Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140711_OR018_03 C20140711_OR018_03 TB422589.[MT7]-RAEEELLLHDTR.4y4_1.heavy 407.224 / 528.253 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 3 1 C20140711_OR018_03 C20140711_OR018_03 TB422589.[MT7]-RAEEELLLHDTR.4b4_1.heavy 407.224 / 630.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 5 1 C20140711_OR018_03 C20140711_OR018_03 TB422589.[MT7]-RAEEELLLHDTR.4b5_1.heavy 407.224 / 759.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 7 1 C20140711_OR018_03 C20140711_OR018_03 TB422589.[MT7]-RAEEELLLHDTR.4b6_1.heavy 407.224 / 872.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 9 2 C20140711_OR018_03 C20140711_OR018_03 TB432257.[MT7]-LVLSSVSDYFAAMFTNDVR.2b8_1.heavy 1140.08 / 945.537 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 11 2 C20140711_OR018_03 C20140711_OR018_03 TB432257.[MT7]-LVLSSVSDYFAAMFTNDVR.2b3_1.heavy 1140.08 / 470.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 13 2 C20140711_OR018_03 C20140711_OR018_03 TB432257.[MT7]-LVLSSVSDYFAAMFTNDVR.2b4_1.heavy 1140.08 / 557.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 15 2 C20140711_OR018_03 C20140711_OR018_03 TB432257.[MT7]-LVLSSVSDYFAAMFTNDVR.2y10_1.heavy 1140.08 / 1171.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 17 3 C20140711_OR018_03 C20140711_OR018_03 TB444122.[MT7]-FWDASGVALRPLYK[MT7].3y7_1.heavy 637.696 / 1004.64 7449.0 40.314998626708984 43 13 10 10 10 1.2879395128821833 51.76226523051407 0.0 3 0.927931304823348 4.569257404561722 7449.0 30.323537463022653 0.0 - - - - - - - 185.69230769230768 14 13 LLGL1 lethal giant larvae homolog 1 (Drosophila) 19 3 C20140711_OR018_03 C20140711_OR018_03 TB444122.[MT7]-FWDASGVALRPLYK[MT7].3y11_2.heavy 637.696 / 659.902 18374.0 40.314998626708984 43 13 10 10 10 1.2879395128821833 51.76226523051407 0.0 3 0.927931304823348 4.569257404561722 18374.0 167.17752112676055 0.0 - - - - - - - 234.84615384615384 36 13 LLGL1 lethal giant larvae homolog 1 (Drosophila) 21 3 C20140711_OR018_03 C20140711_OR018_03 TB444122.[MT7]-FWDASGVALRPLYK[MT7].3b3_1.heavy 637.696 / 593.284 12202.0 40.314998626708984 43 13 10 10 10 1.2879395128821833 51.76226523051407 0.0 3 0.927931304823348 4.569257404561722 12202.0 22.062653764815483 0.0 - - - - - - - 302.93333333333334 24 15 LLGL1 lethal giant larvae homolog 1 (Drosophila) 23 3 C20140711_OR018_03 C20140711_OR018_03 TB444122.[MT7]-FWDASGVALRPLYK[MT7].3y13_2.heavy 637.696 / 810.455 23553.0 40.314998626708984 43 13 10 10 10 1.2879395128821833 51.76226523051407 0.0 3 0.927931304823348 4.569257404561722 23553.0 147.69989939637827 0.0 - - - - - - - 208.26666666666668 47 15 LLGL1 lethal giant larvae homolog 1 (Drosophila) 25 4 C20140711_OR018_03 C20140711_OR018_03 TB422302.[MT7]-IPQTVLWR.2y4_1.heavy 578.852 / 573.351 3563.0 37.94005012512207 43 20 10 5 8 6.9375970424929525 14.4142127868623 0.041896820068359375 4 0.9982676224105271 29.64683760962851 3563.0 5.881826599326599 7.0 - - - - - - - 745.2857142857143 22 7 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 27 4 C20140711_OR018_03 C20140711_OR018_03 TB422302.[MT7]-IPQTVLWR.2y5_1.heavy 578.852 / 674.398 6235.0 37.94005012512207 43 20 10 5 8 6.9375970424929525 14.4142127868623 0.041896820068359375 4 0.9982676224105271 29.64683760962851 6235.0 18.827398852087782 1.0 - - - - - - - 199.71428571428572 14 7 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 29 4 C20140711_OR018_03 C20140711_OR018_03 TB422302.[MT7]-IPQTVLWR.2y6_1.heavy 578.852 / 802.457 4199.0 37.94005012512207 43 20 10 5 8 6.9375970424929525 14.4142127868623 0.041896820068359375 4 0.9982676224105271 29.64683760962851 4199.0 23.72311906935012 0.0 - - - - - - - 148.16666666666666 8 6 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 31 4 C20140711_OR018_03 C20140711_OR018_03 TB422302.[MT7]-IPQTVLWR.2y7_1.heavy 578.852 / 899.51 81560.0 37.94005012512207 43 20 10 5 8 6.9375970424929525 14.4142127868623 0.041896820068359375 4 0.9982676224105271 29.64683760962851 81560.0 124.98388998035362 0.0 - - - - - - - 254.25 163 4 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 33 5 C20140711_OR018_03 C20140711_OR018_03 TB432253.[MT7]-ATLWAEPGSVISRGNSVTIR.3y17_2.heavy 753.417 / 914.987 9245.0 36.98244857788086 41 16 10 5 10 2.7675838936757655 29.321771252950214 0.046600341796875 3 0.9635117355067845 6.441044327393031 9245.0 87.27279999999999 0.0 - - - - - - - 218.75 18 4 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 35 5 C20140711_OR018_03 C20140711_OR018_03 TB432253.[MT7]-ATLWAEPGSVISRGNSVTIR.3b4_1.heavy 753.417 / 616.357 2499.0 36.98244857788086 41 16 10 5 10 2.7675838936757655 29.321771252950214 0.046600341796875 3 0.9635117355067845 6.441044327393031 2499.0 11.62868 1.0 - - - - - - - 625.0 4 7 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 37 5 C20140711_OR018_03 C20140711_OR018_03 TB432253.[MT7]-ATLWAEPGSVISRGNSVTIR.3y14_2.heavy 753.417 / 721.907 9370.0 36.98244857788086 41 16 10 5 10 2.7675838936757655 29.321771252950214 0.046600341796875 3 0.9635117355067845 6.441044327393031 9370.0 47.117714285714285 0.0 - - - - - - - 250.0 18 4 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 39 5 C20140711_OR018_03 C20140711_OR018_03 TB432253.[MT7]-ATLWAEPGSVISRGNSVTIR.3y16_2.heavy 753.417 / 821.947 9620.0 36.98244857788086 41 16 10 5 10 2.7675838936757655 29.321771252950214 0.046600341796875 3 0.9635117355067845 6.441044327393031 9620.0 23.4728 0.0 - - - - - - - 232.14285714285714 19 7 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 41 6 C20140711_OR018_03 C20140711_OR018_03 TB444125.[MT7]-QGADTLAYIALLEEK[MT7].2b8_1.heavy 962.037 / 964.486 4046.0 44.699798583984375 48 18 10 10 10 3.1821622137912167 31.4251736025928 0.0 3 0.9802495292913906 8.767105823269892 4046.0 30.630557357997194 0.0 - - - - - - - 232.8125 8 16 MTX3 metaxin 3 43 6 C20140711_OR018_03 C20140711_OR018_03 TB444125.[MT7]-QGADTLAYIALLEEK[MT7].2b4_1.heavy 962.037 / 516.253 6807.0 44.699798583984375 48 18 10 10 10 3.1821622137912167 31.4251736025928 0.0 3 0.9802495292913906 8.767105823269892 6807.0 50.8997421438665 0.0 - - - - - - - 222.53333333333333 13 15 MTX3 metaxin 3 45 6 C20140711_OR018_03 C20140711_OR018_03 TB444125.[MT7]-QGADTLAYIALLEEK[MT7].2b6_1.heavy 962.037 / 730.385 3339.0 44.699798583984375 48 18 10 10 10 3.1821622137912167 31.4251736025928 0.0 3 0.9802495292913906 8.767105823269892 3339.0 26.049060301203603 0.0 - - - - - - - 165.14285714285714 6 7 MTX3 metaxin 3 47 6 C20140711_OR018_03 C20140711_OR018_03 TB444125.[MT7]-QGADTLAYIALLEEK[MT7].2b7_1.heavy 962.037 / 801.422 4238.0 44.699798583984375 48 18 10 10 10 3.1821622137912167 31.4251736025928 0.0 3 0.9802495292913906 8.767105823269892 4238.0 44.96948808365759 0.0 - - - - - - - 151.14285714285714 8 14 MTX3 metaxin 3 49 7 C20140711_OR018_03 C20140711_OR018_03 TB422300.[MT7]-EVEAQIYR.2b3_1.heavy 576.313 / 502.263 1972.0 26.053199768066406 34 16 0 10 8 5.239592822271887 19.085452513586734 0.0 4 0.9600379161811907 6.152920678010004 1972.0 10.145337620578777 1.0 - - - - - - - 166.2 3 5 MTX3 metaxin 3 51 7 C20140711_OR018_03 C20140711_OR018_03 TB422300.[MT7]-EVEAQIYR.2y5_1.heavy 576.313 / 650.362 3218.0 26.053199768066406 34 16 0 10 8 5.239592822271887 19.085452513586734 0.0 4 0.9600379161811907 6.152920678010004 3218.0 14.999797001510865 0.0 - - - - - - - 225.16666666666666 6 6 MTX3 metaxin 3 53 7 C20140711_OR018_03 C20140711_OR018_03 TB422300.[MT7]-EVEAQIYR.2y6_1.heavy 576.313 / 779.405 3841.0 26.053199768066406 34 16 0 10 8 5.239592822271887 19.085452513586734 0.0 4 0.9600379161811907 6.152920678010004 3841.0 18.67123644484319 0.0 - - - - - - - 145.6 7 5 MTX3 metaxin 3 55 7 C20140711_OR018_03 C20140711_OR018_03 TB422300.[MT7]-EVEAQIYR.2y7_1.heavy 576.313 / 878.473 4879.0 26.053199768066406 34 16 0 10 8 5.239592822271887 19.085452513586734 0.0 4 0.9600379161811907 6.152920678010004 4879.0 36.35793269230769 1.0 - - - - - - - 130.0 40 4 MTX3 metaxin 3 57 8 C20140711_OR018_03 C20140711_OR018_03 TB443917.[MT7]-YFYLNK[MT7]PT.3b4_1.heavy 445.251 / 731.388 1274.0 34.214599609375 50 20 10 10 10 32.59919243736571 3.0675606517595333 0.0 3 0.998157072032185 28.743620416146253 1274.0 11.430004631773969 0.0 - - - - - - - 127.0 2 3 GLT6D1 glycosyltransferase 6 domain containing 1 59 8 C20140711_OR018_03 C20140711_OR018_03 TB443917.[MT7]-YFYLNK[MT7]PT.3b5_1.heavy 445.251 / 845.431 764.0 34.214599609375 50 20 10 10 10 32.59919243736571 3.0675606517595333 0.0 3 0.998157072032185 28.743620416146253 764.0 6.8125984251968505 0.0 - - - - - - - 0.0 1 0 GLT6D1 glycosyltransferase 6 domain containing 1 61 8 C20140711_OR018_03 C20140711_OR018_03 TB443917.[MT7]-YFYLNK[MT7]PT.3y4_1.heavy 445.251 / 603.358 2039.0 34.214599609375 50 20 10 10 10 32.59919243736571 3.0675606517595333 0.0 3 0.998157072032185 28.743620416146253 2039.0 3.0617610278556158 1.0 - - - - - - - 222.75 5 4 GLT6D1 glycosyltransferase 6 domain containing 1 63 8 C20140711_OR018_03 C20140711_OR018_03 TB443917.[MT7]-YFYLNK[MT7]PT.3b3_1.heavy 445.251 / 618.304 7008.0 34.214599609375 50 20 10 10 10 32.59919243736571 3.0675606517595333 0.0 3 0.998157072032185 28.743620416146253 7008.0 20.117514012935015 0.0 - - - - - - - 236.57142857142858 14 7 GLT6D1 glycosyltransferase 6 domain containing 1 65 9 C20140711_OR018_03 C20140711_OR018_03 TB443792.[MT7]-LTQLVNK[MT7].2y4_1.heavy 552.355 / 617.41 14034.0 29.649999618530273 42 18 6 10 8 5.824509805539158 17.168826792067403 0.0 4 0.9881051106438854 11.304483756609258 14034.0 38.85338888888889 0.0 - - - - - - - 248.4 28 10 MTX3 metaxin 3 67 9 C20140711_OR018_03 C20140711_OR018_03 TB443792.[MT7]-LTQLVNK[MT7].2b4_1.heavy 552.355 / 600.384 13495.0 29.649999618530273 42 18 6 10 8 5.824509805539158 17.168826792067403 0.0 4 0.9881051106438854 11.304483756609258 13495.0 32.76563786008231 0.0 - - - - - - - 256.5 26 8 MTX3 metaxin 3 69 9 C20140711_OR018_03 C20140711_OR018_03 TB443792.[MT7]-LTQLVNK[MT7].2y3_1.heavy 552.355 / 504.326 29688.0 29.649999618530273 42 18 6 10 8 5.824509805539158 17.168826792067403 0.0 4 0.9881051106438854 11.304483756609258 29688.0 126.4488888888889 0.0 - - - - - - - 270.0 59 14 MTX3 metaxin 3 71 9 C20140711_OR018_03 C20140711_OR018_03 TB443792.[MT7]-LTQLVNK[MT7].2y6_1.heavy 552.355 / 846.516 19648.0 29.649999618530273 42 18 6 10 8 5.824509805539158 17.168826792067403 0.0 4 0.9881051106438854 11.304483756609258 19648.0 136.44444444444446 1.0 - - - - - - - 194.4 85 10 MTX3 metaxin 3 73 10 C20140711_OR018_03 C20140711_OR018_03 TB422854.[MT7]-GAGVTLNVLEMTSEDLENALK[MT7].4b8_1.heavy 623.834 / 856.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 75 10 C20140711_OR018_03 C20140711_OR018_03 TB422854.[MT7]-GAGVTLNVLEMTSEDLENALK[MT7].4b7_1.heavy 623.834 / 757.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 77 10 C20140711_OR018_03 C20140711_OR018_03 TB422854.[MT7]-GAGVTLNVLEMTSEDLENALK[MT7].4b5_1.heavy 623.834 / 530.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 79 10 C20140711_OR018_03 C20140711_OR018_03 TB422854.[MT7]-GAGVTLNVLEMTSEDLENALK[MT7].4b6_1.heavy 623.834 / 643.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 81 11 C20140711_OR018_03 C20140711_OR018_03 TB444127.[MT7]-LSLPGQLGALTSQPLHR.3y7_1.heavy 644.71 / 838.453 11387.0 40.24729919433594 47 17 10 10 10 1.9752663331220368 36.13239354021286 0.0 3 0.9701991586773526 7.131216759867091 11387.0 48.82731105807478 0.0 - - - - - - - 178.66666666666666 22 18 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 83 11 C20140711_OR018_03 C20140711_OR018_03 TB444127.[MT7]-LSLPGQLGALTSQPLHR.3y6_1.heavy 644.71 / 737.405 9081.0 40.24729919433594 47 17 10 10 10 1.9752663331220368 36.13239354021286 0.0 3 0.9701991586773526 7.131216759867091 9081.0 25.418271840248412 0.0 - - - - - - - 149.78571428571428 18 14 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 85 11 C20140711_OR018_03 C20140711_OR018_03 TB444127.[MT7]-LSLPGQLGALTSQPLHR.3b6_1.heavy 644.71 / 740.442 13482.0 40.24729919433594 47 17 10 10 10 1.9752663331220368 36.13239354021286 0.0 3 0.9701991586773526 7.131216759867091 13482.0 73.42539975968205 0.0 - - - - - - - 234.23529411764707 26 17 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 87 11 C20140711_OR018_03 C20140711_OR018_03 TB444127.[MT7]-LSLPGQLGALTSQPLHR.3y4_1.heavy 644.71 / 522.315 15508.0 40.24729919433594 47 17 10 10 10 1.9752663331220368 36.13239354021286 0.0 3 0.9701991586773526 7.131216759867091 15508.0 34.76038674372428 0.0 - - - - - - - 256.0833333333333 31 12 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 89 12 C20140711_OR018_03 C20140711_OR018_03 TB443890.[MT7]-VQLQEHLK[MT7].3y3_1.heavy 428.262 / 541.358 8356.0 25.41699981689453 45 15 10 10 10 4.097969945177263 19.370524285917767 0.0 3 0.9516461518006626 5.589605284144407 8356.0 48.616727272727275 0.0 - - - - - - - 183.33333333333334 16 9 MTX3 metaxin 3 91 12 C20140711_OR018_03 C20140711_OR018_03 TB443890.[MT7]-VQLQEHLK[MT7].3b4_1.heavy 428.262 / 613.379 11764.0 25.41699981689453 45 15 10 10 10 4.097969945177263 19.370524285917767 0.0 3 0.9516461518006626 5.589605284144407 11764.0 152.8785272727273 0.0 - - - - - - - 220.0 23 3 MTX3 metaxin 3 93 12 C20140711_OR018_03 C20140711_OR018_03 TB443890.[MT7]-VQLQEHLK[MT7].3b5_1.heavy 428.262 / 742.422 3628.0 25.41699981689453 45 15 10 10 10 4.097969945177263 19.370524285917767 0.0 3 0.9516461518006626 5.589605284144407 3628.0 31.149402361155772 1.0 - - - - - - - 110.0 7 4 MTX3 metaxin 3 95 12 C20140711_OR018_03 C20140711_OR018_03 TB443890.[MT7]-VQLQEHLK[MT7].3b3_1.heavy 428.262 / 485.32 15392.0 25.41699981689453 45 15 10 10 10 4.097969945177263 19.370524285917767 0.0 3 0.9516461518006626 5.589605284144407 15392.0 90.95272727272729 0.0 - - - - - - - 198.0 30 5 MTX3 metaxin 3 97 13 C20140711_OR018_03 C20140711_OR018_03 TB443892.[MT7]-QELFAFNK[MT7].2y4_1.heavy 642.863 / 623.363 1981.0 35.7848014831543 47 17 10 10 10 10.769965979316005 9.285080397844576 0.0 3 0.9735674890124334 7.574114474999517 1981.0 -0.29220427146096994 10.0 - - - - - - - 316.25 6 8 LLGL1 lethal giant larvae homolog 1 (Drosophila) 99 13 C20140711_OR018_03 C20140711_OR018_03 TB443892.[MT7]-QELFAFNK[MT7].2b3_1.heavy 642.863 / 515.295 5613.0 35.7848014831543 47 17 10 10 10 10.769965979316005 9.285080397844576 0.0 3 0.9735674890124334 7.574114474999517 5613.0 23.100775324675322 0.0 - - - - - - - 209.0 11 10 LLGL1 lethal giant larvae homolog 1 (Drosophila) 101 13 C20140711_OR018_03 C20140711_OR018_03 TB443892.[MT7]-QELFAFNK[MT7].2y5_1.heavy 642.863 / 770.432 3742.0 35.7848014831543 47 17 10 10 10 10.769965979316005 9.285080397844576 0.0 3 0.9735674890124334 7.574114474999517 3742.0 7.142053009419637 0.0 - - - - - - - 261.25 7 8 LLGL1 lethal giant larvae homolog 1 (Drosophila) 103 13 C20140711_OR018_03 C20140711_OR018_03 TB443892.[MT7]-QELFAFNK[MT7].2y3_1.heavy 642.863 / 552.326 3742.0 35.7848014831543 47 17 10 10 10 10.769965979316005 9.285080397844576 0.0 3 0.9735674890124334 7.574114474999517 3742.0 11.624498701298702 0.0 - - - - - - - 220.0 7 5 LLGL1 lethal giant larvae homolog 1 (Drosophila) 105 14 C20140711_OR018_03 C20140711_OR018_03 TB422309.[MT7]-IAFYAGLK[MT7].2y4_1.heavy 585.86 / 532.357 26838.0 37.132301330566406 47 17 10 10 10 3.1644286056297317 25.753309033205817 0.0 3 0.9765054522168591 8.035720861949054 26838.0 30.8596757001472 0.0 - - - - - - - 282.3333333333333 53 6 C1QL3 complement component 1, q subcomponent-like 3 107 14 C20140711_OR018_03 C20140711_OR018_03 TB422309.[MT7]-IAFYAGLK[MT7].2y5_1.heavy 585.86 / 695.421 22799.0 37.132301330566406 47 17 10 10 10 3.1644286056297317 25.753309033205817 0.0 3 0.9765054522168591 8.035720861949054 22799.0 72.17055117298526 0.0 - - - - - - - 195.33333333333334 45 6 C1QL3 complement component 1, q subcomponent-like 3 109 14 C20140711_OR018_03 C20140711_OR018_03 TB422309.[MT7]-IAFYAGLK[MT7].2y6_1.heavy 585.86 / 842.489 19933.0 37.132301330566406 47 17 10 10 10 3.1644286056297317 25.753309033205817 0.0 3 0.9765054522168591 8.035720861949054 19933.0 123.70624772907664 0.0 - - - - - - - 204.71428571428572 39 7 C1QL3 complement component 1, q subcomponent-like 3 111 14 C20140711_OR018_03 C20140711_OR018_03 TB422309.[MT7]-IAFYAGLK[MT7].2y7_1.heavy 585.86 / 913.526 38043.0 37.132301330566406 47 17 10 10 10 3.1644286056297317 25.753309033205817 0.0 3 0.9765054522168591 8.035720861949054 38043.0 298.5524949272639 0.0 - - - - - - - 228.25 76 8 C1QL3 complement component 1, q subcomponent-like 3 113 15 C20140711_OR018_03 C20140711_OR018_03 TB422578.[MT7]-EVEAQIYRDAK[MT7].4b4_1.heavy 403.225 / 573.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 115 15 C20140711_OR018_03 C20140711_OR018_03 TB422578.[MT7]-EVEAQIYRDAK[MT7].4y6_2.heavy 403.225 / 455.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 117 15 C20140711_OR018_03 C20140711_OR018_03 TB422578.[MT7]-EVEAQIYRDAK[MT7].4y7_2.heavy 403.225 / 519.297 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 119 15 C20140711_OR018_03 C20140711_OR018_03 TB422578.[MT7]-EVEAQIYRDAK[MT7].4b3_1.heavy 403.225 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 121 16 C20140711_OR018_03 C20140711_OR018_03 TB432263.[MT7]-AGPRGPPGEPGPPGPMGPPGEK[MT7].4y4_1.heavy 581.807 / 574.332 67025.0 26.0757999420166 40 15 10 5 10 2.090352660042322 37.877351284438085 0.045200347900390625 3 0.9571751247680113 5.942266408021185 67025.0 132.80429502184876 0.0 - - - - - - - 246.33333333333334 134 3 C1QL3 complement component 1, q subcomponent-like 3 123 16 C20140711_OR018_03 C20140711_OR018_03 TB432263.[MT7]-AGPRGPPGEPGPPGPMGPPGEK[MT7].4b11_1.heavy 581.807 / 1117.59 7295.0 26.0757999420166 40 15 10 5 10 2.090352660042322 37.877351284438085 0.045200347900390625 3 0.9571751247680113 5.942266408021185 7295.0 22.68296633117049 0.0 - - - - - - - 185.0 14 4 C1QL3 complement component 1, q subcomponent-like 3 125 16 C20140711_OR018_03 C20140711_OR018_03 TB432263.[MT7]-AGPRGPPGEPGPPGPMGPPGEK[MT7].4b11_2.heavy 581.807 / 559.297 50427.0 26.0757999420166 40 15 10 5 10 2.090352660042322 37.877351284438085 0.045200347900390625 3 0.9571751247680113 5.942266408021185 50427.0 60.255675668506996 0.0 - - - - - - - 106.0 100 3 C1QL3 complement component 1, q subcomponent-like 3 127 16 C20140711_OR018_03 C20140711_OR018_03 TB432263.[MT7]-AGPRGPPGEPGPPGPMGPPGEK[MT7].4b9_1.heavy 581.807 / 963.513 27910.0 26.0757999420166 40 15 10 5 10 2.090352660042322 37.877351284438085 0.045200347900390625 3 0.9571751247680113 5.942266408021185 27910.0 349.1515915719302 0.0 - - - - - - - 221.8 55 10 C1QL3 complement component 1, q subcomponent-like 3 129 17 C20140711_OR018_03 C20140711_OR018_03 TB432261.[MT7]-LSLGGISPAGQETVDANLQK[MT7].4b7_1.heavy 572.319 / 772.469 4457.0 36.75657653808594 31 14 8 1 8 3.128604805319558 25.473268595542486 0.09529876708984375 4 0.9443568123930245 5.207409258390968 4457.0 46.038744457003745 0.0 - - - - - - - 227.0 8 6 MTX3 metaxin 3 131 17 C20140711_OR018_03 C20140711_OR018_03 TB432261.[MT7]-LSLGGISPAGQETVDANLQK[MT7].4y3_1.heavy 572.319 / 532.357 5200.0 36.75657653808594 31 14 8 1 8 3.128604805319558 25.473268595542486 0.09529876708984375 4 0.9443568123930245 5.207409258390968 5200.0 2.7402261712439415 1.0 - - - - - - - 206.55555555555554 10 9 MTX3 metaxin 3 133 17 C20140711_OR018_03 C20140711_OR018_03 TB432261.[MT7]-LSLGGISPAGQETVDANLQK[MT7].4b6_1.heavy 572.319 / 685.437 3095.0 36.75657653808594 31 14 8 1 8 3.128604805319558 25.473268595542486 0.09529876708984375 4 0.9443568123930245 5.207409258390968 3095.0 31.719646117728892 0.0 - - - - - - - 194.71428571428572 6 7 MTX3 metaxin 3 135 17 C20140711_OR018_03 C20140711_OR018_03 TB432261.[MT7]-LSLGGISPAGQETVDANLQK[MT7].4b4_1.heavy 572.319 / 515.331 5819.0 36.75657653808594 31 14 8 1 8 3.128604805319558 25.473268595542486 0.09529876708984375 4 0.9443568123930245 5.207409258390968 5819.0 10.552794606771721 1.0 - - - - - - - 729.2222222222222 16 9 MTX3 metaxin 3 137 18 C20140711_OR018_03 C20140711_OR018_03 TB443905.[MT7]-QGADPQREK[MT7].3b4_1.heavy 439.577 / 516.253 18452.0 14.328700065612793 50 20 10 10 10 1.024624163345143 53.58045367819814 0.0 3 0.9906843121250231 12.776655413288452 18452.0 443.83287912087906 0.0 - - - - - - - 138.83333333333334 36 12 LLGL1 lethal giant larvae homolog 1 (Drosophila) 139 18 C20140711_OR018_03 C20140711_OR018_03 TB443905.[MT7]-QGADPQREK[MT7].3y4_1.heavy 439.577 / 704.417 131.0 14.328700065612793 50 20 10 10 10 1.024624163345143 53.58045367819814 0.0 3 0.9906843121250231 12.776655413288452 131.0 2.2551742543171116 7.0 - - - - - - - 0.0 0 0 LLGL1 lethal giant larvae homolog 1 (Drosophila) 141 18 C20140711_OR018_03 C20140711_OR018_03 TB443905.[MT7]-QGADPQREK[MT7].3y8_2.heavy 439.577 / 522.781 2613.0 14.328700065612793 50 20 10 10 10 1.024624163345143 53.58045367819814 0.0 3 0.9906843121250231 12.776655413288452 2613.0 25.95224489795918 0.0 - - - - - - - 174.33333333333334 5 6 LLGL1 lethal giant larvae homolog 1 (Drosophila) 143 18 C20140711_OR018_03 C20140711_OR018_03 TB443905.[MT7]-QGADPQREK[MT7].3y5_1.heavy 439.577 / 801.47 686.0 14.328700065612793 50 20 10 10 10 1.024624163345143 53.58045367819814 0.0 3 0.9906843121250231 12.776655413288452 686.0 27.184149184149184 0.0 - - - - - - - 0.0 1 0 LLGL1 lethal giant larvae homolog 1 (Drosophila) 145 19 C20140711_OR018_03 C20140711_OR018_03 TB432260.[MT7]-LSLGGISPAGQETVDANLQK[MT7].2y5_1.heavy 1143.63 / 717.438 2705.0 36.81655025482178 38 13 10 5 10 2.008204993546841 39.525498666496524 0.048198699951171875 3 0.925857227533281 4.504093574985955 2705.0 2.7752456552450884 1.0 - - - - - - - 287.0 5 6 MTX3 metaxin 3 147 19 C20140711_OR018_03 C20140711_OR018_03 TB432260.[MT7]-LSLGGISPAGQETVDANLQK[MT7].2y9_1.heavy 1143.63 / 1161.62 1353.0 36.81655025482178 38 13 10 5 10 2.008204993546841 39.525498666496524 0.048198699951171875 3 0.925857227533281 4.504093574985955 1353.0 11.55 0.0 - - - - - - - 316.2857142857143 2 7 MTX3 metaxin 3 149 19 C20140711_OR018_03 C20140711_OR018_03 TB432260.[MT7]-LSLGGISPAGQETVDANLQK[MT7].2b4_1.heavy 1143.63 / 515.331 1476.0 36.81655025482178 38 13 10 5 10 2.008204993546841 39.525498666496524 0.048198699951171875 3 0.925857227533281 4.504093574985955 1476.0 9.4 0.0 - - - - - - - 246.0 2 1 MTX3 metaxin 3 151 19 C20140711_OR018_03 C20140711_OR018_03 TB432260.[MT7]-LSLGGISPAGQETVDANLQK[MT7].2b5_1.heavy 1143.63 / 572.352 2090.0 36.81655025482178 38 13 10 5 10 2.008204993546841 39.525498666496524 0.048198699951171875 3 0.925857227533281 4.504093574985955 2090.0 24.21341463414634 0.0 - - - - - - - 172.2 4 5 MTX3 metaxin 3 153 20 C20140711_OR018_03 C20140711_OR018_03 TB443904.[MT7]-NITEPLC[CAM]SLDINWPR.3y6_1.heavy 658.007 / 800.405 5302.0 44.5791015625 48 18 10 10 10 5.968338588050548 16.75508159007836 0.0 3 0.9897139222130606 12.158066039730642 5302.0 92.25783043581805 0.0 - - - - - - - 166.28571428571428 10 7 LLGL1 lethal giant larvae homolog 1 (Drosophila) 155 20 C20140711_OR018_03 C20140711_OR018_03 TB443904.[MT7]-NITEPLC[CAM]SLDINWPR.3b4_1.heavy 658.007 / 602.327 15454.0 44.5791015625 48 18 10 10 10 5.968338588050548 16.75508159007836 0.0 3 0.9897139222130606 12.158066039730642 15454.0 28.150161297462528 0.0 - - - - - - - 655.8571428571429 30 7 LLGL1 lethal giant larvae homolog 1 (Drosophila) 157 20 C20140711_OR018_03 C20140711_OR018_03 TB443904.[MT7]-NITEPLC[CAM]SLDINWPR.3y8_1.heavy 658.007 / 1000.52 3815.0 44.5791015625 48 18 10 10 10 5.968338588050548 16.75508159007836 0.0 3 0.9897139222130606 12.158066039730642 3815.0 1.2486410719705054 1.0 - - - - - - - 136.0 8 10 LLGL1 lethal giant larvae homolog 1 (Drosophila) 159 20 C20140711_OR018_03 C20140711_OR018_03 TB443904.[MT7]-NITEPLC[CAM]SLDINWPR.3y5_1.heavy 658.007 / 685.378 4074.0 44.5791015625 48 18 10 10 10 5.968338588050548 16.75508159007836 0.0 3 0.9897139222130606 12.158066039730642 4074.0 20.617058823529412 1.0 - - - - - - - 198.71428571428572 8 14 LLGL1 lethal giant larvae homolog 1 (Drosophila) 161 21 C20140711_OR018_03 C20140711_OR018_03 TB443786.[MT7]-AGAEPGPGER.2y9_1.heavy 542.779 / 869.411 1950.0 16.206249713897705 41 20 10 5 6 5.671235019098924 17.632843580495546 0.04260063171386719 5 0.9924669393624336 14.210312552711002 1950.0 60.0 0.0 - - - - - - - 325.0 3 2 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 163 21 C20140711_OR018_03 C20140711_OR018_03 TB443786.[MT7]-AGAEPGPGER.2b6_1.heavy 542.779 / 627.322 585.0 16.206249713897705 41 20 10 5 6 5.671235019098924 17.632843580495546 0.04260063171386719 5 0.9924669393624336 14.210312552711002 585.0 8.396999999999998 2.0 - - - - - - - 176.42857142857142 7 7 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 165 21 C20140711_OR018_03 C20140711_OR018_03 TB443786.[MT7]-AGAEPGPGER.2y6_1.heavy 542.779 / 612.31 3965.0 16.206249713897705 41 20 10 5 6 5.671235019098924 17.632843580495546 0.04260063171386719 5 0.9924669393624336 14.210312552711002 3965.0 69.53999999999999 0.0 - - - - - - - 178.75 7 8 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 167 21 C20140711_OR018_03 C20140711_OR018_03 TB443786.[MT7]-AGAEPGPGER.2y7_1.heavy 542.779 / 741.353 715.0 16.206249713897705 41 20 10 5 6 5.671235019098924 17.632843580495546 0.04260063171386719 5 0.9924669393624336 14.210312552711002 715.0 1.4177777777777778 5.0 - - - - - - - 179.7058823529412 2 17 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 169 22 C20140711_OR018_03 C20140711_OR018_03 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 83044.0 30.17889976501465 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 83044.0 556.6324386585878 0.0 - - - - - - - 225.85714285714286 166 7 171 22 C20140711_OR018_03 C20140711_OR018_03 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 29050.0 30.17889976501465 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 29050.0 528.4333333333334 0.0 - - - - - - - 210.63636363636363 58 11 173 22 C20140711_OR018_03 C20140711_OR018_03 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 37996.0 30.17889976501465 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 37996.0 156.13558194774347 0.0 - - - - - - - 671.125 75 8 175 23 C20140711_OR018_03 C20140711_OR018_03 TB432232.[MT7]-TDWLAPVLWEGTFDRR.4y9_2.heavy 527.278 / 590.299 2077.0 47.45389938354492 29 3 10 6 10 0.6389916553889832 80.81867998570897 0.0388031005859375 3 0.5349935997545405 1.7344091428097275 2077.0 24.444692307692307 0.0 - - - - - - - 162.5 4 4 GLT6D1 glycosyltransferase 6 domain containing 1 177 23 C20140711_OR018_03 C20140711_OR018_03 TB432232.[MT7]-TDWLAPVLWEGTFDRR.4y11_2.heavy 527.278 / 688.359 2921.0 47.45389938354492 29 3 10 6 10 0.6389916553889832 80.81867998570897 0.0388031005859375 3 0.5349935997545405 1.7344091428097275 2921.0 52.222189044888275 0.0 - - - - - - - 324.5 5 4 GLT6D1 glycosyltransferase 6 domain containing 1 179 23 C20140711_OR018_03 C20140711_OR018_03 TB432232.[MT7]-TDWLAPVLWEGTFDRR.4b4_1.heavy 527.278 / 660.347 1623.0 47.45389938354492 29 3 10 6 10 0.6389916553889832 80.81867998570897 0.0388031005859375 3 0.5349935997545405 1.7344091428097275 1623.0 9.11942218763895 0.0 - - - - - - - 205.83333333333334 3 6 GLT6D1 glycosyltransferase 6 domain containing 1 181 23 C20140711_OR018_03 C20140711_OR018_03 TB432232.[MT7]-TDWLAPVLWEGTFDRR.4b3_1.heavy 527.278 / 547.263 584.0 47.45389938354492 29 3 10 6 10 0.6389916553889832 80.81867998570897 0.0388031005859375 3 0.5349935997545405 1.7344091428097275 584.0 15.273846153846154 0.0 - - - - - - - 0.0 1 0 GLT6D1 glycosyltransferase 6 domain containing 1 183 24 C20140711_OR018_03 C20140711_OR018_03 TB422568.[MT7]-DITLEDFITIK[MT7].2y5_1.heavy 798.46 / 765.499 3387.0 46.427124977111816 44 18 10 6 10 4.004667269413682 24.970863563064718 0.037899017333984375 3 0.9805856091694469 8.842912772566537 3387.0 -3.8199248120300755 0.0 - - - - - - - 212.4 6 5 TGM6 transglutaminase 6 185 24 C20140711_OR018_03 C20140711_OR018_03 TB422568.