.788 / 575.367 12361.0 36.57389831542969 46 16 10 10 10 2.9339542405038723 34.083694496484775 0.0 3 0.9682247801921935 6.904962844496884 12361.0 127.1871767324816 0.0 - - - - - - - 287.0 24 2 ADAM7 ADAM metallopeptidase domain 7 1835 233 C20140710_OR016_03 C20140710_OR016_03 TB424032.[MT7]-FILGVEGQQLVRPK[MT7].4b3_1.heavy 468.788 / 518.346 7905.0 36.57389831542969 46 16 10 10 10 2.9339542405038723 34.083694496484775 0.0 3 0.9682247801921935 6.904962844496884 7905.0 61.08235507246377 1.0 - - - - - - - 239.33333333333334 15 3 ADAM7 ADAM metallopeptidase domain 7 1837 234 C20140710_OR016_03 C20140710_OR016_03 TB423854.[MT7]-RVEHHGTEK[MT7].3y3_1.heavy 460.924 / 521.305 483.0 12.786600112915039 36 16 0 10 10 2.4481628035845633 32.65907447167599 0.0 3 0.9673966920636912 6.816233616005908 483.0 16.905 2.0 - - - - - - - 118.16666666666667 21 12 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1839 234 C20140710_OR016_03 C20140710_OR016_03 TB423854.[MT7]-RVEHHGTEK[MT7].3b4_1.heavy 460.924 / 666.38 890.0 12.786600112915039 36 16 0 10 10 2.4481628035845633 32.65907447167599 0.0 3 0.9673966920636912 6.816233616005908 890.0 77.13333333333333 0.0 - - - - - - - 0.0 1 0 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1841 234 C20140710_OR016_03 C20140710_OR016_03 TB423854.[MT7]-RVEHHGTEK[MT7].3y4_1.heavy 460.924 / 578.327 1840.0 12.786600112915039 36 16 0 10 10 2.4481628035845633 32.65907447167599 0.0 3 0.9673966920636912 6.816233616005908 1840.0 114.48888888888888 0.0 - - - - - - - 36.57142857142857 3 7 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1843 234 C20140710_OR016_03 C20140710_OR016_03 TB423854.[MT7]-RVEHHGTEK[MT7].3b3_1.heavy 460.924 / 529.321 965.0 12.786600112915039 36 16 0 10 10 2.4481628035845633 32.65907447167599 0.0 3 0.9673966920636912 6.816233616005908 965.0 53.22672955974842 0.0 - - - - - - - 0.0 1 0 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 1845 235 C20140710_OR016_03 C20140710_OR016_03 TB445170.[MT7]-ALSELAALC[CAM]YLIAFQVPRPK[MT7].3b6_1.heavy 850.157 / 729.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1847 235 C20140710_OR016_03 C20140710_OR016_03 TB445170.[MT7]-ALSELAALC[CAM]YLIAFQVPRPK[MT7].3b5_1.heavy 850.157 / 658.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1849 235 C20140710_OR016_03 C20140710_OR016_03 TB445170.[MT7]-ALSELAALC[CAM]YLIAFQVPRPK[MT7].3y8_1.heavy 850.157 / 1086.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1851 235 C20140710_OR016_03 C20140710_OR016_03 TB445170.[MT7]-ALSELAALC[CAM]YLIAFQVPRPK[MT7].3b7_1.heavy 850.157 / 800.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1853 236 C20140710_OR016_03 C20140710_OR016_03 TB423922.[MT7]-LMHPQPEDPAK[MT7].2b3_1.heavy 775.916 / 526.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 1855 236 C20140710_OR016_03 C20140710_OR016_03 TB423922.[MT7]-LMHPQPEDPAK[MT7].2y8_1.heavy 775.916 / 1025.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 1857 236 C20140710_OR016_03 C20140710_OR016_03 TB423922.[MT7]-LMHPQPEDPAK[MT7].2y6_1.heavy 775.916 / 800.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 1859 236 C20140710_OR016_03 C20140710_OR016_03 TB423922.[MT7]-LMHPQPEDPAK[MT7].2b5_1.heavy 775.916 / 751.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 1861 237 C20140710_OR016_03 C20140710_OR016_03 TB424036.[MT7]-SSLLAALLGQMQLQK[MT7].3y3_1.heavy 630.376 / 532.357 3979.0 51.7151985168457 45 15 10 10 10 2.7209197339189877 36.75227855985604 0.0 3 0.9556406117384849 5.837823462185673 3979.0 15.96160458452722 0.0 - - - - - - - 221.08333333333334 7 12 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1863 237 C20140710_OR016_03 C20140710_OR016_03 TB424036.[MT7]-SSLLAALLGQMQLQK[MT7].3b6_1.heavy 630.376 / 687.416 10333.0 51.7151985168457 45 15 10 10 10 2.7209197339189877 36.75227855985604 0.0 3 0.9556406117384849 5.837823462185673 10333.0 159.4741841997544 0.0 - - - - - - - 148.625 20 8 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1865 237 C20140710_OR016_03 C20140710_OR016_03 TB424036.[MT7]-SSLLAALLGQMQLQK[MT7].3b5_1.heavy 630.376 / 616.379 4957.0 51.7151985168457 45 15 10 10 10 2.7209197339189877 36.75227855985604 0.0 3 0.9556406117384849 5.837823462185673 4957.0 21.436990845375888 0.0 - - - - - - - 260.27272727272725 9 11 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1867 237 C20140710_OR016_03 C20140710_OR016_03 TB424036.[MT7]-SSLLAALLGQMQLQK[MT7].3b7_1.heavy 630.376 / 800.5 2234.0 51.7151985168457 45 15 10 10 10 2.7209197339189877 36.75227855985604 0.0 3 0.9556406117384849 5.837823462185673 2234.0 54.89257142857143 0.0 - - - - - - - 163.0 4 6 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1869 238 C20140710_OR016_03 C20140710_OR016_03 TB433029.[MT7]-QLYLLDDPLSAVDAHVGK[MT7].4y4_1.heavy 561.313 / 584.364 593.0 41.328800201416016 36 14 10 10 2 1.7616271907703935 56.765699646284446 0.0 12 0.9324859284740755 4.722706812319896 593.0 1.9325842696629212 21.0 - - - - - - - 171.44444444444446 3 9 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1871 238 C20140710_OR016_03 C20140710_OR016_03 TB433029.[MT7]-QLYLLDDPLSAVDAHVGK[MT7].4b4_1.heavy 561.313 / 662.399 8534.0 41.328800201416016 36 14 10 10 2 1.7616271907703935 56.765699646284446 0.0 12 0.9324859284740755 4.722706812319896 8534.0 90.89987158908507 0.0 - - - - - - - 201.8 17 10 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1873 238 C20140710_OR016_03 C20140710_OR016_03 TB433029.[MT7]-QLYLLDDPLSAVDAHVGK[MT7].4y6_1.heavy 561.313 / 770.428 356.0 41.328800201416016 36 14 10 10 2 1.7616271907703935 56.765699646284446 0.0 12 0.9324859284740755 4.722706812319896 356.0 -0.2702784240897674 8.0 - - - - - - - 0.0 1 0 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1875 238 C20140710_OR016_03 C20140710_OR016_03 TB433029.[MT7]-QLYLLDDPLSAVDAHVGK[MT7].4b3_1.heavy 561.313 / 549.315 12208.0 41.328800201416016 36 14 10 10 2 1.7616271907703935 56.765699646284446 0.0 12 0.9324859284740755 4.722706812319896 12208.0 48.01824127934517 0.0 - - - - - - - 197.88888888888889 24 9 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1877 239 C20140710_OR016_03 C20140710_OR016_03 TB424033.[MT7]-GAAASLADFVENVEWR.3y6_1.heavy 626.987 / 832.395 9691.0 48.960201263427734 43 13 10 10 10 1.3029853133972416 51.16455725264339 0.0 3 0.9279981128177455 4.571402882248442 9691.0 67.13728880866427 0.0 - - - - - - - 332.2 19 5 CHRNA10 cholinergic receptor, nicotinic, alpha 10 1879 239 C20140710_OR016_03 C20140710_OR016_03 TB424033.