[MT7]-DITLEDFITIK[MT7].2b6_1.heavy 798.46 / 831.422 4781.0 46.427124977111816 44 18 10 6 10 4.004667269413682 24.970863563064718 0.037899017333984375 3 0.9805856091694469 8.842912772566537 4781.0 -0.36219696969696713 0.0 - - - - - - - 79.4 9 5 TGM6 transglutaminase 6 187 24 C20140711_OR018_03 C20140711_OR018_03 TB422568.[MT7]-DITLEDFITIK[MT7].2y6_1.heavy 798.46 / 880.526 2058.0 46.427124977111816 44 18 10 6 10 4.004667269413682 24.970863563064718 0.037899017333984375 3 0.9805856091694469 8.842912772566537 2058.0 -0.7239195979899495 0.0 - - - - - - - 237.0 4 7 TGM6 transglutaminase 6 189 24 C20140711_OR018_03 C20140711_OR018_03 TB422568.[MT7]-DITLEDFITIK[MT7].2b5_1.heavy 798.46 / 716.395 1926.0 46.427124977111816 44 18 10 6 10 4.004667269413682 24.970863563064718 0.037899017333984375 3 0.9805856091694469 8.842912772566537 1926.0 -1.4481203007518797 0.0 - - - - - - - 165.83333333333334 3 6 TGM6 transglutaminase 6 191 25 C20140711_OR018_03 C20140711_OR018_03 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 26444.0 16.349000930786133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 26444.0 42.23182915506035 0.0 - - - - - - - 206.11111111111111 52 9 193 25 C20140711_OR018_03 C20140711_OR018_03 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 35657.0 16.349000930786133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 35657.0 320.9821027131783 0.0 - - - - - - - 215.6 71 5 195 25 C20140711_OR018_03 C20140711_OR018_03 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 21239.0 16.349000930786133 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 21239.0 190.342700477707 0.0 - - - - - - - 174.1818181818182 42 11 197 26 C20140711_OR018_03 C20140711_OR018_03 TB431990.[MT7]-AMAIADALGK[MT7].2y4_1.heavy 624.865 / 532.357 9849.0 35.437950134277344 41 18 10 5 8 4.4523430878334995 22.460084056249084 0.045501708984375 4 0.9880789848590441 11.292064964437015 9849.0 80.99617127809509 0.0 - - - - - - - 333.42857142857144 19 7 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 199 26 C20140711_OR018_03 C20140711_OR018_03 TB431990.[MT7]-AMAIADALGK[MT7].2y5_1.heavy 624.865 / 647.385 5184.0 35.437950134277344 41 18 10 5 8 4.4523430878334995 22.460084056249084 0.045501708984375 4 0.9880789848590441 11.292064964437015 5184.0 14.206236433430261 0.0 - - - - - - - 285.2 10 5 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 201 26 C20140711_OR018_03 C20140711_OR018_03 TB431990.[MT7]-AMAIADALGK[MT7].2y6_1.heavy 624.865 / 718.422 7646.0 35.437950134277344 41 18 10 5 8 4.4523430878334995 22.460084056249084 0.045501708984375 4 0.9880789848590441 11.292064964437015 7646.0 69.96598281101615 1.0 - - - - - - - 181.8 19 5 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 203 26 C20140711_OR018_03 C20140711_OR018_03 TB431990.[MT7]-AMAIADALGK[MT7].2y7_1.heavy 624.865 / 831.506 4017.0 35.437950134277344 41 18 10 5 8 4.4523430878334995 22.460084056249084 0.045501708984375 4 0.9880789848590441 11.292064964437015 4017.0 20.033779851279853 2.0 - - - - - - - 194.5 16 6 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 205 27 C20140711_OR018_03 C20140711_OR018_03 TB443776.[MT7]-QDLAGTYR.2b3_1.heavy 534.284 / 501.279 4166.0 22.186599731445312 46 16 10 10 10 3.537259939175979 28.270469719365735 0.0 3 0.9632295824971296 6.4161315606017855 4166.0 12.613642724473959 0.0 - - - - - - - 304.57142857142856 8 14 KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 207 27 C20140711_OR018_03 C20140711_OR018_03 TB443776.[MT7]-QDLAGTYR.2y5_1.heavy 534.284 / 567.289 4265.0 22.186599731445312 46 16 10 10 10 3.537259939175979 28.270469719365735 0.0 3 0.9632295824971296 6.4161315606017855 4265.0 41.63995416348358 0.0 - - - - - - - 253.44444444444446 8 9 KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 209 27 C20140711_OR018_03 C20140711_OR018_03 TB443776.[MT7]-QDLAGTYR.2y6_1.heavy 534.284 / 680.373 9622.0 22.186599731445312 46 16 10 10 10 3.537259939175979 28.270469719365735 0.0 3 0.9632295824971296 6.4161315606017855 9622.0 51.37943327414027 0.0 - - - - - - - 144.84615384615384 19 13 KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 211 27 C20140711_OR018_03 C20140711_OR018_03 TB443776.[MT7]-QDLAGTYR.2y7_1.heavy 534.284 / 795.399 6745.0 22.186599731445312 46 16 10 10 10 3.537259939175979 28.270469719365735 0.0 3 0.9632295824971296 6.4161315606017855 6745.0 51.02989627821843 0.0 - - - - - - - 226.71428571428572 13 7 KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 213 28 C20140711_OR018_03 C20140711_OR018_03 TB422462.[MT7]-GQEPQAPSSSK[MT7].2y8_1.heavy 702.372 / 945.512 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 215 28 C20140711_OR018_03 C20140711_OR018_03 TB422462.[MT7]-GQEPQAPSSSK[MT7].2y5_1.heavy 702.372 / 649.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 217 28 C20140711_OR018_03 C20140711_OR018_03 TB422462.[MT7]-GQEPQAPSSSK[MT7].2y6_1.heavy 702.372 / 720.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 219 28 C20140711_OR018_03 C20140711_OR018_03 TB422462.[MT7]-GQEPQAPSSSK[MT7].2b5_1.heavy 702.372 / 684.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 221 29 C20140711_OR018_03 C20140711_OR018_03 TB444007.[MT7]-VLEPPMLGHDLR.3y7_1.heavy 507.617 / 841.435 1028.0 35.51882362365723 37 18 8 5 6 3.4230827890050675 23.338295645924866 0.04650115966796875 5 0.9844357632059237 9.879467849118388 1028.0 2.461785547032258 1.0 - - - - - - - 209.33333333333334 2 6 TGM6 transglutaminase 6 223 29 C20140711_OR018_03 C20140711_OR018_03 TB444007.[MT7]-VLEPPMLGHDLR.3y6_1.heavy 507.617 / 710.394 4453.0 35.51882362365723 37 18 8 5 6 3.4230827890050675 23.338295645924866 0.04650115966796875 5 0.9844357632059237 9.879467849118388 4453.0 36.325053000276526 0.0 - - - - - - - 274.2 8 5 TGM6 transglutaminase 6 225 29 C20140711_OR018_03 C20140711_OR018_03 TB444007.[MT7]-VLEPPMLGHDLR.3b4_1.heavy 507.617 / 583.357 3882.0 35.51882362365723 37 18 8 5 6 3.4230827890050675 23.338295645924866 0.04650115966796875 5 0.9844357632059237 9.879467849118388 3882.0 16.013408922744752 2.0 - - - - - - - 314.25 13 8 TGM6 transglutaminase 6 227 29 C20140711_OR018_03 C20140711_OR018_03 TB444007.[MT7]-VLEPPMLGHDLR.3y5_1.heavy 507.617 / 597.31 4910.0 35.51882362365723 37 18 8 5 6 3.4230827890050675 23.338295645924866 0.04650115966796875 5 0.9844357632059237 9.879467849118388 4910.0 13.112827988338193 1.0 - - - - - - - 277.42857142857144 9 7 TGM6 transglutaminase 6 229 30 C20140711_OR018_03 C20140711_OR018_03 TB444009.[MT7]-AQLAEVVESMFR.2y8_1.heavy 762.404 / 996.482 1559.0 50.778499603271484 46 16 10 10 10 16.918267569542618 5.910770685529682 0.0 3 0.9692047601974926 7.0145483234593335 1559.0 38.20647887323943 0.0 - - - - - - - 118.85714285714286 3 14 DUOX2;DUOX1 dual oxidase 2;dual oxidase 1 231 30 C20140711_OR018_03 C20140711_OR018_03 TB444009.[MT7]-AQLAEVVESMFR.2b4_1.heavy 762.404 / 528.326 1488.0 50.778499603271484 46 16 10 10 10 16.918267569542618 5.910770685529682 0.0 3 0.9692047601974926 7.0145483234593335 1488.0 25.568450704225352 0.0 - - - - - - - 119.3157894736842 2 19 DUOX2;DUOX1 dual oxidase 2;dual oxidase 1 233 30 C20140711_OR018_03 C20140711_OR018_03 TB444009.[MT7]-AQLAEVVESMFR.2y10_1.heavy 762.404 / 1180.6 957.0 50.778499603271484 46 16 10 10 10 16.918267569542618 5.910770685529682 0.0 3 0.9692047601974926 7.0145483234593335 957.0 29.480852300242134 0.0 - - - - - - - 0.0 1 0 DUOX2;DUOX1 dual oxidase 2;dual oxidase 1 235 30 C20140711_OR018_03 C20140711_OR018_03 TB444009.[MT7]-AQLAEVVESMFR.2b5_1.heavy 762.404 / 657.369 1382.0 50.778499603271484 46 16 10 10 10 16.918267569542618 5.910770685529682 0.0 3 0.9692047601974926 7.0145483234593335 1382.0 18.915379373012268 0.0 - - - - - - - 133.83333333333334 2 18 DUOX2;DUOX1 dual oxidase 2;dual oxidase 1 237 31 C20140711_OR018_03 C20140711_OR018_03 TB431995.[MT7]-VDITDLYK[MT7].3y3_1.heavy 418.911 / 567.362 517.0 35.58857536315918 25 14 2 5 4 3.415893121459696 29.274920626693238 0.04650115966796875 7 0.9458915497660595 5.281433934400146 517.0 2.6382989690721645 9.0 - - - - - - - 237.16666666666666 11 6 TGM6 transglutaminase 6 239 31 C20140711_OR018_03 C20140711_OR018_03 TB431995.[MT7]-VDITDLYK[MT7].3b4_1.heavy 418.911 / 573.336 517.0 35.58857536315918 25 14 2 5 4 3.415893121459696 29.274920626693238 0.04650115966796875 7 0.9458915497660595 5.281433934400146 517.0 -0.3999999999999999 3.0 - - - - - - - 0.0 1 0 TGM6 transglutaminase 6 241 31 C20140711_OR018_03 C20140711_OR018_03 TB431995.[MT7]-VDITDLYK[MT7].3b5_1.heavy 418.911 / 688.363 2069.0 35.58857536315918 25 14 2 5 4 3.415893121459696 29.274920626693238 0.04650115966796875 7 0.9458915497660595 5.281433934400146 2069.0 16.55001684578795 0.0 - - - - - - - 129.0 4 2 TGM6 transglutaminase 6 243 31 C20140711_OR018_03 C20140711_OR018_03 TB431995.[MT7]-VDITDLYK[MT7].3b3_1.heavy 418.911 / 472.289 2069.0 35.58857536315918 25 14 2 5 4 3.415893121459696 29.274920626693238 0.04650115966796875 7 0.9458915497660595 5.281433934400146 2069.0 12.787849679576482 0.0 - - - - - - - 280.3333333333333 4 6 TGM6 transglutaminase 6 245 32 C20140711_OR018_03 C20140711_OR018_03 TB432239.[MT7]-TFQADFPLDPATHGGTYR.3y6_1.heavy 713.352 / 690.332 6412.0 36.61249923706055 47 17 10 10 10 2.6478765229553387 37.766111498427556 0.0 3 0.9714112979884716 7.281569937089515 6412.0 22.329836055210862 0.0 - - - - - - - 151.0 12 5 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 247 32 C20140711_OR018_03 C20140711_OR018_03 TB432239.[MT7]-TFQADFPLDPATHGGTYR.3b5_1.heavy 713.352 / 707.348 17351.0 36.61249923706055 47 17 10 10 10 2.6478765229553387 37.766111498427556 0.0 3 0.9714112979884716 7.281569937089515 17351.0 29.680696236791338 0.0 - - - - - - - 314.25 34 4 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 249 32 C20140711_OR018_03 C20140711_OR018_03 TB432239.[MT7]-TFQADFPLDPATHGGTYR.3b3_1.heavy 713.352 / 521.284 6286.0 36.61249923706055 47 17 10 10 10 2.6478765229553387 37.766111498427556 0.0 3 0.9714112979884716 7.281569937089515 6286.0 1.9768420855920155 1.0 - - - - - - - 298.375 12 8 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 251 32 C20140711_OR018_03 C20140711_OR018_03 TB432239.[MT7]-TFQADFPLDPATHGGTYR.3y9_1.heavy 713.352 / 959.469 13705.0 36.61249923706055 47 17 10 10 10 2.6478765229553387 37.766111498427556 0.0 3 0.9714112979884716 7.281569937089515 13705.0 20.844575164335314 0.0 - - - - - - - 276.6 27 5 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 253 33 C20140711_OR018_03 C20140711_OR018_03 TB422562.[MT7]-QWNFVATMSTPR.3y7_1.heavy 527.937 / 763.377 3150.0 39.04444885253906 27 14 4 3 6 1.8443144715845592 43.29892395162331 0.07550048828125 6 0.9347146635480577 4.803557476755894 3150.0 5.639899053053986 1.0 - - - - - - - 314.8 6 5 KLHL5 kelch-like 5 (Drosophila) 255 33 C20140711_OR018_03 C20140711_OR018_03 TB422562.[MT7]-QWNFVATMSTPR.3y6_1.heavy 527.937 / 692.34 1575.0 39.04444885253906 27 14 4 3 6 1.8443144715845592 43.29892395162331 0.07550048828125 6 0.9347146635480577 4.803557476755894 1575.0 16.270661157024794 0.0 - - - - - - - 262.1666666666667 3 6 KLHL5 kelch-like 5 (Drosophila) 257 33 C20140711_OR018_03 C20140711_OR018_03 TB422562.[MT7]-QWNFVATMSTPR.3b4_1.heavy 527.937 / 720.359 2666.0 39.04444885253906 27 14 4 3 6 1.8443144715845592 43.29892395162331 0.07550048828125 6 0.9347146635480577 4.803557476755894 2666.0 26.87010905682883 1.0 - - - - - - - 272.5 5 4 KLHL5 kelch-like 5 (Drosophila) 259 33 C20140711_OR018_03 C20140711_OR018_03 TB422562.[MT7]-QWNFVATMSTPR.3b3_1.heavy 527.937 / 573.29 2787.0 39.04444885253906 27 14 4 3 6 1.8443144715845592 43.29892395162331 0.07550048828125 6 0.9347146635480577 4.803557476755894 2787.0 21.240893744245 4.0 - - - - - - - 217.9 10 10 KLHL5 kelch-like 5 (Drosophila) 261 34 C20140711_OR018_03 C20140711_OR018_03 TB431859.[MT7]-GDVESR.2y4_1.heavy 403.71 / 490.262 558.0 13.64900016784668 42 16 10 6 10 2.565844720007239 38.97351980041796 0.03639984130859375 3 0.963307260320108 6.4229615288045 558.0 10.407640449438201 0.0 - - - - - - - 0.0 1 0 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 263 34 C20140711_OR018_03 C20140711_OR018_03 TB431859.[MT7]-GDVESR.2b3_1.heavy 403.71 / 416.226 1295.0 13.64900016784668 42 16 10 6 10 2.565844720007239 38.97351980041796 0.03639984130859375 3 0.963307260320108 6.4229615288045 1295.0 13.788712686567164 1.0 - - - - - - - 108.8125 2 16 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 265 34 C20140711_OR018_03 C20140711_OR018_03 TB431859.[MT7]-GDVESR.2y5_1.heavy 403.71 / 605.289 156.0 13.64900016784668 42 16 10 6 10 2.565844720007239 38.97351980041796 0.03639984130859375 3 0.963307260320108 6.4229615288045 156.0 11.487272727272726 3.0 - - - - - - - 0.0 0 0 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 267 34 C20140711_OR018_03 C20140711_OR018_03 TB431859.[MT7]-GDVESR.2b4_1.heavy 403.71 / 545.269 1250.0 13.64900016784668 42 16 10 6 10 2.565844720007239 38.97351980041796 0.03639984130859375 3 0.963307260320108 6.4229615288045 1250.0 21.922165856112695 0.0 - - - - - - - 73.0 2 15 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 269 35 C20140711_OR018_03 C20140711_OR018_03 TB444108.[MT7]-GLYEEISMPLLADVR.3y7_1.heavy 617.333 / 783.472 7691.0 48.42067527770996 43 17 10 6 10 3.405153794655932 23.373772043101997 0.03929901123046875 3 0.9762642439073886 7.994624056875035 7691.0 34.74711451474377 0.0 - - - - - - - 179.9 15 10 ITIH5L inter-alpha (globulin) inhibitor H5-like 271 35 C20140711_OR018_03 C20140711_OR018_03 TB444108.[MT7]-GLYEEISMPLLADVR.3b4_1.heavy 617.333 / 607.321 4445.0 48.42067527770996 43 17 10 6 10 3.405153794655932 23.373772043101997 0.03929901123046875 3 0.9762642439073886 7.994624056875035 4445.0 24.41045833333333 0.0 - - - - - - - 236.36363636363637 8 11 ITIH5L inter-alpha (globulin) inhibitor H5-like 273 35 C20140711_OR018_03 C20140711_OR018_03 TB444108.[MT7]-GLYEEISMPLLADVR.3b5_1.heavy 617.333 / 736.363 5594.0 48.42067527770996 43 17 10 6 10 3.405153794655932 23.373772043101997 0.03929901123046875 3 0.9762642439073886 7.994624056875035 5594.0 27.346908714524208 0.0 - - - - - - - 207.0 11 7 ITIH5L inter-alpha (globulin) inhibitor H5-like 275 35 C20140711_OR018_03 C20140711_OR018_03 TB444108.[MT7]-GLYEEISMPLLADVR.3y5_1.heavy 617.333 / 573.336 3196.0 48.42067527770996 43 17 10 6 10 3.405153794655932 23.373772043101997 0.03929901123046875 3 0.9762642439073886 7.994624056875035 3196.0 4.982628062360801 1.0 - - - - - - - 203.0625 6 16 ITIH5L inter-alpha (globulin) inhibitor H5-like 277 36 C20140711_OR018_03 C20140711_OR018_03 TB422840.[MT7]-TVNREDSDEQDHQEVSY[MT7]A.4b8_1.heavy 603.28 / 1061.5 1099.0 20.082849502563477 39 17 10 6 6 3.903447329492296 25.618380769340767 0.03459930419921875 5 0.978089659648138 8.322266934165926 1099.0 2.800730253353204 5.0 - - - - - - - 263.85 3 20 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 279 36 C20140711_OR018_03 C20140711_OR018_03 TB422840.[MT7]-TVNREDSDEQDHQEVSY[MT7]A.4b8_2.heavy 603.28 / 531.253 1319.0 20.082849502563477 39 17 10 6 6 3.903447329492296 25.618380769340767 0.03459930419921875 5 0.978089659648138 8.322266934165926 1319.0 4.053679771797098 0.0 - - - - - - - 203.0 2 13 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 281 36 C20140711_OR018_03 C20140711_OR018_03 TB422840.[MT7]-TVNREDSDEQDHQEVSY[MT7]A.4b11_2.heavy 603.28 / 717.317 2492.0 20.082849502563477 39 17 10 6 6 3.903447329492296 25.618380769340767 0.03459930419921875 5 0.978089659648138 8.322266934165926 2492.0 23.982995670995674 0.0 - - - - - - - 128.16666666666666 4 12 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 283 36 C20140711_OR018_03 C20140711_OR018_03 TB422840.[MT7]-TVNREDSDEQDHQEVSY[MT7]A.4b6_1.heavy 603.28 / 859.439 366.0 20.082849502563477 39 17 10 6 6 3.903447329492296 25.618380769340767 0.03459930419921875 5 0.978089659648138 8.322266934165926 366.0 1.7428571428571429 1.0 - - - - - - - 0.0 0 0 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 285 37 C20140711_OR018_03 C20140711_OR018_03 TB422458.[MT7]-DAEAWFNEK[MT7].2y4_1.heavy 699.351 / 681.369 12219.0 34.53229904174805 48 18 10 10 10 3.240180995666185 30.862473464831822 0.0 3 0.9824213800025157 9.29462193037608 12219.0 -1.7234132581100141 0.0 - - - - - - - 327.0 24 2 KRT25;KRT28;KRT27;KRT10 keratin 25;keratin 28;keratin 27;keratin 10 287 37 C20140711_OR018_03 C20140711_OR018_03 TB422458.[MT7]-DAEAWFNEK[MT7].2y5_1.heavy 699.351 / 867.448 5782.0 34.53229904174805 48 18 10 10 10 3.240180995666185 30.862473464831822 0.0 3 0.9824213800025157 9.29462193037608 5782.0 -10.609174311926601 0.0 - - - - - - - 109.0 11 1 KRT25;KRT28;KRT27;KRT10 keratin 25;keratin 28;keratin 27;keratin 10 289 37 C20140711_OR018_03 C20140711_OR018_03 TB422458.[MT7]-DAEAWFNEK[MT7].2b4_1.heavy 699.351 / 531.253 14837.0 34.53229904174805 48 18 10 10 10 3.240180995666185 30.862473464831822 0.0 3 0.9824213800025157 9.29462193037608 14837.0 -9.52834862385322 0.0 - - - - - - - 218.0 29 5 KRT25;KRT28;KRT27;KRT10 keratin 25;keratin 28;keratin 27;keratin 10 291 37 C20140711_OR018_03 C20140711_OR018_03 TB422458.[MT7]-DAEAWFNEK[MT7].2b5_1.heavy 699.351 / 717.332 4691.0 34.53229904174805 48 18 10 10 10 3.240180995666185 30.862473464831822 0.0 3 0.9824213800025157 9.29462193037608 4691.0 -1.0759174311926607 0.0 - - - - - - - 239.8 9 5 KRT25;KRT28;KRT27;KRT10 keratin 25;keratin 28;keratin 27;keratin 10 293 38 C20140711_OR018_03 C20140711_OR018_03 TB422459.[MT7]-DAEAWFNEK[MT7].3b4_1.heavy 466.569 / 531.253 N/A 29.47369956970215 22 10 0 10 2 1.2595731438074014 67.27826239030883 0.0 12 0.8463850558739346 3.1075818310349126 217.0 0.1335384615384615 31.0 - - - - - - - 238.4 12 10 KRT25;KRT28;KRT27;KRT10 keratin 25;keratin 28;keratin 27;keratin 10 295 38 C20140711_OR018_03 C20140711_OR018_03 TB422459.[MT7]-DAEAWFNEK[MT7].3b5_1.heavy 466.569 / 717.332 1302.0 29.47369956970215 22 10 0 10 2 1.2595731438074014 67.27826239030883 0.0 12 0.8463850558739346 3.1075818310349126 1302.0 9.600000000000001 0.0 - - - - - - - 216.83333333333334 5 6 KRT25;KRT28;KRT27;KRT10 keratin 25;keratin 28;keratin 27;keratin 10 297 38 C20140711_OR018_03 C20140711_OR018_03 TB422459.[MT7]-DAEAWFNEK[MT7].3b3_1.heavy 466.569 / 460.216 1519.0 29.47369956970215 22 10 0 10 2 1.2595731438074014 67.27826239030883 0.0 12 0.8463850558739346 3.1075818310349126 1519.0 1.4000000000000001 7.0 - - - - - - - 283.61538461538464 19 13 KRT25;KRT28;KRT27;KRT10 keratin 25;keratin 28;keratin 27;keratin 10 299 38 C20140711_OR018_03 C20140711_OR018_03 TB422459.[MT7]-DAEAWFNEK[MT7].3y4_1.heavy 466.569 / 681.369 542.0 29.47369956970215 22 10 0 10 2 1.2595731438074014 67.27826239030883 0.0 12 0.8463850558739346 3.1075818310349126 542.0 2.2978801843317975 4.0 - - - - - - - 184.1 5 10 KRT25;KRT28;KRT27;KRT10 keratin 25;keratin 28;keratin 27;keratin 10 301 39 C20140711_OR018_03 C20140711_OR018_03 TB431980.[MT7]-EGTFNHTLR.2y4_1.heavy 609.821 / 526.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 303 39 C20140711_OR018_03 C20140711_OR018_03 TB431980.[MT7]-EGTFNHTLR.2y8_1.heavy 609.821 / 945.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 305 39 C20140711_OR018_03 C20140711_OR018_03 TB431980.[MT7]-EGTFNHTLR.2y6_1.heavy 609.821 / 787.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 307 39 C20140711_OR018_03 C20140711_OR018_03 TB431980.[MT7]-EGTFNHTLR.2b5_1.heavy 609.821 / 693.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 309 40 C20140711_OR018_03 C20140711_OR018_03 TB422703.[MT7]-FDRFILTEEGDHK[MT7].4b3_2.heavy 474.503 / 282.156 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 311 40 C20140711_OR018_03 C20140711_OR018_03 TB422703.[MT7]-FDRFILTEEGDHK[MT7].4b4_1.heavy 474.503 / 710.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 313 40 C20140711_OR018_03 C20140711_OR018_03 TB422703.[MT7]-FDRFILTEEGDHK[MT7].4b5_1.heavy 474.503 / 823.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 315 40 C20140711_OR018_03 C20140711_OR018_03 TB422703.[MT7]-FDRFILTEEGDHK[MT7].4b3_1.heavy 474.503 / 563.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 317 41 C20140711_OR018_03 C20140711_OR018_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 159727.0 19.250999450683594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 159727.0 1285.1064439834026 0.0 - - - - - - - 180.75 319 12 319 41 C20140711_OR018_03 C20140711_OR018_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 97540.0 19.250999450683594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 97540.0 490.03886195886815 0.0 - - - - - - - 216.8 195 10 321 41 C20140711_OR018_03 C20140711_OR018_03 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 98022.0 19.250999450683594 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 98022.0 1330.4989557692309 0.0 - - - - - - - 235.28571428571428 196 14 323 42 C20140711_OR018_03 C20140711_OR018_03 TB443768.[MT7]-DATQASYR.2y5_1.heavy 528.266 / 624.31 621.0 16.91207456588745 35 20 4 5 6 8.386250951322596 11.924279464142316 0.04070091247558594 5 0.995036648698567 17.510359751479594 621.0 9.629999999999999 3.0 - - - - - - - 149.5 6 6 LLGL1 lethal giant larvae homolog 1 (Drosophila) 325 42 C20140711_OR018_03 C20140711_OR018_03 TB443768.[MT7]-DATQASYR.2b4_1.heavy 528.266 / 560.28 552.0 16.91207456588745 35 20 4 5 6 8.386250951322596 11.924279464142316 0.04070091247558594 5 0.995036648698567 17.510359751479594 552.0 3.9999999999999996 1.0 - - - - - - - 0.0 1 0 LLGL1 lethal giant larvae homolog 1 (Drosophila) 327 42 C20140711_OR018_03 C20140711_OR018_03 TB443768.[MT7]-DATQASYR.2y6_1.heavy 528.266 / 725.358 689.0 16.91207456588745 35 20 4 5 6 8.386250951322596 11.924279464142316 0.04070091247558594 5 0.995036648698567 17.510359751479594 689.0 13.979710144927537 0.0 - - - - - - - 0.0 1 0 LLGL1 lethal giant larvae homolog 1 (Drosophila) 329 42 C20140711_OR018_03 C20140711_OR018_03 TB443768.[MT7]-DATQASYR.2y7_1.heavy 528.266 / 796.395 1999.0 16.91207456588745 35 20 4 5 6 8.386250951322596 11.924279464142316 0.04070091247558594 5 0.995036648698567 17.510359751479594 1999.0 27.232753623188405 0.0 - - - - - - - 172.5 3 2 LLGL1 lethal giant larvae homolog 1 (Drosophila) 331 43 C20140711_OR018_03 C20140711_OR018_03 TB432102.[MT7]-LLLQAGYDPELR.2y4_1.heavy 766.434 / 514.298 8184.0 39.06319999694824 41 15 10 6 10 2.495491361955555 34.648834065229366 0.037998199462890625 3 0.9594240552980783 6.105883441230968 8184.0 28.72024844720497 0.0 - - - - - - - 303.6 16 10 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 333 43 C20140711_OR018_03 C20140711_OR018_03 TB432102.[MT7]-LLLQAGYDPELR.2y8_1.heavy 766.434 / 920.447 1747.0 39.06319999694824 41 15 10 6 10 2.495491361955555 34.648834065229366 0.037998199462890625 3 0.9594240552980783 6.105883441230968 1747.0 15.191304347826087 0.0 - - - - - - - 174.8 3 10 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 335 43 C20140711_OR018_03 C20140711_OR018_03 TB432102.[MT7]-LLLQAGYDPELR.2y9_1.heavy 766.434 / 1048.51 3494.0 39.06319999694824 41 15 10 6 10 2.495491361955555 34.648834065229366 0.037998199462890625 3 0.9594240552980783 6.105883441230968 3494.0 30.00282608695652 0.0 - - - - - - - 176.92307692307693 6 13 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 337 43 C20140711_OR018_03 C20140711_OR018_03 TB432102.[MT7]-LLLQAGYDPELR.2b4_1.heavy 766.434 / 612.42 2575.0 39.06319999694824 41 15 10 6 10 2.495491361955555 34.648834065229366 0.037998199462890625 3 0.9594240552980783 6.105883441230968 2575.0 37.78532608695652 1.0 - - - - - - - 138.0 5 10 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 339 44 C20140711_OR018_03 C20140711_OR018_03 TB432100.[MT7]-ATLWAEPGSVISR.3y7_1.heavy 510.951 / 715.41 10479.0 37.36130142211914 47 17 10 10 10 3.1070781759002357 32.184578030781694 0.0 3 0.97973008157758 8.653664127956791 10479.0 72.59365217391304 0.0 - - - - - - - 213.57142857142858 20 7 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 341 44 C20140711_OR018_03 C20140711_OR018_03 TB432100.[MT7]-ATLWAEPGSVISR.3y6_1.heavy 510.951 / 618.357 6103.0 37.36130142211914 47 17 10 10 10 3.1070781759002357 32.184578030781694 0.0 3 0.97973008157758 8.653664127956791 6103.0 17.371668117829927 1.0 - - - - - - - 184.0 13 5 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 343 44 C20140711_OR018_03 C20140711_OR018_03 TB432100.[MT7]-ATLWAEPGSVISR.3b4_1.heavy 510.951 / 616.357 4030.0 37.36130142211914 47 17 10 10 10 3.1070781759002357 32.184578030781694 0.0 3 0.97973008157758 8.653664127956791 4030.0 18.222608695652173 0.0 - - - - - - - 241.5 8 10 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 345 44 C20140711_OR018_03 C20140711_OR018_03 TB432100.[MT7]-ATLWAEPGSVISR.3b5_1.heavy 510.951 / 687.395 5412.0 37.36130142211914 47 17 10 10 10 3.1070781759002357 32.184578030781694 0.0 3 0.97973008157758 8.653664127956791 5412.0 39.13895652173913 0.0 - - - - - - - 268.3333333333333 10 3 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 347 45 C20140711_OR018_03 C20140711_OR018_03 TB422451.[MT7]-YGGGTSPLHWR.2b8_1.heavy 687.855 / 877.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 349 45 C20140711_OR018_03 C20140711_OR018_03 TB422451.[MT7]-YGGGTSPLHWR.2y5_1.heavy 687.855 / 708.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 351 45 C20140711_OR018_03 C20140711_OR018_03 TB422451.[MT7]-YGGGTSPLHWR.2b6_1.heavy 687.855 / 667.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 353 45 C20140711_OR018_03 C20140711_OR018_03 TB422451.[MT7]-YGGGTSPLHWR.2y10_1.heavy 687.855 / 1067.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 355 46 C20140711_OR018_03 C20140711_OR018_03 TB431987.[MT7]-VTMQNLNDR.2y8_1.heavy 617.82 / 991.463 89920.0 26.269899368286133 48 18 10 10 10 6.057449490812966 16.508598239517315 0.0 3 0.9857316470130062 10.319477352517499 89920.0 296.51237255410507 0.0 - - - - - - - 263.1111111111111 179 9 KRT25;KRT28;KRT27;KRT26;KRT10;KRT14;KRT16 keratin 25;keratin 28;keratin 27;keratin 26;keratin 10;keratin 14;keratin 16 357 46 C20140711_OR018_03 C20140711_OR018_03 TB431987.[MT7]-VTMQNLNDR.2y5_1.heavy 617.82 / 631.316 9465.0 26.269899368286133 48 18 10 10 10 6.057449490812966 16.508598239517315 0.0 3 0.9857316470130062 10.319477352517499 9465.0 153.36805555555554 0.0 - - - - - - - 108.0 18 5 KRT25;KRT28;KRT27;KRT26;KRT10;KRT14;KRT16 keratin 25;keratin 28;keratin 27;keratin 26;keratin 10;keratin 14;keratin 16 359 46 C20140711_OR018_03 C20140711_OR018_03 TB431987.[MT7]-VTMQNLNDR.2b5_1.heavy 617.82 / 718.367 3980.0 26.269899368286133 48 18 10 10 10 6.057449490812966 16.508598239517315 0.0 3 0.9857316470130062 10.319477352517499 3980.0 7.219620944287676 1.0 - - - - - - - 273.0769230769231 8 13 KRT25;KRT28;KRT27;KRT26;KRT10;KRT14;KRT16 keratin 25;keratin 28;keratin 27;keratin 26;keratin 10;keratin 14;keratin 16 361 46 C20140711_OR018_03 C20140711_OR018_03 TB431987.[MT7]-VTMQNLNDR.2y7_1.heavy 617.82 / 890.415 18285.0 26.269899368286133 48 18 10 10 10 6.057449490812966 16.508598239517315 0.0 3 0.9857316470130062 10.319477352517499 18285.0 139.30697595219237 0.0 - - - - - - - 197.5 36 6 KRT25;KRT28;KRT27;KRT26;KRT10;KRT14;KRT16 keratin 25;keratin 28;keratin 27;keratin 26;keratin 10;keratin 14;keratin 16 363 47 C20140711_OR018_03 C20140711_OR018_03 TB422453.[MT7]-LALC[CAM]LANLTSR.3y6_1.heavy 459.266 / 661.363 549.0 41.43022441864014 36 13 10 3 10 1.1819010743581282 55.93518858556752 0.062099456787109375 3 0.9242756059633008 4.456203837746694 549.0 1.2065934065934063 1.0 - - - - - - - 0.0 1 0 TGM6 transglutaminase 6 365 47 C20140711_OR018_03 C20140711_OR018_03 TB422453.