[MT7]-GAAASLADFVENVEWR.3b5_1.heavy 626.987 / 502.274 6092.0 48.960201263427734 43 13 10 10 10 1.3029853133972416 51.16455725264339 0.0 3 0.9279981128177455 4.571402882248442 6092.0 47.00748638891599 0.0 - - - - - - - 256.3333333333333 12 9 CHRNA10 cholinergic receptor, nicotinic, alpha 10 1881 239 C20140710_OR016_03 C20140710_OR016_03 TB424033.[MT7]-GAAASLADFVENVEWR.3b8_1.heavy 626.987 / 801.422 5538.0 48.960201263427734 43 13 10 10 10 1.3029853133972416 51.16455725264339 0.0 3 0.9279981128177455 4.571402882248442 5538.0 61.33002511379689 0.0 - - - - - - - 197.85714285714286 11 7 CHRNA10 cholinergic receptor, nicotinic, alpha 10 1883 239 C20140710_OR016_03 C20140710_OR016_03 TB424033.[MT7]-GAAASLADFVENVEWR.3y5_1.heavy 626.987 / 703.352 2400.0 48.960201263427734 43 13 10 10 10 1.3029853133972416 51.16455725264339 0.0 3 0.9279981128177455 4.571402882248442 2400.0 7.9339546655318935 2.0 - - - - - - - 184.42857142857142 7 7 CHRNA10 cholinergic receptor, nicotinic, alpha 10 1885 240 C20140710_OR016_03 C20140710_OR016_03 TB423755.[MT7]-EFLGGHIVR.2b6_1.heavy 586.339 / 785.406 405.0 28.78667449951172 32 11 10 7 4 1.3311765373752706 48.837419888535734 0.0287017822265625 8 0.8642907462487042 3.3114574219529067 405.0 1.8 22.0 - - - - - - - 0.0 1 0 ZNF654 zinc finger protein 654 1887 240 C20140710_OR016_03 C20140710_OR016_03 TB423755.[MT7]-EFLGGHIVR.2y6_1.heavy 586.339 / 638.373 3971.0 28.78667449951172 32 11 10 7 4 1.3311765373752706 48.837419888535734 0.0287017822265625 8 0.8642907462487042 3.3114574219529067 3971.0 24.18551440329218 2.0 - - - - - - - 222.75 7 20 ZNF654 zinc finger protein 654 1889 240 C20140710_OR016_03 C20140710_OR016_03 TB423755.[MT7]-EFLGGHIVR.2b5_1.heavy 586.339 / 648.347 891.0 28.78667449951172 32 11 10 7 4 1.3311765373752706 48.837419888535734 0.0287017822265625 8 0.8642907462487042 3.3114574219529067 891.0 2.245833333333333 5.0 - - - - - - - 190.35 2 20 ZNF654 zinc finger protein 654 1891 240 C20140710_OR016_03 C20140710_OR016_03 TB423755.[MT7]-EFLGGHIVR.2y7_1.heavy 586.339 / 751.457 1459.0 28.78667449951172 32 11 10 7 4 1.3311765373752706 48.837419888535734 0.0287017822265625 8 0.8642907462487042 3.3114574219529067 1459.0 2.161481481481481 5.0 - - - - - - - 262.2857142857143 5 21 ZNF654 zinc finger protein 654 1893 241 C20140710_OR016_03 C20140710_OR016_03 TB424039.[MT7]-LTVIPQDPVLFVGTVR.3y7_1.heavy 633.379 / 791.477 5327.0 45.71540069580078 48 18 10 10 10 6.0196057972019705 16.612383496354852 0.0 3 0.9892312802527189 11.882007651431477 5327.0 33.225026069110164 0.0 - - - - - - - 217.0 10 5 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1895 241 C20140710_OR016_03 C20140710_OR016_03 TB424039.[MT7]-LTVIPQDPVLFVGTVR.3y6_1.heavy 633.379 / 678.393 5229.0 45.71540069580078 48 18 10 10 10 6.0196057972019705 16.612383496354852 0.0 3 0.9892312802527189 11.882007651431477 5229.0 22.774894706630498 0.0 - - - - - - - 279.5 10 6 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1897 241 C20140710_OR016_03 C20140710_OR016_03 TB424039.[MT7]-LTVIPQDPVLFVGTVR.3b4_1.heavy 633.379 / 571.394 6018.0 45.71540069580078 48 18 10 10 10 6.0196057972019705 16.612383496354852 0.0 3 0.9892312802527189 11.882007651431477 6018.0 7.637005100257253 0.0 - - - - - - - 274.0 12 9 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1899 241 C20140710_OR016_03 C20140710_OR016_03 TB424039.[MT7]-LTVIPQDPVLFVGTVR.3y9_1.heavy 633.379 / 987.599 3256.0 45.71540069580078 48 18 10 10 10 6.0196057972019705 16.612383496354852 0.0 3 0.9892312802527189 11.882007651431477 3256.0 30.088503018224877 1.0 - - - - - - - 138.4 7 5 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1901 242 C20140710_OR016_03 C20140710_OR016_03 TB445176.[MT7]-RNVMETFAK[MT7]PEIGDLGMLSMK[MT7].3b9_2.heavy 933.836 / 683.381 8728.0 41.029526710510254 40 15 10 5 10 1.8303599731343236 38.02188012787507 0.041500091552734375 3 0.9541630983081663 5.742245164340075 8728.0 67.76956223953322 1.0 - - - - - - - 118.0 17 3 GALP galanin-like peptide 1903 242 C20140710_OR016_03 C20140710_OR016_03 TB445176.[MT7]-RNVMETFAK[MT7]PEIGDLGMLSMK[MT7].3b14_2.heavy 933.836 / 938.995 5779.0 41.029526710510254 40 15 10 5 10 1.8303599731343236 38.02188012787507 0.041500091552734375 3 0.9541630983081663 5.742245164340075 5779.0 23.752669491525424 0.0 - - - - - - - 314.6666666666667 11 6 GALP galanin-like peptide 1905 242 C20140710_OR016_03 C20140710_OR016_03 TB445176.[MT7]-RNVMETFAK[MT7]PEIGDLGMLSMK[MT7].3y7_1.heavy 933.836 / 923.518 3774.0 41.029526710510254 40 15 10 5 10 1.8303599731343236 38.02188012787507 0.041500091552734375 3 0.9541630983081663 5.742245164340075 3774.0 15.032033898305084 0.0 - - - - - - - 303.42857142857144 7 7 GALP galanin-like peptide 1907 242 C20140710_OR016_03 C20140710_OR016_03 TB445176.[MT7]-RNVMETFAK[MT7]PEIGDLGMLSMK[MT7].3y3_1.heavy 933.836 / 509.287 4718.0 41.029526710510254 40 15 10 5 10 1.8303599731343236 38.02188012787507 0.041500091552734375 3 0.9541630983081663 5.742245164340075 4718.0 77.56711864406779 0.0 - - - - - - - 265.5 9 4 GALP galanin-like peptide 1909 243 C20140710_OR016_03 C20140710_OR016_03 TB423759.[MT7]-SVLLLLGGLR.2y8_1.heavy 592.896 / 854.582 1212.0 48.61164855957031 43 17 10 6 10 5.927747353398441 16.869814794429274 0.035400390625 3 0.9714463396489054 7.2860581178285795 1212.0 9.33654957759004 0.0 - - - - - - - 87.0 2 2 LMLN leishmanolysin-like (metallopeptidase M8 family) 1911 243 C20140710_OR016_03 C20140710_OR016_03 TB423759.[MT7]-SVLLLLGGLR.2b4_1.heavy 592.896 / 557.378 1645.0 48.61164855957031 43 17 10 6 10 5.927747353398441 16.869814794429274 0.035400390625 3 0.9714463396489054 7.2860581178285795 1645.0 7.937923853923854 0.0 - - - - - - - 199.2 3 10 LMLN leishmanolysin-like (metallopeptidase M8 family) 1913 243 C20140710_OR016_03 C20140710_OR016_03 TB423759.[MT7]-SVLLLLGGLR.2y6_1.heavy 592.896 / 628.414 1732.0 48.61164855957031 43 17 10 6 10 5.927747353398441 16.869814794429274 0.035400390625 3 0.9714463396489054 7.2860581178285795 1732.0 12.73686153846154 0.0 - - - - - - - 202.22222222222223 3 9 LMLN leishmanolysin-like (metallopeptidase M8 family) 1915 243 C20140710_OR016_03 C20140710_OR016_03 TB423759.