[MT7]-LALC[CAM]LANLTSR.3b4_1.heavy 459.266 / 602.345 549.0 41.43022441864014 36 13 10 3 10 1.1819010743581282 55.93518858556752 0.062099456787109375 3 0.9242756059633008 4.456203837746694 549.0 3.6197802197802194 1.0 - - - - - - - 0.0 1 0 TGM6 transglutaminase 6 367 47 C20140711_OR018_03 C20140711_OR018_03 TB422453.[MT7]-LALC[CAM]LANLTSR.3b5_1.heavy 459.266 / 715.429 731.0 41.43022441864014 36 13 10 3 10 1.1819010743581282 55.93518858556752 0.062099456787109375 3 0.9242756059633008 4.456203837746694 731.0 7.872307692307692 0.0 - - - - - - - 0.0 1 0 TGM6 transglutaminase 6 369 47 C20140711_OR018_03 C20140711_OR018_03 TB422453.[MT7]-LALC[CAM]LANLTSR.3y5_1.heavy 459.266 / 590.326 1006.0 41.43022441864014 36 13 10 3 10 1.1819010743581282 55.93518858556752 0.062099456787109375 3 0.9242756059633008 4.456203837746694 1006.0 12.099123881582898 0.0 - - - - - - - 156.57142857142858 2 7 TGM6 transglutaminase 6 371 48 C20140711_OR018_03 C20140711_OR018_03 TB422456.[MT7]-K[MT7]RPDVITK[MT7].3y6_1.heavy 463.637 / 816.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLT6D1 glycosyltransferase 6 domain containing 1 373 48 C20140711_OR018_03 C20140711_OR018_03 TB422456.[MT7]-K[MT7]RPDVITK[MT7].3y3_1.heavy 463.637 / 505.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLT6D1 glycosyltransferase 6 domain containing 1 375 48 C20140711_OR018_03 C20140711_OR018_03 TB422456.[MT7]-K[MT7]RPDVITK[MT7].3b4_1.heavy 463.637 / 785.487 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLT6D1 glycosyltransferase 6 domain containing 1 377 48 C20140711_OR018_03 C20140711_OR018_03 TB422456.[MT7]-K[MT7]RPDVITK[MT7].3y4_1.heavy 463.637 / 604.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLT6D1 glycosyltransferase 6 domain containing 1 379 49 C20140711_OR018_03 C20140711_OR018_03 TB422554.[MT7]-FC[CAM]DDILSSYFR.2b3_1.heavy 783.873 / 567.235 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 381 49 C20140711_OR018_03 C20140711_OR018_03 TB422554.[MT7]-FC[CAM]DDILSSYFR.2y8_1.heavy 783.873 / 1000.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 383 49 C20140711_OR018_03 C20140711_OR018_03 TB422554.[MT7]-FC[CAM]DDILSSYFR.2b4_1.heavy 783.873 / 682.262 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 385 49 C20140711_OR018_03 C20140711_OR018_03 TB422554.[MT7]-FC[CAM]DDILSSYFR.2y7_1.heavy 783.873 / 885.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 387 50 C20140711_OR018_03 C20140711_OR018_03 TB422599.[MT7]-RLQFGVAVLDDK[MT7].4b7_1.heavy 412.996 / 916.549 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 389 50 C20140711_OR018_03 C20140711_OR018_03 TB422599.[MT7]-RLQFGVAVLDDK[MT7].4b5_1.heavy 412.996 / 746.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 391 50 C20140711_OR018_03 C20140711_OR018_03 TB422599.[MT7]-RLQFGVAVLDDK[MT7].4y3_1.heavy 412.996 / 521.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 393 50 C20140711_OR018_03 C20140711_OR018_03 TB422599.[MT7]-RLQFGVAVLDDK[MT7].4b6_1.heavy 412.996 / 845.511 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 395 51 C20140711_OR018_03 C20140711_OR018_03 TB422598.[MT7]-RLQFGVAVLDDK[MT7].3y3_1.heavy 550.326 / 521.269 14618.0 36.216400146484375 39 9 10 10 10 1.72973560040836 46.076185946030485 0.0 3 0.8045381278213605 2.7446644186751707 14618.0 45.43955026455026 0.0 - - - - - - - 252.0 29 5 KLHL5 kelch-like 5 (Drosophila) 397 51 C20140711_OR018_03 C20140711_OR018_03 TB422598.[MT7]-RLQFGVAVLDDK[MT7].3b5_1.heavy 550.326 / 746.443 1890.0 36.216400146484375 39 9 10 10 10 1.72973560040836 46.076185946030485 0.0 3 0.8045381278213605 2.7446644186751707 1890.0 8.299999999999999 3.0 - - - - - - - 162.0 4 7 KLHL5 kelch-like 5 (Drosophila) 399 51 C20140711_OR018_03 C20140711_OR018_03 TB422598.[MT7]-RLQFGVAVLDDK[MT7].3y4_1.heavy 550.326 / 634.353 10586.0 36.216400146484375 39 9 10 10 10 1.72973560040836 46.076185946030485 0.0 3 0.8045381278213605 2.7446644186751707 10586.0 40.4676455026455 0.0 - - - - - - - 270.0 21 7 KLHL5 kelch-like 5 (Drosophila) 401 51 C20140711_OR018_03 C20140711_OR018_03 TB422598.[MT7]-RLQFGVAVLDDK[MT7].3b7_1.heavy 550.326 / 916.549 4663.0 36.216400146484375 39 9 10 10 10 1.72973560040836 46.076185946030485 0.0 3 0.8045381278213605 2.7446644186751707 4663.0 34.787460317460315 0.0 - - - - - - - 252.0 9 6 KLHL5 kelch-like 5 (Drosophila) 403 52 C20140711_OR018_03 C20140711_OR018_03 TB432115.[MT7]-TVEHGFPNQPSALAFDPELR.3b6_1.heavy 790.405 / 815.417 15933.0 37.83209991455078 48 18 10 10 10 4.898357052567604 20.41500832357297 0.0 3 0.9885187900060882 11.506735845809327 15933.0 266.9117948717949 0.0 - - - - - - - 117.0 31 5 LLGL1 lethal giant larvae homolog 1 (Drosophila) 405 52 C20140711_OR018_03 C20140711_OR018_03 TB432115.[MT7]-TVEHGFPNQPSALAFDPELR.3y11_1.heavy 790.405 / 1215.64 7498.0 37.83209991455078 48 18 10 10 10 4.898357052567604 20.41500832357297 0.0 3 0.9885187900060882 11.506735845809327 7498.0 83.65290028490028 0.0 - - - - - - - 200.57142857142858 14 7 LLGL1 lethal giant larvae homolog 1 (Drosophila) 407 52 C20140711_OR018_03 C20140711_OR018_03 TB432115.[MT7]-TVEHGFPNQPSALAFDPELR.3b5_1.heavy 790.405 / 668.348 13004.0 37.83209991455078 48 18 10 10 10 4.898357052567604 20.41500832357297 0.0 3 0.9885187900060882 11.506735845809327 13004.0 113.53021600417529 0.0 - - - - - - - 267.85714285714283 26 7 LLGL1 lethal giant larvae homolog 1 (Drosophila) 409 52 C20140711_OR018_03 C20140711_OR018_03 TB432115.[MT7]-TVEHGFPNQPSALAFDPELR.3y4_1.heavy 790.405 / 514.298 42058.0 37.83209991455078 48 18 10 10 10 4.898357052567604 20.41500832357297 0.0 3 0.9885187900060882 11.506735845809327 42058.0 22.3575506634589 1.0 - - - - - - - 351.3333333333333 117 6 LLGL1 lethal giant larvae homolog 1 (Drosophila) 411 53 C20140711_OR018_03 C20140711_OR018_03 TB422715.[MT7]-QGADTLAYIALLEEK[MT7].3b6_1.heavy 641.694 / 730.385 18476.0 44.699798583984375 45 15 10 10 10 1.9412651239659553 40.78677897181873 0.0 3 0.9575584117783142 5.969231887765123 18476.0 0.0 0.0 - - - - - - - 167.16666666666666 36 6 MTX3 metaxin 3 413 53 C20140711_OR018_03 C20140711_OR018_03 TB422715.[MT7]-QGADTLAYIALLEEK[MT7].3b5_1.heavy 641.694 / 617.301 14680.0 44.699798583984375 45 15 10 10 10 1.9412651239659553 40.78677897181873 0.0 3 0.9575584117783142 5.969231887765123 14680.0 -3.0797202797202843 0.0 - - - - - - - 286.4 29 5 MTX3 metaxin 3 415 53 C20140711_OR018_03 C20140711_OR018_03 TB422715.[MT7]-QGADTLAYIALLEEK[MT7].3b8_1.heavy 641.694 / 964.486 39458.0 44.699798583984375 45 15 10 10 10 1.9412651239659553 40.78677897181873 0.0 3 0.9575584117783142 5.969231887765123 39458.0 -11.037202797202795 0.0 - - - - - - - 229.0 78 5 MTX3 metaxin 3 417 53 C20140711_OR018_03 C20140711_OR018_03 TB422715.[MT7]-QGADTLAYIALLEEK[MT7].3b7_1.heavy 641.694 / 801.422 48911.0 44.699798583984375 45 15 10 10 10 1.9412651239659553 40.78677897181873 0.0 3 0.9575584117783142 5.969231887765123 48911.0 -3.4203496503496638 0.0 - - - - - - - 170.0 97 8 MTX3 metaxin 3 419 54 C20140711_OR018_03 C20140711_OR018_03 TB422406.[MT7]-STVGVAVLSGK[MT7].3b6_1.heavy 435.938 / 659.385 4058.0 30.717400550842285 43 17 10 6 10 2.3754027059377987 33.704136195647145 0.03560066223144531 3 0.9754599018803555 7.861982333369374 4058.0 74.13653846153846 0.0 - - - - - - - 104.0 8 1 KLHL5 kelch-like 5 (Drosophila) 421 54 C20140711_OR018_03 C20140711_OR018_03 TB422406.[MT7]-STVGVAVLSGK[MT7].3b5_1.heavy 435.938 / 588.347 4994.0 30.717400550842285 43 17 10 6 10 2.3754027059377987 33.704136195647145 0.03560066223144531 3 0.9754599018803555 7.861982333369374 4994.0 25.77032051282051 0.0 - - - - - - - 267.42857142857144 9 7 KLHL5 kelch-like 5 (Drosophila) 423 54 C20140711_OR018_03 C20140711_OR018_03 TB422406.[MT7]-STVGVAVLSGK[MT7].3y4_1.heavy 435.938 / 548.352 4266.0 30.717400550842285 43 17 10 6 10 2.3754027059377987 33.704136195647145 0.03560066223144531 3 0.9754599018803555 7.861982333369374 4266.0 59.88807692307692 1.0 - - - - - - - 190.66666666666666 8 6 KLHL5 kelch-like 5 (Drosophila) 425 54 C20140711_OR018_03 C20140711_OR018_03 TB422406.[MT7]-STVGVAVLSGK[MT7].3b7_1.heavy 435.938 / 758.453 1040.0 30.717400550842285 43 17 10 6 10 2.3754027059377987 33.704136195647145 0.03560066223144531 3 0.9754599018803555 7.861982333369374 1040.0 11.933333333333334 0.0 - - - - - - - 260.0 2 4 KLHL5 kelch-like 5 (Drosophila) 427 55 C20140711_OR018_03 C20140711_OR018_03 TB422711.[MT7]-AADPGPGAELDPAAPPPAR.3y6_1.heavy 638.666 / 608.352 3628.0 28.41307544708252 40 18 10 6 6 5.446453462370489 18.360571827318335 0.039699554443359375 5 0.9882290525725834 11.363960948830272 3628.0 4.063168188067341 1.0 - - - - - - - 755.625 7 8 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 429 55 C20140711_OR018_03 C20140711_OR018_03 TB422711.[MT7]-AADPGPGAELDPAAPPPAR.3b5_1.heavy 638.666 / 556.285 6266.0 28.41307544708252 40 18 10 6 6 5.446453462370489 18.360571827318335 0.039699554443359375 5 0.9882290525725834 11.363960948830272 6266.0 6.067589516875978 1.0 - - - - - - - 330.0 14 4 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 431 55 C20140711_OR018_03 C20140711_OR018_03 TB422711.[MT7]-AADPGPGAELDPAAPPPAR.3y8_1.heavy 638.666 / 776.441 7145.0 28.41307544708252 40 18 10 6 6 5.446453462370489 18.360571827318335 0.039699554443359375 5 0.9882290525725834 11.363960948830272 7145.0 4.257617098681219 0.0 - - - - - - - 256.6666666666667 14 6 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 433 55 C20140711_OR018_03 C20140711_OR018_03 TB422711.[MT7]-AADPGPGAELDPAAPPPAR.3y5_1.heavy 638.666 / 537.314 10333.0 28.41307544708252 40 18 10 6 6 5.446453462370489 18.360571827318335 0.039699554443359375 5 0.9882290525725834 11.363960948830272 10333.0 1.84083852947901 1.0 - - - - - - - 261.25 21 8 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 435 56 C20140711_OR018_03 C20140711_OR018_03 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 124919.0 38.127201080322266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 124919.0 485.6354351915494 0.0 - - - - - - - 259.0 249 11 437 56 C20140711_OR018_03 C20140711_OR018_03 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 72613.0 38.127201080322266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 72613.0 433.57576489805115 0.0 - - - - - - - 177.1 145 10 439 56 C20140711_OR018_03 C20140711_OR018_03 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 138072.0 38.127201080322266 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 138072.0 1225.6131428571427 0.0 - - - - - - - 224.0 276 11 441 57 C20140711_OR018_03 C20140711_OR018_03 TB422710.[MT7]-FWDASGVALRPLYK[MT7].4y9_2.heavy 478.524 / 580.867 1624.0 40.347999572753906 41 11 10 10 10 1.2010442286895535 68.58929030922793 0.0 3 0.8575906766327659 3.230718292474804 1624.0 5.987096774193549 1.0 - - - - - - - 361.0 3 3 LLGL1 lethal giant larvae homolog 1 (Drosophila) 443 57 C20140711_OR018_03 C20140711_OR018_03 TB422710.[MT7]-FWDASGVALRPLYK[MT7].4y3_1.heavy 478.524 / 567.362 217.0 40.347999572753906 41 11 10 10 10 1.2010442286895535 68.58929030922793 0.0 3 0.8575906766327659 3.230718292474804 217.0 0.7055555555555555 20.0 - - - - - - - 0.0 1 0 LLGL1 lethal giant larvae homolog 1 (Drosophila) 445 57 C20140711_OR018_03 C20140711_OR018_03 TB422710.[MT7]-FWDASGVALRPLYK[MT7].4y7_2.heavy 478.524 / 502.822 3465.0 40.347999572753906 41 11 10 10 10 1.2010442286895535 68.58929030922793 0.0 3 0.8575906766327659 3.230718292474804 3465.0 15.921403017112873 0.0 - - - - - - - 289.0 6 3 LLGL1 lethal giant larvae homolog 1 (Drosophila) 447 57 C20140711_OR018_03 C20140711_OR018_03 TB422710.[MT7]-FWDASGVALRPLYK[MT7].4b3_1.heavy 478.524 / 593.284 1732.0 40.347999572753906 41 11 10 10 10 1.2010442286895535 68.58929030922793 0.0 3 0.8575906766327659 3.230718292474804 1732.0 12.291612903225804 0.0 - - - - - - - 244.0 3 4 LLGL1 lethal giant larvae homolog 1 (Drosophila) 449 58 C20140711_OR018_03 C20140711_OR018_03 TB422342.[MT7]-EGMFNDTLR.2y8_1.heavy 613.801 / 953.451 6008.0 31.91515064239502 40 18 10 6 6 4.035646017385946 24.779180227698493 0.038600921630859375 5 0.988151997643483 11.326874167113976 6008.0 23.146763285024157 0.0 - - - - - - - 272.0 12 8 KIR2DL1;KIR2DS1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 451 58 C20140711_OR018_03 C20140711_OR018_03 TB422342.[MT7]-EGMFNDTLR.2b6_1.heavy 613.801 / 838.352 2589.0 31.91515064239502 40 18 10 6 6 4.035646017385946 24.779180227698493 0.038600921630859375 5 0.988151997643483 11.326874167113976 2589.0 0.0 2.0 - - - - - - - 138.44444444444446 8 9 KIR2DL1;KIR2DS1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 453 58 C20140711_OR018_03 C20140711_OR018_03 TB422342.[MT7]-EGMFNDTLR.2y6_1.heavy 613.801 / 765.389 2382.0 31.91515064239502 40 18 10 6 6 4.035646017385946 24.779180227698493 0.038600921630859375 5 0.988151997643483 11.326874167113976 2382.0 9.371628141258297 0.0 - - - - - - - 230.22222222222223 4 9 KIR2DL1;KIR2DS1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 455 58 C20140711_OR018_03 C20140711_OR018_03 TB422342.[MT7]-EGMFNDTLR.2b5_1.heavy 613.801 / 723.325 1450.0 31.91515064239502 40 18 10 6 6 4.035646017385946 24.779180227698493 0.038600921630859375 5 0.988151997643483 11.326874167113976 1450.0 2.217538991298129 1.0 - - - - - - - 310.61538461538464 2 13 KIR2DL1;KIR2DS1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 457 59 C20140711_OR018_03 C20140711_OR018_03 TB443953.[MT7]-FLDPC[CAM]SLQLPLASIGYR.3y7_1.heavy 698.711 / 779.441 593.0 49.04732608795166 38 16 10 2 10 3.261341968393579 23.0987939617292 0.08340072631835938 3 0.9659542231685926 6.6694623342414445 593.0 2.8666811258916525 4.0 - - - - - - - 155.06666666666666 3 15 KLHL5 kelch-like 5 (Drosophila) 459 59 C20140711_OR018_03 C20140711_OR018_03 TB443953.[MT7]-FLDPC[CAM]SLQLPLASIGYR.3y8_1.heavy 698.711 / 876.494 4239.0 49.04732608795166 38 16 10 2 10 3.261341968393579 23.0987939617292 0.08340072631835938 3 0.9659542231685926 6.6694623342414445 4239.0 110.37243707093822 0.0 - - - - - - - 128.63636363636363 8 11 KLHL5 kelch-like 5 (Drosophila) 461 59 C20140711_OR018_03 C20140711_OR018_03 TB443953.[MT7]-FLDPC[CAM]SLQLPLASIGYR.3y6_1.heavy 698.711 / 666.357 1094.0 49.04732608795166 38 16 10 2 10 3.261341968393579 23.0987939617292 0.08340072631835938 3 0.9659542231685926 6.6694623342414445 1094.0 9.54467493796526 1.0 - - - - - - - 152.06666666666666 2 15 KLHL5 kelch-like 5 (Drosophila) 463 59 C20140711_OR018_03 C20140711_OR018_03 TB443953.[MT7]-FLDPC[CAM]SLQLPLASIGYR.3b3_1.heavy 698.711 / 520.289 3008.0 49.04732608795166 38 16 10 2 10 3.261341968393579 23.0987939617292 0.08340072631835938 3 0.9659542231685926 6.6694623342414445 3008.0 21.14356660882977 0.0 - - - - - - - 198.9090909090909 6 11 KLHL5 kelch-like 5 (Drosophila) 465 60 C20140711_OR018_03 C20140711_OR018_03 TB422346.[MT7]-RGVDVEAAK[MT7].3y3_1.heavy 411.578 / 433.289 6404.0 19.625 39 13 10 6 10 2.0216962726242413 37.69847289065768 0.033599853515625 3 0.9152497233807139 4.208969617314426 6404.0 43.34585152838427 0.0 - - - - - - - 719.0 12 7 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 467 60 C20140711_OR018_03 C20140711_OR018_03 TB422346.[MT7]-RGVDVEAAK[MT7].3b4_1.heavy 411.578 / 572.327 4346.0 19.625 39 13 10 6 10 2.0216962726242413 37.69847289065768 0.033599853515625 3 0.9152497233807139 4.208969617314426 4346.0 8.625459317585301 2.0 - - - - - - - 216.92307692307693 8 13 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 469 60 C20140711_OR018_03 C20140711_OR018_03 TB422346.[MT7]-RGVDVEAAK[MT7].3b5_1.heavy 411.578 / 671.396 457.0 19.625 39 13 10 6 10 2.0216962726242413 37.69847289065768 0.033599853515625 3 0.9152497233807139 4.208969617314426 457.0 3.6545032751091706 2.0 - - - - - - - 0.0 0 0 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 471 60 C20140711_OR018_03 C20140711_OR018_03 TB422346.[MT7]-RGVDVEAAK[MT7].3y4_1.heavy 411.578 / 562.332 1601.0 19.625 39 13 10 6 10 2.0216962726242413 37.69847289065768 0.033599853515625 3 0.9152497233807139 4.208969617314426 1601.0 29.808092105263153 0.0 - - - - - - - 222.69230769230768 3 13 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 473 61 C20140711_OR018_03 C20140711_OR018_03 TB443958.[MT7]-SSYDMYHLSR.3b4_1.heavy 468.223 / 597.264 18040.0 27.224074363708496 43 18 10 5 10 5.411964271988671 18.477579483955864 0.042499542236328125 3 0.9882872682537325 11.392222544748963 18040.0 100.03999999999999 0.0 - - - - - - - 233.75 36 8 KIR2DS2;LOC100287457;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL1;KIR3DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 475 61 C20140711_OR018_03 C20140711_OR018_03 TB443958.[MT7]-SSYDMYHLSR.3b5_1.heavy 468.223 / 728.304 1980.0 27.224074363708496 43 18 10 5 10 5.411964271988671 18.477579483955864 0.042499542236328125 3 0.9882872682537325 11.392222544748963 1980.0 26.46 0.0 - - - - - - - 178.75 3 8 KIR2DS2;LOC100287457;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL1;KIR3DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 477 61 C20140711_OR018_03 C20140711_OR018_03 TB443958.[MT7]-SSYDMYHLSR.3y4_1.heavy 468.223 / 512.294 4840.0 27.224074363708496 43 18 10 5 10 5.411964271988671 18.477579483955864 0.042499542236328125 3 0.9882872682537325 11.392222544748963 4840.0 41.06666666666667 0.0 - - - - - - - 251.42857142857142 9 7 KIR2DS2;LOC100287457;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL1;KIR3DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 479 61 C20140711_OR018_03 C20140711_OR018_03 TB443958.[MT7]-SSYDMYHLSR.3y5_1.heavy 468.223 / 675.357 1760.0 27.224074363708496 43 18 10 5 10 5.411964271988671 18.477579483955864 0.042499542236328125 3 0.9882872682537325 11.392222544748963 1760.0 4.241066666666667 0.0 - - - - - - - 235.71428571428572 3 7 KIR2DS2;LOC100287457;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL1;KIR3DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 481 62 C20140711_OR018_03 C20140711_OR018_03 TB422540.[MT7]-ATLWAEPGSVISR.2y8_1.heavy 765.923 / 844.452 13684.0 37.36130142211914 50 20 10 10 10 16.63988397629478 6.00965728742221 0.0 3 0.9952407967891194 17.882278466062342 13684.0 60.54557544757033 0.0 - - - - - - - 234.4 27 5 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 483 62 C20140711_OR018_03 C20140711_OR018_03 TB422540.[MT7]-ATLWAEPGSVISR.2y9_1.heavy 765.923 / 915.489 22155.0 37.36130142211914 50 20 10 10 10 16.63988397629478 6.00965728742221 0.0 3 0.9952407967891194 17.882278466062342 22155.0 198.71069250442653 0.0 - - - - - - - 279.2857142857143 44 7 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 485 62 C20140711_OR018_03 C20140711_OR018_03 TB422540.[MT7]-ATLWAEPGSVISR.2y10_1.heavy 765.923 / 1101.57 26977.0 37.36130142211914 50 20 10 10 10 16.63988397629478 6.00965728742221 0.0 3 0.9952407967891194 17.882278466062342 26977.0 247.36949091982873 0.0 - - - - - - - 204.71428571428572 53 7 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 487 62 C20140711_OR018_03 C20140711_OR018_03 TB422540.[MT7]-ATLWAEPGSVISR.2y7_1.heavy 765.923 / 715.41 35318.0 37.36130142211914 50 20 10 10 10 16.63988397629478 6.00965728742221 0.0 3 0.9952407967891194 17.882278466062342 35318.0 219.1431873866988 0.0 - - - - - - - 304.1666666666667 70 6 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 489 63 C20140711_OR018_03 C20140711_OR018_03 TB422810.[MT7]-FLDPC[CAM]SLQLPLASIGYRR.4y10_2.heavy 563.31 / 573.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 491 63 C20140711_OR018_03 C20140711_OR018_03 TB422810.[MT7]-FLDPC[CAM]SLQLPLASIGYRR.4y9_2.heavy 563.31 / 516.801 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 493 63 C20140711_OR018_03 C20140711_OR018_03 TB422810.[MT7]-FLDPC[CAM]SLQLPLASIGYRR.4y11_2.heavy 563.31 / 637.372 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 495 63 C20140711_OR018_03 C20140711_OR018_03 TB422810.[MT7]-FLDPC[CAM]SLQLPLASIGYRR.4b3_1.heavy 563.31 / 520.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 497 64 C20140711_OR018_03 C20140711_OR018_03 TB422812.[MT7]-ATLWAEPGSVISRGNSVTIR.4b4_1.heavy 565.315 / 616.357 3486.0 36.97079849243164 43 18 10 5 10 8.511043651015914 11.749440385970008 0.046600341796875 3 0.9872409220320544 10.91414888011569 3486.0 14.252065116279068 2.0 - - - - - - - 161.25 6 4 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 499 64 C20140711_OR018_03 C20140711_OR018_03 TB422812.[MT7]-ATLWAEPGSVISRGNSVTIR.4b5_1.heavy 565.315 / 687.395 5036.0 36.97079849243164 43 18 10 5 10 8.511043651015914 11.749440385970008 0.046600341796875 3 0.9872409220320544 10.91414888011569 5036.0 18.145215503875967 0.0 - - - - - - - 232.2 10 5 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 501 64 C20140711_OR018_03 C20140711_OR018_03 TB422812.[MT7]-ATLWAEPGSVISRGNSVTIR.4y13_2.heavy 565.315 / 673.381 5423.0 36.97079849243164 43 18 10 5 10 8.511043651015914 11.749440385970008 0.046600341796875 3 0.9872409220320544 10.91414888011569 5423.0 16.706846094389036 0.0 - - - - - - - 258.0 10 5 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 503 64 C20140711_OR018_03 C20140711_OR018_03 TB422812.[MT7]-ATLWAEPGSVISRGNSVTIR.4y14_2.heavy 565.315 / 721.907 12396.0 36.97079849243164 43 18 10 5 10 8.511043651015914 11.749440385970008 0.046600341796875 3 0.9872409220320544 10.91414888011569 12396.0 39.42474492637328 0.0 - - - - - - - 193.5 24 6 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 505 65 C20140711_OR018_03 C20140711_OR018_03 TB422916.[MT7]-YLLSHGANIAAVNSDGDLPLDLAESDAMEGLLK[MT7].4b8_1.heavy 925.98 / 1000.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 507 65 C20140711_OR018_03 C20140711_OR018_03 TB422916.[MT7]-YLLSHGANIAAVNSDGDLPLDLAESDAMEGLLK[MT7].4b8_2.heavy 925.98 / 500.77 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 509 65 C20140711_OR018_03 C20140711_OR018_03 TB422916.[MT7]-YLLSHGANIAAVNSDGDLPLDLAESDAMEGLLK[MT7].4b11_2.heavy 925.98 / 628.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 511 65 C20140711_OR018_03 C20140711_OR018_03 TB422916.[MT7]-YLLSHGANIAAVNSDGDLPLDLAESDAMEGLLK[MT7].4y3_1.heavy 925.98 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 513 66 C20140711_OR018_03 C20140711_OR018_03 TB422815.[MT7]-LVLSSVSDYFAAMFTNDVR.3y7_1.heavy 760.388 / 882.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 515 66 C20140711_OR018_03 C20140711_OR018_03 TB422815.[MT7]-LVLSSVSDYFAAMFTNDVR.3y6_1.heavy 760.388 / 751.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 517 66 C20140711_OR018_03 C20140711_OR018_03 TB422815.[MT7]-LVLSSVSDYFAAMFTNDVR.3y8_1.heavy 760.388 / 953.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 519 66 C20140711_OR018_03 C20140711_OR018_03 TB422815.[MT7]-LVLSSVSDYFAAMFTNDVR.3b8_1.heavy 760.388 / 945.537 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 521 67 C20140711_OR018_03 C20140711_OR018_03 TB422816.[MT7]-LSLGGISPAGQETVDANLQK[MT7].3y6_1.heavy 762.756 / 832.464 9662.0 36.804500579833984 48 18 10 10 10 4.5908957971181215 21.782241292162148 0.0 3 0.9897489455068308 12.178853361724288 9662.0 31.21272461341007 0.0 - - - - - - - 257.6 19 5 MTX3 metaxin 3 523 67 C20140711_OR018_03 C20140711_OR018_03 TB422816.[MT7]-LSLGGISPAGQETVDANLQK[MT7].3b6_1.heavy 762.756 / 685.437 9533.0 36.804500579833984 48 18 10 10 10 4.5908957971181215 21.782241292162148 0.0 3 0.9897489455068308 12.178853361724288 9533.0 73.64484470294022 1.0 - - - - - - - 312.7142857142857 21 7 MTX3 metaxin 3 525 67 C20140711_OR018_03 C20140711_OR018_03 TB422816.[MT7]-LSLGGISPAGQETVDANLQK[MT7].3b5_1.heavy 762.756 / 572.352 15202.0 36.804500579833984 48 18 10 10 10 4.5908957971181215 21.782241292162148 0.0 3 0.9897489455068308 12.178853361724288 15202.0 72.49751887842595 0.0 - - - - - - - 209.5 30 8 MTX3 metaxin 3 527 67 C20140711_OR018_03 C20140711_OR018_03 TB422816.[MT7]-LSLGGISPAGQETVDANLQK[MT7].3b7_1.heavy 762.756 / 772.469 12496.0 36.804500579833984 48 18 10 10 10 4.5908957971181215 21.782241292162148 0.0 3 0.9897489455068308 12.178853361724288 12496.0 76.12185564525846 0.0 - - - - - - - 184.14285714285714 24 7 MTX3 metaxin 3 529 68 C20140711_OR018_03 C20140711_OR018_03 TB422912.[MT7]-GEPGRQGLPGPPGAPGLNAAGAISAATYSTVPK[MT7].4b16_2.heavy 837.704 / 785.416 7382.0 37.36130142211914 44 14 10 10 10 4.3507915264230395 22.984323517383977 0.0 3 0.9351608478511404 4.820240363900173 7382.0 -1.4250965250965244 0.0 - - - - - - - 302.6666666666667 14 3 C1QL3 complement component 1, q subcomponent-like 3 531 68 C20140711_OR018_03 C20140711_OR018_03 TB422912.[MT7]-GEPGRQGLPGPPGAPGLNAAGAISAATYSTVPK[MT7].4b10_1.heavy 837.704 / 1093.59 2979.0 37.36130142211914 44 14 10 10 10 4.3507915264230395 22.984323517383977 0.0 3 0.9351608478511404 4.820240363900173 2979.0 22.791052395017335 1.0 - - - - - - - 130.0 9 1 C1QL3 complement component 1, q subcomponent-like 3 533 68 C20140711_OR018_03 C20140711_OR018_03 TB422912.[MT7]-GEPGRQGLPGPPGAPGLNAAGAISAATYSTVPK[MT7].4b13_2.heavy 837.704 / 672.861 8289.0 37.36130142211914 44 14 10 10 10 4.3507915264230395 22.984323517383977 0.0 3 0.9351608478511404 4.820240363900173 8289.0 -1.1201351351351363 0.0 - - - - - - - 259.0 16 2 C1QL3 complement component 1, q subcomponent-like 3 535 68 C20140711_OR018_03 C20140711_OR018_03 TB422912.[MT7]-GEPGRQGLPGPPGAPGLNAAGAISAATYSTVPK[MT7].4b14_2.heavy 837.704 / 708.379 36782.0 37.36130142211914 44 14 10 10 10 4.3507915264230395 22.984323517383977 0.0 3 0.9351608478511404 4.820240363900173 36782.0 -0.05676234567901162 0.0 - - - - - - - 345.6666666666667 73 3 C1QL3 complement component 1, q subcomponent-like 3 537 69 C20140711_OR018_03 C20140711_OR018_03 TB422400.[MT7]-MTQDLAGTYR.2b4_1.heavy 650.328 / 620.283 15760.0 27.932100296020508 45 15 10 10 10 1.594323537690424 44.07884803180622 0.0 3 0.9570552728426442 5.933908437867584 15760.0 171.92727272727274 0.0 - - - - - - - 220.25 31 8 LOC100506173;KIR2DL1;KIR2DS5 putative killer cell immunoglobulin-like receptor like protein KIR3DP1-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 539 69 C20140711_OR018_03 C20140711_OR018_03 TB422400.[MT7]-MTQDLAGTYR.2y9_1.heavy 650.328 / 1024.51 16752.0 27.932100296020508 45 15 10 10 10 1.594323537690424 44.07884803180622 0.0 3 0.9570552728426442 5.933908437867584 16752.0 110.48377390228819 0.0 - - - - - - - 220.33333333333334 33 9 LOC100506173;KIR2DL1;KIR2DS5 putative killer cell immunoglobulin-like receptor like protein KIR3DP1-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 541 69 C20140711_OR018_03 C20140711_OR018_03 TB422400.[MT7]-MTQDLAGTYR.2y6_1.heavy 650.328 / 680.373 9808.0 27.932100296020508 45 15 10 10 10 1.594323537690424 44.07884803180622 0.0 3 0.9570552728426442 5.933908437867584 9808.0 73.61953221642406 0.0 - - - - - - - 220.14285714285714 19 7 LOC100506173;KIR2DL1;KIR2DS5 putative killer cell immunoglobulin-like receptor like protein KIR3DP1-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 543 69 C20140711_OR018_03 C20140711_OR018_03 TB422400.[MT7]-MTQDLAGTYR.2y7_1.heavy 650.328 / 795.399 5070.0 27.932100296020508 45 15 10 10 10 1.594323537690424 44.07884803180622 0.0 3 0.9570552728426442 5.933908437867584 5070.0 40.09909090909091 0.0 - - - - - - - 283.14285714285717 10 7 LOC100506173;KIR2DL1;KIR2DS5 putative killer cell immunoglobulin-like receptor like protein KIR3DP1-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 545 70 C20140711_OR018_03 C20140711_OR018_03 TB422913.[MT7]-GEPGRQGLPGPPGAPGLNAAGAISAATYSTVPK[MT7].3b14_2.heavy 1116.6 / 708.379 648.0 37.382750511169434 29 8 10 1 10 0.640658760136215 95.83316438835652 0.13350296020507812 3 0.7565088179023212 2.4484228800080516 648.0 -0.33316195372750645 3.0 - - - - - - - 0.0 1 0 C1QL3 complement component 1, q subcomponent-like 3 547 70 C20140711_OR018_03 C20140711_OR018_03 TB422913.[MT7]-GEPGRQGLPGPPGAPGLNAAGAISAATYSTVPK[MT7].3y5_1.heavy 1116.6 / 675.416 1167.0 37.382750511169434 29 8 10 1 10 0.640658760136215 95.83316438835652 0.13350296020507812 3 0.7565088179023212 2.4484228800080516 1167.0 -0.09011583011583024 0.0 - - - - - - - 259.0 2 3 C1QL3 complement component 1, q subcomponent-like 3 549 70 C20140711_OR018_03 C20140711_OR018_03 TB422913.[MT7]-GEPGRQGLPGPPGAPGLNAAGAISAATYSTVPK[MT7].3b10_1.heavy 1116.6 / 1093.59 1167.0 37.382750511169434 29 8 10 1 10 0.640658760136215 95.83316438835652 0.13350296020507812 3 0.7565088179023212 2.4484228800080516 1167.0 -0.8976923076923082 0.0 - - - - - - - 259.25 2 4 C1QL3 complement component 1, q subcomponent-like 3 551 70 C20140711_OR018_03 C20140711_OR018_03 TB422913.[MT7]-GEPGRQGLPGPPGAPGLNAAGAISAATYSTVPK[MT7].3y10_1.heavy 1116.6 / 1168.63 2204.0 37.382750511169434 29 8 10 1 10 0.640658760136215 95.83316438835652 0.13350296020507812 3 0.7565088179023212 2.4484228800080516 2204.0 18.146894586894586 0.0 - - - - - - - 194.5 4 2 C1QL3 complement component 1, q subcomponent-like 3 553 71 C20140711_OR018_03 C20140711_OR018_03 TB422401.[MT7]-DSPYEWSK[MT7].2y4_1.heavy 650.327 / 693.369 1099.0 28.889275074005127 41 15 10 6 10 1.6823884188739147 41.28988066012977 0.03529930114746094 3 0.9521490517044002 5.619140817748913 1099.0 0.666060606060606 0.0 - - - - - - - 171.11111111111111 2 9 KIR2DS1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 555 71 C20140711_OR018_03 C20140711_OR018_03 TB422401.[MT7]-DSPYEWSK[MT7].2y3_1.heavy 650.327 / 564.326 2089.0 28.889275074005127 41 15 10 6 10 1.6823884188739147 41.28988066012977 0.03529930114746094 3 0.9521490517044002 5.619140817748913 2089.0 10.761515151515152 0.0 - - - - - - - 281.1111111111111 4 9 KIR2DS1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 557 71 C20140711_OR018_03 C20140711_OR018_03 TB422401.[MT7]-DSPYEWSK[MT7].2y6_1.heavy 650.327 / 953.485 1979.0 28.889275074005127 41 15 10 6 10 1.6823884188739147 41.28988066012977 0.03529930114746094 3 0.9521490517044002 5.619140817748913 1979.0 8.665621212121213 0.0 - - - - - - - 275.0 3 10 KIR2DS1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 559 71 C20140711_OR018_03 C20140711_OR018_03 TB422401.[MT7]-DSPYEWSK[MT7].2y7_1.heavy 650.327 / 1040.52 3078.0 28.889275074005127 41 15 10 6 10 1.6823884188739147 41.28988066012977 0.03529930114746094 3 0.9521490517044002 5.619140817748913 3078.0 17.393483626906253 0.0 - - - - - - - 195.55555555555554 6 9 KIR2DS1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 561 72 C20140711_OR018_03 C20140711_OR018_03 TB422818.[MT7]-DILLQQQQQLGHGGPEAAPR.3y7_1.heavy 767.412 / 697.363 953.0 30.815500259399414 36 17 10 1 8 3.8882441382165442 19.69511635474436 0.10760116577148438 4 0.9791962124164906 8.54152393062375 953.0 -0.5 2.0 - - - - - - - 291.25 2 4 IRF2BP2 interferon regulatory factor 2 binding protein 2 563 72 C20140711_OR018_03 C20140711_OR018_03 TB422818.[MT7]-DILLQQQQQLGHGGPEAAPR.3y8_1.heavy 767.412 / 754.384 2540.0 30.815500259399414 36 17 10 1 8 3.8882441382165442 19.69511635474436 0.10760116577148438 4 0.9791962124164906 8.54152393062375 2540.0 -2.880907372400756 0.0 - - - - - - - 661.5 5 4 IRF2BP2 interferon regulatory factor 2 binding protein 2 565 72 C20140711_OR018_03 C20140711_OR018_03 TB422818.[MT7]-DILLQQQQQLGHGGPEAAPR.3y10_1.heavy 767.412 / 948.465 3281.0 30.815500259399414 36 17 10 1 8 3.8882441382165442 19.69511635474436 0.10760116577148438 4 0.9791962124164906 8.54152393062375 3281.0 -0.30952830188679314 0.0 - - - - - - - 212.0 6 4 IRF2BP2 interferon regulatory factor 2 binding protein 2 567 72 C20140711_OR018_03 C20140711_OR018_03 TB422818.[MT7]-DILLQQQQQLGHGGPEAAPR.3y9_1.heavy 767.412 / 891.443 953.0 30.815500259399414 36 17 10 1 8 3.8882441382165442 19.69511635474436 0.10760116577148438 4 0.9791962124164906 8.54152393062375 953.0 -0.3375442739079103 1.0 - - - - - - - 0.0 1 0 IRF2BP2 interferon regulatory factor 2 binding protein 2 569 73 C20140711_OR018_03 C20140711_OR018_03 TB432111.[MT7]-YK[MT7]EDLTEDK[MT7].3y3_1.heavy 524.954 / 535.284 2289.0 23.875600814819336 42 12 10 10 10 1.503265678209158 44.2350907248369 0.0 3 0.8826243036119406 3.5664063429064696 2289.0 35.096191843483055 0.0 - - - - - - - 148.22222222222223 4 9 TGM6 transglutaminase 6 571 73 C20140711_OR018_03 C20140711_OR018_03 TB432111.[MT7]-YK[MT7]EDLTEDK[MT7].3b4_1.heavy 524.954 / 824.439 382.0 23.875600814819336 42 12 10 10 10 1.503265678209158 44.2350907248369 0.0 3 0.8826243036119406 3.5664063429064696 382.0 -0.24025157232704397 6.0 - - - - - - - 0.0 1 0 TGM6 transglutaminase 6 573 73 C20140711_OR018_03 C20140711_OR018_03 TB432111.[MT7]-YK[MT7]EDLTEDK[MT7].3y4_1.heavy 524.954 / 636.332 4769.0 23.875600814819336 42 12 10 10 10 1.503265678209158 44.2350907248369 0.0 3 0.8826243036119406 3.5664063429064696 4769.0 99.5968 0.0 - - - - - - - 171.6 9 5 TGM6 transglutaminase 6 575 73 C20140711_OR018_03 C20140711_OR018_03 TB432111.[MT7]-YK[MT7]EDLTEDK[MT7].3y5_1.heavy 524.954 / 749.416 2289.0 23.875600814819336 42 12 10 10 10 1.503265678209158 44.2350907248369 0.0 3 0.8826243036119406 3.5664063429064696 2289.0 22.77015706806283 0.0 - - - - - - - 250.5 4 8 TGM6 transglutaminase 6 577 74 C20140711_OR018_03 C20140711_OR018_03 TB443948.[MT7]-TGASALHVAAAK[MT7].3b6_1.heavy 462.277 / 645.369 5858.0 23.04444980621338 42 16 10 6 10 2.9088061670166607 34.378364957388115 0.03769874572753906 3 0.9687292799383158 6.960735945235719 5858.0 27.71663752589823 0.0 - - - - - - - 308.0 11 1 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 579 74 C20140711_OR018_03 C20140711_OR018_03 TB443948.[MT7]-TGASALHVAAAK[MT7].3b5_1.heavy 462.277 / 532.285 8222.0 23.04444980621338 42 16 10 6 10 2.9088061670166607 34.378364957388115 0.03769874572753906 3 0.9687292799383158 6.960735945235719 8222.0 54.925982094347205 0.0 - - - - - - - 235.0 16 7 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 581 74 C20140711_OR018_03 C20140711_OR018_03 TB443948.[MT7]-TGASALHVAAAK[MT7].3y4_1.heavy 462.277 / 504.326 12641.0 23.04444980621338 42 16 10 6 10 2.9088061670166607 34.378364957388115 0.03769874572753906 3 0.9687292799383158 6.960735945235719 12641.0 77.36171659551962 0.0 - - - - - - - 161.71428571428572 25 7 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 583 74 C20140711_OR018_03 C20140711_OR018_03 TB443948.[MT7]-TGASALHVAAAK[MT7].3y5_1.heavy 462.277 / 603.395 3392.0 23.04444980621338 42 16 10 6 10 2.9088061670166607 34.378364957388115 0.03769874572753906 3 0.9687292799383158 6.960735945235719 3392.0 6.927737226277373 1.0 - - - - - - - 161.71428571428572 6 7 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 585 75 C20140711_OR018_03 C20140711_OR018_03 TB443749.[MT7]-EAQMEK[MT7].2y4_1.heavy 512.273 / 679.357 2483.0 17.955299377441406 44 20 6 10 8 22.78974238639639 4.387939025571953 0.0 4 0.9988023374829799 35.65757353549892 2483.0 50.9015 0.0 - - - - - - - 78.0 4 2 TGM6 transglutaminase 6 587 75 C20140711_OR018_03 C20140711_OR018_03 TB443749.[MT7]-EAQMEK[MT7].2y5_1.heavy 512.273 / 750.394 11098.0 17.955299377441406 44 20 6 10 8 22.78974238639639 4.387939025571953 0.0 4 0.9988023374829799 35.65757353549892 11098.0 253.2620512820513 1.0 - - - - - - - 155.28571428571428 35 7 TGM6 transglutaminase 6 589 75 C20140711_OR018_03 C20140711_OR018_03 TB443749.[MT7]-EAQMEK[MT7].2y3_1.heavy 512.273 / 551.298 7916.0 17.955299377441406 44 20 6 10 8 22.78974238639639 4.387939025571953 0.0 4 0.9988023374829799 35.65757353549892 7916.0 144.43917287014062 0.0 - - - - - - - 181.33333333333334 15 3 TGM6 transglutaminase 6 591 75 C20140711_OR018_03 C20140711_OR018_03 TB443749.[MT7]-EAQMEK[MT7].2b5_1.heavy 512.273 / 733.331 2095.0 17.955299377441406 44 20 6 10 8 22.78974238639639 4.387939025571953 0.0 4 0.9988023374829799 35.65757353549892 2095.0 53.69108974358974 0.0 - - - - - - - 194.0 4 2 TGM6 transglutaminase 6 593 76 C20140711_OR018_03 C20140711_OR018_03 TB443849.[MT7]-EGTFNHTLR.3b4_1.heavy 406.883 / 579.289 2075.0 22.24055004119873 37 13 10 6 8 16.798450421901574 5.95293003154752 0.03529930114746094 4 0.9031513627079759 3.9332050968748 2075.0 10.485104206623195 1.0 - - - - - - - 258.53846153846155 5 13 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 595 76 C20140711_OR018_03 C20140711_OR018_03 TB443849.[MT7]-EGTFNHTLR.3b5_1.heavy 406.883 / 693.332 1284.0 22.24055004119873 37 13 10 6 8 16.798450421901574 5.95293003154752 0.03529930114746094 4 0.9031513627079759 3.9332050968748 1284.0 17.119999999999997 0.0 - - - - - - - 164.83333333333334 2 6 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 597 76 C20140711_OR018_03 C20140711_OR018_03 TB443849.[MT7]-EGTFNHTLR.3b3_1.heavy 406.883 / 432.221 2964.0 22.24055004119873 37 13 10 6 8 16.798450421901574 5.95293003154752 0.03529930114746094 4 0.9031513627079759 3.9332050968748 2964.0 40.41818181818182 0.0 - - - - - - - 143.9090909090909 5 11 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 599 76 C20140711_OR018_03 C20140711_OR018_03 TB443849.[MT7]-EGTFNHTLR.3y4_1.heavy 406.883 / 526.31 2766.0 22.24055004119873 37 13 10 6 8 16.798450421901574 5.95293003154752 0.03529930114746094 4 0.9031513627079759 3.9332050968748 2766.0 14.951351351351352 0.0 - - - - - - - 269.3636363636364 5 11 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 601 77 C20140711_OR018_03 C20140711_OR018_03 TB432126.[MT7]-DITLEDFITIK[MT7].3b6_1.heavy 532.643 / 831.422 4836.0 46.41765022277832 37 11 10 6 10 1.5535776043805796 64.36756021587385 0.037899017333984375 3 0.8578973497491357 3.2342897723366963 4836.0 106.6674503816794 0.0 - - - - - - - 108.83333333333333 9 6 TGM6 transglutaminase 6 603 77 C20140711_OR018_03 C20140711_OR018_03 TB432126.[MT7]-DITLEDFITIK[MT7].3b4_1.heavy 532.643 / 587.352 3986.0 46.41765022277832 37 11 10 6 10 1.5535776043805796 64.36756021587385 0.037899017333984375 3 0.8578973497491357 3.2342897723366963 3986.0 35.91745453696571 0.0 - - - - - - - 163.375 7 8 TGM6 transglutaminase 6 605 77 C20140711_OR018_03 C20140711_OR018_03 TB432126.[MT7]-DITLEDFITIK[MT7].3b5_1.heavy 532.643 / 716.395 2810.0 46.41765022277832 37 11 10 6 10 1.5535776043805796 64.36756021587385 0.037899017333984375 3 0.8578973497491357 3.2342897723366963 2810.0 24.038508694272302 0.0 - - - - - - - 195.83333333333334 5 6 TGM6 transglutaminase 6 607 77 C20140711_OR018_03 C20140711_OR018_03 TB432126.[MT7]-DITLEDFITIK[MT7].3b7_1.heavy 532.643 / 978.49 3659.0 46.41765022277832 37 11 10 6 10 1.5535776043805796 64.36756021587385 0.037899017333984375 3 0.8578973497491357 3.2342897723366963 3659.0 107.5183076923077 0.0 - - - - - - - 174.0 7 6 TGM6 transglutaminase 6 609 78 C20140711_OR018_03 C20140711_OR018_03 TB432223.[MT7]-VAHNYTMEHFMEVIR.4y4_1.heavy 506.002 / 516.314 1400.0 37.04069900512695 43 13 10 10 10 3.726924695700525 26.831773691419777 0.0 3 0.9226954211682038 4.409826436785388 1400.0 2.053220049578786 2.0 - - - - - - - 218.0 2 7 KLHL5 kelch-like 5 (Drosophila) 611 78 C20140711_OR018_03 C20140711_OR018_03 TB432223.[MT7]-VAHNYTMEHFMEVIR.4y5_1.heavy 506.002 / 647.354 2545.0 37.04069900512695 43 13 10 10 10 3.726924695700525 26.831773691419777 0.0 3 0.9226954211682038 4.409826436785388 2545.0 20.379055118110237 2.0 - - - - - - - 212.0 5 3 KLHL5 kelch-like 5 (Drosophila) 613 78 C20140711_OR018_03 C20140711_OR018_03 TB432223.[MT7]-VAHNYTMEHFMEVIR.4b4_1.heavy 506.002 / 566.317 1145.0 37.04069900512695 43 13 10 10 10 3.726924695700525 26.831773691419777 0.0 3 0.9226954211682038 4.409826436785388 1145.0 4.100333845883943 1.0 - - - - - - - 240.22222222222223 2 9 KLHL5 kelch-like 5 (Drosophila) 615 78 C20140711_OR018_03 C20140711_OR018_03 TB432223.[MT7]-VAHNYTMEHFMEVIR.4y6_1.heavy 506.002 / 794.423 1018.0 37.04069900512695 43 13 10 10 10 3.726924695700525 26.831773691419777 0.0 3 0.9226954211682038 4.409826436785388 1018.0 15.22992125984252 1.0 - - - - - - - 169.33333333333334 2 6 KLHL5 kelch-like 5 (Drosophila) 617 79 C20140711_OR018_03 C20140711_OR018_03 TB443844.[MT7]-NHEEEMK[MT7].2y6_1.heavy 602.797 / 946.442 1551.0 15.52180004119873 41 11 10 10 10 2.803204937727781 35.67345314433482 0.0 3 0.8643349137491254 3.312009254594757 1551.0 40.562376659038904 0.0 - - - - - - - 105.33333333333333 3 6 KRT28;KRT24;KRT27;KRT10;KRT13;KRT15 keratin 28;keratin 24;keratin 27;keratin 10;keratin 13;keratin 15 619 79 C20140711_OR018_03 C20140711_OR018_03 TB443844.[MT7]-NHEEEMK[MT7].2y4_1.heavy 602.797 / 680.341 345.0 15.52180004119873 41 11 10 10 10 2.803204937727781 35.67345314433482 0.0 3 0.8643349137491254 3.312009254594757 345.0 12.099210526315789 0.0 - - - - - - - 0.0 0 0 KRT28;KRT24;KRT27;KRT10;KRT13;KRT15 keratin 28;keratin 24;keratin 27;keratin 10;keratin 13;keratin 15 621 79 C20140711_OR018_03 C20140711_OR018_03 TB443844.[MT7]-NHEEEMK[MT7].2y5_1.heavy 602.797 / 809.383 1034.0 15.52180004119873 41 11 10 10 10 2.803204937727781 35.67345314433482 0.0 3 0.8643349137491254 3.312009254594757 1034.0 4.010682146757501 0.0 - - - - - - - 229.66666666666666 2 6 KRT28;KRT24;KRT27;KRT10;KRT13;KRT15 keratin 28;keratin 24;keratin 27;keratin 10;keratin 13;keratin 15 623 79 C20140711_OR018_03 C20140711_OR018_03 TB443844.[MT7]-NHEEEMK[MT7].2y3_1.heavy 602.797 / 551.298 402.0 15.52180004119873 41 11 10 10 10 2.803204937727781 35.67345314433482 0.0 3 0.8643349137491254 3.312009254594757 402.0 2.33314459049545 6.0 - - - - - - - 0.0 0 0 KRT28;KRT24;KRT27;KRT10;KRT13;KRT15 keratin 28;keratin 24;keratin 27;keratin 10;keratin 13;keratin 15 625 80 C20140711_OR018_03 C20140711_OR018_03 TB422330.[MT7]-QDLAGTY[MT7]R.3y6_2.heavy 404.559 / 412.741 1906.0 19.961524963378906 33 13 10 6 4 2.1767355689016306 37.14753952769617 0.0364990234375 7 0.9270649979125095 4.541703119676901 1906.0 28.13660767639623 0.0 - - - - - - - 174.14285714285714 3 7 KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 627 80 C20140711_OR018_03 C20140711_OR018_03 TB422330.[MT7]-QDLAGTY[MT7]R.3y4_1.heavy 404.559 / 640.354 686.0 19.961524963378906 33 13 10 6 4 2.1767355689016306 37.14753952769617 0.0364990234375 7 0.9270649979125095 4.541703119676901 686.0 17.330526315789477 0.0 - - - - - - - 0.0 1 0 KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 629 80 C20140711_OR018_03 C20140711_OR018_03 TB422330.[MT7]-QDLAGTY[MT7]R.3b3_1.heavy 404.559 / 501.279 534.0 19.961524963378906 33 13 10 6 4 2.1767355689016306 37.14753952769617 0.0364990234375 7 0.9270649979125095 4.541703119676901 534.0 0.0 9.0 - - - - - - - 0.0 1 0 KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 631 80 C20140711_OR018_03 C20140711_OR018_03 TB422330.[MT7]-QDLAGTY[MT7]R.3y5_1.heavy 404.559 / 711.391 229.0 19.961524963378906 33 13 10 6 4 2.1767355689016306 37.14753952769617 0.0364990234375 7 0.9270649979125095 4.541703119676901 229.0 1.2042752372735117 1.0 - - - - - - - 0.0 0 0 KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 633 81 C20140711_OR018_03 C20140711_OR018_03 TB422622.[MT7]-LSADMATVLQLLQR.3y6_1.heavy 568.326 / 770.488 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 635 81 C20140711_OR018_03 C20140711_OR018_03 TB422622.[MT7]-LSADMATVLQLLQR.3b4_1.heavy 568.326 / 531.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 637 81 C20140711_OR018_03 C20140711_OR018_03 TB422622.[MT7]-LSADMATVLQLLQR.3b5_1.heavy 568.326 / 662.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 639 81 C20140711_OR018_03 C20140711_OR018_03 TB422622.[MT7]-LSADMATVLQLLQR.3y5_1.heavy 568.326 / 657.404 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 641 82 C20140711_OR018_03 C20140711_OR018_03 TB422538.[MT7]-YSTFSGFIIYAD.2b8_1.heavy 764.378 / 1047.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - C1QL3 complement component 1, q subcomponent-like 3 643 82 C20140711_OR018_03 C20140711_OR018_03 TB422538.[MT7]-YSTFSGFIIYAD.2b6_1.heavy 764.378 / 787.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - C1QL3 complement component 1, q subcomponent-like 3 645 82 C20140711_OR018_03 C20140711_OR018_03 TB422538.[MT7]-YSTFSGFIIYAD.2b7_1.heavy 764.378 / 934.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - C1QL3 complement component 1, q subcomponent-like 3 647 82 C20140711_OR018_03 C20140711_OR018_03 TB422538.[MT7]-YSTFSGFIIYAD.2b5_1.heavy 764.378 / 730.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - C1QL3 complement component 1, q subcomponent-like 3 649 83 C20140711_OR018_03 C20140711_OR018_03 TB422626.[MT7]-TLTVSLASPPSAVIGR.2y8_1.heavy 857.005 / 796.468 18372.0 37.91910171508789 42 12 10 10 10 3.6456822023035085 18.4329860323545 0.0 3 0.8896552515942675 3.68052429068938 18372.0 26.786420653400555 0.0 - - - - - - - 273.57142857142856 36 7 TGM6 transglutaminase 6 651 83 C20140711_OR018_03 C20140711_OR018_03 TB422626.[MT7]-TLTVSLASPPSAVIGR.2y12_1.heavy 857.005 / 1154.65 5996.0 37.91910171508789 42 12 10 10 10 3.6456822023035085 18.4329860323545 0.0 3 0.8896552515942675 3.68052429068938 5996.0 -0.23010443994483076 2.0 - - - - - - - 255.4 22 5 TGM6 transglutaminase 6 653 83 C20140711_OR018_03 C20140711_OR018_03 TB422626.[MT7]-TLTVSLASPPSAVIGR.2y9_1.heavy 857.005 / 883.5 18500.0 37.91910171508789 42 12 10 10 10 3.6456822023035085 18.4329860323545 0.0 3 0.8896552515942675 3.68052429068938 18500.0 168.88051470588235 0.0 - - - - - - - 204.4 37 5 TGM6 transglutaminase 6 655 83 C20140711_OR018_03 C20140711_OR018_03 TB422626.[MT7]-TLTVSLASPPSAVIGR.2y10_1.heavy 857.005 / 954.537 19520.0 37.91910171508789 42 12 10 10 10 3.6456822023035085 18.4329860323545 0.0 3 0.8896552515942675 3.68052429068938 19520.0 58.8379048231248 0.0 - - - - - - - 340.3333333333333 39 6 TGM6 transglutaminase 6 657 84 C20140711_OR018_03 C20140711_OR018_03 TB422532.[MT7]-ILLAAMC[CAM]LVTK[MT7].3b4_1.heavy 507.643 / 555.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 659 84 C20140711_OR018_03 C20140711_OR018_03 TB422532.[MT7]-ILLAAMC[CAM]LVTK[MT7].3b5_1.heavy 507.643 / 626.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 661 84 C20140711_OR018_03 C20140711_OR018_03 TB422532.[MT7]-ILLAAMC[CAM]LVTK[MT7].3b3_1.heavy 507.643 / 484.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 663 84 C20140711_OR018_03 C20140711_OR018_03 TB422532.[MT7]-ILLAAMC[CAM]LVTK[MT7].3y4_1.heavy 507.643 / 604.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 665 85 C20140711_OR018_03 C20140711_OR018_03 TB422533.[MT7]-AQLAEVVESMFR.3b4_1.heavy 508.605 / 528.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2;DUOX1 dual oxidase 2;dual oxidase 1 667 85 C20140711_OR018_03 C20140711_OR018_03 TB422533.[MT7]-AQLAEVVESMFR.3b5_1.heavy 508.605 / 657.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2;DUOX1 dual oxidase 2;dual oxidase 1 669 85 C20140711_OR018_03 C20140711_OR018_03 TB422533.[MT7]-AQLAEVVESMFR.3y4_1.heavy 508.605 / 540.26 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2;DUOX1 dual oxidase 2;dual oxidase 1 671 85 C20140711_OR018_03 C20140711_OR018_03 TB422533.[MT7]-AQLAEVVESMFR.3y5_1.heavy 508.605 / 669.302 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2;DUOX1 dual oxidase 2;dual oxidase 1 673 86 C20140711_OR018_03 C20140711_OR018_03 TB432225.[MT7]-QLQVDLVSPHFPDIK[MT7].4y5_1.heavy 506.791 / 763.447 1387.0 39.68497371673584 35 12 9 6 8 1.1983546758474286 58.50166131099075 0.036899566650390625 4 0.8840332809933937 3.5884468192939445 1387.0 10.553260869565216 1.0 - - - - - - - 150.0 2 8 TGM6 transglutaminase 6 675 86 C20140711_OR018_03 C20140711_OR018_03 TB432225.[MT7]-QLQVDLVSPHFPDIK[MT7].4y4_1.heavy 506.791 / 616.379 1479.0 39.68497371673584 35 12 9 6 8 1.1983546758474286 58.50166131099075 0.036899566650390625 4 0.8840332809933937 3.5884468192939445 1479.0 16.820511163337247 0.0 - - - - - - - 169.16666666666666 2 6 TGM6 transglutaminase 6 677 86 C20140711_OR018_03 C20140711_OR018_03 TB432225.[MT7]-QLQVDLVSPHFPDIK[MT7].4b5_1.heavy 506.791 / 728.406 1757.0 39.68497371673584 35 12 9 6 8 1.1983546758474286 58.50166131099075 0.036899566650390625 4 0.8840332809933937 3.5884468192939445 1757.0 18.142934782608695 0.0 - - - - - - - 197.85714285714286 3 7 TGM6 transglutaminase 6 679 86 C20140711_OR018_03 C20140711_OR018_03 TB432225.[MT7]-QLQVDLVSPHFPDIK[MT7].4y3_1.heavy 506.791 / 519.326 462.0 39.68497371673584 35 12 9 6 8 1.1983546758474286 58.50166131099075 0.036899566650390625 4 0.8840332809933937 3.5884468192939445 462.0 1.935405405405405 17.0 - - - - - - - 277.3 4 10 TGM6 transglutaminase 6 681 87 C20140711_OR018_03 C20140711_OR018_03 TB444214.[MT7]-ISSLVAQEVLSLGADVLPEYK[MT7].3b4_1.heavy 840.479 / 545.341 6726.0 54.607398986816406 48 18 10 10 10 5.723522086301812 17.471759258050465 0.0 3 0.9839565134470019 9.730398883544341 6726.0 83.56234251095898 0.0 - - - - - - - 76.61904761904762 13 42 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 683 87 C20140711_OR018_03 C20140711_OR018_03 TB444214.[MT7]-ISSLVAQEVLSLGADVLPEYK[MT7].3b5_1.heavy 840.479 / 644.41 12302.0 54.607398986816406 48 18 10 10 10 5.723522086301812 17.471759258050465 0.0 3 0.9839565134470019 9.730398883544341 12302.0 144.50616990982437 0.0 - - - - - - - 83.34883720930233 24 43 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 685 87 C20140711_OR018_03 C20140711_OR018_03 TB444214.[MT7]-ISSLVAQEVLSLGADVLPEYK[MT7].3y4_1.heavy 840.479 / 680.374 19764.0 54.607398986816406 48 18 10 10 10 5.723522086301812 17.471759258050465 0.0 3 0.9839565134470019 9.730398883544341 19764.0 674.0391144505568 0.0 - - - - - - - 57.78048780487805 39 41 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 687 87 C20140711_OR018_03 C20140711_OR018_03 TB444214.[MT7]-ISSLVAQEVLSLGADVLPEYK[MT7].3b8_1.heavy 840.479 / 972.548 7926.0 54.607398986816406 48 18 10 10 10 5.723522086301812 17.471759258050465 0.0 3 0.9839565134470019 9.730398883544341 7926.0 265.3367485915929 0.0 - - - - - - - 76.33333333333333 15 36 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 689 88 C20140711_OR018_03 C20140711_OR018_03 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 953755.0 35.136199951171875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 953755.0 804.4274604896494 0.0 - - - - - - - 231.11111111111111 1907 9 691 88 C20140711_OR018_03 C20140711_OR018_03 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 180135.0 35.136199951171875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 180135.0 703.6527165958527 0.0 - - - - - - - 247.0 360 10 693 88 C20140711_OR018_03 C20140711_OR018_03 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 273451.0 35.136199951171875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 273451.0 241.06729318775112 0.0 - - - - - - - 299.0 546 10 695 89 C20140711_OR018_03 C20140711_OR018_03 TB432137.[MT7]-WWLDGPLVHVK[MT7].4y4_1.heavy 410.241 / 626.411 858.0 42.64320182800293 29 3 10 6 10 0.39598335780010796 117.11971570264396 0.032199859619140625 3 0.5986276461314097 1.878698916457025 858.0 11.0825 0.0 - - - - - - - 0.0 1 0 GLT6D1 glycosyltransferase 6 domain containing 1 697 89 C20140711_OR018_03 C20140711_OR018_03 TB432137.[MT7]-WWLDGPLVHVK[MT7].4y5_1.heavy 410.241 / 739.495 143.0 42.64320182800293 29 3 10 6 10 0.39598335780010796 117.11971570264396 0.032199859619140625 3 0.5986276461314097 1.878698916457025 143.0 1.0 4.0 - - - - - - - 0.0 0 0 GLT6D1 glycosyltransferase 6 domain containing 1 699 89 C20140711_OR018_03 C20140711_OR018_03 TB432137.[MT7]-WWLDGPLVHVK[MT7].4y3_2.heavy 410.241 / 264.175 1931.0 42.64320182800293 29 3 10 6 10 0.39598335780010796 117.11971570264396 0.032199859619140625 3 0.5986276461314097 1.878698916457025 1931.0 18.904895104895104 0.0 - - - - - - - 250.5 3 4 GLT6D1 glycosyltransferase 6 domain containing 1 701 89 C20140711_OR018_03 C20140711_OR018_03 TB432137.[MT7]-WWLDGPLVHVK[MT7].4y3_1.heavy 410.241 / 527.342 358.0 42.64320182800293 29 3 10 6 10 0.39598335780010796 117.11971570264396 0.032199859619140625 3 0.5986276461314097 1.878698916457025 358.0 0.0 1.0 - - - - - - - 0.0 0 0 GLT6D1 glycosyltransferase 6 domain containing 1 703 90 C20140711_OR018_03 C20140711_OR018_03 TB443938.[MT7]-YGGGTSPLHWR.3y3_1.heavy 458.906 / 498.257 10459.0 30.003799438476562 42 14 10 10 8 3.1433371535089547 31.813322948309406 0.0 4 0.9480602387338621 5.391560367700666 10459.0 63.64706602112676 0.0 - - - - - - - 173.375 20 8 TGM6 transglutaminase 6 705 90 C20140711_OR018_03 C20140711_OR018_03 TB443938.[MT7]-YGGGTSPLHWR.3b4_1.heavy 458.906 / 479.237 3735.0 30.003799438476562 42 14 10 10 8 3.1433371535089547 31.813322948309406 0.0 4 0.9480602387338621 5.391560367700666 3735.0 3.82123782335201 1.0 - - - - - - - 232.8181818181818 7 11 TGM6 transglutaminase 6 707 90 C20140711_OR018_03 C20140711_OR018_03 TB443938.[MT7]-YGGGTSPLHWR.3y4_1.heavy 458.906 / 611.341 2028.0 30.003799438476562 42 14 10 10 8 3.1433371535089547 31.813322948309406 0.0 4 0.9480602387338621 5.391560367700666 2028.0 18.185352112676057 0.0 - - - - - - - 200.0 4 8 TGM6 transglutaminase 6 709 90 C20140711_OR018_03 C20140711_OR018_03 TB443938.[MT7]-YGGGTSPLHWR.3y5_1.heavy 458.906 / 708.394 4909.0 30.003799438476562 42 14 10 10 8 3.1433371535089547 31.813322948309406 0.0 4 0.9480602387338621 5.391560367700666 4909.0 14.880406249999998 0.0 - - - - - - - 170.8 9 5 TGM6 transglutaminase 6 711 91 C20140711_OR018_03 C20140711_OR018_03 TB422323.[MT7]-LSDWFHPR.3y3_1.heavy 401.213 / 409.231 2838.0 36.804500579833984 44 14 10 10 10 2.558640641586075 39.08325318322585 0.0 3 0.9350774817968185 4.817110286239115 2838.0 -0.2933333333333339 0.0 - - - - - - - 301.0 5 3 GLT6D1 glycosyltransferase 6 domain containing 1 713 91 C20140711_OR018_03 C20140711_OR018_03 TB422323.[MT7]-LSDWFHPR.3b4_1.heavy 401.213 / 646.332 645.0 36.804500579833984 44 14 10 10 10 2.558640641586075 39.08325318322585 0.0 3 0.9350774817968185 4.817110286239115 645.0 7.5 0.0 - - - - - - - 0.0 1 0 GLT6D1 glycosyltransferase 6 domain containing 1 715 91 C20140711_OR018_03 C20140711_OR018_03 TB422323.[MT7]-LSDWFHPR.3y4_1.heavy 401.213 / 556.299 1161.0 36.804500579833984 44 14 10 10 10 2.558640641586075 39.08325318322585 0.0 3 0.9350774817968185 4.817110286239115 1161.0 3.9 0.0 - - - - - - - 172.0 2 3 GLT6D1 glycosyltransferase 6 domain containing 1 717 91 C20140711_OR018_03 C20140711_OR018_03 TB422323.[MT7]-LSDWFHPR.3b3_1.heavy 401.213 / 460.252 3483.0 36.804500579833984 44 14 10 10 10 2.558640641586075 39.08325318322585 0.0 3 0.9350774817968185 4.817110286239115 3483.0 52.92 0.0 - - - - - - - 129.0 6 1 GLT6D1 glycosyltransferase 6 domain containing 1 719 92 C20140711_OR018_03 C20140711_OR018_03 TB422322.[MT7]-ERQVYSK[MT7].2y4_1.heavy 599.345 / 640.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 721 92 C20140711_OR018_03 C20140711_OR018_03 TB422322.[MT7]-ERQVYSK[MT7].2y5_1.heavy 599.345 / 768.437 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 723 92 C20140711_OR018_03 C20140711_OR018_03 TB422322.[MT7]-ERQVYSK[MT7].2b6_1.heavy 599.345 / 907.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 725 92 C20140711_OR018_03 C20140711_OR018_03 TB422322.[MT7]-ERQVYSK[MT7].2y3_1.heavy 599.345 / 541.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 727 93 C20140711_OR018_03 C20140711_OR018_03 TB422528.[MT7]-AVNRLFGVEASGR.3y7_1.heavy 507.287 / 675.342 2195.0 30.934200286865234 40 14 10 6 10 2.567409132361413 31.114135382414982 0.037200927734375 3 0.9443314643529372 5.206212328852789 2195.0 7.689490445859873 0.0 - - - - - - - 180.9090909090909 4 11 TGM6 transglutaminase 6 729 93 C20140711_OR018_03 C20140711_OR018_03 TB422528.[MT7]-AVNRLFGVEASGR.3y8_1.heavy 507.287 / 822.41 1150.0 30.934200286865234 40 14 10 6 10 2.567409132361413 31.114135382414982 0.037200927734375 3 0.9443314643529372 5.206212328852789 1150.0 7.677130724901426 0.0 - - - - - - - 196.25 2 8 TGM6 transglutaminase 6 731 93 C20140711_OR018_03 C20140711_OR018_03 TB422528.