[MT7]-SVLLLLGGLR.2y7_1.heavy 592.896 / 741.498 1818.0 48.61164855957031 43 17 10 6 10 5.927747353398441 16.869814794429274 0.035400390625 3 0.9714463396489054 7.2860581178285795 1818.0 7.691538461538461 0.0 - - - - - - - 208.0 3 10 LMLN leishmanolysin-like (metallopeptidase M8 family) 1917 244 C20140710_OR016_03 C20140710_OR016_03 TB432853.[MT7]-LAQQLFQK[MT7].2y4_1.heavy 632.387 / 679.426 1992.0 34.30542469024658 31 18 2 5 6 3.459035394922054 23.023303737790965 0.044498443603515625 5 0.9800739207722814 8.72825941411894 1992.0 15.904025015634772 1.0 - - - - - - - 253.83333333333334 3 12 NBPF1 neuroblastoma breakpoint family, member 1 1919 244 C20140710_OR016_03 C20140710_OR016_03 TB432853.[MT7]-LAQQLFQK[MT7].2b4_1.heavy 632.387 / 585.348 1758.0 34.30542469024658 31 18 2 5 6 3.459035394922054 23.023303737790965 0.044498443603515625 5 0.9800739207722814 8.72825941411894 1758.0 4.290426742532006 2.0 - - - - - - - 265.53333333333336 3 15 NBPF1 neuroblastoma breakpoint family, member 1 1921 244 C20140710_OR016_03 C20140710_OR016_03 TB432853.[MT7]-LAQQLFQK[MT7].2y3_1.heavy 632.387 / 566.342 2578.0 34.30542469024658 31 18 2 5 6 3.459035394922054 23.023303737790965 0.044498443603515625 5 0.9800739207722814 8.72825941411894 2578.0 18.256130915155307 2.0 - - - - - - - 273.55555555555554 8 9 NBPF1 neuroblastoma breakpoint family, member 1 1923 244 C20140710_OR016_03 C20140710_OR016_03 TB432853.[MT7]-LAQQLFQK[MT7].2y7_1.heavy 632.387 / 1006.58 1172.0 34.30542469024658 31 18 2 5 6 3.459035394922054 23.023303737790965 0.044498443603515625 5 0.9800739207722814 8.72825941411894 1172.0 0.4333746344537704 4.0 - - - - - - - 244.08333333333334 13 12 NBPF1 neuroblastoma breakpoint family, member 1 1925 245 C20140710_OR016_03 C20140710_OR016_03 TB432852.[MT7]-RRAVLTQK[MT7].2y4_1.heavy 630.411 / 633.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1927 245 C20140710_OR016_03 C20140710_OR016_03 TB432852.[MT7]-RRAVLTQK[MT7].2b6_1.heavy 630.411 / 841.549 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1929 245 C20140710_OR016_03 C20140710_OR016_03 TB432852.[MT7]-RRAVLTQK[MT7].2y3_1.heavy 630.411 / 520.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1931 245 C20140710_OR016_03 C20140710_OR016_03 TB432852.[MT7]-RRAVLTQK[MT7].2y7_1.heavy 630.411 / 959.612 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 1933 246 C20140710_OR016_03 C20140710_OR016_03 TB433023.[MT7]-AQLTEVQEAYETLLQK[MT7].3y3_1.heavy 718.063 / 532.357 5182.0 45.222975730895996 38 13 10 5 10 1.1504417014120676 51.54717532922909 0.041500091552734375 3 0.9166267587586603 4.244088566490428 5182.0 14.696850765994675 0.0 - - - - - - - 244.15384615384616 10 13 RPGRIP1 retinitis pigmentosa GTPase regulator interacting protein 1 1935 246 C20140710_OR016_03 C20140710_OR016_03 TB433023.[MT7]-AQLTEVQEAYETLLQK[MT7].3b6_1.heavy 718.063 / 786.448 2856.0 45.222975730895996 38 13 10 5 10 1.1504417014120676 51.54717532922909 0.041500091552734375 3 0.9166267587586603 4.244088566490428 2856.0 35.66523706922207 0.0 - - - - - - - 229.33333333333334 5 6 RPGRIP1 retinitis pigmentosa GTPase regulator interacting protein 1 1937 246 C20140710_OR016_03 C20140710_OR016_03 TB433023.[MT7]-AQLTEVQEAYETLLQK[MT7].3b5_1.heavy 718.063 / 687.379 4653.0 45.222975730895996 38 13 10 5 10 1.1504417014120676 51.54717532922909 0.041500091552734375 3 0.9166267587586603 4.244088566490428 4653.0 45.95086491200254 0.0 - - - - - - - 229.33333333333334 9 6 RPGRIP1 retinitis pigmentosa GTPase regulator interacting protein 1 1939 246 C20140710_OR016_03 C20140710_OR016_03 TB433023.[MT7]-AQLTEVQEAYETLLQK[MT7].3y5_1.heavy 718.063 / 746.489 2009.0 45.222975730895996 38 13 10 5 10 1.1504417014120676 51.54717532922909 0.041500091552734375 3 0.9166267587586603 4.244088566490428 2009.0 8.168983451536644 0.0 - - - - - - - 202.91666666666666 4 12 RPGRIP1 retinitis pigmentosa GTPase regulator interacting protein 1 1941 247 C20140710_OR016_03 C20140710_OR016_03 TB432854.[MT7]-GAFGEVAVVK[MT7].2b6_1.heavy 632.879 / 705.369 5741.0 32.17379951477051 41 15 10 6 10 4.902076500250222 20.39951844792622 0.035602569580078125 3 0.95691123315698 5.923909775895825 5741.0 24.75672862453532 0.0 - - - - - - - 185.46666666666667 11 15 CDC42BPA;CDC42BPB CDC42 binding protein kinase alpha (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 1943 247 C20140710_OR016_03 C20140710_OR016_03 TB432854.[MT7]-GAFGEVAVVK[MT7].2b7_1.heavy 632.879 / 776.406 5113.0 32.17379951477051 41 15 10 6 10 4.902076500250222 20.39951844792622 0.035602569580078125 3 0.95691123315698 5.923909775895825 5113.0 20.67391405227339 0.0 - - - - - - - 293.06666666666666 10 15 CDC42BPA;CDC42BPB CDC42 binding protein kinase alpha (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 1945 247 C20140710_OR016_03 C20140710_OR016_03 TB432854.[MT7]-GAFGEVAVVK[MT7].2b5_1.heavy 632.879 / 606.3 6907.0 32.17379951477051 41 15 10 6 10 4.902076500250222 20.39951844792622 0.035602569580078125 3 0.95691123315698 5.923909775895825 6907.0 12.34615551425031 0.0 - - - - - - - 653.4285714285714 13 7 CDC42BPA;CDC42BPB CDC42 binding protein kinase alpha (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 1947 247 C20140710_OR016_03 C20140710_OR016_03 TB432854.[MT7]-GAFGEVAVVK[MT7].2y7_1.heavy 632.879 / 845.521 4754.0 32.17379951477051 41 15 10 6 10 4.902076500250222 20.39951844792622 0.035602569580078125 3 0.95691123315698 5.923909775895825 4754.0 70.89981626319056 0.0 - - - - - - - 260.2 9 10 CDC42BPA;CDC42BPB CDC42 binding protein kinase alpha (DMPK-like);CDC42 binding protein kinase beta (DMPK-like) 1949 248 C20140710_OR016_03 C20140710_OR016_03 TB432857.[MT7]-K[MT7]LPLIQK[MT7].3y3_1.heavy 424.631 / 532.357 11808.0 28.600099563598633 36 10 10 10 6 1.2743311169183358 65.17037723670857 0.0 5 0.8443768247078677 3.086917961799592 11808.0 72.03916526690392 0.0 - - - - - - - 234.2 23 10 ADAM7 ADAM metallopeptidase domain 7 1951 248 C20140710_OR016_03 C20140710_OR016_03 TB432857.[MT7]-K[MT7]LPLIQK[MT7].3b4_1.heavy 424.631 / 740.527 1593.0 28.600099563598633 36 10 10 10 6 1.2743311169183358 65.17037723670857 0.0 5 0.8443768247078677 3.086917961799592 1593.0 0.40323931599594337 2.0 - - - - - - - 204.45454545454547 4 11 ADAM7 ADAM metallopeptidase domain 7 1953 248 C20140710_OR016_03 C20140710_OR016_03 TB432857.