[MT7]-AVNRLFGVEASGR.3y12_2.heavy 507.287 / 652.857 1882.0 30.934200286865234 40 14 10 6 10 2.567409132361413 31.114135382414982 0.037200927734375 3 0.9443314643529372 5.206212328852789 1882.0 14.947942583732058 0.0 - - - - - - - 209.16666666666666 3 6 TGM6 transglutaminase 6 733 93 C20140711_OR018_03 C20140711_OR018_03 TB422528.[MT7]-AVNRLFGVEASGR.3y5_1.heavy 507.287 / 519.252 2509.0 30.934200286865234 40 14 10 6 10 2.567409132361413 31.114135382414982 0.037200927734375 3 0.9443314643529372 5.206212328852789 2509.0 9.71974393222758 0.0 - - - - - - - 209.36363636363637 5 11 TGM6 transglutaminase 6 735 94 C20140711_OR018_03 C20140711_OR018_03 TB422321.[MT7]-ISLQDLSK[MT7].2y4_1.heavy 596.363 / 606.358 3920.0 34.214599609375 47 17 10 10 10 9.262056165072709 10.796738674194273 0.0 3 0.9779314105528109 8.292264415206667 3920.0 14.349999999999998 1.0 - - - - - - - 270.6666666666667 10 12 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 737 94 C20140711_OR018_03 C20140711_OR018_03 TB422321.[MT7]-ISLQDLSK[MT7].2y5_1.heavy 596.363 / 734.417 4032.0 34.214599609375 47 17 10 10 10 9.262056165072709 10.796738674194273 0.0 3 0.9779314105528109 8.292264415206667 4032.0 65.88 0.0 - - - - - - - 156.8 8 10 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 739 94 C20140711_OR018_03 C20140711_OR018_03 TB422321.[MT7]-ISLQDLSK[MT7].2b5_1.heavy 596.363 / 701.395 5376.0 34.214599609375 47 17 10 10 10 9.262056165072709 10.796738674194273 0.0 3 0.9779314105528109 8.292264415206667 5376.0 47.626666666666665 0.0 - - - - - - - 257.6 10 10 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 741 94 C20140711_OR018_03 C20140711_OR018_03 TB422321.[MT7]-ISLQDLSK[MT7].2y7_1.heavy 596.363 / 934.533 9632.0 34.214599609375 47 17 10 10 10 9.262056165072709 10.796738674194273 0.0 3 0.9779314105528109 8.292264415206667 9632.0 28.236666666666668 0.0 - - - - - - - 236.44444444444446 19 9 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 743 95 C20140711_OR018_03 C20140711_OR018_03 TB422525.[MT7]-DFLGSSEESEK[MT7].3b4_1.heavy 505.919 / 577.31 1655.0 27.82140064239502 43 17 10 6 10 3.293830345660813 24.25601879993015 0.039600372314453125 3 0.9718846496567205 7.342903244374364 1655.0 4.6000000000000005 2.0 - - - - - - - 260.8181818181818 3 11 LLGL1 lethal giant larvae homolog 1 (Drosophila) 745 95 C20140711_OR018_03 C20140711_OR018_03 TB422525.[MT7]-DFLGSSEESEK[MT7].3b5_1.heavy 505.919 / 664.342 221.0 27.82140064239502 43 17 10 6 10 3.293830345660813 24.25601879993015 0.039600372314453125 3 0.9718846496567205 7.342903244374364 221.0 0.2348997528151606 23.0 - - - - - - - 0.0 1 0 LLGL1 lethal giant larvae homolog 1 (Drosophila) 747 95 C20140711_OR018_03 C20140711_OR018_03 TB422525.[MT7]-DFLGSSEESEK[MT7].3y4_1.heavy 505.919 / 636.332 1876.0 27.82140064239502 43 17 10 6 10 3.293830345660813 24.25601879993015 0.039600372314453125 3 0.9718846496567205 7.342903244374364 1876.0 12.733031674208146 0.0 - - - - - - - 220.75 3 8 LLGL1 lethal giant larvae homolog 1 (Drosophila) 749 95 C20140711_OR018_03 C20140711_OR018_03 TB422525.[MT7]-DFLGSSEESEK[MT7].3b3_1.heavy 505.919 / 520.289 2207.0 27.82140064239502 43 17 10 6 10 3.293830345660813 24.25601879993015 0.039600372314453125 3 0.9718846496567205 7.342903244374364 2207.0 10.986515181323364 1.0 - - - - - - - 257.6666666666667 4 6 LLGL1 lethal giant larvae homolog 1 (Drosophila) 751 96 C20140711_OR018_03 C20140711_OR018_03 TB422523.[MT7]-GLLLTGHEDGTVR.3b6_1.heavy 504.615 / 699.452 1079.0 29.102850437164307 44 18 10 6 10 12.284729281154732 8.140187521543842 0.03619956970214844 3 0.9850073548504366 10.066514864629193 1079.0 3.496759259259259 1.0 - - - - - - - 694.0 3 7 LLGL1 lethal giant larvae homolog 1 (Drosophila) 753 96 C20140711_OR018_03 C20140711_OR018_03 TB422523.[MT7]-GLLLTGHEDGTVR.3y6_1.heavy 504.615 / 676.326 9066.0 29.102850437164307 44 18 10 6 10 12.284729281154732 8.140187521543842 0.03619956970214844 3 0.9850073548504366 10.066514864629193 9066.0 46.82906968760727 0.0 - - - - - - - 225.8181818181818 18 11 LLGL1 lethal giant larvae homolog 1 (Drosophila) 755 96 C20140711_OR018_03 C20140711_OR018_03 TB422523.[MT7]-GLLLTGHEDGTVR.3b4_1.heavy 504.615 / 541.383 4317.0 29.102850437164307 44 18 10 6 10 12.284729281154732 8.140187521543842 0.03619956970214844 3 0.9850073548504366 10.066514864629193 4317.0 13.24412962962963 0.0 - - - - - - - 225.0 8 12 LLGL1 lethal giant larvae homolog 1 (Drosophila) 757 96 C20140711_OR018_03 C20140711_OR018_03 TB422523.[MT7]-GLLLTGHEDGTVR.3y5_1.heavy 504.615 / 547.284 6691.0 29.102850437164307 44 18 10 6 10 12.284729281154732 8.140187521543842 0.03619956970214844 3 0.9850073548504366 10.066514864629193 6691.0 31.804495924495924 0.0 - - - - - - - 172.8 13 5 LLGL1 lethal giant larvae homolog 1 (Drosophila) 759 97 C20140711_OR018_03 C20140711_OR018_03 TB422521.[MT7]-YLSIPTVFFLR.3y6_1.heavy 500.63 / 782.456 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A3 761 97 C20140711_OR018_03 C20140711_OR018_03 TB422521.[MT7]-YLSIPTVFFLR.3b3_1.heavy 500.63 / 508.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A3 763 97 C20140711_OR018_03 C20140711_OR018_03 TB422521.[MT7]-YLSIPTVFFLR.3y4_1.heavy 500.63 / 582.34 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A3 765 97 C20140711_OR018_03 C20140711_OR018_03 TB422521.[MT7]-YLSIPTVFFLR.3y5_1.heavy 500.63 / 681.408 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A3 767 98 C20140711_OR018_03 C20140711_OR018_03 TB443677.[MT7]-GNSVTIR.2y5_1.heavy 445.762 / 575.351 1929.0 19.65019989013672 34 14 6 6 8 7.192234168634461 13.903885448572137 0.033599853515625 4 0.9492969089940527 5.457488709422725 1929.0 7.3429831613253675 0.0 - - - - - - - 224.0 3 9 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 769 98 C20140711_OR018_03 C20140711_OR018_03 TB443677.[MT7]-GNSVTIR.2b4_1.heavy 445.762 / 502.274 1578.0 19.65019989013672 34 14 6 6 8 7.192234168634461 13.903885448572137 0.033599853515625 4 0.9492969089940527 5.457488709422725 1578.0 4.23262814374768 3.0 - - - - - - - 204.6 3 15 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 771 98 C20140711_OR018_03 C20140711_OR018_03 TB443677.[MT7]-GNSVTIR.2y6_1.heavy 445.762 / 689.394 1315.0 19.65019989013672 34 14 6 6 8 7.192234168634461 13.903885448572137 0.033599853515625 4 0.9492969089940527 5.457488709422725 1315.0 1.4985754985754987 0.0 - - - - - - - 212.71428571428572 2 7 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 773 98 C20140711_OR018_03 C20140711_OR018_03 TB443677.[MT7]-GNSVTIR.2b5_1.heavy 445.762 / 603.322 1841.0 19.65019989013672 34 14 6 6 8 7.192234168634461 13.903885448572137 0.033599853515625 4 0.9492969089940527 5.457488709422725 1841.0 0.0 3.0 - - - - - - - 188.92307692307693 6 13 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 775 99 C20140711_OR018_03 C20140711_OR018_03 TB422327.[MT7]-DYWPGPGK[MT7].2b3_1.heavy 604.321 / 609.279 3417.0 30.056599617004395 42 16 10 6 10 1.8658354788731186 53.59529343948135 0.03520011901855469 3 0.963584907741403 6.447552223325987 3417.0 14.689906542056075 1.0 - - - - - - - 149.8 6 5 DUOX2 dual oxidase 2 777 99 C20140711_OR018_03 C20140711_OR018_03 TB422327.[MT7]-DYWPGPGK[MT7].2y4_1.heavy 604.321 / 502.311 3417.0 30.056599617004395 42 16 10 6 10 1.8658354788731186 53.59529343948135 0.03520011901855469 3 0.963584907741403 6.447552223325987 3417.0 4.479213483146068 0.0 - - - - - - - 654.125 6 8 DUOX2 dual oxidase 2 779 99 C20140711_OR018_03 C20140711_OR018_03 TB422327.[MT7]-DYWPGPGK[MT7].2y5_1.heavy 604.321 / 599.363 14308.0 30.056599617004395 42 16 10 6 10 1.8658354788731186 53.59529343948135 0.03520011901855469 3 0.963584907741403 6.447552223325987 14308.0 65.97224541244918 0.0 - - - - - - - 271.0769230769231 28 13 DUOX2 dual oxidase 2 781 99 C20140711_OR018_03 C20140711_OR018_03 TB422327.[MT7]-DYWPGPGK[MT7].2y6_1.heavy 604.321 / 785.443 1175.0 30.056599617004395 42 16 10 6 10 1.8658354788731186 53.59529343948135 0.03520011901855469 3 0.963584907741403 6.447552223325987 1175.0 2.6404494382022476 4.0 - - - - - - - 266.9166666666667 2 12 DUOX2 dual oxidase 2 783 100 C20140711_OR018_03 C20140711_OR018_03 TB432136.[MT7]-WWLDGPLVHVK[MT7].2b3_1.heavy 819.474 / 630.352 923.0 42.66732597351074 37 13 10 6 8 0.9116578367608148 66.57673896482058 0.03209686279296875 4 0.9038875139291925 3.9484902406208646 923.0 6.629999999999999 0.0 - - - - - - - 0.0 1 0 GLT6D1 glycosyltransferase 6 domain containing 1 785 100 C20140711_OR018_03 C20140711_OR018_03 TB432136.[MT7]-WWLDGPLVHVK[MT7].2y8_1.heavy 819.474 / 1008.6 1135.0 42.66732597351074 37 13 10 6 8 0.9116578367608148 66.57673896482058 0.03209686279296875 4 0.9038875139291925 3.9484902406208646 1135.0 14.387323943661972 1.0 - - - - - - - 167.35714285714286 3 14 GLT6D1 glycosyltransferase 6 domain containing 1 787 100 C20140711_OR018_03 C20140711_OR018_03 TB432136.[MT7]-WWLDGPLVHVK[MT7].2y3_1.heavy 819.474 / 527.342 2980.0 42.66732597351074 37 13 10 6 8 0.9116578367608148 66.57673896482058 0.03209686279296875 4 0.9038875139291925 3.9484902406208646 2980.0 47.638028169014085 0.0 - - - - - - - 220.1 5 10 GLT6D1 glycosyltransferase 6 domain containing 1 789 100 C20140711_OR018_03 C20140711_OR018_03 TB432136.[MT7]-WWLDGPLVHVK[MT7].2y7_1.heavy 819.474 / 893.569 3406.0 42.66732597351074 37 13 10 6 8 0.9116578367608148 66.57673896482058 0.03209686279296875 4 0.9038875139291925 3.9484902406208646 3406.0 12.952394366197183 0.0 - - - - - - - 213.0 6 15 GLT6D1 glycosyltransferase 6 domain containing 1 791 101 C20140711_OR018_03 C20140711_OR018_03 TB444242.[MT7]-LSWTLDSQLTPSGQFQALFPVGPVTPSHR.4y8_1.heavy 828.439 / 850.453 4150.0 48.29304885864258 41 15 10 6 10 3.300179805855076 30.301379283208483 0.03929901123046875 3 0.9536957475664526 5.712966980972544 4150.0 52.97042990792991 0.0 - - - - - - - 186.05882352941177 8 17 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 793 101 C20140711_OR018_03 C20140711_OR018_03 TB444242.[MT7]-LSWTLDSQLTPSGQFQALFPVGPVTPSHR.4y10_1.heavy 828.439 / 1046.57 15095.0 48.29304885864258 41 15 10 6 10 3.300179805855076 30.301379283208483 0.03929901123046875 3 0.9536957475664526 5.712966980972544 15095.0 132.18034445474206 0.0 - - - - - - - 225.76470588235293 30 17 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 795 101 C20140711_OR018_03 C20140711_OR018_03 TB444242.[MT7]-LSWTLDSQLTPSGQFQALFPVGPVTPSHR.4y11_1.heavy 828.439 / 1193.64 2334.0 48.29304885864258 41 15 10 6 10 3.300179805855076 30.301379283208483 0.03929901123046875 3 0.9536957475664526 5.712966980972544 2334.0 12.407755500767548 0.0 - - - - - - - 210.3684210526316 4 19 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 797 101 C20140711_OR018_03 C20140711_OR018_03 TB444242.[MT7]-LSWTLDSQLTPSGQFQALFPVGPVTPSHR.4b6_1.heavy 828.439 / 860.463 3787.0 48.29304885864258 41 15 10 6 10 3.300179805855076 30.301379283208483 0.03929901123046875 3 0.9536957475664526 5.712966980972544 3787.0 73.82813384076519 0.0 - - - - - - - 183.6153846153846 7 13 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 799 102 C20140711_OR018_03 C20140711_OR018_03 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 12617.0 22.912399291992188 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 12617.0 60.20294416243655 0.0 - - - - - - - 236.6 25 10 801 102 C20140711_OR018_03 C20140711_OR018_03 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 14391.0 22.912399291992188 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 14391.0 165.65174128711047 0.0 - - - - - - - 253.57142857142858 28 7 803 102 C20140711_OR018_03 C20140711_OR018_03 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 49680.0 22.912399291992188 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 49680.0 320.27208121827414 0.0 - - - - - - - 206.27272727272728 99 11 805 103 C20140711_OR018_03 C20140711_OR018_03 TB422421.[MT7]-APVVAIAVLDGR.2y8_1.heavy 662.907 / 814.478 5689.0 40.481300354003906 45 15 10 10 10 2.613938553542802 33.23759449167918 0.0 3 0.9568730150742978 5.921265220105483 5689.0 21.61013103548089 0.0 - - - - - - - 269.7692307692308 11 13 LLGL1 lethal giant larvae homolog 1 (Drosophila) 807 103 C20140711_OR018_03 C20140711_OR018_03 TB422421.[MT7]-APVVAIAVLDGR.2y9_1.heavy 662.907 / 913.547 4172.0 40.481300354003906 45 15 10 10 10 2.613938553542802 33.23759449167918 0.0 3 0.9568730150742978 5.921265220105483 4172.0 8.314084507042253 1.0 - - - - - - - 167.84615384615384 8 13 LLGL1 lethal giant larvae homolog 1 (Drosophila) 809 103 C20140711_OR018_03 C20140711_OR018_03 TB422421.[MT7]-APVVAIAVLDGR.2y6_1.heavy 662.907 / 630.357 3793.0 40.481300354003906 45 15 10 10 10 2.613938553542802 33.23759449167918 0.0 3 0.9568730150742978 5.921265220105483 3793.0 42.62555967383247 0.0 - - - - - - - 339.6666666666667 7 12 LLGL1 lethal giant larvae homolog 1 (Drosophila) 811 103 C20140711_OR018_03 C20140711_OR018_03 TB422421.[MT7]-APVVAIAVLDGR.2y11_1.heavy 662.907 / 1109.67 8913.0 40.481300354003906 45 15 10 10 10 2.613938553542802 33.23759449167918 0.0 3 0.9568730150742978 5.921265220105483 8913.0 54.43204530313125 0.0 - - - - - - - 216.85714285714286 17 7 LLGL1 lethal giant larvae homolog 1 (Drosophila) 813 104 C20140711_OR018_03 C20140711_OR018_03 TB422746.[MT7]-QLQVDLVSPHFPDIK[MT7].2y4_1.heavy 1012.57 / 616.379 4685.0 39.70339870452881 40 14 10 6 10 1.9210428879206067 52.05505854595622 0.036800384521484375 3 0.9389261491804327 4.968201567081595 4685.0 24.161470720944635 0.0 - - - - - - - 253.88888888888889 9 9 TGM6 transglutaminase 6 815 104 C20140711_OR018_03 C20140711_OR018_03 TB422746.[MT7]-QLQVDLVSPHFPDIK[MT7].2y8_1.heavy 1012.57 / 1084.59 2971.0 39.70339870452881 40 14 10 6 10 1.9210428879206067 52.05505854595622 0.036800384521484375 3 0.9389261491804327 4.968201567081595 2971.0 4.742533684337277 1.0 - - - - - - - 266.8333333333333 5 6 TGM6 transglutaminase 6 817 104 C20140711_OR018_03 C20140711_OR018_03 TB422746.[MT7]-QLQVDLVSPHFPDIK[MT7].2b6_1.heavy 1012.57 / 841.49 1485.0 39.70339870452881 40 14 10 6 10 1.9210428879206067 52.05505854595622 0.036800384521484375 3 0.9389261491804327 4.968201567081595 1485.0 2.5938864628820966 0.0 - - - - - - - 177.77777777777777 2 9 TGM6 transglutaminase 6 819 104 C20140711_OR018_03 C20140711_OR018_03 TB422746.[MT7]-QLQVDLVSPHFPDIK[MT7].2b5_1.heavy 1012.57 / 728.406 4113.0 39.70339870452881 40 14 10 6 10 1.9210428879206067 52.05505854595622 0.036800384521484375 3 0.9389261491804327 4.968201567081595 4113.0 8.227289280189714 0.0 - - - - - - - 209.5 8 6 TGM6 transglutaminase 6 821 105 C20140711_OR018_03 C20140711_OR018_03 TB443723.[MT7]-GEGWTAAR.2b4_1.heavy 496.258 / 574.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 823 105 C20140711_OR018_03 C20140711_OR018_03 TB443723.[MT7]-GEGWTAAR.2y6_1.heavy 496.258 / 661.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 825 105 C20140711_OR018_03 C20140711_OR018_03 TB443723.[MT7]-GEGWTAAR.2b5_1.heavy 496.258 / 675.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 827 105 C20140711_OR018_03 C20140711_OR018_03 TB443723.[MT7]-GEGWTAAR.2y7_1.heavy 496.258 / 790.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 829 106 C20140711_OR018_03 C20140711_OR018_03 TB422744.[MT7]-VAHNYTMEHFMEVIR.3y7_1.heavy 674.333 / 931.482 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 831 106 C20140711_OR018_03 C20140711_OR018_03 TB422744.[MT7]-VAHNYTMEHFMEVIR.3y6_1.heavy 674.333 / 794.423 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 833 106 C20140711_OR018_03 C20140711_OR018_03 TB422744.[MT7]-VAHNYTMEHFMEVIR.3b4_1.heavy 674.333 / 566.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 835 106 C20140711_OR018_03 C20140711_OR018_03 TB422744.[MT7]-VAHNYTMEHFMEVIR.3y5_1.heavy 674.333 / 647.354 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 837 107 C20140711_OR018_03 C20140711_OR018_03 TB422210.[MT7]-TAAHVGIR.2y5_1.heavy 484.792 / 581.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 839 107 C20140711_OR018_03 C20140711_OR018_03 TB422210.[MT7]-TAAHVGIR.2y6_1.heavy 484.792 / 652.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 841 107 C20140711_OR018_03 C20140711_OR018_03 TB422210.[MT7]-TAAHVGIR.2b7_1.heavy 484.792 / 794.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 843 107 C20140711_OR018_03 C20140711_OR018_03 TB422210.[MT7]-TAAHVGIR.2y7_1.heavy 484.792 / 723.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 845 108 C20140711_OR018_03 C20140711_OR018_03 TB422415.[MT7]-ILLAAMC[CAM]LVTK[MT7]GEK[MT7].3b4_1.heavy 660.397 / 555.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 847 108 C20140711_OR018_03 C20140711_OR018_03 TB422415.[MT7]-ILLAAMC[CAM]LVTK[MT7]GEK[MT7].3b5_1.heavy 660.397 / 626.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 849 108 C20140711_OR018_03 C20140711_OR018_03 TB422415.[MT7]-ILLAAMC[CAM]LVTK[MT7]GEK[MT7].3y8_1.heavy 660.397 / 1222.71 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 851 108 C20140711_OR018_03 C20140711_OR018_03 TB422415.[MT7]-ILLAAMC[CAM]LVTK[MT7]GEK[MT7].3y5_1.heavy 660.397 / 850.524 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 853 109 C20140711_OR018_03 C20140711_OR018_03 TB443726.[MT7]-VFTLPK[MT7].2b3_1.heavy 496.823 / 492.294 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL2;LLGL1 lethal giant larvae homolog 2 (Drosophila);lethal giant larvae homolog 1 (Drosophila) 855 109 C20140711_OR018_03 C20140711_OR018_03 TB443726.[MT7]-VFTLPK[MT7].2y4_1.heavy 496.823 / 602.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL2;LLGL1 lethal giant larvae homolog 2 (Drosophila);lethal giant larvae homolog 1 (Drosophila) 857 109 C20140711_OR018_03 C20140711_OR018_03 TB443726.[MT7]-VFTLPK[MT7].2y5_1.heavy 496.823 / 749.468 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL2;LLGL1 lethal giant larvae homolog 2 (Drosophila);lethal giant larvae homolog 1 (Drosophila) 859 109 C20140711_OR018_03 C20140711_OR018_03 TB443726.[MT7]-VFTLPK[MT7].2y3_1.heavy 496.823 / 501.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL2;LLGL1 lethal giant larvae homolog 2 (Drosophila);lethal giant larvae homolog 1 (Drosophila) 861 110 C20140711_OR018_03 C20140711_OR018_03 TB422417.[MT7]-AVFQTSELER.3y6_1.heavy 441.906 / 734.368 625.0 31.256099700927734 33 13 8 6 6 1.3650423622445207 50.08214991283265 0.03440093994140625 5 0.9192678517347086 4.313929940683 625.0 5.709134615384616 1.0 - - - - - - - 0.0 1 0 TGM6 transglutaminase 6 863 110 C20140711_OR018_03 C20140711_OR018_03 TB422417.[MT7]-AVFQTSELER.3y4_1.heavy 441.906 / 546.288 2398.0 31.256099700927734 33 13 8 6 6 1.3650423622445207 50.08214991283265 0.03440093994140625 5 0.9192678517347086 4.313929940683 2398.0 25.64781518800688 0.0 - - - - - - - 289.55555555555554 4 9 TGM6 transglutaminase 6 865 110 C20140711_OR018_03 C20140711_OR018_03 TB422417.[MT7]-AVFQTSELER.3b3_1.heavy 441.906 / 462.283 1355.0 31.256099700927734 33 13 8 6 6 1.3650423622445207 50.08214991283265 0.03440093994140625 5 0.9192678517347086 4.313929940683 1355.0 14.185937730695407 2.0 - - - - - - - 225.66666666666666 6 12 TGM6 transglutaminase 6 867 110 C20140711_OR018_03 C20140711_OR018_03 TB422417.[MT7]-AVFQTSELER.3y5_1.heavy 441.906 / 633.32 1459.0 31.256099700927734 33 13 8 6 6 1.3650423622445207 50.08214991283265 0.03440093994140625 5 0.9192678517347086 4.313929940683 1459.0 18.03580732366675 1.0 - - - - - - - 208.28571428571428 5 7 TGM6 transglutaminase 6 869 111 C20140711_OR018_03 C20140711_OR018_03 TB422517.[MT7]-LQFGVAVLDDK[MT7].3b6_1.heavy 498.292 / 760.447 1628.0 40.42224979400635 35 12 10 3 10 1.4301444723102423 47.42176503390049 0.06599807739257812 3 0.897513045049031 3.821617521656885 1628.0 14.388293248333817 0.0 - - - - - - - 152.5 3 4 KLHL5 kelch-like 5 (Drosophila) 871 111 C20140711_OR018_03 C20140711_OR018_03 TB422517.[MT7]-LQFGVAVLDDK[MT7].3y3_1.heavy 498.292 / 521.269 1628.0 40.42224979400635 35 12 10 3 10 1.4301444723102423 47.42176503390049 0.06599807739257812 3 0.897513045049031 3.821617521656885 1628.0 15.518592092574734 0.0 - - - - - - - 223.6 3 5 KLHL5 kelch-like 5 (Drosophila) 873 111 C20140711_OR018_03 C20140711_OR018_03 TB422517.[MT7]-LQFGVAVLDDK[MT7].3b4_1.heavy 498.292 / 590.342 915.0 40.42224979400635 35 12 10 3 10 1.4301444723102423 47.42176503390049 0.06599807739257812 3 0.897513045049031 3.821617521656885 915.0 10.176470588235293 2.0 - - - - - - - 0.0 1 0 KLHL5 kelch-like 5 (Drosophila) 875 111 C20140711_OR018_03 C20140711_OR018_03 TB422517.[MT7]-LQFGVAVLDDK[MT7].3b5_1.heavy 498.292 / 689.41 509.0 40.42224979400635 35 12 10 3 10 1.4301444723102423 47.42176503390049 0.06599807739257812 3 0.897513045049031 3.821617521656885 509.0 0.9503685503685503 8.0 - - - - - - - 268.09090909090907 2 11 KLHL5 kelch-like 5 (Drosophila) 877 112 C20140711_OR018_03 C20140711_OR018_03 TB422313.[MT7]-QLNRLETR.2y4_1.heavy 587.345 / 518.293 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 879 112 C20140711_OR018_03 C20140711_OR018_03 TB422313.[MT7]-QLNRLETR.2b4_1.heavy 587.345 / 656.396 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 881 112 C20140711_OR018_03 C20140711_OR018_03 TB422313.[MT7]-QLNRLETR.2b6_1.heavy 587.345 / 898.523 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 883 112 C20140711_OR018_03 C20140711_OR018_03 TB422313.[MT7]-QLNRLETR.2b5_1.heavy 587.345 / 769.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 885 113 C20140711_OR018_03 C20140711_OR018_03 TB422605.[MT7]-LK[MT7]QELFAFNK[MT7].2b4_1.heavy 835.504 / 787.492 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL1 lethal giant larvae homolog 1 (Drosophila) 887 113 C20140711_OR018_03 C20140711_OR018_03 TB422605.[MT7]-LK[MT7]QELFAFNK[MT7].2b6_1.heavy 835.504 / 1047.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL1 lethal giant larvae homolog 1 (Drosophila) 889 113 C20140711_OR018_03 C20140711_OR018_03 TB422605.[MT7]-LK[MT7]QELFAFNK[MT7].2y3_1.heavy 835.504 / 552.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL1 lethal giant larvae homolog 1 (Drosophila) 891 113 C20140711_OR018_03 C20140711_OR018_03 TB422605.[MT7]-LK[MT7]QELFAFNK[MT7].2b5_1.heavy 835.504 / 900.576 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL1 lethal giant larvae homolog 1 (Drosophila) 893 114 C20140711_OR018_03 C20140711_OR018_03 TB443866.[MT7]-QIMTTDDK[MT7].2y4_1.heavy 620.328 / 622.316 5059.0 22.00550079345703 45 15 10 10 10 2.0751245676976273 38.92247101754066 0.0 3 0.9507856670958569 5.540119727171538 5059.0 28.61546853075922 0.0 - - - - - - - 281.0 10 6 OR4C45 olfactory receptor, family 4, subfamily C, member 45 895 114 C20140711_OR018_03 C20140711_OR018_03 TB443866.[MT7]-QIMTTDDK[MT7].2y5_1.heavy 620.328 / 723.364 5158.0 22.00550079345703 45 15 10 10 10 2.0751245676976273 38.92247101754066 0.0 3 0.9507856670958569 5.540119727171538 5158.0 37.222037757931965 0.0 - - - - - - - 223.0 10 4 OR4C45 olfactory receptor, family 4, subfamily C, member 45 897 114 C20140711_OR018_03 C20140711_OR018_03 TB443866.[MT7]-QIMTTDDK[MT7].2y6_1.heavy 620.328 / 854.405 6844.0 22.00550079345703 45 15 10 10 10 2.0751245676976273 38.92247101754066 0.0 3 0.9507856670958569 5.540119727171538 6844.0 78.79018409905507 0.0 - - - - - - - 240.85714285714286 13 7 OR4C45 olfactory receptor, family 4, subfamily C, member 45 899 114 C20140711_OR018_03 C20140711_OR018_03 TB443866.[MT7]-QIMTTDDK[MT7].2y7_1.heavy 620.328 / 967.489 11010.0 22.00550079345703 45 15 10 10 10 2.0751245676976273 38.92247101754066 0.0 3 0.9507856670958569 5.540119727171538 11010.0 107.86374762746254 0.0 - - - - - - - 225.1818181818182 22 11 OR4C45 olfactory receptor, family 4, subfamily C, member 45 901 115 C20140711_OR018_03 C20140711_OR018_03 TB422514.[MT7]-IYEEAHQQGK[MT7].3b4_1.heavy 497.6 / 679.342 3466.0 20.118199825286865 30 18 0 6 6 3.8332865396213722 26.08727497054717 0.03560066223144531 5 0.987262054266108 10.923217733579055 3466.0 25.957489177489176 0.0 - - - - - - - 219.15384615384616 6 13 ITIH5L inter-alpha (globulin) inhibitor H5-like 903 115 C20140711_OR018_03 C20140711_OR018_03 TB422514.[MT7]-IYEEAHQQGK[MT7].3b5_1.heavy 497.6 / 750.379 3158.0 20.118199825286865 30 18 0 6 6 3.8332865396213722 26.08727497054717 0.03560066223144531 5 0.987262054266108 10.923217733579055 3158.0 40.07554730983303 2.0 - - - - - - - 192.5 28 10 ITIH5L inter-alpha (globulin) inhibitor H5-like 905 115 C20140711_OR018_03 C20140711_OR018_03 TB422514.[MT7]-IYEEAHQQGK[MT7].3y4_1.heavy 497.6 / 604.354 2311.0 20.118199825286865 30 18 0 6 6 3.8332865396213722 26.08727497054717 0.03560066223144531 5 0.987262054266108 10.923217733579055 2311.0 13.805974025974026 1.0 - - - - - - - 196.0 10 11 ITIH5L inter-alpha (globulin) inhibitor H5-like 907 115 C20140711_OR018_03 C20140711_OR018_03 TB422514.[MT7]-IYEEAHQQGK[MT7].3b3_1.heavy 497.6 / 550.299 2003.0 20.118199825286865 30 18 0 6 6 3.8332865396213722 26.08727497054717 0.03560066223144531 5 0.987262054266108 10.923217733579055 2003.0 9.79822510822511 0.0 - - - - - - - 225.5 4 14 ITIH5L inter-alpha (globulin) inhibitor H5-like 909 116 C20140711_OR018_03 C20140711_OR018_03 TB432204.[MT7]-VEEEGAGEGAGGEAGADK[MT7].2b3_1.heavy 960.955 / 502.263 879.0 20.278874397277832 37 11 10 6 10 1.9315937132158076 36.77428336535887 0.035900115966796875 3 0.8638960475110316 3.3065378531290244 879.0 14.6390125 0.0 - - - - - - - 0.0 1 0 KCNJ9 potassium inwardly-rectifying channel, subfamily J, member 9 911 116 C20140711_OR018_03 C20140711_OR018_03 TB432204.[MT7]-VEEEGAGEGAGGEAGADK[MT7].2b4_1.heavy 960.955 / 631.305 1279.0 20.278874397277832 37 11 10 6 10 1.9315937132158076 36.77428336535887 0.035900115966796875 3 0.8638960475110316 3.3065378531290244 1279.0 30.536125 0.0 - - - - - - - 146.66666666666666 2 6 KCNJ9 potassium inwardly-rectifying channel, subfamily J, member 9 913 116 C20140711_OR018_03 C20140711_OR018_03 TB432204.[MT7]-VEEEGAGEGAGGEAGADK[MT7].2y10_1.heavy 960.955 / 976.482 1519.0 20.278874397277832 37 11 10 6 10 1.9315937132158076 36.77428336535887 0.035900115966796875 3 0.8638960475110316 3.3065378531290244 1519.0 21.519166666666667 0.0 - - - - - - - 160.0 3 5 KCNJ9 potassium inwardly-rectifying channel, subfamily J, member 9 915 116 C20140711_OR018_03 C20140711_OR018_03 TB432204.[MT7]-VEEEGAGEGAGGEAGADK[MT7].2b5_1.heavy 960.955 / 688.327 240.0 20.278874397277832 37 11 10 6 10 1.9315937132158076 36.77428336535887 0.035900115966796875 3 0.8638960475110316 3.3065378531290244 240.0 3.0 1.0 - - - - - - - 0.0 0 0 KCNJ9 potassium inwardly-rectifying channel, subfamily J, member 9 917 117 C20140711_OR018_03 C20140711_OR018_03 TB432203.[MT7]-VEEEGAGEGAGGEAGADK[MT7].3b6_1.heavy 640.972 / 759.364 7010.0 20.269899368286133 45 15 10 10 10 3.5521326367527615 28.152101913462495 0.0 3 0.9503472465774854 5.515401371258005 7010.0 37.299944865392796 0.0 - - - - - - - 223.06666666666666 14 15 KCNJ9 potassium inwardly-rectifying channel, subfamily J, member 9 919 117 C20140711_OR018_03 C20140711_OR018_03 TB432203.[MT7]-VEEEGAGEGAGGEAGADK[MT7].3b5_1.heavy 640.972 / 688.327 4939.0 20.269899368286133 45 15 10 10 10 3.5521326367527615 28.152101913462495 0.0 3 0.9503472465774854 5.515401371258005 4939.0 67.84920226130653 0.0 - - - - - - - 239.0 9 5 KCNJ9 potassium inwardly-rectifying channel, subfamily J, member 9 921 117 C20140711_OR018_03 C20140711_OR018_03 TB432203.[MT7]-VEEEGAGEGAGGEAGADK[MT7].3y4_1.heavy 640.972 / 534.3 13463.0 20.269899368286133 45 15 10 10 10 3.5521326367527615 28.152101913462495 0.0 3 0.9503472465774854 5.515401371258005 13463.0 75.12981576026637 0.0 - - - - - - - 180.9090909090909 26 11 KCNJ9 potassium inwardly-rectifying channel, subfamily J, member 9 923 117 C20140711_OR018_03 C20140711_OR018_03 TB432203.