[MT7]-K[MT7]LPLIQK[MT7].3b4_2.heavy 424.631 / 370.767 17712.0 28.600099563598633 36 10 10 10 6 1.2743311169183358 65.17037723670857 0.0 5 0.8443768247078677 3.086917961799592 17712.0 6.760937351005674 1.0 - - - - - - - 300.0 36 10 ADAM7 ADAM metallopeptidase domain 7 1955 248 C20140710_OR016_03 C20140710_OR016_03 TB432857.[MT7]-K[MT7]LPLIQK[MT7].3y5_1.heavy 424.631 / 742.494 1218.0 28.600099563598633 36 10 10 10 6 1.2743311169183358 65.17037723670857 0.0 5 0.8443768247078677 3.086917961799592 1218.0 0.17188097928436913 2.0 - - - - - - - 206.2 3 10 ADAM7 ADAM metallopeptidase domain 7 1957 249 C20140710_OR016_03 C20140710_OR016_03 TB433026.[MT7]-AFATDSTDAEEDK[MT7]IPK[MT7].4y8_2.heavy 543.286 / 609.353 3709.0 27.714600563049316 39 13 10 6 10 1.6805303310570545 51.89659897290291 0.03800010681152344 3 0.9208433421055445 4.357238829219453 3709.0 8.420731889469753 0.0 - - - - - - - 195.7 7 10 SAG S-antigen; retina and pineal gland (arrestin) 1959 249 C20140710_OR016_03 C20140710_OR016_03 TB433026.[MT7]-AFATDSTDAEEDK[MT7]IPK[MT7].4y10_2.heavy 543.286 / 717.39 1546.0 27.714600563049316 39 13 10 6 10 1.6805303310570545 51.89659897290291 0.03800010681152344 3 0.9208433421055445 4.357238829219453 1546.0 1.5009708737864078 1.0 - - - - - - - 277.3076923076923 4 13 SAG S-antigen; retina and pineal gland (arrestin) 1961 249 C20140710_OR016_03 C20140710_OR016_03 TB433026.[MT7]-AFATDSTDAEEDK[MT7]IPK[MT7].4b4_1.heavy 543.286 / 535.3 2473.0 27.714600563049316 39 13 10 6 10 1.6805303310570545 51.89659897290291 0.03800010681152344 3 0.9208433421055445 4.357238829219453 2473.0 10.244142394822006 0.0 - - - - - - - 240.33333333333334 4 12 SAG S-antigen; retina and pineal gland (arrestin) 1963 249 C20140710_OR016_03 C20140710_OR016_03 TB433026.[MT7]-AFATDSTDAEEDK[MT7]IPK[MT7].4b5_1.heavy 543.286 / 650.327 3915.0 27.714600563049316 39 13 10 6 10 1.6805303310570545 51.89659897290291 0.03800010681152344 3 0.9208433421055445 4.357238829219453 3915.0 29.077427184466018 0.0 - - - - - - - 252.8181818181818 7 11 SAG S-antigen; retina and pineal gland (arrestin) 1965 250 C20140710_OR016_03 C20140710_OR016_03 TB432958.[MT7]-EAQAQGDPVASAIK[MT7].3b4_1.heavy 558.308 / 544.285 5565.0 26.688599586486816 39 14 10 5 10 2.078647483091569 38.22011799997062 0.04419898986816406 3 0.9493073763816751 5.458056983007258 5565.0 21.071359223300973 0.0 - - - - - - - 283.25 11 8 SDCCAG1 serologically defined colon cancer antigen 1 1967 250 C20140710_OR016_03 C20140710_OR016_03 TB432958.[MT7]-EAQAQGDPVASAIK[MT7].3y4_1.heavy 558.308 / 562.368 5359.0 26.688599586486816 39 14 10 5 10 2.078647483091569 38.22011799997062 0.04419898986816406 3 0.9493073763816751 5.458056983007258 5359.0 20.611650485436897 1.0 - - - - - - - 188.83333333333334 10 6 SDCCAG1 serologically defined colon cancer antigen 1 1969 250 C20140710_OR016_03 C20140710_OR016_03 TB432958.[MT7]-EAQAQGDPVASAIK[MT7].3y5_1.heavy 558.308 / 633.405 9687.0 26.688599586486816 39 14 10 5 10 2.078647483091569 38.22011799997062 0.04419898986816406 3 0.9493073763816751 5.458056983007258 9687.0 20.72053629218678 0.0 - - - - - - - 298.7 19 10 SDCCAG1 serologically defined colon cancer antigen 1 1971 250 C20140710_OR016_03 C20140710_OR016_03 TB432958.[MT7]-EAQAQGDPVASAIK[MT7].3b7_1.heavy 558.308 / 844.392 6904.0 26.688599586486816 39 14 10 5 10 2.078647483091569 38.22011799997062 0.04419898986816406 3 0.9493073763816751 5.458056983007258 6904.0 43.345501618122974 0.0 - - - - - - - 217.44444444444446 13 9 SDCCAG1 serologically defined colon cancer antigen 1 1973 251 C20140710_OR016_03 C20140710_OR016_03 TB432957.[MT7]-IDVQEPELEDLAR.2y8_1.heavy 835.94 / 942.489 4986.0 37.697898864746094 43 15 10 10 8 3.3753669206008774 29.626408728979946 0.0 4 0.9526864308727789 5.651218893523162 4986.0 10.49139004052918 0.0 - - - - - - - 293.2857142857143 9 7 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1975 251 C20140710_OR016_03 C20140710_OR016_03 TB432957.[MT7]-IDVQEPELEDLAR.2y9_1.heavy 835.94 / 1071.53 1760.0 37.697898864746094 43 15 10 10 8 3.3753669206008774 29.626408728979946 0.0 4 0.9526864308727789 5.651218893523162 1760.0 3.989978696207925 1.0 - - - - - - - 366.6666666666667 4 6 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1977 251 C20140710_OR016_03 C20140710_OR016_03 TB432957.[MT7]-IDVQEPELEDLAR.2y10_1.heavy 835.94 / 1199.59 1467.0 37.697898864746094 43 15 10 10 8 3.3753669206008774 29.626408728979946 0.0 4 0.9526864308727789 5.651218893523162 1467.0 4.812917109768035 3.0 - - - - - - - 244.44444444444446 3 9 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1979 251 C20140710_OR016_03 C20140710_OR016_03 TB432957.[MT7]-IDVQEPELEDLAR.2b5_1.heavy 835.94 / 729.39 3960.0 37.697898864746094 43 15 10 10 8 3.3753669206008774 29.626408728979946 0.0 4 0.9526864308727789 5.651218893523162 3960.0 26.07112627986348 0.0 - - - - - - - 209.57142857142858 7 7 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1981 252 C20140710_OR016_03 C20140710_OR016_03 TB423658.[MT7]-SFTNTIQDIR.3b4_1.heavy 446.909 / 594.3 891.0 32.683349609375 34 20 2 6 6 6.074159196758207 16.46318391743342 0.03790283203125 5 0.9935597484510887 15.370132033570473 891.0 1.1020847880299252 2.0 - - - - - - - 191.69230769230768 2 13 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1983 252 C20140710_OR016_03 C20140710_OR016_03 TB423658.[MT7]-SFTNTIQDIR.3b5_1.heavy 446.909 / 695.348 624.0 32.683349609375 34 20 2 6 6 6.074159196758207 16.46318391743342 0.03790283203125 5 0.9935597484510887 15.370132033570473 624.0 9.184719101123596 0.0 - - - - - - - 0.0 1 0 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1985 252 C20140710_OR016_03 C20140710_OR016_03 TB423658.[MT7]-SFTNTIQDIR.3b3_1.heavy 446.909 / 480.258 1069.0 32.683349609375 34 20 2 6 6 6.074159196758207 16.46318391743342 0.03790283203125 5 0.9935597484510887 15.370132033570473 1069.0 14.197280898876404 2.0 - - - - - - - 178.0 6 7 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1987 252 C20140710_OR016_03 C20140710_OR016_03 TB423658.[MT7]-SFTNTIQDIR.3y4_1.heavy 446.909 / 531.289 1515.0 32.683349609375 34 20 2 6 6 6.074159196758207 16.46318391743342 0.03790283203125 5 0.9935597484510887 15.370132033570473 1515.0 11.291573033707863 1.0 - - - - - - - 255.875 3 8 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 1989 253 C20140710_OR016_03 C20140710_OR016_03 TB444863.[MT7]-QLC[CAM]GTER.2b3_1.heavy 504.257 / 546.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - RGPD6;RGPD5 RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1991 253 C20140710_OR016_03 C20140710_OR016_03 TB444863.[MT7]-QLC[CAM]GTER.2y5_1.heavy 504.257 / 622.261 N/A N/A - - - - - - - - - 0.0 - - - - - - - RGPD6;RGPD5 RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1993 253 C20140710_OR016_03 C20140710_OR016_03 TB444863.[MT7]-QLC[CAM]GTER.2b4_1.heavy 504.257 / 603.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - RGPD6;RGPD5 RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1995 253 C20140710_OR016_03 C20140710_OR016_03 TB444863.[MT7]-QLC[CAM]GTER.2y6_1.heavy 504.257 / 735.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - RGPD6;RGPD5 RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 1997 254 C20140710_OR016_03 C20140710_OR016_03 TB445162.[MT7]-LFPC[CAM]VILTPLDC[CAM]FWEGAK[MT7].3b6_1.heavy 818.765 / 874.498 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTCH2 patched 2 1999 254 C20140710_OR016_03 C20140710_OR016_03 TB445162.[MT7]-LFPC[CAM]VILTPLDC[CAM]FWEGAK[MT7].3b4_1.heavy 818.765 / 662.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTCH2 patched 2 2001 254 C20140710_OR016_03 C20140710_OR016_03 TB445162.[MT7]-LFPC[CAM]VILTPLDC[CAM]FWEGAK[MT7].3b5_1.heavy 818.765 / 761.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTCH2 patched 2 2003 254 C20140710_OR016_03 C20140710_OR016_03 TB445162.[MT7]-LFPC[CAM]VILTPLDC[CAM]FWEGAK[MT7].3y4_1.heavy 818.765 / 548.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - PTCH2 patched 2 2005 255 C20140710_OR016_03 C20140710_OR016_03 TB423847.[MT7]-ITLALMEDTGR.3y6_1.heavy 455.251 / 708.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMLN leishmanolysin-like (metallopeptidase M8 family) 2007 255 C20140710_OR016_03 C20140710_OR016_03 TB423847.[MT7]-ITLALMEDTGR.3b4_1.heavy 455.251 / 543.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMLN leishmanolysin-like (metallopeptidase M8 family) 2009 255 C20140710_OR016_03 C20140710_OR016_03 TB423847.[MT7]-ITLALMEDTGR.3b3_1.heavy 455.251 / 472.325 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMLN leishmanolysin-like (metallopeptidase M8 family) 2011 255 C20140710_OR016_03 C20140710_OR016_03 TB423847.[MT7]-ITLALMEDTGR.3y5_1.heavy 455.251 / 577.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - LMLN leishmanolysin-like (metallopeptidase M8 family) 2013 256 C20140710_OR016_03 C20140710_OR016_03 TB444853.[MT7]-IHNTAK[MT7].2y4_1.heavy 486.297 / 577.343 1138.0 14.88029956817627 39 13 10 10 6 1.6352133507184798 49.366107702621676 0.0 6 0.9149740184299611 4.202040422083778 1138.0 19.791304347826088 0.0 - - - - - - - 123.3 2 10 PREX1;PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1;phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2015 256 C20140710_OR016_03 C20140710_OR016_03 TB444853.[MT7]-IHNTAK[MT7].2b3_1.heavy 486.297 / 509.295 137.0 14.88029956817627 39 13 10 10 6 1.6352133507184798 49.366107702621676 0.0 6 0.9149740184299611 4.202040422083778 137.0 0.7010989010989012 14.0 - - - - - - - 0.0 0 0 PREX1;PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1;phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2017 256 C20140710_OR016_03 C20140710_OR016_03 TB444853.[MT7]-IHNTAK[MT7].2y5_1.heavy 486.297 / 714.401 819.0 14.88029956817627 39 13 10 10 6 1.6352133507184798 49.366107702621676 0.0 6 0.9149740184299611 4.202040422083778 819.0 23.60310695017455 0.0 - - - - - - - 0.0 1 0 PREX1;PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1;phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2019 256 C20140710_OR016_03 C20140710_OR016_03 TB444853.[MT7]-IHNTAK[MT7].2y3_1.heavy 486.297 / 463.3 410.0 14.88029956817627 39 13 10 10 6 1.6352133507184798 49.366107702621676 0.0 6 0.9149740184299611 4.202040422083778 410.0 1.7978128927034038 5.0 - - - - - - - 0.0 0 0 PREX1;PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1;phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2021 257 C20140710_OR016_03 C20140710_OR016_03 TB445022.[MT7]-SINNASSVSTSQR.2y8_1.heavy 747.885 / 851.422 960.0 19.473000526428223 37 11 10 6 10 8.999078159410077 11.112249302494709 0.03800010681152344 3 0.8670273285594122 3.346161640050616 960.0 17.124324324324327 0.0 - - - - - - - 0.0 1 0 ZNF28;ZNF468 zinc finger protein 28;zinc finger protein 468 2023 257 C20140710_OR016_03 C20140710_OR016_03 TB445022.[MT7]-SINNASSVSTSQR.2b4_1.heavy 747.885 / 573.311 1255.0 19.473000526428223 37 11 10 6 10 8.999078159410077 11.112249302494709 0.03800010681152344 3 0.8670273285594122 3.346161640050616 1255.0 11.273819860584567 0.0 - - - - - - - 133.0 2 5 ZNF28;ZNF468 zinc finger protein 28;zinc finger protein 468 2025 257 C20140710_OR016_03 C20140710_OR016_03 TB445022.[MT7]-SINNASSVSTSQR.2y10_1.heavy 747.885 / 1036.5 1107.0 19.473000526428223 37 11 10 6 10 8.999078159410077 11.112249302494709 0.03800010681152344 3 0.8670273285594122 3.346161640050616 1107.0 29.170945945945945 0.0 - - - - - - - 258.5 2 4 ZNF28;ZNF468 zinc finger protein 28;zinc finger protein 468 2027 257 C20140710_OR016_03 C20140710_OR016_03 TB445022.[MT7]-SINNASSVSTSQR.2y11_1.heavy 747.885 / 1150.54 221.0 19.473000526428223 37 11 10 6 10 8.999078159410077 11.112249302494709 0.03800010681152344 3 0.8670273285594122 3.346161640050616 221.0 3.9664864864864864 1.0 - - - - - - - 0.0 0 0 ZNF28;ZNF468 zinc finger protein 28;zinc finger protein 468 2029 258 C20140710_OR016_03 C20140710_OR016_03 TB445028.[MT7]-FIDWFC[CAM]GFK[MT7].2y4_1.heavy 754.386 / 655.335 1157.0 48.41499900817871 42 16 10 6 10 2.1840927684057383 35.74802909978362 0.03639984130859375 3 0.9641673595082794 6.500062502497981 1157.0 7.6620290892252 2.0 - - - - - - - 235.9375 3 16 SLC5A3 solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 2031 258 C20140710_OR016_03 C20140710_OR016_03 TB445028.[MT7]-FIDWFC[CAM]GFK[MT7].2b3_1.heavy 754.386 / 520.289 4087.0 48.41499900817871 42 16 10 6 10 2.1840927684057383 35.74802909978362 0.03639984130859375 3 0.9641673595082794 6.500062502497981 4087.0 101.37883116883117 0.0 - - - - - - - 188.33333333333334 8 9 SLC5A3 solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 2033 258 C20140710_OR016_03 C20140710_OR016_03 TB445028.