[MT7]-VEEEGAGEGAGGEAGADK[MT7].3y5_1.heavy 640.972 / 605.338 9798.0 20.269899368286133 45 15 10 10 10 3.5521326367527615 28.152101913462495 0.0 3 0.9503472465774854 5.515401371258005 9798.0 23.409018477039993 0.0 - - - - - - - 206.11764705882354 19 17 KCNJ9 potassium inwardly-rectifying channel, subfamily J, member 9 925 118 C20140711_OR018_03 C20140711_OR018_03 TB422314.[MT7]-C[CAM]GPASVTAIR.2y8_1.heavy 588.32 / 814.478 729.0 25.804899215698242 41 20 10 5 6 13.84211922991988 7.224327311373607 0.046199798583984375 6 0.9927522651346818 14.487670744942562 729.0 7.218782307692307 2.0 - - - - - - - 0.0 1 0 TGM6 transglutaminase 6 927 118 C20140711_OR018_03 C20140711_OR018_03 TB422314.[MT7]-C[CAM]GPASVTAIR.2y9_1.heavy 588.32 / 871.5 2394.0 25.804899215698242 41 20 10 5 6 13.84211922991988 7.224327311373607 0.046199798583984375 6 0.9927522651346818 14.487670744942562 2394.0 25.951767094017097 0.0 - - - - - - - 156.0 4 4 TGM6 transglutaminase 6 929 118 C20140711_OR018_03 C20140711_OR018_03 TB422314.[MT7]-C[CAM]GPASVTAIR.2b5_1.heavy 588.32 / 617.283 625.0 25.804899215698242 41 20 10 5 6 13.84211922991988 7.224327311373607 0.046199798583984375 6 0.9927522651346818 14.487670744942562 625.0 3.605769230769231 8.0 - - - - - - - 190.66666666666666 2 12 TGM6 transglutaminase 6 931 118 C20140711_OR018_03 C20140711_OR018_03 TB422314.[MT7]-C[CAM]GPASVTAIR.2y7_1.heavy 588.32 / 717.425 729.0 25.804899215698242 41 20 10 5 6 13.84211922991988 7.224327311373607 0.046199798583984375 6 0.9927522651346818 14.487670744942562 729.0 1.8692307692307693 13.0 - - - - - - - 225.33333333333334 2 12 TGM6 transglutaminase 6 933 119 C20140711_OR018_03 C20140711_OR018_03 TB432207.[MT7]-AVGSDSRVDITDLYK[MT7].3y10_2.heavy 643.017 / 677.378 32515.0 32.82780075073242 44 14 10 10 10 1.6136048558148464 51.84675663573175 0.0 3 0.938942032283727 4.968854445839739 32515.0 114.15448127224636 0.0 - - - - - - - 293.8 65 10 TGM6 transglutaminase 6 935 119 C20140711_OR018_03 C20140711_OR018_03 TB432207.[MT7]-AVGSDSRVDITDLYK[MT7].3y3_1.heavy 643.017 / 567.362 11516.0 32.82780075073242 44 14 10 10 10 1.6136048558148464 51.84675663573175 0.0 3 0.938942032283727 4.968854445839739 11516.0 46.68312475833495 1.0 - - - - - - - 271.2 23 10 TGM6 transglutaminase 6 937 119 C20140711_OR018_03 C20140711_OR018_03 TB432207.[MT7]-AVGSDSRVDITDLYK[MT7].3b5_1.heavy 643.017 / 574.295 23144.0 32.82780075073242 44 14 10 10 10 1.6136048558148464 51.84675663573175 0.0 3 0.938942032283727 4.968854445839739 23144.0 210.28594716389642 0.0 - - - - - - - 237.3 46 10 TGM6 transglutaminase 6 939 119 C20140711_OR018_03 C20140711_OR018_03 TB432207.[MT7]-AVGSDSRVDITDLYK[MT7].3b12_2.heavy 643.017 / 680.845 8242.0 32.82780075073242 44 14 10 10 10 1.6136048558148464 51.84675663573175 0.0 3 0.938942032283727 4.968854445839739 8242.0 21.303855083596574 0.0 - - - - - - - 268.375 16 8 TGM6 transglutaminase 6 941 120 C20140711_OR018_03 C20140711_OR018_03 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 75190.0 32.48979949951172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 75190.0 328.0225715476315 0.0 - - - - - - - 231.8 150 5 943 120 C20140711_OR018_03 C20140711_OR018_03 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 77044.0 32.48979949951172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 77044.0 239.13197541566927 0.0 - - - - - - - 232.0 154 7 945 120 C20140711_OR018_03 C20140711_OR018_03 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 154088.0 32.48979949951172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 154088.0 463.419505399909 0.0 - - - - - - - 304.375 308 8 947 121 C20140711_OR018_03 C20140711_OR018_03 TB432141.[MT7]-IYGAPGVEFTGLHR.3y7_1.heavy 554.302 / 859.442 3234.0 34.76089859008789 48 18 10 10 10 10.49111840932338 9.531872208317726 0.0 3 0.9815161532999622 9.063479557986252 3234.0 22.396089666746583 2.0 - - - - - - - 240.14285714285714 7 7 LLGL1 lethal giant larvae homolog 1 (Drosophila) 949 121 C20140711_OR018_03 C20140711_OR018_03 TB432141.[MT7]-IYGAPGVEFTGLHR.3b6_1.heavy 554.302 / 703.39 6338.0 34.76089859008789 48 18 10 10 10 10.49111840932338 9.531872208317726 0.0 3 0.9815161532999622 9.063479557986252 6338.0 31.819919676797575 0.0 - - - - - - - 181.0 12 5 LLGL1 lethal giant larvae homolog 1 (Drosophila) 951 121 C20140711_OR018_03 C20140711_OR018_03 TB432141.[MT7]-IYGAPGVEFTGLHR.3b4_1.heavy 554.302 / 549.315 20696.0 34.76089859008789 48 18 10 10 10 10.49111840932338 9.531872208317726 0.0 3 0.9815161532999622 9.063479557986252 20696.0 40.417823642138416 0.0 - - - - - - - 215.33333333333334 41 6 LLGL1 lethal giant larvae homolog 1 (Drosophila) 953 121 C20140711_OR018_03 C20140711_OR018_03 TB432141.[MT7]-IYGAPGVEFTGLHR.3y5_1.heavy 554.302 / 583.331 7114.0 34.76089859008789 48 18 10 10 10 10.49111840932338 9.531872208317726 0.0 3 0.9815161532999622 9.063479557986252 7114.0 18.07572706043174 0.0 - - - - - - - 232.8 14 5 LLGL1 lethal giant larvae homolog 1 (Drosophila) 955 122 C20140711_OR018_03 C20140711_OR018_03 TB432140.[MT7]-DTEQPGEVSALGPGR.3y7_1.heavy 552.948 / 657.368 9521.0 26.40744924545288 40 15 10 5 10 4.956817543982169 20.174234599658632 0.04260063171386719 3 0.9503181622078113 5.513773130206059 9521.0 52.49732923076923 0.0 - - - - - - - 204.33333333333334 19 9 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 957 122 C20140711_OR018_03 C20140711_OR018_03 TB432140.[MT7]-DTEQPGEVSALGPGR.3y6_1.heavy 552.948 / 570.336 3787.0 26.40744924545288 40 15 10 5 10 4.956817543982169 20.174234599658632 0.04260063171386719 3 0.9503181622078113 5.513773130206059 3787.0 45.5497339031339 0.0 - - - - - - - 240.44444444444446 7 9 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 959 122 C20140711_OR018_03 C20140711_OR018_03 TB432140.[MT7]-DTEQPGEVSALGPGR.3b4_1.heavy 552.948 / 618.285 21099.0 26.40744924545288 40 15 10 5 10 4.956817543982169 20.174234599658632 0.04260063171386719 3 0.9503181622078113 5.513773130206059 21099.0 205.93693453691472 0.0 - - - - - - - 240.22222222222223 42 9 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 961 122 C20140711_OR018_03 C20140711_OR018_03 TB432140.[MT7]-DTEQPGEVSALGPGR.3y8_1.heavy 552.948 / 756.436 1515.0 26.40744924545288 40 15 10 5 10 4.956817543982169 20.174234599658632 0.04260063171386719 3 0.9503181622078113 5.513773130206059 1515.0 0.9649489184118355 7.0 - - - - - - - 216.36363636363637 5 11 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 963 123 C20140711_OR018_03 C20140711_OR018_03 TB444233.[MT7]-SEETVILQC[CAM]WSDVMFEHFLLHR.4y9_1.heavy 730.862 / 1229.62 1409.0 52.85085105895996 44 17 10 7 10 7.496712606127929 13.339180151878633 0.029300689697265625 3 0.9727176909554001 7.454687659880477 1409.0 26.913483146067417 0.0 - - - - - - - 108.9375 2 16 LOC100506173;KIR2DL1;KIR2DS1;KIR2DS4;KIR2DS5 putative killer cell immunoglobulin-like receptor like protein KIR3DP1-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 965 123 C20140711_OR018_03 C20140711_OR018_03 TB444233.[MT7]-SEETVILQC[CAM]WSDVMFEHFLLHR.4b4_1.heavy 730.862 / 591.274 5680.0 52.85085105895996 44 17 10 7 10 7.496712606127929 13.339180151878633 0.029300689697265625 3 0.9727176909554001 7.454687659880477 5680.0 147.05830845771143 0.0 - - - - - - - 113.05882352941177 11 17 LOC100506173;KIR2DL1;KIR2DS1;KIR2DS4;KIR2DS5 putative killer cell immunoglobulin-like receptor like protein KIR3DP1-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 967 123 C20140711_OR018_03 C20140711_OR018_03 TB444233.[MT7]-SEETVILQC[CAM]WSDVMFEHFLLHR.4b5_1.heavy 730.862 / 690.343 7916.0 52.85085105895996 44 17 10 7 10 7.496712606127929 13.339180151878633 0.029300689697265625 3 0.9727176909554001 7.454687659880477 7916.0 87.54948896631825 0.0 - - - - - - - 81.05263157894737 15 19 LOC100506173;KIR2DL1;KIR2DS1;KIR2DS4;KIR2DS5 putative killer cell immunoglobulin-like receptor like protein KIR3DP1-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 969 123 C20140711_OR018_03 C20140711_OR018_03 TB444233.[MT7]-SEETVILQC[CAM]WSDVMFEHFLLHR.4b6_1.heavy 730.862 / 803.427 3712.0 52.85085105895996 44 17 10 7 10 7.496712606127929 13.339180151878633 0.029300689697265625 3 0.9727176909554001 7.454687659880477 3712.0 55.754200426439226 0.0 - - - - - - - 79.38888888888889 7 18 LOC100506173;KIR2DL1;KIR2DS1;KIR2DS4;KIR2DS5 putative killer cell immunoglobulin-like receptor like protein KIR3DP1-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 971 124 C20140711_OR018_03 C20140711_OR018_03 TB432045.[MT7]-GVVQGQWQGK[MT7].2y4_1.heavy 687.89 / 662.374 1798.0 25.724175453186035 41 16 10 5 10 2.3652461461692957 33.72876390795604 0.045299530029296875 3 0.9669031700065118 6.764941118755271 1798.0 9.96415359392218 0.0 - - - - - - - 176.0 3 6 TGM6 transglutaminase 6 973 124 C20140711_OR018_03 C20140711_OR018_03 TB432045.[MT7]-GVVQGQWQGK[MT7].2b4_1.heavy 687.89 / 528.326 2961.0 25.724175453186035 41 16 10 5 10 2.3652461461692957 33.72876390795604 0.045299530029296875 3 0.9669031700065118 6.764941118755271 2961.0 23.373869361759382 0.0 - - - - - - - 317.0 5 2 TGM6 transglutaminase 6 975 124 C20140711_OR018_03 C20140711_OR018_03 TB432045.[MT7]-GVVQGQWQGK[MT7].2y6_1.heavy 687.89 / 847.454 1903.0 25.724175453186035 41 16 10 5 10 2.3652461461692957 33.72876390795604 0.045299530029296875 3 0.9669031700065118 6.764941118755271 1903.0 0.5194706994328921 1.0 - - - - - - - 211.33333333333334 3 3 TGM6 transglutaminase 6 977 124 C20140711_OR018_03 C20140711_OR018_03 TB432045.[MT7]-GVVQGQWQGK[MT7].2y7_1.heavy 687.89 / 975.513 2432.0 25.724175453186035 41 16 10 5 10 2.3652461461692957 33.72876390795604 0.045299530029296875 3 0.9669031700065118 6.764941118755271 2432.0 12.788716916124123 0.0 - - - - - - - 281.8333333333333 4 6 TGM6 transglutaminase 6 979 125 C20140711_OR018_03 C20140711_OR018_03 TB444132.[MT7]-TDWLAPVLWEGTFDR.3b4_1.heavy 650.667 / 660.347 6153.0 50.86149978637695 46 16 10 10 10 6.826334936637859 14.649149350010141 0.0 3 0.9693405502790805 7.030145267456734 6153.0 82.10416451969084 0.0 - - - - - - - 134.6 12 15 GLT6D1 glycosyltransferase 6 domain containing 1 981 125 C20140711_OR018_03 C20140711_OR018_03 TB444132.[MT7]-TDWLAPVLWEGTFDR.3b5_1.heavy 650.667 / 731.385 5492.0 50.86149978637695 46 16 10 10 10 6.826334936637859 14.649149350010141 0.0 3 0.9693405502790805 7.030145267456734 5492.0 74.26728496634256 0.0 - - - - - - - 156.41666666666666 10 12 GLT6D1 glycosyltransferase 6 domain containing 1 983 125 C20140711_OR018_03 C20140711_OR018_03 TB444132.[MT7]-TDWLAPVLWEGTFDR.3b3_1.heavy 650.667 / 547.263 5666.0 50.86149978637695 46 16 10 10 10 6.826334936637859 14.649149350010141 0.0 3 0.9693405502790805 7.030145267456734 5666.0 83.82199501936913 1.0 - - - - - - - 139.125 11 16 GLT6D1 glycosyltransferase 6 domain containing 1 985 125 C20140711_OR018_03 C20140711_OR018_03 TB444132.[MT7]-TDWLAPVLWEGTFDR.3y5_1.heavy 650.667 / 595.284 7022.0 50.86149978637695 46 16 10 10 10 6.826334936637859 14.649149350010141 0.0 3 0.9693405502790805 7.030145267456734 7022.0 15.974899229783531 1.0 - - - - - - - 127.5 16 18 GLT6D1 glycosyltransferase 6 domain containing 1 987 126 C20140711_OR018_03 C20140711_OR018_03 TB432044.[MT7]-GQPPLY[MT7]HLR.3y7_1.heavy 456.938 / 1039.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 989 126 C20140711_OR018_03 C20140711_OR018_03 TB432044.[MT7]-GQPPLY[MT7]HLR.3y6_1.heavy 456.938 / 942.564 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 991 126 C20140711_OR018_03 C20140711_OR018_03 TB432044.[MT7]-GQPPLY[MT7]HLR.3y7_2.heavy 456.938 / 520.312 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 993 126 C20140711_OR018_03 C20140711_OR018_03 TB432044.[MT7]-GQPPLY[MT7]HLR.3y4_1.heavy 456.938 / 732.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 995 127 C20140711_OR018_03 C20140711_OR018_03 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 150234.0 26.813100814819336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 150234.0 207.55124770761245 0.0 - - - - - - - 1409.0 300 1 997 127 C20140711_OR018_03 C20140711_OR018_03 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 199445.0 26.813100814819336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 199445.0 179.59528595455959 0.0 - - - - - - - 3329.285714285714 398 7 999 127 C20140711_OR018_03 C20140711_OR018_03 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 248439.0 26.813100814819336 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 248439.0 214.66144917299334 0.0 - - - - - - - 2276.0 496 1 1001 128 C20140711_OR018_03 C20140711_OR018_03 TB431925.[MT7]-GEAGRPGK[MT7].2y3_1.heavy 530.311 / 445.289 1070.0 13.803699970245361 38 12 10 6 10 1.420567827466323 44.54168671125926 0.036400794982910156 3 0.8961518489591529 3.7960412227524936 1070.0 2.17258883248731 0.0 - - - - - - - 70.3157894736842 2 19 C1QL3 complement component 1, q subcomponent-like 3 1003 128 C20140711_OR018_03 C20140711_OR018_03 TB431925.[MT7]-GEAGRPGK[MT7].2y6_1.heavy 530.311 / 729.449 1114.0 13.803699970245361 38 12 10 6 10 1.420567827466323 44.54168671125926 0.036400794982910156 3 0.8961518489591529 3.7960412227524936 1114.0 21.72872949680289 0.0 - - - - - - - 73.875 2 8 C1QL3 complement component 1, q subcomponent-like 3 1005 128 C20140711_OR018_03 C20140711_OR018_03 TB431925.[MT7]-GEAGRPGK[MT7].2b5_1.heavy 530.311 / 615.333 590.0 13.803699970245361 38 12 10 6 10 1.420567827466323 44.54168671125926 0.036400794982910156 3 0.8961518489591529 3.7960412227524936 590.0 36.47272727272727 0.0 - - - - - - - 0.0 1 0 C1QL3 complement component 1, q subcomponent-like 3 1007 128 C20140711_OR018_03 C20140711_OR018_03 TB431925.[MT7]-GEAGRPGK[MT7].2y7_1.heavy 530.311 / 858.491 415.0 13.803699970245361 38 12 10 6 10 1.420567827466323 44.54168671125926 0.036400794982910156 3 0.8961518489591529 3.7960412227524936 415.0 13.204545454545455 0.0 - - - - - - - 0.0 0 0 C1QL3 complement component 1, q subcomponent-like 3 1009 129 C20140711_OR018_03 C20140711_OR018_03 TB422500.[MT7]-FILTEEGDHK[MT7].3y7_1.heavy 492.936 / 959.455 320.0 29.737499237060547 40 14 10 6 10 2.1512916020452137 46.48370304840631 0.034999847412109375 3 0.9370156259189767 4.891473356715203 320.0 -0.300187617260788 5.0 - - - - - - - 0.0 1 0 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1011 129 C20140711_OR018_03 C20140711_OR018_03 TB422500.[MT7]-FILTEEGDHK[MT7].3y4_1.heavy 492.936 / 600.322 2772.0 29.737499237060547 40 14 10 6 10 2.1512916020452137 46.48370304840631 0.034999847412109375 3 0.9370156259189767 4.891473356715203 2772.0 11.001375 0.0 - - - - - - - 256.1 5 10 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1013 129 C20140711_OR018_03 C20140711_OR018_03 TB422500.[MT7]-FILTEEGDHK[MT7].3b3_1.heavy 492.936 / 518.346 7144.0 29.737499237060547 40 14 10 6 10 2.1512916020452137 46.48370304840631 0.034999847412109375 3 0.9370156259189767 4.891473356715203 7144.0 30.659922203459654 0.0 - - - - - - - 189.66666666666666 14 9 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1015 129 C20140711_OR018_03 C20140711_OR018_03 TB422500.[MT7]-FILTEEGDHK[MT7].3y5_1.heavy 492.936 / 729.365 960.0 29.737499237060547 40 14 10 6 10 2.1512916020452137 46.48370304840631 0.034999847412109375 3 0.9370156259189767 4.891473356715203 960.0 1.4409005628517824 2.0 - - - - - - - 0.0 1 0 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1017 130 C20140711_OR018_03 C20140711_OR018_03 TB422390.[MT7]-QELFAFNK[MT7].3y3_1.heavy 428.911 / 552.326 4477.0 35.773624420166016 38 17 10 1 10 2.7153294490395203 28.51466969343072 0.09270095825195312 3 0.979603061814578 8.626585161991896 4477.0 29.982600643862312 0.0 - - - - - - - 124.0 8 1 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1019 130 C20140711_OR018_03 C20140711_OR018_03 TB422390.[MT7]-QELFAFNK[MT7].3b4_1.heavy 428.911 / 662.363 3109.0 35.773624420166016 38 17 10 1 10 2.7153294490395203 28.51466969343072 0.09270095825195312 3 0.979603061814578 8.626585161991896 3109.0 20.808578474756935 0.0 - - - - - - - 249.0 6 2 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1021 130 C20140711_OR018_03 C20140711_OR018_03 TB422390.[MT7]-QELFAFNK[MT7].3b5_1.heavy 428.911 / 733.4 871.0 35.773624420166016 38 17 10 1 10 2.7153294490395203 28.51466969343072 0.09270095825195312 3 0.979603061814578 8.626585161991896 871.0 1.755341727786071 1.0 - - - - - - - 331.3333333333333 2 3 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1023 130 C20140711_OR018_03 C20140711_OR018_03 TB422390.[MT7]-QELFAFNK[MT7].3b3_1.heavy 428.911 / 515.295 9577.0 35.773624420166016 38 17 10 1 10 2.7153294490395203 28.51466969343072 0.09270095825195312 3 0.979603061814578 8.626585161991896 9577.0 61.56989028500059 0.0 - - - - - - - 310.75 19 4 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1025 131 C20140711_OR018_03 C20140711_OR018_03 TB443989.[MT7]-RIPITISYSK[MT7].2y4_1.heavy 733.453 / 628.342 1638.0 31.017149448394775 32 14 6 6 6 3.1258153653701037 31.991652836526306 0.03619956970214844 5 0.9357008724186423 4.84066288160938 1638.0 0.0 1.0 - - - - - - - 156.0 3 6 TGM6 transglutaminase 6 1027 131 C20140711_OR018_03 C20140711_OR018_03 TB443989.[MT7]-RIPITISYSK[MT7].2y8_1.heavy 733.453 / 1052.61 2457.0 31.017149448394775 32 14 6 6 6 3.1258153653701037 31.991652836526306 0.03619956970214844 5 0.9357008724186423 4.84066288160938 2457.0 2.4499999999999997 0.0 - - - - - - - 260.0 4 9 TGM6 transglutaminase 6 1029 131 C20140711_OR018_03 C20140711_OR018_03 TB443989.[MT7]-RIPITISYSK[MT7].2y3_1.heavy 733.453 / 541.31 234.0 31.017149448394775 32 14 6 6 6 3.1258153653701037 31.991652836526306 0.03619956970214844 5 0.9357008724186423 4.84066288160938 234.0 1.4 29.0 - - - - - - - 170.1818181818182 7 11 TGM6 transglutaminase 6 1031 131 C20140711_OR018_03 C20140711_OR018_03 TB443989.[MT7]-RIPITISYSK[MT7].2y6_1.heavy 733.453 / 842.474 585.0 31.017149448394775 32 14 6 6 6 3.1258153653701037 31.991652836526306 0.03619956970214844 5 0.9357008724186423 4.84066288160938 585.0 4.85 7.0 - - - - - - - 0.0 1 0 TGM6 transglutaminase 6 1033 132 C20140711_OR018_03 C20140711_OR018_03 TB422503.[MT7]-LIGEHHDGVSK[MT7].3y6_1.heavy 493.943 / 786.423 1058.0 20.851299285888672 44 14 10 10 10 2.207919890100198 35.61250649059604 0.0 3 0.949602378636099 5.474145150382411 1058.0 9.268539676154077 0.0 - - - - - - - 146.4 2 5 KIR2DL1;KIR2DS1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 1035 132 C20140711_OR018_03 C20140711_OR018_03 TB422503.[MT7]-LIGEHHDGVSK[MT7].3b5_1.heavy 493.943 / 694.4 1871.0 20.851299285888672 44 14 10 10 10 2.207919890100198 35.61250649059604 0.0 3 0.949602378636099 5.474145150382411 1871.0 32.72939180489283 0.0 - - - - - - - 162.33333333333334 3 3 KIR2DL1;KIR2DS1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 1037 132 C20140711_OR018_03 C20140711_OR018_03 TB422503.[MT7]-LIGEHHDGVSK[MT7].3y4_1.heavy 493.943 / 534.337 2685.0 20.851299285888672 44 14 10 10 10 2.207919890100198 35.61250649059604 0.0 3 0.949602378636099 5.474145150382411 2685.0 15.862153846153848 0.0 - - - - - - - 366.1666666666667 5 6 KIR2DL1;KIR2DS1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 1039 132 C20140711_OR018_03 C20140711_OR018_03 TB422503.[MT7]-LIGEHHDGVSK[MT7].3y5_1.heavy 493.943 / 649.364 5044.0 20.851299285888672 44 14 10 10 10 2.207919890100198 35.61250649059604 0.0 3 0.949602378636099 5.474145150382411 5044.0 42.12299386503068 0.0 - - - - - - - 227.7 10 10 KIR2DL1;KIR2DS1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 1041 133 C20140711_OR018_03 C20140711_OR018_03 TB422255.[MT7]-TWSVMPPMSTHR.3y7_1.heavy 525.263 / 825.404 2230.0 33.29065132141113 38 15 10 5 8 3.1313210631077517 31.935402976771947 0.044300079345703125 4 0.9593119311694336 6.097406808720121 2230.0 41.69679245283019 0.0 - - - - - - - 227.57142857142858 4 7 KLHL5 kelch-like 5 (Drosophila) 1043 133 C20140711_OR018_03 C20140711_OR018_03 TB422255.[MT7]-TWSVMPPMSTHR.3y6_1.heavy 525.263 / 728.351 5415.0 33.29065132141113 38 15 10 5 8 3.1313210631077517 31.935402976771947 0.044300079345703125 4 0.9593119311694336 6.097406808720121 5415.0 18.88197767397672 0.0 - - - - - - - 235.88888888888889 10 9 KLHL5 kelch-like 5 (Drosophila) 1045 133 C20140711_OR018_03 C20140711_OR018_03 TB422255.[MT7]-TWSVMPPMSTHR.3b4_1.heavy 525.263 / 618.337 4035.0 33.29065132141113 38 15 10 5 8 3.1313210631077517 31.935402976771947 0.044300079345703125 4 0.9593119311694336 6.097406808720121 4035.0 10.263997308209959 1.0 - - - - - - - 684.2222222222222 8 9 KLHL5 kelch-like 5 (Drosophila) 1047 133 C20140711_OR018_03 C20140711_OR018_03 TB422255.[MT7]-TWSVMPPMSTHR.3b3_1.heavy 525.263 / 519.268 3398.0 33.29065132141113 38 15 10 5 8 3.1313210631077517 31.935402976771947 0.044300079345703125 4 0.9593119311694336 6.097406808720121 3398.0 6.933577898491228 0.0 - - - - - - - 227.42857142857142 6 7 KLHL5 kelch-like 5 (Drosophila) 1049 134 C20140711_OR018_03 C20140711_OR018_03 TB443803.[MT7]-LIMEAMK[MT7].2y4_1.heavy 562.326 / 622.335 5051.0 35.04249954223633 47 17 10 10 10 4.547639347173736 21.989430639909457 0.0 3 0.9702951886691114 7.142792182213213 5051.0 26.737143393009376 0.0 - - - - - - - 248.83333333333334 10 6 KLHL5 kelch-like 5 (Drosophila) 1051 134 C20140711_OR018_03 C20140711_OR018_03 TB443803.[MT7]-LIMEAMK[MT7].2y5_1.heavy 562.326 / 753.375 6314.0 35.04249954223633 47 17 10 10 10 4.547639347173736 21.989430639909457 0.0 3 0.9702951886691114 7.142792182213213 6314.0 31.9453258029911 0.0 - - - - - - - 315.625 12 8 KLHL5 kelch-like 5 (Drosophila) 1053 134 C20140711_OR018_03 C20140711_OR018_03 TB443803.[MT7]-LIMEAMK[MT7].2y6_1.heavy 562.326 / 866.46 5051.0 35.04249954223633 47 17 10 10 10 4.547639347173736 21.989430639909457 0.0 3 0.9702951886691114 7.142792182213213 5051.0 46.34939604054181 0.0 - - - - - - - 258.5 10 8 KLHL5 kelch-like 5 (Drosophila) 1055 134 C20140711_OR018_03 C20140711_OR018_03 TB443803.[MT7]-LIMEAMK[MT7].2b5_1.heavy 562.326 / 702.398 3100.0 35.04249954223633 47 17 10 10 10 4.547639347173736 21.989430639909457 0.0 3 0.9702951886691114 7.142792182213213 3100.0 12.589185286517706 1.0 - - - - - - - 247.3846153846154 6 13 KLHL5 kelch-like 5 (Drosophila) 1057 135 C20140711_OR018_03 C20140711_OR018_03 TB422505.[MT7]-ASVQFDITPSK[MT7].3y3_1.heavy 494.28 / 475.3 19035.0 32.201900482177734 43 13 10 10 10 1.5399487316915008 55.85201126350786 0.0 3 0.9153147502917441 4.210608820617363 19035.0 48.37190934065934 0.0 - - - - - - - 237.71428571428572 38 7 TGM6 transglutaminase 6 1059 135 C20140711_OR018_03 C20140711_OR018_03 TB422505.[MT7]-ASVQFDITPSK[MT7].3b6_1.heavy 494.28 / 792.401 4369.0 32.201900482177734 43 13 10 10 10 1.5399487316915008 55.85201126350786 0.0 3 0.9153147502917441 4.210608820617363 4369.0 22.96525641025641 0.0 - - - - - - - 193.14285714285714 8 7 TGM6 transglutaminase 6 1061 135 C20140711_OR018_03 C20140711_OR018_03 TB422505.[MT7]-ASVQFDITPSK[MT7].3b4_1.heavy 494.28 / 530.305 6969.0 32.201900482177734 43 13 10 10 10 1.5399487316915008 55.85201126350786 0.0 3 0.9153147502917441 4.210608820617363 6969.0 33.10275 0.0 - - - - - - - 231.11111111111111 13 9 TGM6 transglutaminase 6 1063 135 C20140711_OR018_03 C20140711_OR018_03 TB422505.[MT7]-ASVQFDITPSK[MT7].3y4_1.heavy 494.28 / 576.347 2913.0 32.201900482177734 43 13 10 10 10 1.5399487316915008 55.85201126350786 0.0 3 0.9153147502917441 4.210608820617363 2913.0 25.075305253798614 1.0 - - - - - - - 222.85714285714286 8 7 TGM6 transglutaminase 6 1065 136 C20140711_OR018_03 C20140711_OR018_03 TB443986.[MT7]-YNADYELSAK[MT7].2y4_1.heavy 731.377 / 562.368 1606.0 28.302099227905273 50 20 10 10 10 11.87275133736053 8.422647553084467 0.0 3 0.9902465426565218 12.486176021012746 1606.0 4.536244384197669 1.0 - - - - - - - 267.5 3 2 MTX3 metaxin 3 1067 136 C20140711_OR018_03 C20140711_OR018_03 TB443986.[MT7]-YNADYELSAK[MT7].2b4_1.heavy 731.377 / 608.28 5675.0 28.302099227905273 50 20 10 10 10 11.87275133736053 8.422647553084467 0.0 3 0.9902465426565218 12.486176021012746 5675.0 27.049065420560748 0.0 - - - - - - - 275.14285714285717 11 7 MTX3 metaxin 3 1069 136 C20140711_OR018_03 C20140711_OR018_03 TB443986.[MT7]-YNADYELSAK[MT7].2b6_1.heavy 731.377 / 900.386 2463.0 28.302099227905273 50 20 10 10 10 11.87275133736053 8.422647553084467 0.0 3 0.9902465426565218 12.486176021012746 2463.0 25.30905140186916 0.0 - - - - - - - 124.83333333333333 4 6 MTX3 metaxin 3 1071 136 C20140711_OR018_03 C20140711_OR018_03 TB443986.[MT7]-YNADYELSAK[MT7].2y6_1.heavy 731.377 / 854.474 2249.0 28.302099227905273 50 20 10 10 10 11.87275133736053 8.422647553084467 0.0 3 0.9902465426565218 12.486176021012746 2249.0 26.833862928348907 0.0 - - - - - - - 187.25 4 8 MTX3 metaxin 3 1073 137 C20140711_OR018_03 C20140711_OR018_03 TB444075.[MT7]-TLTVSLASPPSAVIGR.3y7_1.heavy 571.672 / 699.415 40990.0 37.91910171508789 50 20 10 10 10 9.458531916742748 10.57246524938906 0.0 3 0.9935605096895707 15.371041467197012 40990.0 109.39215305761752 0.0 - - - - - - - 376.44444444444446 81 9 TGM6 transglutaminase 6 1075 137 C20140711_OR018_03 C20140711_OR018_03 TB444075.[MT7]-TLTVSLASPPSAVIGR.3y6_1.heavy 571.672 / 602.362 13795.0 37.91910171508789 50 20 10 10 10 9.458531916742748 10.57246524938906 0.0 3 0.9935605096895707 15.371041467197012 13795.0 106.33294148327951 0.0 - - - - - - - 210.22222222222223 27 9 TGM6 transglutaminase 6 1077 137 C20140711_OR018_03 C20140711_OR018_03 TB444075.[MT7]-TLTVSLASPPSAVIGR.3b5_1.heavy 571.672 / 646.389 19549.0 37.91910171508789 50 20 10 10 10 9.458531916742748 10.57246524938906 0.0 3 0.9935605096895707 15.371041467197012 19549.0 33.28996376811594 0.0 - - - - - - - 184.0 39 9 TGM6 transglutaminase 6 1079 137 C20140711_OR018_03 C20140711_OR018_03 TB444075.[MT7]-TLTVSLASPPSAVIGR.3y8_1.heavy 571.672 / 796.468 25856.0 37.91910171508789 50 20 10 10 10 9.458531916742748 10.57246524938906 0.0 3 0.9935605096895707 15.371041467197012 25856.0 49.12670756368209 0.0 - - - - - - - 212.8 51 10 TGM6 transglutaminase 6 1081 138 C20140711_OR018_03 C20140711_OR018_03 TB443985.[MT7]-NASVMDQGPAGNR.2y12_1.heavy 730.855 / 1202.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1083 138 C20140711_OR018_03 C20140711_OR018_03 TB443985.[MT7]-NASVMDQGPAGNR.2y9_1.heavy 730.855 / 945.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1085 138 C20140711_OR018_03 C20140711_OR018_03 TB443985.[MT7]-NASVMDQGPAGNR.2y11_1.heavy 730.855 / 1131.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1087 138 C20140711_OR018_03 C20140711_OR018_03 TB443985.[MT7]-NASVMDQGPAGNR.2y7_1.heavy 730.855 / 699.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1089 139 C20140711_OR018_03 C20140711_OR018_03 TB422250.[MT7]-DENAALIR.2b3_1.heavy 523.292 / 503.222 N/A 24.521400451660156 45 18 9 10 8 3.0021872426536276 26.69171475290009 0.0 4 0.9818374079705502 9.143530752729587 605.0 -0.30479493770516375 28.0 - - - - - - - 625.1 3 10 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1091 139 C20140711_OR018_03 C20140711_OR018_03 TB422250.[MT7]-DENAALIR.2b4_1.heavy 523.292 / 574.259 1815.0 24.521400451660156 45 18 9 10 8 3.0021872426536276 26.69171475290009 0.0 4 0.9818374079705502 9.143530752729587 1815.0 19.455574367845703 2.0 - - - - - - - 181.6 4 5 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1093 139 C20140711_OR018_03 C20140711_OR018_03 TB422250.[MT7]-DENAALIR.2b5_1.heavy 523.292 / 645.296 1512.0 24.521400451660156 45 18 9 10 8 3.0021872426536276 26.69171475290009 0.0 4 0.9818374079705502 9.143530752729587 1512.0 8.808118811881188 0.0 - - - - - - - 235.22222222222223 3 9 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1095 139 C20140711_OR018_03 C20140711_OR018_03 TB422250.