[MT7]-FIDWFC[CAM]GFK[MT7].2y5_1.heavy 754.386 / 802.404 1388.0 48.41499900817871 42 16 10 6 10 2.1840927684057383 35.74802909978362 0.03639984130859375 3 0.9641673595082794 6.500062502497981 1388.0 11.116017316017317 0.0 - - - - - - - 253.14285714285714 2 7 SLC5A3 solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 2035 258 C20140710_OR016_03 C20140710_OR016_03 TB445028.[MT7]-FIDWFC[CAM]GFK[MT7].2y6_1.heavy 754.386 / 988.483 2468.0 48.41499900817871 42 16 10 6 10 2.1840927684057383 35.74802909978362 0.03639984130859375 3 0.9641673595082794 6.500062502497981 2468.0 40.27861471861472 0.0 - - - - - - - 171.22222222222223 4 9 SLC5A3 solute carrier family 5 (sodium/myo-inositol cotransporter), member 3 2037 259 C20140710_OR016_03 C20140710_OR016_03 TB424042.[MT7]-DDSDVTEVMWQPALR.2y8_1.heavy 953.46 / 1000.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 2039 259 C20140710_OR016_03 C20140710_OR016_03 TB424042.[MT7]-DDSDVTEVMWQPALR.2b4_1.heavy 953.46 / 577.222 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 2041 259 C20140710_OR016_03 C20140710_OR016_03 TB424042.[MT7]-DDSDVTEVMWQPALR.2y10_1.heavy 953.46 / 1230.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 2043 259 C20140710_OR016_03 C20140710_OR016_03 TB424042.[MT7]-DDSDVTEVMWQPALR.2b5_1.heavy 953.46 / 676.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - TNFSF12-TNFSF13;TNFSF13 TNFSF12-TNFSF13 readthrough;tumor necrosis factor (ligand) superfamily, member 13 2045 260 C20140710_OR016_03 C20140710_OR016_03 TB423932.[MT7]-IHTTEFEWPK[MT7].3y3_1.heavy 525.952 / 574.347 1134.0 33.880574226379395 20 3 10 5 2 0.43621096534192255 113.96353234025736 0.040699005126953125 11 0.5754679478491934 1.8225695535781585 1134.0 5.467965435386025 9.0 - - - - - - - 700.4 3 10 SDCCAG1 serologically defined colon cancer antigen 1 2047 260 C20140710_OR016_03 C20140710_OR016_03 TB423932.[MT7]-IHTTEFEWPK[MT7].3b6_1.heavy 525.952 / 873.459 4225.0 33.880574226379395 20 3 10 5 2 0.43621096534192255 113.96353234025736 0.040699005126953125 11 0.5754679478491934 1.8225695535781585 4225.0 43.03522884882108 0.0 - - - - - - - 176.57142857142858 8 7 SDCCAG1 serologically defined colon cancer antigen 1 2049 260 C20140710_OR016_03 C20140710_OR016_03 TB423932.[MT7]-IHTTEFEWPK[MT7].3b5_1.heavy 525.952 / 726.39 824.0 33.880574226379395 20 3 10 5 2 0.43621096534192255 113.96353234025736 0.040699005126953125 11 0.5754679478491934 1.8225695535781585 824.0 1.0497271073377805 6.0 - - - - - - - 206.0 5 10 SDCCAG1 serologically defined colon cancer antigen 1 2051 260 C20140710_OR016_03 C20140710_OR016_03 TB423932.[MT7]-IHTTEFEWPK[MT7].3b7_1.heavy 525.952 / 1002.5 206.0 33.880574226379395 20 3 10 5 2 0.43621096534192255 113.96353234025736 0.040699005126953125 11 0.5754679478491934 1.8225695535781585 206.0 1.1323333333333334 17.0 - - - - - - - 171.66666666666666 3 6 SDCCAG1 serologically defined colon cancer antigen 1 2053 261 C20140710_OR016_03 C20140710_OR016_03 TB445026.[MT7]-YVASVLGLTPSPR.2y8_1.heavy 752.436 / 840.494 5020.0 39.719725608825684 40 15 10 5 10 4.994477118897336 20.022115953166615 0.048900604248046875 3 0.9579627569624108 5.9980767094610385 5020.0 9.451882845188285 0.0 - - - - - - - 335.0 10 5 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 2055 261 C20140710_OR016_03 C20140710_OR016_03 TB445026.[MT7]-YVASVLGLTPSPR.2y12_1.heavy 752.436 / 1196.7 2988.0 39.719725608825684 40 15 10 5 10 4.994477118897336 20.022115953166615 0.048900604248046875 3 0.9579627569624108 5.9980767094610385 2988.0 13.949061199752917 0.0 - - - - - - - 263.2 5 5 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 2057 261 C20140710_OR016_03 C20140710_OR016_03 TB445026.[MT7]-YVASVLGLTPSPR.2y10_1.heavy 752.436 / 1026.59 7291.0 39.719725608825684 40 15 10 5 10 4.994477118897336 20.022115953166615 0.048900604248046875 3 0.9579627569624108 5.9980767094610385 7291.0 11.460769230769229 0.0 - - - - - - - 318.6666666666667 14 3 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 2059 261 C20140710_OR016_03 C20140710_OR016_03 TB445026.[MT7]-YVASVLGLTPSPR.2y11_1.heavy 752.436 / 1097.63 7650.0 39.719725608825684 40 15 10 5 10 4.994477118897336 20.022115953166615 0.048900604248046875 3 0.9579627569624108 5.9980767094610385 7650.0 20.799037656903767 0.0 - - - - - - - 263.0 15 5 RGPD8;RGPD6;RGPD5 RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 2061 262 C20140710_OR016_03 C20140710_OR016_03 TB424044.[MT7]-MLFSNIEDILAVHK[MT7].4y4_1.heavy 480.273 / 598.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2063 262 C20140710_OR016_03 C20140710_OR016_03 TB424044.[MT7]-MLFSNIEDILAVHK[MT7].4b5_1.heavy 480.273 / 737.377 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2065 262 C20140710_OR016_03 C20140710_OR016_03 TB424044.[MT7]-MLFSNIEDILAVHK[MT7].4y3_1.heavy 480.273 / 527.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2067 262 C20140710_OR016_03 C20140710_OR016_03 TB424044.[MT7]-MLFSNIEDILAVHK[MT7].4b3_1.heavy 480.273 / 536.302 N/A N/A - - - - - - - - - 0.0 - - - - - - - PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2069 263 C20140710_OR016_03 C20140710_OR016_03 TB423747.[MT7]-VYWFEK[MT7].2y4_1.heavy 580.323 / 753.405 4999.0 36.14039993286133 34 10 10 10 4 0.7499083920552578 87.93490666745494 0.0 7 0.8352239711880225 2.9975270530651263 4999.0 11.392278911564624 0.0 - - - - - - - 294.0 9 5 SDCCAG1 serologically defined colon cancer antigen 1 2071 263 C20140710_OR016_03 C20140710_OR016_03 TB423747.[MT7]-VYWFEK[MT7].2y5_1.heavy 580.323 / 916.469 588.0 36.14039993286133 34 10 10 10 4 0.7499083920552578 87.93490666745494 0.0 7 0.8352239711880225 2.9975270530651263 588.0 1.0333333333333332 11.0 - - - - - - - 235.2 4 5 SDCCAG1 serologically defined colon cancer antigen 1 2073 263 C20140710_OR016_03 C20140710_OR016_03 TB423747.[MT7]-VYWFEK[MT7].2b4_1.heavy 580.323 / 740.389 294.0 36.14039993286133 34 10 10 10 4 0.7499083920552578 87.93490666745494 0.0 7 0.8352239711880225 2.9975270530651263 294.0 1.0999999999999999 22.0 - - - - - - - 269.5 2 6 SDCCAG1 serologically defined colon cancer antigen 1 2075 263 C20140710_OR016_03 C20140710_OR016_03 TB423747.[MT7]-VYWFEK[MT7].2y3_1.heavy 580.323 / 567.326 8822.0 36.14039993286133 34 10 10 10 4 0.7499083920552578 87.93490666745494 0.0 7 0.8352239711880225 2.9975270530651263 8822.0 3.6894865379861206 1.0 - - - - - - - 257.25 21 4 SDCCAG1 serologically defined colon cancer antigen 1 2077 264 C20140710_OR016_03 C20140710_OR016_03 TB445169.