[MT7]-DENAALIR.2y7_1.heavy 523.292 / 786.447 1210.0 24.521400451660156 45 18 9 10 8 3.0021872426536276 26.69171475290009 0.0 4 0.9818374079705502 9.143530752729587 1210.0 15.027611304176775 0.0 - - - - - - - 201.625 2 8 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1097 140 C20140711_OR018_03 C20140711_OR018_03 TB422758.[MT7]-C[CAM]FGSFRDSPYEWSK[MT7].4b8_2.heavy 514.247 / 551.249 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1099 140 C20140711_OR018_03 C20140711_OR018_03 TB422758.[MT7]-C[CAM]FGSFRDSPYEWSK[MT7].4b7_2.heavy 514.247 / 507.733 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1101 140 C20140711_OR018_03 C20140711_OR018_03 TB422758.[MT7]-C[CAM]FGSFRDSPYEWSK[MT7].4y3_1.heavy 514.247 / 564.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1103 140 C20140711_OR018_03 C20140711_OR018_03 TB422758.[MT7]-C[CAM]FGSFRDSPYEWSK[MT7].4b10_2.heavy 514.247 / 681.307 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1105 141 C20140711_OR018_03 C20140711_OR018_03 TB443702.[MT7]-AVINDK[MT7].2y4_1.heavy 474.292 / 633.369 4167.0 19.92502450942993 44 20 10 6 8 10.528425423002627 9.498096437243012 0.03650093078613281 4 0.995329709810326 18.051831381542918 4167.0 68.01629594362979 0.0 - - - - - - - 159.8 8 5 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1107 141 C20140711_OR018_03 C20140711_OR018_03 TB443702.[MT7]-AVINDK[MT7].2y5_1.heavy 474.292 / 732.437 2483.0 19.92502450942993 44 20 10 6 8 10.528425423002627 9.498096437243012 0.03650093078613281 4 0.995329709810326 18.051831381542918 2483.0 35.83642139055504 1.0 - - - - - - - 199.5 8 8 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1109 141 C20140711_OR018_03 C20140711_OR018_03 TB443702.[MT7]-AVINDK[MT7].2y3_1.heavy 474.292 / 520.285 3724.0 19.92502450942993 44 20 10 6 8 10.528425423002627 9.498096437243012 0.03650093078613281 4 0.995329709810326 18.051831381542918 3724.0 39.08988764044943 0.0 - - - - - - - 201.54545454545453 7 11 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1111 141 C20140711_OR018_03 C20140711_OR018_03 TB443702.[MT7]-AVINDK[MT7].2b5_1.heavy 474.292 / 657.369 1685.0 19.92502450942993 44 20 10 6 8 10.528425423002627 9.498096437243012 0.03650093078613281 4 0.995329709810326 18.051831381542918 1685.0 16.564406779661017 0.0 - - - - - - - 211.46153846153845 3 13 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1113 142 C20140711_OR018_03 C20140711_OR018_03 TB422755.[MT7]-C[CAM]TLHPNDSLAMEGPLSR.3y7_1.heavy 681.335 / 789.392 2381.0 32.201900482177734 46 16 10 10 10 1.9700915385999378 35.79339630173952 0.0 3 0.9607589206927226 6.2095679918316335 2381.0 -0.30565976174987797 2.0 - - - - - - - 181.5 7 4 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1115 142 C20140711_OR018_03 C20140711_OR018_03 TB422755.[MT7]-C[CAM]TLHPNDSLAMEGPLSR.3b3_1.heavy 681.335 / 519.272 6004.0 32.201900482177734 46 16 10 10 10 1.9700915385999378 35.79339630173952 0.0 3 0.9607589206927226 6.2095679918316335 6004.0 -1.2884120171673814 0.0 - - - - - - - 181.5 12 4 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1117 142 C20140711_OR018_03 C20140711_OR018_03 TB422755.[MT7]-C[CAM]TLHPNDSLAMEGPLSR.3y8_1.heavy 681.335 / 860.43 4037.0 32.201900482177734 46 16 10 10 10 1.9700915385999378 35.79339630173952 0.0 3 0.9607589206927226 6.2095679918316335 4037.0 -0.6500805152979066 0.0 - - - - - - - 138.33333333333334 8 6 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1119 142 C20140711_OR018_03 C20140711_OR018_03 TB422755.[MT7]-C[CAM]TLHPNDSLAMEGPLSR.3y5_1.heavy 681.335 / 529.309 5487.0 32.201900482177734 46 16 10 10 10 1.9700915385999378 35.79339630173952 0.0 3 0.9607589206927226 6.2095679918316335 5487.0 -0.5301449275362318 0.0 - - - - - - - 145.2 10 5 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1121 143 C20140711_OR018_03 C20140711_OR018_03 TB431935.[MT7]-LGPQEEK[MT7].2y4_1.heavy 544.813 / 677.359 516.0 20.88599967956543 41 18 10 3 10 4.338964321092434 23.0469744851054 0.06940078735351562 3 0.9899952964585811 12.328138630650182 516.0 1.0499999999999998 4.0 - - - - - - - 0.0 1 0 TGM6 transglutaminase 6 1123 143 C20140711_OR018_03 C20140711_OR018_03 TB431935.[MT7]-LGPQEEK[MT7].2y5_1.heavy 544.813 / 774.411 2667.0 20.88599967956543 41 18 10 3 10 4.338964321092434 23.0469744851054 0.06940078735351562 3 0.9899952964585811 12.328138630650182 2667.0 5.262579281183932 0.0 - - - - - - - 147.42857142857142 5 7 TGM6 transglutaminase 6 1125 143 C20140711_OR018_03 C20140711_OR018_03 TB431935.[MT7]-LGPQEEK[MT7].2y3_1.heavy 544.813 / 549.3 1032.0 20.88599967956543 41 18 10 3 10 4.338964321092434 23.0469744851054 0.06940078735351562 3 0.9899952964585811 12.328138630650182 1032.0 11.404 2.0 - - - - - - - 193.5 2 8 TGM6 transglutaminase 6 1127 143 C20140711_OR018_03 C20140711_OR018_03 TB431935.[MT7]-LGPQEEK[MT7].2y6_1.heavy 544.813 / 831.433 6367.0 20.88599967956543 41 18 10 3 10 4.338964321092434 23.0469744851054 0.06940078735351562 3 0.9899952964585811 12.328138630650182 6367.0 142.14697674418605 0.0 - - - - - - - 150.5 12 4 TGM6 transglutaminase 6 1129 144 C20140711_OR018_03 C20140711_OR018_03 TB422763.[MT7]-NDIFGEPLNLYARPGK[MT7].4y8_2.heavy 523.791 / 531.813 5619.0 38.60885047912598 36 10 10 6 10 2.1029761103379303 47.5516576286408 0.037502288818359375 3 0.8458341959867874 3.1018739331832785 5619.0 -2.1949218749999986 0.0 - - - - - - - 128.0 11 3 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1131 144 C20140711_OR018_03 C20140711_OR018_03 TB422763.[MT7]-NDIFGEPLNLYARPGK[MT7].4y10_2.heavy 523.791 / 636.881 1405.0 38.60885047912598 36 10 10 6 10 2.1029761103379303 47.5516576286408 0.037502288818359375 3 0.8458341959867874 3.1018739331832785 1405.0 9.845330882352942 0.0 - - - - - - - 255.16666666666666 2 6 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1133 144 C20140711_OR018_03 C20140711_OR018_03 TB422763.[MT7]-NDIFGEPLNLYARPGK[MT7].4b5_1.heavy 523.791 / 691.353 1532.0 38.60885047912598 36 10 10 6 10 2.1029761103379303 47.5516576286408 0.037502288818359375 3 0.8458341959867874 3.1018739331832785 1532.0 12.870505136986301 0.0 - - - - - - - 153.4 3 5 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1135 144 C20140711_OR018_03 C20140711_OR018_03 TB422763.[MT7]-NDIFGEPLNLYARPGK[MT7].4b6_1.heavy 523.791 / 820.396 639.0 38.60885047912598 36 10 10 6 10 2.1029761103379303 47.5516576286408 0.037502288818359375 3 0.8458341959867874 3.1018739331832785 639.0 -0.5 5.0 - - - - - - - 351.0 2 4 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1137 145 C20140711_OR018_03 C20140711_OR018_03 TB444147.[MT7]-QLQVDLVSPHFPDIK[MT7].3b6_1.heavy 675.385 / 841.49 6078.0 39.70339870452881 40 14 10 6 10 2.214491451197683 34.91858497413982 0.036800384521484375 3 0.9352778166252942 4.824642248143471 6078.0 16.118453038674033 1.0 - - - - - - - 175.64285714285714 12 14 TGM6 transglutaminase 6 1139 145 C20140711_OR018_03 C20140711_OR018_03 TB444147.[MT7]-QLQVDLVSPHFPDIK[MT7].3b5_1.heavy 675.385 / 728.406 11866.0 39.70339870452881 40 14 10 6 10 2.214491451197683 34.91858497413982 0.036800384521484375 3 0.9352778166252942 4.824642248143471 11866.0 76.78 0.0 - - - - - - - 216.92857142857142 23 14 TGM6 transglutaminase 6 1141 145 C20140711_OR018_03 C20140711_OR018_03 TB444147.[MT7]-QLQVDLVSPHFPDIK[MT7].3y4_1.heavy 675.385 / 616.379 23659.0 39.70339870452881 40 14 10 6 10 2.214491451197683 34.91858497413982 0.036800384521484375 3 0.9352778166252942 4.824642248143471 23659.0 181.9878251231527 0.0 - - - - - - - 256.45454545454544 47 11 TGM6 transglutaminase 6 1143 145 C20140711_OR018_03 C20140711_OR018_03 TB444147.[MT7]-QLQVDLVSPHFPDIK[MT7].3y5_1.heavy 675.385 / 763.447 4486.0 39.70339870452881 40 14 10 6 10 2.214491451197683 34.91858497413982 0.036800384521484375 3 0.9352778166252942 4.824642248143471 4486.0 38.864884792626725 0.0 - - - - - - - 200.30769230769232 8 13 TGM6 transglutaminase 6 1145 146 C20140711_OR018_03 C20140711_OR018_03 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 166943.0 37.78860092163086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 166943.0 90.7063469040305 0.0 - - - - - - - 299.5 333 4 1147 146 C20140711_OR018_03 C20140711_OR018_03 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 377919.0 37.78860092163086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 377919.0 144.42804964635968 0.0 - - - - - - - 233.16666666666666 755 6 1149 146 C20140711_OR018_03 C20140711_OR018_03 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 415361.0 37.78860092163086 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 415361.0 255.89433760240783 0.0 - - - - - - - 279.6 830 5 1151 147 C20140711_OR018_03 C20140711_OR018_03 TB422661.[MT7]-WLPQNDLLGHPMTR.3y7_1.heavy 607.99 / 811.424 14064.0 37.40520095825195 47 17 10 10 10 2.6586108696230837 29.56468804756907 0.0 3 0.9781200683515727 8.328069339403973 14064.0 51.22025376968409 1.0 - - - - - - - 156.0 33 10 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1153 147 C20140711_OR018_03 C20140711_OR018_03 TB422661.[MT7]-WLPQNDLLGHPMTR.3b6_1.heavy 607.99 / 898.454 19273.0 37.40520095825195 47 17 10 10 10 2.6586108696230837 29.56468804756907 0.0 3 0.9781200683515727 8.328069339403973 19273.0 107.0493786726709 0.0 - - - - - - - 238.66666666666666 38 6 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1155 147 C20140711_OR018_03 C20140711_OR018_03 TB422661.[MT7]-WLPQNDLLGHPMTR.3y6_1.heavy 607.99 / 698.34 34249.0 37.40520095825195 47 17 10 10 10 2.6586108696230837 29.56468804756907 0.0 3 0.9781200683515727 8.328069339403973 34249.0 52.1305582229514 0.0 - - - - - - - 227.75 68 4 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1157 147 C20140711_OR018_03 C20140711_OR018_03 TB422661.[MT7]-WLPQNDLLGHPMTR.3b4_1.heavy 607.99 / 669.384 7162.0 37.40520095825195 47 17 10 10 10 2.6586108696230837 29.56468804756907 0.0 3 0.9781200683515727 8.328069339403973 7162.0 37.438448250406026 0.0 - - - - - - - 221.2 14 10 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1159 148 C20140711_OR018_03 C20140711_OR018_03 TB422660.[MT7]-WLPQNDLLGHPMTR.4b4_1.heavy 456.244 / 669.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1161 148 C20140711_OR018_03 C20140711_OR018_03 TB422660.[MT7]-WLPQNDLLGHPMTR.4y7_1.heavy 456.244 / 811.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1163 148 C20140711_OR018_03 C20140711_OR018_03 TB422660.[MT7]-WLPQNDLLGHPMTR.4y6_1.heavy 456.244 / 698.34 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1165 148 C20140711_OR018_03 C20140711_OR018_03 TB422660.[MT7]-WLPQNDLLGHPMTR.4b3_1.heavy 456.244 / 541.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1167 149 C20140711_OR018_03 C20140711_OR018_03 TB443999.[MT7]-C[CAM]QGTLEAQEYR.2y5_1.heavy 749.857 / 666.321 1345.0 23.732449531555176 38 13 10 5 10 3.077563383376774 32.493238170216884 0.04089927673339844 3 0.9069424228687581 4.013836293296487 1345.0 13.325333369092958 0.0 - - - - - - - 103.0 2 2 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1169 149 C20140711_OR018_03 C20140711_OR018_03 TB443999.[MT7]-C[CAM]QGTLEAQEYR.2y9_1.heavy 749.857 / 1066.52 3311.0 23.732449531555176 38 13 10 5 10 3.077563383376774 32.493238170216884 0.04089927673339844 3 0.9069424228687581 4.013836293296487 3311.0 32.14563106796116 0.0 - - - - - - - 206.5 6 2 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1171 149 C20140711_OR018_03 C20140711_OR018_03 TB443999.[MT7]-C[CAM]QGTLEAQEYR.2b6_1.heavy 749.857 / 833.394 1138.0 23.732449531555176 38 13 10 5 10 3.077563383376774 32.493238170216884 0.04089927673339844 3 0.9069424228687581 4.013836293296487 1138.0 10.775265700483093 0.0 - - - - - - - 221.57142857142858 2 7 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1173 149 C20140711_OR018_03 C20140711_OR018_03 TB443999.[MT7]-C[CAM]QGTLEAQEYR.2y10_1.heavy 749.857 / 1194.57 931.0 23.732449531555176 38 13 10 5 10 3.077563383376774 32.493238170216884 0.04089927673339844 3 0.9069424228687581 4.013836293296487 931.0 8.615567124743993 0.0 - - - - - - - 0.0 1 0 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1175 150 C20140711_OR018_03 C20140711_OR018_03 TB443719.[MT7]-YVDSFGR.2b3_1.heavy 494.254 / 522.268 4310.0 28.35284948348999 37 14 10 5 8 1.9235258705170633 41.30431405149161 0.04060173034667969 4 0.9447642684684222 5.226761814801971 4310.0 39.46361029356275 0.0 - - - - - - - 180.0 8 7 TGM6 transglutaminase 6 1177 150 C20140711_OR018_03 C20140711_OR018_03 TB443719.[MT7]-YVDSFGR.2y5_1.heavy 494.254 / 581.268 2418.0 28.35284948348999 37 14 10 5 8 1.9235258705170633 41.30431405149161 0.04060173034667969 4 0.9447642684684222 5.226761814801971 2418.0 27.634285714285713 0.0 - - - - - - - 240.0 4 7 TGM6 transglutaminase 6 1179 150 C20140711_OR018_03 C20140711_OR018_03 TB443719.[MT7]-YVDSFGR.2b4_1.heavy 494.254 / 609.3 1261.0 28.35284948348999 37 14 10 5 8 1.9235258705170633 41.30431405149161 0.04060173034667969 4 0.9447642684684222 5.226761814801971 1261.0 12.249714285714287 1.0 - - - - - - - 315.0 2 4 TGM6 transglutaminase 6 1181 150 C20140711_OR018_03 C20140711_OR018_03 TB443719.[MT7]-YVDSFGR.2y6_1.heavy 494.254 / 680.336 3259.0 28.35284948348999 37 14 10 5 8 1.9235258705170633 41.30431405149161 0.04060173034667969 4 0.9447642684684222 5.226761814801971 3259.0 -0.33737863696521375 2.0 - - - - - - - 105.0 8 1 TGM6 transglutaminase 6 1183 151 C20140711_OR018_03 C20140711_OR018_03 TB422269.[MT7]-GVDVEAAK[MT7].2y4_1.heavy 538.813 / 562.332 959.0 22.349900245666504 46 20 10 6 10 9.908373699377004 10.092473602028916 0.03700065612792969 3 0.9976576863347482 25.49500116290068 959.0 1.539678899082569 0.0 - - - - - - - 0.0 1 0 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1185 151 C20140711_OR018_03 C20140711_OR018_03 TB422269.[MT7]-GVDVEAAK[MT7].2y5_1.heavy 538.813 / 661.4 1569.0 22.349900245666504 46 20 10 6 10 9.908373699377004 10.092473602028916 0.03700065612792969 3 0.9976576863347482 25.49500116290068 1569.0 13.88655172413793 1.0 - - - - - - - 226.4 3 10 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1187 151 C20140711_OR018_03 C20140711_OR018_03 TB422269.[MT7]-GVDVEAAK[MT7].2b4_1.heavy 538.813 / 515.295 871.0 22.349900245666504 46 20 10 6 10 9.908373699377004 10.092473602028916 0.03700065612792969 3 0.9976576863347482 25.49500116290068 871.0 2.4131481917743676 5.0 - - - - - - - 0.0 1 0 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1189 151 C20140711_OR018_03 C20140711_OR018_03 TB422269.[MT7]-GVDVEAAK[MT7].2b5_1.heavy 538.813 / 644.337 959.0 22.349900245666504 46 20 10 6 10 9.908373699377004 10.092473602028916 0.03700065612792969 3 0.9976576863347482 25.49500116290068 959.0 1.0991404011461319 0.0 - - - - - - - 0.0 1 0 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1191 152 C20140711_OR018_03 C20140711_OR018_03 TB444087.[MT7]-MTLTQVSTWFANAR.2y8_1.heavy 885.46 / 952.464 14290.0 46.2864990234375 47 17 10 10 10 2.1726218410799008 36.46565408273999 0.0 3 0.9738043229872189 7.60842767936093 14290.0 46.56619144602851 0.0 - - - - - - - 250.15384615384616 28 13 IRX5;IRX2;IRX4;IRX6;IRX3;IRX1 iroquois homeobox 5;iroquois homeobox 2;iroquois homeobox 4;iroquois homeobox 6;iroquois homeobox 3;iroquois homeobox 1 1193 152 C20140711_OR018_03 C20140711_OR018_03 TB444087.[MT7]-MTLTQVSTWFANAR.2y9_1.heavy 885.46 / 1051.53 11039.0 46.2864990234375 47 17 10 10 10 2.1726218410799008 36.46565408273999 0.0 3 0.9738043229872189 7.60842767936093 11039.0 140.15803508306823 0.0 - - - - - - - 130.3125 22 16 IRX5;IRX2;IRX4;IRX6;IRX3;IRX1 iroquois homeobox 5;iroquois homeobox 2;iroquois homeobox 4;iroquois homeobox 6;iroquois homeobox 3;iroquois homeobox 1 1195 152 C20140711_OR018_03 C20140711_OR018_03 TB444087.[MT7]-MTLTQVSTWFANAR.2y10_1.heavy 885.46 / 1179.59 5826.0 46.2864990234375 47 17 10 10 10 2.1726218410799008 36.46565408273999 0.0 3 0.9738043229872189 7.60842767936093 5826.0 35.866905537459274 0.0 - - - - - - - 187.38888888888889 11 18 IRX5;IRX2;IRX4;IRX6;IRX3;IRX1 iroquois homeobox 5;iroquois homeobox 2;iroquois homeobox 4;iroquois homeobox 6;iroquois homeobox 3;iroquois homeobox 1 1197 152 C20140711_OR018_03 C20140711_OR018_03 TB444087.[MT7]-MTLTQVSTWFANAR.2b5_1.heavy 885.46 / 719.388 5152.0 46.2864990234375 47 17 10 10 10 2.1726218410799008 36.46565408273999 0.0 3 0.9738043229872189 7.60842767936093 5152.0 102.6360655737705 0.0 - - - - - - - 156.55555555555554 10 9 IRX5;IRX2;IRX4;IRX6;IRX3;IRX1 iroquois homeobox 5;iroquois homeobox 2;iroquois homeobox 4;iroquois homeobox 6;iroquois homeobox 3;iroquois homeobox 1 1199 153 C20140711_OR018_03 C20140711_OR018_03 TB422766.[MT7]-TDWLAPVLWEGTFDRR.3y11_2.heavy 702.701 / 688.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLT6D1 glycosyltransferase 6 domain containing 1 1201 153 C20140711_OR018_03 C20140711_OR018_03 TB422766.[MT7]-TDWLAPVLWEGTFDRR.3b4_1.heavy 702.701 / 660.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLT6D1 glycosyltransferase 6 domain containing 1 1203 153 C20140711_OR018_03 C20140711_OR018_03 TB422766.[MT7]-TDWLAPVLWEGTFDRR.3b5_1.heavy 702.701 / 731.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLT6D1 glycosyltransferase 6 domain containing 1 1205 153 C20140711_OR018_03 C20140711_OR018_03 TB422766.[MT7]-TDWLAPVLWEGTFDRR.3b3_1.heavy 702.701 / 547.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - GLT6D1 glycosyltransferase 6 domain containing 1 1207 154 C20140711_OR018_03 C20140711_OR018_03 TB422767.[MT7]-ALGPVESLQGHLRDPTK[MT7].4b16_2.heavy 527.303 / 908.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL1 lethal giant larvae homolog 1 (Drosophila) 1209 154 C20140711_OR018_03 C20140711_OR018_03 TB422767.[MT7]-ALGPVESLQGHLRDPTK[MT7].4y8_2.heavy 527.303 / 534.307 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL1 lethal giant larvae homolog 1 (Drosophila) 1211 154 C20140711_OR018_03 C20140711_OR018_03 TB422767.[MT7]-ALGPVESLQGHLRDPTK[MT7].4y9_2.heavy 527.303 / 598.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL1 lethal giant larvae homolog 1 (Drosophila) 1213 154 C20140711_OR018_03 C20140711_OR018_03 TB422767.[MT7]-ALGPVESLQGHLRDPTK[MT7].4b5_1.heavy 527.303 / 582.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL1 lethal giant larvae homolog 1 (Drosophila) 1215 155 C20140711_OR018_03 C20140711_OR018_03 TB444158.[MT7]-FAEEYLRPFLHSANK[MT7].4y4_1.heavy 528.289 / 563.327 7598.0 38.420724868774414 35 12 10 3 10 1.5504914659642595 50.166300935060875 0.07649993896484375 3 0.8994345102761091 3.858595651136068 7598.0 51.71034676535087 0.0 - - - - - - - 201.72727272727272 15 11 GLT6D1 glycosyltransferase 6 domain containing 1 1217 155 C20140711_OR018_03 C20140711_OR018_03 TB444158.[MT7]-FAEEYLRPFLHSANK[MT7].4b4_1.heavy 528.289 / 621.3 2049.0 38.420724868774414 35 12 10 3 10 1.5504914659642595 50.166300935060875 0.07649993896484375 3 0.8994345102761091 3.858595651136068 2049.0 10.791238359829192 1.0 - - - - - - - 186.27272727272728 4 11 GLT6D1 glycosyltransferase 6 domain containing 1 1219 155 C20140711_OR018_03 C20140711_OR018_03 TB444158.[MT7]-FAEEYLRPFLHSANK[MT7].4y6_1.heavy 528.289 / 813.47 171.0 38.420724868774414 35 12 10 3 10 1.5504914659642595 50.166300935060875 0.07649993896484375 3 0.8994345102761091 3.858595651136068 171.0 1.6 29.0 - - - - - - - 153.6 15 10 GLT6D1 glycosyltransferase 6 domain containing 1 1221 155 C20140711_OR018_03 C20140711_OR018_03 TB444158.[MT7]-FAEEYLRPFLHSANK[MT7].4b9_2.heavy 528.289 / 649.339 4183.0 38.420724868774414 35 12 10 3 10 1.5504914659642595 50.166300935060875 0.07649993896484375 3 0.8994345102761091 3.858595651136068 4183.0 36.72164884868421 0.0 - - - - - - - 159.875 8 8 GLT6D1 glycosyltransferase 6 domain containing 1 1223 156 C20140711_OR018_03 C20140711_OR018_03 TB444153.[MT7]-C[CAM]FGSFRDSPYEWSK[MT7].3y6_1.heavy 685.328 / 953.485 2331.0 34.53229904174805 40 20 2 10 8 8.414351281262759 11.884457477153578 0.0 4 0.9957466537453009 18.916594152382515 2331.0 12.735 0.0 - - - - - - - 172.33333333333334 4 3 KIR2DS1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1225 156 C20140711_OR018_03 C20140711_OR018_03 TB444153.[MT7]-C[CAM]FGSFRDSPYEWSK[MT7].3y3_1.heavy 685.328 / 564.326 4014.0 34.53229904174805 40 20 2 10 8 8.414351281262759 11.884457477153578 0.0 4 0.9957466537453009 18.916594152382515 4014.0 14.984436313338376 1.0 - - - - - - - 232.8 22 10 KIR2DS1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1227 156 C20140711_OR018_03 C20140711_OR018_03 TB444153.[MT7]-C[CAM]FGSFRDSPYEWSK[MT7].3y4_1.heavy 685.328 / 693.369 2201.0 34.53229904174805 40 20 2 10 8 8.414351281262759 11.884457477153578 0.0 4 0.9957466537453009 18.916594152382515 2201.0 9.347876447876448 0.0 - - - - - - - 291.0 4 8 KIR2DS1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1229 156 C20140711_OR018_03 C20140711_OR018_03 TB444153.[MT7]-C[CAM]FGSFRDSPYEWSK[MT7].3y5_1.heavy 685.328 / 856.432 1554.0 34.53229904174805 40 20 2 10 8 8.414351281262759 11.884457477153578 0.0 4 0.9957466537453009 18.916594152382515 1554.0 20.479069767441864 0.0 - - - - - - - 210.25 3 8 KIR2DS1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1231 157 C20140711_OR018_03 C20140711_OR018_03 TB432069.[MT7]-QLHPSNC[CAM]LGIR.3y7_1.heavy 480.262 / 819.414 854.0 26.007999420166016 37 10 9 10 8 0.65253886024476 79.71959663096646 0.0 4 0.8460496801399792 3.1041031229752445 854.0 0.3560184703433923 1.0 - - - - - - - 0.0 1 0 KLHL5;KLHL4 kelch-like 5 (Drosophila);kelch-like 4 (Drosophila) 1233 157 C20140711_OR018_03 C20140711_OR018_03 TB432069.[MT7]-QLHPSNC[CAM]LGIR.3y6_1.heavy 480.262 / 732.382 2136.0 26.007999420166016 37 10 9 10 8 0.65253886024476 79.71959663096646 0.0 4 0.8460496801399792 3.1041031229752445 2136.0 39.32635514018692 0.0 - - - - - - - 267.0 4 2 KLHL5;KLHL4 kelch-like 5 (Drosophila);kelch-like 4 (Drosophila) 1235 157 C20140711_OR018_03 C20140711_OR018_03 TB432069.[MT7]-QLHPSNC[CAM]LGIR.3b3_1.heavy 480.262 / 523.311 2350.0 26.007999420166016 37 10 9 10 8 0.65253886024476 79.71959663096646 0.0 4 0.8460496801399792 3.1041031229752445 2350.0 8.994803864168619 1.0 - - - - - - - 213.66666666666666 5 3 KLHL5;KLHL4 kelch-like 5 (Drosophila);kelch-like 4 (Drosophila) 1237 157 C20140711_OR018_03 C20140711_OR018_03 TB432069.[MT7]-QLHPSNC[CAM]LGIR.3y5_1.heavy 480.262 / 618.339 854.0 26.007999420166016 37 10 9 10 8 0.65253886024476 79.71959663096646 0.0 4 0.8460496801399792 3.1041031229752445 854.0 5.586915887850466 0.0 - - - - - - - 0.0 1 0 KLHL5;KLHL4 kelch-like 5 (Drosophila);kelch-like 4 (Drosophila) 1239 158 C20140711_OR018_03 C20140711_OR018_03 TB422773.[MT7]-EGSPEPWDTQNPLEPK[MT7].4y5_1.heavy 528.768 / 727.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1241 158 C20140711_OR018_03 C20140711_OR018_03 TB422773.[MT7]-EGSPEPWDTQNPLEPK[MT7].4b4_1.heavy 528.768 / 515.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1243 158 C20140711_OR018_03 C20140711_OR018_03 TB422773.[MT7]-EGSPEPWDTQNPLEPK[MT7].4b5_1.heavy 528.768 / 644.301 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1245 158 C20140711_OR018_03 C20140711_OR018_03 TB422773.[MT7]-EGSPEPWDTQNPLEPK[MT7].4y3_1.heavy 528.768 / 517.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1247 159 C20140711_OR018_03 C20140711_OR018_03 TB422772.[MT7]-EGSPEPWDTQNPLEPK[MT7].3b6_1.heavy 704.688 / 741.354 3970.0 34.900699615478516 50 20 10 10 10 9.735275571746742 10.271922891450068 0.0 3 0.9955821860614625 18.560883444488216 3970.0 -0.3500881834215166 0.0 - - - - - - - 696.8571428571429 7 7 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1249 159 C20140711_OR018_03 C20140711_OR018_03 TB422772.[MT7]-EGSPEPWDTQNPLEPK[MT7].3b5_1.heavy 704.688 / 644.301 33687.0 34.900699615478516 50 20 10 10 10 9.735275571746742 10.271922891450068 0.0 3 0.9955821860614625 18.560883444488216 33687.0 -0.4753015873015869 0.0 - - - - - - - 302.3333333333333 67 6 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1251 159 C20140711_OR018_03 C20140711_OR018_03 TB422772.[MT7]-EGSPEPWDTQNPLEPK[MT7].3b8_1.heavy 704.688 / 1042.46 7713.0 34.900699615478516 50 20 10 10 10 9.735275571746742 10.271922891450068 0.0 3 0.9955821860614625 18.560883444488216 7713.0 90.4882254034357 0.0 - - - - - - - 243.0 15 7 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1253 159 C20140711_OR018_03 C20140711_OR018_03 TB422772.[MT7]-EGSPEPWDTQNPLEPK[MT7].3y5_1.heavy 704.688 / 727.447 14972.0 34.900699615478516 50 20 10 10 10 9.735275571746742 10.271922891450068 0.0 3 0.9955821860614625 18.560883444488216 14972.0 154.04118461918313 0.0 - - - - - - - 188.66666666666666 29 3 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1255 160 C20140711_OR018_03 C20140711_OR018_03 TB431903.[MT7]-VYSNTK[MT7].2y4_1.heavy 500.289 / 593.338 2273.0 17.823224544525146 41 16 10 5 10 2.5285181346127863 39.54885615851589 0.04030036926269531 3 0.9611693520829739 6.242515225627525 2273.0 14.939906103286386 0.0 - - - - - - - 131.85714285714286 4 7 TGM6 transglutaminase 6 1257 160 C20140711_OR018_03 C20140711_OR018_03 TB431903.[MT7]-VYSNTK[MT7].2y5_1.heavy 500.289 / 756.401 6251.0 17.823224544525146 41 16 10 5 10 2.5285181346127863 39.54885615851589 0.04030036926269531 3 0.9611693520829739 6.242515225627525 6251.0 69.8468544600939 0.0 - - - - - - - 200.0909090909091 12 11 TGM6 transglutaminase 6 1259 160 C20140711_OR018_03 C20140711_OR018_03 TB431903.[MT7]-VYSNTK[MT7].2b4_1.heavy 500.289 / 608.316 1136.0 17.823224544525146 41 16 10 5 10 2.5285181346127863 39.54885615851589 0.04030036926269531 3 0.9611693520829739 6.242515225627525 1136.0 9.093333333333334 0.0 - - - - - - - 165.66666666666666 2 6 TGM6 transglutaminase 6 1261 160 C20140711_OR018_03 C20140711_OR018_03 TB431903.[MT7]-VYSNTK[MT7].2y3_1.heavy 500.289 / 506.306 994.0 17.823224544525146 41 16 10 5 10 2.5285181346127863 39.54885615851589 0.04030036926269531 3 0.9611693520829739 6.242515225627525 994.0 9.8 0.0 - - - - - - - 0.0 1 0 TGM6 transglutaminase 6 1263 161 C20140711_OR018_03 C20140711_OR018_03 TB431907.[MT7]-GYIEVMR.2y5_1.heavy 506.274 / 647.354 1147.0 30.47885036468506 43 20 10 3 10 7.3553908690847924 13.595470557561637 0.06999969482421875 3 0.9936191613318621 15.441599592304483 1147.0 5.8916633291040545 0.0 - - - - - - - 182.375 2 8 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1265 161 C20140711_OR018_03 C20140711_OR018_03 TB431907.[MT7]-GYIEVMR.2b4_1.heavy 506.274 / 607.321 3442.0 30.47885036468506 43 20 10 3 10 7.3553908690847924 13.595470557561637 0.06999969482421875 3 0.9936191613318621 15.441599592304483 3442.0 20.436608289175215 0.0 - - - - - - - 199.0909090909091 6 11 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1267 161 C20140711_OR018_03 C20140711_OR018_03 TB431907.[MT7]-GYIEVMR.2y6_1.heavy 506.274 / 810.418 1252.0 30.47885036468506 43 20 10 3 10 7.3553908690847924 13.595470557561637 0.06999969482421875 3 0.9936191613318621 15.441599592304483 1252.0 16.469652189915347 0.0 - - - - - - - 208.6 2 10 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1269 161 C20140711_OR018_03 C20140711_OR018_03 TB431907.[MT7]-GYIEVMR.2b5_1.heavy 506.274 / 706.389 1669.0 30.47885036468506 43 20 10 3 10 7.3553908690847924 13.595470557561637 0.06999969482421875 3 0.9936191613318621 15.441599592304483 1669.0 -0.5 1.0 - - - - - - - 313.0 3 5 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1271 162 C20140711_OR018_03 C20140711_OR018_03 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 83382.0 40.61579895019531 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 83382.0 391.6857298513761 0.0 - - - - - - - 222.44444444444446 166 9 1273 162 C20140711_OR018_03 C20140711_OR018_03 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 125303.0 40.61579895019531 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 125303.0 420.43752403469955 0.0 - - - - - - - 753.6 250 10 1275 162 C20140711_OR018_03 C20140711_OR018_03 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 200916.0 40.61579895019531 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 200916.0 521.1324474340013 0.0 - - - - - - - 308.0 401 4 1277 163 C20140711_OR018_03 C20140711_OR018_03 TB422907.