[MT7]-NTDVPLEGYLVTPIQRIC[CAM]K[MT7].4b8_1.heavy 626.85 / 970.496 4108.0 40.93510055541992 40 15 10 5 10 1.3206300639632835 57.77333801021316 0.04219818115234375 3 0.9589236123133565 6.068317844333323 4108.0 16.82443288638641 2.0 - - - - - - - 190.0 8 9 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2079 264 C20140710_OR016_03 C20140710_OR016_03 TB445169.[MT7]-NTDVPLEGYLVTPIQRIC[CAM]K[MT7].4b4_1.heavy 626.85 / 574.295 26128.0 40.93510055541992 40 15 10 5 10 1.3206300639632835 57.77333801021316 0.04219818115234375 3 0.9589236123133565 6.068317844333323 26128.0 33.06842890937314 0.0 - - - - - - - 410.4 52 5 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2081 264 C20140710_OR016_03 C20140710_OR016_03 TB445169.[MT7]-NTDVPLEGYLVTPIQRIC[CAM]K[MT7].4y7_1.heavy 626.85 / 1058.63 5591.0 40.93510055541992 40 15 10 5 10 1.3206300639632835 57.77333801021316 0.04219818115234375 3 0.9589236123133565 6.068317844333323 5591.0 0.521617418133944 1.0 - - - - - - - 273.6 11 5 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2083 264 C20140710_OR016_03 C20140710_OR016_03 TB445169.[MT7]-NTDVPLEGYLVTPIQRIC[CAM]K[MT7].4y7_2.heavy 626.85 / 529.817 13007.0 40.93510055541992 40 15 10 5 10 1.3206300639632835 57.77333801021316 0.04219818115234375 3 0.9589236123133565 6.068317844333323 13007.0 59.33017543859649 0.0 - - - - - - - 342.0 26 8 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2085 265 C20140710_OR016_03 C20140710_OR016_03 TB424047.[MT7]-DLSNLPYGDLTEIGER.3y6_1.heavy 645.997 / 704.357 3438.0 40.24412441253662 37 16 10 1 10 3.3279652294023827 30.04839086553721 0.09350204467773438 3 0.9632778658004806 6.420374417324206 3438.0 3.201073082141739 1.0 - - - - - - - 220.4 6 10 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 2087 265 C20140710_OR016_03 C20140710_OR016_03 TB424047.[MT7]-DLSNLPYGDLTEIGER.3b4_1.heavy 645.997 / 574.295 5914.0 40.24412441253662 37 16 10 1 10 3.3279652294023827 30.04839086553721 0.09350204467773438 3 0.9632778658004806 6.420374417324206 5914.0 14.18797357293869 0.0 - - - - - - - 344.0 11 6 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 2089 265 C20140710_OR016_03 C20140710_OR016_03 TB424047.[MT7]-DLSNLPYGDLTEIGER.3b5_1.heavy 645.997 / 687.379 5501.0 40.24412441253662 37 16 10 1 10 3.3279652294023827 30.04839086553721 0.09350204467773438 3 0.9632778658004806 6.420374417324206 5501.0 17.528361204770203 0.0 - - - - - - - 321.3333333333333 11 6 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 2091 265 C20140710_OR016_03 C20140710_OR016_03 TB424047.[MT7]-DLSNLPYGDLTEIGER.3y9_1.heavy 645.997 / 989.49 4538.0 40.24412441253662 37 16 10 1 10 3.3279652294023827 30.04839086553721 0.09350204467773438 3 0.9632778658004806 6.420374417324206 4538.0 32.39378656126482 0.0 - - - - - - - 153.22222222222223 9 9 ABCC12 ATP-binding cassette, sub-family C (CFTR/MRP), member 12 2093 266 C20140710_OR016_03 C20140710_OR016_03 TB423748.[MT7]-VVENVIAK[MT7].2b4_1.heavy 580.368 / 586.332 2668.0 28.50339984893799 31 13 4 6 8 1.3348854991891035 51.20001275979741 0.031200408935546875 4 0.915417795035066 4.21321023099207 2668.0 10.54314338154221 0.0 - - - - - - - 248.28571428571428 5 14 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2095 266 C20140710_OR016_03 C20140710_OR016_03 TB423748.[MT7]-VVENVIAK[MT7].2y6_1.heavy 580.368 / 817.49 1455.0 28.50339984893799 31 13 4 6 8 1.3348854991891035 51.20001275979741 0.031200408935546875 4 0.915417795035066 4.21321023099207 1455.0 0.692197906755471 2.0 - - - - - - - 183.9090909090909 4 11 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2097 266 C20140710_OR016_03 C20140710_OR016_03 TB423748.[MT7]-VVENVIAK[MT7].2b5_1.heavy 580.368 / 685.4 3234.0 28.50339984893799 31 13 4 6 8 1.3348854991891035 51.20001275979741 0.031200408935546875 4 0.915417795035066 4.21321023099207 3234.0 3.8099726785909436 1.0 - - - - - - - 248.5 14 14 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2099 266 C20140710_OR016_03 C20140710_OR016_03 TB423748.[MT7]-VVENVIAK[MT7].2y7_1.heavy 580.368 / 916.558 4204.0 28.50339984893799 31 13 4 6 8 1.3348854991891035 51.20001275979741 0.031200408935546875 4 0.915417795035066 4.21321023099207 4204.0 31.83275720164609 0.0 - - - - - - - 182.125 8 16 PREX2 phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 2101 267 C20140710_OR016_03 C20140710_OR016_03 TB432862.[MT7]-AVAVC[CAM]NLQK[MT7].3y3_1.heavy 430.92 / 532.357 2051.0 25.752899169921875 47 17 10 10 10 3.9449041274748025 25.349158501352893 0.0 3 0.9747338122053442 7.7477184575797295 2051.0 3.6191404601280057 0.0 - - - - - - - 307.8333333333333 4 6 LMLN leishmanolysin-like (metallopeptidase M8 family) 2103 267 C20140710_OR016_03 C20140710_OR016_03 TB432862.[MT7]-AVAVC[CAM]NLQK[MT7].3b6_1.heavy 430.92 / 759.394 718.0 25.752899169921875 47 17 10 10 10 3.9449041274748025 25.349158501352893 0.0 3 0.9747338122053442 7.7477184575797295 718.0 2.0745128286347794 1.0 - - - - - - - 205.33333333333334 2 3 LMLN leishmanolysin-like (metallopeptidase M8 family) 2105 267 C20140710_OR016_03 C20140710_OR016_03 TB432862.[MT7]-AVAVC[CAM]NLQK[MT7].3b4_1.heavy 430.92 / 485.32 5537.0 25.752899169921875 47 17 10 10 10 3.9449041274748025 25.349158501352893 0.0 3 0.9747338122053442 7.7477184575797295 5537.0 102.08507766990292 0.0 - - - - - - - 188.33333333333334 11 6 LMLN leishmanolysin-like (metallopeptidase M8 family) 2107 267 C20140710_OR016_03 C20140710_OR016_03 TB432862.[MT7]-AVAVC[CAM]NLQK[MT7].3y4_1.heavy 430.92 / 646.4 1025.0 25.752899169921875 47 17 10 10 10 3.9449041274748025 25.349158501352893 0.0 3 0.9747338122053442 7.7477184575797295 1025.0 14.941504854368933 0.0 - - - - - - - 205.2 2 5 LMLN leishmanolysin-like (metallopeptidase M8 family) 2109 268 C20140710_OR016_03 C20140710_OR016_03 TB445165.[MT7]-LTVSGFLGELTSSEVATEVPFR.3b9_1.heavy 828.443 / 1048.58 3266.0 52.588900566101074 41 17 10 6 8 3.3340437637294844 23.829143741227803 0.039600372314453125 4 0.9754275752158595 7.856787792333528 3266.0 39.69097222222223 0.0 - - - - - - - 96.0 6 12 SAG S-antigen; retina and pineal gland (arrestin) 2111 268 C20140710_OR016_03 C20140710_OR016_03 TB445165.[MT7]-LTVSGFLGELTSSEVATEVPFR.3b6_1.heavy 828.443 / 749.431 3074.0 52.588900566101074 41 17 10 6 8 3.3340437637294844 23.829143741227803 0.039600372314453125 4 0.9754275752158595 7.856787792333528 3074.0 29.992847222222224 0.0 - - - - - - - 132.92307692307693 6 13 SAG S-antigen; retina and pineal gland (arrestin) 2113 268 C20140710_OR016_03 C20140710_OR016_03 TB445165.[MT7]-LTVSGFLGELTSSEVATEVPFR.3b5_1.heavy 828.443 / 602.363 1681.0 52.588900566101074 41 17 10 6 8 3.3340437637294844 23.829143741227803 0.039600372314453125 4 0.9754275752158595 7.856787792333528 1681.0 14.88385416666667 0.0 - - - - - - - 128.0 3 15 SAG S-antigen; retina and pineal gland (arrestin) 2115 268 C20140710_OR016_03 C20140710_OR016_03 TB445165.[MT7]-LTVSGFLGELTSSEVATEVPFR.3b8_1.heavy 828.443 / 919.537 1873.0 52.588900566101074 41 17 10 6 8 3.3340437637294844 23.829143741227803 0.039600372314453125 4 0.9754275752158595 7.856787792333528 1873.0 8.324444444444445 1.0 - - - - - - - 113.45454545454545 4 11 SAG S-antigen; retina and pineal gland (arrestin) 2117 269 C20140710_OR016_03 C20140710_OR016_03 TB433038.[MT7]-AHRFLGLLYELEENTEK[MT7].4b8_1.heavy 588.322 / 1052.65 4332.0 42.66239929199219 37 7 10 10 10 0.6975263463869813 79.35140359453192 0.0 3 0.7251485285789979 2.29785774490598 4332.0 63.10393700787402 0.0 - - - - - - - 190.75 8 4 RGPD4;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 2119 269 C20140710_OR016_03 C20140710_OR016_03 TB433038.[MT7]-AHRFLGLLYELEENTEK[MT7].4b8_2.heavy 588.322 / 526.828 24847.0 42.66239929199219 37 7 10 10 10 0.6975263463869813 79.35140359453192 0.0 3 0.7251485285789979 2.29785774490598 24847.0 39.00627943485086 0.0 - - - - - - - 669.0 49 8 RGPD4;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 2121 269 C20140710_OR016_03 C20140710_OR016_03 TB433038.[MT7]-AHRFLGLLYELEENTEK[MT7].4b7_1.heavy 588.322 / 939.565 3695.0 42.66239929199219 37 7 10 10 10 0.6975263463869813 79.35140359453192 0.0 3 0.7251485285789979 2.29785774490598 3695.0 12.86479057591623 0.0 - - - - - - - 233.33333333333334 7 6 RGPD4;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 2123 269 C20140710_OR016_03 C20140710_OR016_03 TB433038.[MT7]-AHRFLGLLYELEENTEK[MT7].4b6_1.heavy 588.322 / 826.48 3440.0 42.66239929199219 37 7 10 10 10 0.6975263463869813 79.35140359453192 0.0 3 0.7251485285789979 2.29785774490598 3440.0 25.031218156553958 0.0 - - - - - - - 233.5 6 6 RGPD4;RGPD1;RGPD3;RGPD8;RGPD6;RGPD2;RGPD5 RANBP2-like and GRIP domain containing 4;RANBP2-like and GRIP domain containing 1;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 2;RANBP2-like and GRIP domain containing 5 2125 270 C20140710_OR016_03 C20140710_OR016_03 TB432869.[MT7]-SVELNPTQK[MT7].3y3_1.heavy 435.254 / 520.321 3302.0 24.733400344848633 50 20 10 10 10 10.172787474200879 9.83014736655112 0.0 3 0.9925484781346636 14.28794701223549 3302.0 20.362333333333332 0.0 - - - - - - - 200.0 6 5 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 2127 270 C20140710_OR016_03 C20140710_OR016_03 TB432869.[MT7]-SVELNPTQK[MT7].3b4_1.heavy 435.254 / 573.336 3402.0 24.733400344848633 50 20 10 10 10 10.172787474200879 9.83014736655112 0.0 3 0.9925484781346636 14.28794701223549 3402.0 11.615400000000001 0.0 - - - - - - - 228.57142857142858 6 7 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 2129 270 C20140710_OR016_03 C20140710_OR016_03 TB432869.[MT7]-SVELNPTQK[MT7].3b5_1.heavy 435.254 / 687.379 2001.0 24.733400344848633 50 20 10 10 10 10.172787474200879 9.83014736655112 0.0 3 0.9925484781346636 14.28794701223549 2001.0 9.56197245626562 1.0 - - - - - - - 222.22222222222223 5 9 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 2131 270 C20140710_OR016_03 C20140710_OR016_03 TB432869.[MT7]-SVELNPTQK[MT7].3b3_1.heavy 435.254 / 460.252 8204.0 24.733400344848633 50 20 10 10 10 10.172787474200879 9.83014736655112 0.0 3 0.9925484781346636 14.28794701223549 8204.0 157.51680000000002 0.0 - - - - - - - 160.0 16 5 LOC100510476;RGPD4;RANBP2;RGPD3;RGPD8;RGPD6;RGPD5 e3 SUMO-protein ligase RanBP2-like;RANBP2-like and GRIP domain containing 4;RAN binding protein 2;RANBP2-like and GRIP domain containing 3;RANBP2-like and GRIP domain containing 8;RANBP2-like and GRIP domain containing 6;RANBP2-like and GRIP domain containing 5 2133 271 C20140710_OR016_03 C20140710_OR016_03 TB444851.[MT7]-VC[CAM]DTGK[MT7].2y4_1.heavy 484.26 / 564.311 1633.0 16.492300033569336 43 13 10 10 10 2.8454816566107266 35.143435125535376 0.0 3 0.9268620181734086 4.5353176157581485 1633.0 15.564502464745555 0.0 - - - - - - - 175.1 3 10 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 2135 271 C20140710_OR016_03 C20140710_OR016_03 TB444851.[MT7]-VC[CAM]DTGK[MT7].2b3_1.heavy 484.26 / 519.235 3383.0 16.492300033569336 43 13 10 10 10 2.8454816566107266 35.143435125535376 0.0 3 0.9268620181734086 4.5353176157581485 3383.0 69.04388190836089 0.0 - - - - - - - 155.44444444444446 6 9 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 2137 271 C20140710_OR016_03 C20140710_OR016_03 TB444851.[MT7]-VC[CAM]DTGK[MT7].2y5_1.heavy 484.26 / 724.342 3616.0 16.492300033569336 43 13 10 10 10 2.8454816566107266 35.143435125535376 0.0 3 0.9268620181734086 4.5353176157581485 3616.0 80.10063448275862 0.0 - - - - - - - 93.2 7 5 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 2139 271 C20140710_OR016_03 C20140710_OR016_03 TB444851.[MT7]-VC[CAM]DTGK[MT7].2b4_1.heavy 484.26 / 620.283 350.0 16.492300033569336 43 13 10 10 10 2.8454816566107266 35.143435125535376 0.0 3 0.9268620181734086 4.5353176157581485 350.0 3.2087431214143542 4.0 - - - - - - - 0.0 0 0 TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator 2141 272 C20140710_OR016_03 C20140710_OR016_03 TB432963.[MT7]-AFATDSTDAEEDK[MT7].3b5_1.heavy 563.268 / 650.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 2143 272 C20140710_OR016_03 C20140710_OR016_03 TB432963.[MT7]-AFATDSTDAEEDK[MT7].3y4_1.heavy 563.268 / 664.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 2145 272 C20140710_OR016_03 C20140710_OR016_03 TB432963.[MT7]-AFATDSTDAEEDK[MT7].3b8_1.heavy 563.268 / 953.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin) 2147 272 C20140710_OR016_03 C20140710_OR016_03 TB432963.[MT7]-AFATDSTDAEEDK[MT7].3y5_1.heavy 563.268 / 735.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - SAG S-antigen; retina and pineal gland (arrestin)