[MT7]-TLEDLTEDSMWNFHVWNESWFAR.4y8_1.heavy 765.104 / 1095.5 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1279 163 C20140711_OR018_03 C20140711_OR018_03 TB422907.[MT7]-TLEDLTEDSMWNFHVWNESWFAR.4b4_1.heavy 765.104 / 603.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1281 163 C20140711_OR018_03 C20140711_OR018_03 TB422907.[MT7]-TLEDLTEDSMWNFHVWNESWFAR.4b5_1.heavy 765.104 / 716.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1283 163 C20140711_OR018_03 C20140711_OR018_03 TB422907.[MT7]-TLEDLTEDSMWNFHVWNESWFAR.4y7_1.heavy 765.104 / 909.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1285 164 C20140711_OR018_03 C20140711_OR018_03 TB444054.[MT7]-WWLDGPLVHVK[MT7].3y3_1.heavy 546.652 / 527.342 47593.0 42.66732597351074 40 14 10 6 10 2.200602034078246 35.73885110966048 0.03209686279296875 3 0.9366646354212873 4.877754732678102 47593.0 431.1184090909091 0.0 - - - - - - - 278.14285714285717 95 14 GLT6D1 glycosyltransferase 6 domain containing 1 1287 164 C20140711_OR018_03 C20140711_OR018_03 TB444054.[MT7]-WWLDGPLVHVK[MT7].3b4_1.heavy 546.652 / 745.379 15776.0 42.66732597351074 40 14 10 6 10 2.200602034078246 35.73885110966048 0.03209686279296875 3 0.9366646354212873 4.877754732678102 15776.0 103.73915151515152 0.0 - - - - - - - 193.28571428571428 31 14 GLT6D1 glycosyltransferase 6 domain containing 1 1289 164 C20140711_OR018_03 C20140711_OR018_03 TB444054.[MT7]-WWLDGPLVHVK[MT7].3b5_1.heavy 546.652 / 802.4 22839.0 42.66732597351074 40 14 10 6 10 2.200602034078246 35.73885110966048 0.03209686279296875 3 0.9366646354212873 4.877754732678102 22839.0 160.91113636363636 0.0 - - - - - - - 209.0 45 18 GLT6D1 glycosyltransferase 6 domain containing 1 1291 164 C20140711_OR018_03 C20140711_OR018_03 TB444054.[MT7]-WWLDGPLVHVK[MT7].3b7_1.heavy 546.652 / 1012.54 3631.0 42.66732597351074 40 14 10 6 10 2.200602034078246 35.73885110966048 0.03209686279296875 3 0.9366646354212873 4.877754732678102 3631.0 26.407272727272726 1.0 - - - - - - - 143.0 8 12 GLT6D1 glycosyltransferase 6 domain containing 1 1293 165 C20140711_OR018_03 C20140711_OR018_03 TB422233.[MT7]-FSGAPLK[MT7].2y6_1.heavy 504.31 / 716.442 5407.0 27.213449478149414 43 18 10 5 10 3.464777547491983 24.045774517373847 0.042499542236328125 3 0.9828495929338537 9.410278976540015 5407.0 32.21330513595166 0.0 - - - - - - - 198.5 10 10 MTX3 metaxin 3 1295 165 C20140711_OR018_03 C20140711_OR018_03 TB422233.[MT7]-FSGAPLK[MT7].2y4_1.heavy 504.31 / 572.389 1104.0 27.213449478149414 43 18 10 5 10 3.464777547491983 24.045774517373847 0.042499542236328125 3 0.9828495929338537 9.410278976540015 1104.0 4.496682205301363 2.0 - - - - - - - 331.0 2 9 MTX3 metaxin 3 1297 165 C20140711_OR018_03 C20140711_OR018_03 TB422233.[MT7]-FSGAPLK[MT7].2b4_1.heavy 504.31 / 507.268 3862.0 27.213449478149414 43 18 10 5 10 3.464777547491983 24.045774517373847 0.042499542236328125 3 0.9828495929338537 9.410278976540015 3862.0 11.637387559157894 1.0 - - - - - - - 275.75 7 4 MTX3 metaxin 3 1299 165 C20140711_OR018_03 C20140711_OR018_03 TB422233.[MT7]-FSGAPLK[MT7].2y3_1.heavy 504.31 / 501.352 9159.0 27.213449478149414 43 18 10 5 10 3.464777547491983 24.045774517373847 0.042499542236328125 3 0.9828495929338537 9.410278976540015 9159.0 93.86466600790514 0.0 - - - - - - - 242.6 18 5 MTX3 metaxin 3 1301 166 C20140711_OR018_03 C20140711_OR018_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 70114.0 35.64670181274414 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 70114.0 221.70093290971218 0.0 - - - - - - - 317.2 140 5 1303 166 C20140711_OR018_03 C20140711_OR018_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 14805.0 35.64670181274414 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 14805.0 60.232268277973645 1.0 - - - - - - - 241.85714285714286 54 7 1305 166 C20140711_OR018_03 C20140711_OR018_03 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 17555.0 35.64670181274414 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 17555.0 62.95931212063126 0.0 - - - - - - - 290.875 35 8 1307 167 C20140711_OR018_03 C20140711_OR018_03 TB422777.[MT7]-ALDC[CAM]EEILIFTMETGPR.2y8_1.heavy 1070.03 / 938.44 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1309 167 C20140711_OR018_03 C20140711_OR018_03 TB422777.[MT7]-ALDC[CAM]EEILIFTMETGPR.2y9_1.heavy 1070.03 / 1051.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1311 167 C20140711_OR018_03 C20140711_OR018_03 TB422777.[MT7]-ALDC[CAM]EEILIFTMETGPR.2b6_1.heavy 1070.03 / 862.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1313 167 C20140711_OR018_03 C20140711_OR018_03 TB422777.[MT7]-ALDC[CAM]EEILIFTMETGPR.2y10_1.heavy 1070.03 / 1164.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1315 168 C20140711_OR018_03 C20140711_OR018_03 TB444169.[MT7]-LRFDRFILTEEGDHK[MT7].4y4_1.heavy 541.799 / 600.322 2775.0 34.99530029296875 48 18 10 10 10 5.806821176887343 17.221126146957303 0.0 3 0.989121190168554 11.821624825933135 2775.0 18.8258476442096 0.0 - - - - - - - 252.0 5 5 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1317 168 C20140711_OR018_03 C20140711_OR018_03 TB444169.[MT7]-LRFDRFILTEEGDHK[MT7].4b4_1.heavy 541.799 / 676.39 3785.0 34.99530029296875 48 18 10 10 10 5.806821176887343 17.221126146957303 0.0 3 0.989121190168554 11.821624825933135 3785.0 32.82456182926172 0.0 - - - - - - - 236.25 7 8 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1319 168 C20140711_OR018_03 C20140711_OR018_03 TB444169.[MT7]-LRFDRFILTEEGDHK[MT7].4b13_2.heavy 541.799 / 868.958 6055.0 34.99530029296875 48 18 10 10 10 5.806821176887343 17.221126146957303 0.0 3 0.989121190168554 11.821624825933135 6055.0 63.36925925925926 0.0 - - - - - - - 210.0 12 6 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1321 168 C20140711_OR018_03 C20140711_OR018_03 TB444169.[MT7]-LRFDRFILTEEGDHK[MT7].4b10_2.heavy 541.799 / 718.412 3659.0 34.99530029296875 48 18 10 10 10 5.806821176887343 17.221126146957303 0.0 3 0.989121190168554 11.821624825933135 3659.0 18.896273300128293 0.0 - - - - - - - 210.0 7 6 LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1323 169 C20140711_OR018_03 C20140711_OR018_03 TB432307.[MT7]-EDNIEC[CAM]LLSTAC[CAM]LLQLSQVVEAC[CAM]C[CAM]K[MT7].4b4_1.heavy 811.151 / 616.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 1325 169 C20140711_OR018_03 C20140711_OR018_03 TB432307.[MT7]-EDNIEC[CAM]LLSTAC[CAM]LLQLSQVVEAC[CAM]C[CAM]K[MT7].4b5_1.heavy 811.151 / 745.349 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 1327 169 C20140711_OR018_03 C20140711_OR018_03 TB432307.[MT7]-EDNIEC[CAM]LLSTAC[CAM]LLQLSQVVEAC[CAM]C[CAM]K[MT7].4b6_1.heavy 811.151 / 905.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 1329 169 C20140711_OR018_03 C20140711_OR018_03 TB432307.[MT7]-EDNIEC[CAM]LLSTAC[CAM]LLQLSQVVEAC[CAM]C[CAM]K[MT7].4b3_1.heavy 811.151 / 503.222 N/A N/A - - - - - - - - - 0.0 - - - - - - - KLHL5 kelch-like 5 (Drosophila) 1331 170 C20140711_OR018_03 C20140711_OR018_03 TB422781.[MT7]-AVFQTSELERGEGWTAAR.3y6_1.heavy 718.035 / 661.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1333 170 C20140711_OR018_03 C20140711_OR018_03 TB422781.[MT7]-AVFQTSELERGEGWTAAR.3y17_2.heavy 718.035 / 968.979 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1335 170 C20140711_OR018_03 C20140711_OR018_03 TB422781.[MT7]-AVFQTSELERGEGWTAAR.3y8_1.heavy 718.035 / 847.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1337 170 C20140711_OR018_03 C20140711_OR018_03 TB422781.[MT7]-AVFQTSELERGEGWTAAR.3y16_2.heavy 718.035 / 919.445 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1339 171 C20140711_OR018_03 C20140711_OR018_03 TB432053.[MT7]-SSYDMYHLSR.2y9_1.heavy 701.831 / 1171.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS2;LOC100287457;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL1;KIR3DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 1341 171 C20140711_OR018_03 C20140711_OR018_03 TB432053.[MT7]-SSYDMYHLSR.2b4_1.heavy 701.831 / 597.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS2;LOC100287457;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL1;KIR3DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 1343 171 C20140711_OR018_03 C20140711_OR018_03 TB432053.[MT7]-SSYDMYHLSR.2y6_1.heavy 701.831 / 806.398 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS2;LOC100287457;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL1;KIR3DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 1345 171 C20140711_OR018_03 C20140711_OR018_03 TB432053.[MT7]-SSYDMYHLSR.2b5_1.heavy 701.831 / 728.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DS2;LOC100287457;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL1;KIR3DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DL2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 1347 172 C20140711_OR018_03 C20140711_OR018_03 TB444164.[MT7]-ALDC[CAM]EEILIFTMETGPR.3b6_1.heavy 713.691 / 862.373 24885.0 48.011199951171875 41 16 10 5 10 5.3230054994400575 18.786379238292973 0.0406036376953125 3 0.9659047616383306 6.664595108013901 24885.0 163.95103109037018 0.0 - - - - - - - 257.84615384615387 49 13 TGM6 transglutaminase 6 1349 172 C20140711_OR018_03 C20140711_OR018_03 TB444164.[MT7]-ALDC[CAM]EEILIFTMETGPR.3b5_1.heavy 713.691 / 733.331 7806.0 48.011199951171875 41 16 10 5 10 5.3230054994400575 18.786379238292973 0.0406036376953125 3 0.9659047616383306 6.664595108013901 7806.0 144.27389020670958 0.0 - - - - - - - 192.0 15 12 TGM6 transglutaminase 6 1351 172 C20140711_OR018_03 C20140711_OR018_03 TB444164.[MT7]-ALDC[CAM]EEILIFTMETGPR.3y8_1.heavy 713.691 / 938.44 17603.0 48.011199951171875 41 16 10 5 10 5.3230054994400575 18.786379238292973 0.0406036376953125 3 0.9659047616383306 6.664595108013901 17603.0 130.85119481061164 0.0 - - - - - - - 215.11111111111111 35 9 TGM6 transglutaminase 6 1353 172 C20140711_OR018_03 C20140711_OR018_03 TB444164.[MT7]-ALDC[CAM]EEILIFTMETGPR.3b7_1.heavy 713.691 / 975.457 14197.0 48.011199951171875 41 16 10 5 10 5.3230054994400575 18.786379238292973 0.0406036376953125 3 0.9659047616383306 6.664595108013901 14197.0 289.47301592507085 0.0 - - - - - - - 229.6153846153846 28 13 TGM6 transglutaminase 6 1355 173 C20140711_OR018_03 C20140711_OR018_03 TB431915.[MT7]-RLSNAATR.2b4_1.heavy 516.805 / 615.37 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2 dual oxidase 2 1357 173 C20140711_OR018_03 C20140711_OR018_03 TB431915.[MT7]-RLSNAATR.2b6_1.heavy 516.805 / 757.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2 dual oxidase 2 1359 173 C20140711_OR018_03 C20140711_OR018_03 TB431915.[MT7]-RLSNAATR.2b5_1.heavy 516.805 / 686.407 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2 dual oxidase 2 1361 173 C20140711_OR018_03 C20140711_OR018_03 TB431915.[MT7]-RLSNAATR.2y7_1.heavy 516.805 / 732.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2 dual oxidase 2 1363 174 C20140711_OR018_03 C20140711_OR018_03 TB443833.[MT7]-NLAQEPSQR.2y8_1.heavy 593.818 / 928.485 4571.0 18.967899322509766 44 14 10 10 10 1.4005962474969873 47.85369170882704 0.0 3 0.9450540968256305 5.240657921088238 4571.0 98.10926829268291 0.0 - - - - - - - 122.66666666666667 9 6 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1365 174 C20140711_OR018_03 C20140711_OR018_03 TB443833.[MT7]-NLAQEPSQR.2y6_1.heavy 593.818 / 744.364 2040.0 18.967899322509766 44 14 10 10 10 1.4005962474969873 47.85369170882704 0.0 3 0.9450540968256305 5.240657921088238 2040.0 23.05447154471545 1.0 - - - - - - - 204.0 4 4 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1367 174 C20140711_OR018_03 C20140711_OR018_03 TB443833.[MT7]-NLAQEPSQR.2b5_1.heavy 593.818 / 700.375 4407.0 18.967899322509766 44 14 10 10 10 1.4005962474969873 47.85369170882704 0.0 3 0.9450540968256305 5.240657921088238 4407.0 17.912230893260237 1.0 - - - - - - - 233.28571428571428 8 7 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1369 174 C20140711_OR018_03 C20140711_OR018_03 TB443833.[MT7]-NLAQEPSQR.2y7_1.heavy 593.818 / 815.401 3999.0 18.967899322509766 44 14 10 10 10 1.4005962474969873 47.85369170882704 0.0 3 0.9450540968256305 5.240657921088238 3999.0 0.4953681314423001 1.0 - - - - - - - 109.0 10 3 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1371 175 C20140711_OR018_03 C20140711_OR018_03 TB443973.[MT7]-YTGTRPSNLANNTILVK[MT7].3b11_2.heavy 717.411 / 660.345 3624.0 30.68179988861084 42 18 10 6 8 4.912200733592577 20.35747426120842 0.03560066223144531 4 0.9879123757069217 11.21381675316173 3624.0 5.890600706713782 1.0 - - - - - - - 245.5 12 12 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1373 175 C20140711_OR018_03 C20140711_OR018_03 TB443973.[MT7]-YTGTRPSNLANNTILVK[MT7].3y3_1.heavy 717.411 / 503.367 8608.0 30.68179988861084 42 18 10 6 8 4.912200733592577 20.35747426120842 0.03560066223144531 4 0.9879123757069217 11.21381675316173 8608.0 39.84603864593362 0.0 - - - - - - - 288.45454545454544 17 11 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1375 175 C20140711_OR018_03 C20140711_OR018_03 TB443973.[MT7]-YTGTRPSNLANNTILVK[MT7].3y4_1.heavy 717.411 / 616.451 2265.0 30.68179988861084 42 18 10 6 8 4.912200733592577 20.35747426120842 0.03560066223144531 4 0.9879123757069217 11.21381675316173 2265.0 4.663235294117647 0.0 - - - - - - - 272.0 4 15 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1377 175 C20140711_OR018_03 C20140711_OR018_03 TB443973.[MT7]-YTGTRPSNLANNTILVK[MT7].3b8_1.heavy 717.411 / 1021.52 1586.0 30.68179988861084 42 18 10 6 8 4.912200733592577 20.35747426120842 0.03560066223144531 4 0.9879123757069217 11.21381675316173 1586.0 9.201570025373202 0.0 - - - - - - - 226.625 3 8 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1379 176 C20140711_OR018_03 C20140711_OR018_03 TB422241.[MT7]-RLPAGPK[MT7].2y4_1.heavy 513.837 / 516.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DL1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1381 176 C20140711_OR018_03 C20140711_OR018_03 TB422241.[MT7]-RLPAGPK[MT7].2y5_1.heavy 513.837 / 613.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DL1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1383 176 C20140711_OR018_03 C20140711_OR018_03 TB422241.[MT7]-RLPAGPK[MT7].2y6_1.heavy 513.837 / 726.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DL1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1385 176 C20140711_OR018_03 C20140711_OR018_03 TB422241.[MT7]-RLPAGPK[MT7].2b5_1.heavy 513.837 / 639.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - KIR2DL1;KIR2DS5 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1387 177 C20140711_OR018_03 C20140711_OR018_03 TB444064.[MT7]-LK[MT7]QELFAFNK[MT7].3y3_1.heavy 557.338 / 552.326 25847.0 36.16550064086914 45 15 10 10 10 2.9799739537280003 33.55734028309148 0.0 3 0.9536485897679499 5.710037234819265 25847.0 52.79365401793099 0.0 - - - - - - - 259.8333333333333 51 6 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1389 177 C20140711_OR018_03 C20140711_OR018_03 TB444064.[MT7]-LK[MT7]QELFAFNK[MT7].3b4_1.heavy 557.338 / 787.492 7576.0 36.16550064086914 45 15 10 10 10 2.9799739537280003 33.55734028309148 0.0 3 0.9536485897679499 5.710037234819265 7576.0 24.82364038630206 0.0 - - - - - - - 194.875 15 8 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1391 177 C20140711_OR018_03 C20140711_OR018_03 TB444064.[MT7]-LK[MT7]QELFAFNK[MT7].3y4_1.heavy 557.338 / 623.363 32308.0 36.16550064086914 45 15 10 10 10 2.9799739537280003 33.55734028309148 0.0 3 0.9536485897679499 5.710037234819265 32308.0 110.2068222621185 0.0 - - - - - - - 222.71428571428572 64 7 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1393 177 C20140711_OR018_03 C20140711_OR018_03 TB444064.[MT7]-LK[MT7]QELFAFNK[MT7].3y5_1.heavy 557.338 / 770.432 9693.0 36.16550064086914 45 15 10 10 10 2.9799739537280003 33.55734028309148 0.0 3 0.9536485897679499 5.710037234819265 9693.0 65.8190123788298 0.0 - - - - - - - 247.44444444444446 19 9 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1395 178 C20140711_OR018_03 C20140711_OR018_03 TB443836.[MT7]-IMLAIITK[MT7].2b3_1.heavy 595.893 / 502.318 18680.0 41.62810134887695 50 20 10 10 10 7.185484011545565 13.916946978007463 0.0 3 0.9946860543750065 16.922374849589655 18680.0 38.41125541125541 0.0 - - - - - - - 224.4 37 10 IRX5;IRX2;IRX4;IRX6;IRX3;IRX1 iroquois homeobox 5;iroquois homeobox 2;iroquois homeobox 4;iroquois homeobox 6;iroquois homeobox 3;iroquois homeobox 1 1397 178 C20140711_OR018_03 C20140711_OR018_03 TB443836.[MT7]-IMLAIITK[MT7].2y5_1.heavy 595.893 / 689.468 17360.0 41.62810134887695 50 20 10 10 10 7.185484011545565 13.916946978007463 0.0 3 0.9946860543750065 16.922374849589655 17360.0 124.93939393939392 0.0 - - - - - - - 173.25 34 8 IRX5;IRX2;IRX4;IRX6;IRX3;IRX1 iroquois homeobox 5;iroquois homeobox 2;iroquois homeobox 4;iroquois homeobox 6;iroquois homeobox 3;iroquois homeobox 1 1399 178 C20140711_OR018_03 C20140711_OR018_03 TB443836.[MT7]-IMLAIITK[MT7].2b4_1.heavy 595.893 / 573.355 25347.0 41.62810134887695 50 20 10 10 10 7.185484011545565 13.916946978007463 0.0 3 0.9946860543750065 16.922374849589655 25347.0 29.763522727272722 0.0 - - - - - - - 264.0 50 7 IRX5;IRX2;IRX4;IRX6;IRX3;IRX1 iroquois homeobox 5;iroquois homeobox 2;iroquois homeobox 4;iroquois homeobox 6;iroquois homeobox 3;iroquois homeobox 1 1401 178 C20140711_OR018_03 C20140711_OR018_03 TB443836.[MT7]-IMLAIITK[MT7].2y3_1.heavy 595.893 / 505.347 24093.0 41.62810134887695 50 20 10 10 10 7.185484011545565 13.916946978007463 0.0 3 0.9946860543750065 16.922374849589655 24093.0 28.899431818181817 0.0 - - - - - - - 234.66666666666666 48 9 IRX5;IRX2;IRX4;IRX6;IRX3;IRX1 iroquois homeobox 5;iroquois homeobox 2;iroquois homeobox 4;iroquois homeobox 6;iroquois homeobox 3;iroquois homeobox 1 1403 179 C20140711_OR018_03 C20140711_OR018_03 TB422646.[MT7]-HGLGVSTAQPALVPK[MT7].3b9_1.heavy 588.352 / 995.539 4480.0 28.736000061035156 42 16 10 6 10 2.3188412950409854 43.12498669652703 0.03620147705078125 3 0.9626623252970269 6.366900957523792 4480.0 46.564332065339 0.0 - - - - - - - 234.28571428571428 8 7 ITIH5L inter-alpha (globulin) inhibitor H5-like 1405 179 C20140711_OR018_03 C20140711_OR018_03 TB422646.[MT7]-HGLGVSTAQPALVPK[MT7].3y6_1.heavy 588.352 / 768.51 3059.0 28.736000061035156 42 16 10 6 10 2.3188412950409854 43.12498669652703 0.03620147705078125 3 0.9626623252970269 6.366900957523792 3059.0 17.160243902439024 0.0 - - - - - - - 237.0 6 6 ITIH5L inter-alpha (globulin) inhibitor H5-like 1407 179 C20140711_OR018_03 C20140711_OR018_03 TB422646.[MT7]-HGLGVSTAQPALVPK[MT7].3b4_1.heavy 588.352 / 509.295 6010.0 28.736000061035156 42 16 10 6 10 2.3188412950409854 43.12498669652703 0.03620147705078125 3 0.9626623252970269 6.366900957523792 6010.0 12.826219512195122 0.0 - - - - - - - 273.25 12 12 ITIH5L inter-alpha (globulin) inhibitor H5-like 1409 179 C20140711_OR018_03 C20140711_OR018_03 TB422646.[MT7]-HGLGVSTAQPALVPK[MT7].3b5_1.heavy 588.352 / 608.364 5900.0 28.736000061035156 42 16 10 6 10 2.3188412950409854 43.12498669652703 0.03620147705078125 3 0.9626623252970269 6.366900957523792 5900.0 26.922406861431256 0.0 - - - - - - - 233.33333333333334 11 15 ITIH5L inter-alpha (globulin) inhibitor H5-like 1411 180 C20140711_OR018_03 C20140711_OR018_03 TB422247.[MT7]-RLPAGTK[MT7].2y4_1.heavy 515.834 / 520.321 793.0 17.93464946746826 43 18 10 5 10 5.873140386811333 17.026666044720983 0.04129981994628906 3 0.9886189903567517 11.557375386338029 793.0 1.001262626262626 0.0 - - - - - - - 0.0 1 0 KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 1413 180 C20140711_OR018_03 C20140711_OR018_03 TB422247.[MT7]-RLPAGTK[MT7].2y5_1.heavy 515.834 / 617.374 3039.0 17.93464946746826 43 18 10 5 10 5.873140386811333 17.026666044720983 0.04129981994628906 3 0.9886189903567517 11.557375386338029 3039.0 52.49181818181818 0.0 - - - - - - - 132.0 6 6 KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 1415 180 C20140711_OR018_03 C20140711_OR018_03 TB422247.[MT7]-RLPAGTK[MT7].2b6_1.heavy 515.834 / 740.453 264.0 17.93464946746826 43 18 10 5 10 5.873140386811333 17.026666044720983 0.04129981994628906 3 0.9886189903567517 11.557375386338029 264.0 2.48 7.0 - - - - - - - 0.0 1 0 KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 1417 180 C20140711_OR018_03 C20140711_OR018_03 TB422247.[MT7]-RLPAGTK[MT7].2y6_1.heavy 515.834 / 730.458 727.0 17.93464946746826 43 18 10 5 10 5.873140386811333 17.026666044720983 0.04129981994628906 3 0.9886189903567517 11.557375386338029 727.0 2.9184945866987455 1.0 - - - - - - - 0.0 1 0 KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 1419 181 C20140711_OR018_03 C20140711_OR018_03 TB432300.[MT7]-VLNLSLEYNFVTPLTSLVMVQPK[MT7].4b7_1.heavy 724.164 / 913.547 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 1421 181 C20140711_OR018_03 C20140711_OR018_03 TB432300.[MT7]-VLNLSLEYNFVTPLTSLVMVQPK[MT7].4b4_1.heavy 724.164 / 584.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 1423 181 C20140711_OR018_03 C20140711_OR018_03 TB432300.[MT7]-VLNLSLEYNFVTPLTSLVMVQPK[MT7].4b9_1.heavy 724.164 / 1190.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 1425 181 C20140711_OR018_03 C20140711_OR018_03 TB432300.[MT7]-VLNLSLEYNFVTPLTSLVMVQPK[MT7].4b6_1.heavy 724.164 / 784.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 1427 182 C20140711_OR018_03 C20140711_OR018_03 TB422899.[MT7]-SSDTC[CAM]NPLSGAFSGVSNIFSFWGDSR.3b11_1.heavy 980.451 / 1234.55 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1429 182 C20140711_OR018_03 C20140711_OR018_03 TB422899.[MT7]-SSDTC[CAM]NPLSGAFSGVSNIFSFWGDSR.3b6_1.heavy 980.451 / 809.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1431 182 C20140711_OR018_03 C20140711_OR018_03 TB422899.[MT7]-SSDTC[CAM]NPLSGAFSGVSNIFSFWGDSR.3y8_1.heavy 980.451 / 1001.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1433 182 C20140711_OR018_03 C20140711_OR018_03 TB422899.[MT7]-SSDTC[CAM]NPLSGAFSGVSNIFSFWGDSR.3y5_1.heavy 980.451 / 620.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1435 183 C20140711_OR018_03 C20140711_OR018_03 TB422499.[MT7]-K[MT7]NHEEEMK[MT7].3b6_2.heavy 492.933 / 528.272 331.0 14.883825063705444 45 20 10 5 10 8.204668077798623 12.188183489176664 0.04629993438720703 3 0.9952821143496083 17.960473032028275 331.0 11.682352941176472 0.0 - - - - - - - 0.0 0 0 KRT28;KRT24;KRT27;KRT10;KRT13;KRT15 keratin 28;keratin 24;keratin 27;keratin 10;keratin 13;keratin 15 1437 183 C20140711_OR018_03 C20140711_OR018_03 TB422499.[MT7]-K[MT7]NHEEEMK[MT7].3y3_1.heavy 492.933 / 551.298 561.0 14.883825063705444 45 20 10 5 10 8.204668077798623 12.188183489176664 0.04629993438720703 3 0.9952821143496083 17.960473032028275 561.0 5.0249999999999995 2.0 - - - - - - - 0.0 1 0 KRT28;KRT24;KRT27;KRT10;KRT13;KRT15 keratin 28;keratin 24;keratin 27;keratin 10;keratin 13;keratin 15 1439 183 C20140711_OR018_03 C20140711_OR018_03 TB422499.[MT7]-K[MT7]NHEEEMK[MT7].3y5_1.heavy 492.933 / 809.383 561.0 14.883825063705444 45 20 10 5 10 8.204668077798623 12.188183489176664 0.04629993438720703 3 0.9952821143496083 17.960473032028275 561.0 24.453000000000003 0.0 - - - - - - - 0.0 1 0 KRT28;KRT24;KRT27;KRT10;KRT13;KRT15 keratin 28;keratin 24;keratin 27;keratin 10;keratin 13;keratin 15 1441 183 C20140711_OR018_03 C20140711_OR018_03 TB422499.[MT7]-K[MT7]NHEEEMK[MT7].3y4_1.heavy 492.933 / 680.341 994.0 14.883825063705444 45 20 10 5 10 8.204668077798623 12.188183489176664 0.04629993438720703 3 0.9952821143496083 17.960473032028275 994.0 51.541515789473685 0.0 - - - - - - - 0.0 1 0 KRT28;KRT24;KRT27;KRT10;KRT13;KRT15 keratin 28;keratin 24;keratin 27;keratin 10;keratin 13;keratin 15 1443 184 C20140711_OR018_03 C20140711_OR018_03 TB432084.[MT7]-FILTEEGDHK[MT7].2b3_1.heavy 738.9 / 518.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1445 184 C20140711_OR018_03 C20140711_OR018_03 TB432084.[MT7]-FILTEEGDHK[MT7].2y8_1.heavy 738.9 / 1072.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1447 184 C20140711_OR018_03 C20140711_OR018_03 TB432084.[MT7]-FILTEEGDHK[MT7].2y9_1.heavy 738.9 / 1185.62 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1449 184 C20140711_OR018_03 C20140711_OR018_03 TB432084.[MT7]-FILTEEGDHK[MT7].2y7_1.heavy 738.9 / 959.455 N/A N/A - - - - - - - - - 0.0 - - - - - - - LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 1451 185 C20140711_OR018_03 C20140711_OR018_03 TB422698.[MT7]-AAEFLAAC[CAM]AGGDLDEAR.3b4_1.heavy 627.636 / 563.295 22545.0 37.04069900512695 50 20 10 10 10 7.463324523056303 13.39885458431721 0.0 3 0.9967128264086609 21.519491835169013 22545.0 29.08609753526826 0.0 - - - - - - - 300.6666666666667 45 3 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1453 185 C20140711_OR018_03 C20140711_OR018_03 TB422698.[MT7]-AAEFLAAC[CAM]AGGDLDEAR.3b5_1.heavy 627.636 / 676.379 14686.0 37.04069900512695 50 20 10 10 10 7.463324523056303 13.39885458431721 0.0 3 0.9967128264086609 21.519491835169013 14686.0 16.149414735101416 0.0 - - - - - - - 309.0 29 5 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1455 185 C20140711_OR018_03 C20140711_OR018_03 TB422698.[MT7]-AAEFLAAC[CAM]AGGDLDEAR.3y8_1.heavy 627.636 / 832.38 10564.0 37.04069900512695 50 20 10 10 10 7.463324523056303 13.39885458431721 0.0 3 0.9967128264086609 21.519491835169013 10564.0 58.42805527207044 0.0 - - - - - - - 202.57142857142858 21 7 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1457 185 C20140711_OR018_03 C20140711_OR018_03 TB422698.[MT7]-AAEFLAAC[CAM]AGGDLDEAR.3y9_1.heavy 627.636 / 903.417 8116.0 37.04069900512695 50 20 10 10 10 7.463324523056303 13.39885458431721 0.0 3 0.9967128264086609 21.519491835169013 8116.0 19.219932428189253 0.0 - - - - - - - 257.75 16 4 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1459 186 C20140711_OR018_03 C20140711_OR018_03 TB422695.[MT7]-AGGSIQATIQNVHSAK[MT7].4y5_1.heavy 468.265 / 685.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 1461 186 C20140711_OR018_03 C20140711_OR018_03 TB422695.[MT7]-AGGSIQATIQNVHSAK[MT7].4y4_1.heavy 468.265 / 586.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 1463 186 C20140711_OR018_03 C20140711_OR018_03 TB422695.[MT7]-AGGSIQATIQNVHSAK[MT7].4b4_1.heavy 468.265 / 417.221 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 1465 186 C20140711_OR018_03 C20140711_OR018_03 TB422695.[MT7]-AGGSIQATIQNVHSAK[MT7].4b5_1.heavy 468.265 / 530.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 1467 187 C20140711_OR018_03 C20140711_OR018_03 TB422494.[MT7]-YNADYELSAK[MT7].3b6_1.heavy 487.92 / 900.386 772.0 28.302099227905273 48 18 10 10 10 3.7649819144603653 26.56055255296837 0.0 3 0.9818721496303673 9.152314929835587 772.0 -2.8072727272727276 0.0 - - - - - - - 0.0 1 0 MTX3 metaxin 3 1469 187 C20140711_OR018_03 C20140711_OR018_03 TB422494.[MT7]-YNADYELSAK[MT7].3b4_1.heavy 487.92 / 608.28 12028.0 28.302099227905273 48 18 10 10 10 3.7649819144603653 26.56055255296837 0.0 3 0.9818721496303673 9.152314929835587 12028.0 53.25012995732028 0.0 - - - - - - - 267.85714285714283 24 7 MTX3 metaxin 3 1471 187 C20140711_OR018_03 C20140711_OR018_03 TB422494.[MT7]-YNADYELSAK[MT7].3y4_1.heavy 487.92 / 562.368 1766.0 28.302099227905273 48 18 10 10 10 3.7649819144603653 26.56055255296837 0.0 3 0.9818721496303673 9.152314929835587 1766.0 9.509618175480846 1.0 - - - - - - - 220.5 5 6 MTX3 metaxin 3 1473 187 C20140711_OR018_03 C20140711_OR018_03 TB422494.[MT7]-YNADYELSAK[MT7].3b3_1.heavy 487.92 / 493.253 3973.0 28.302099227905273 48 18 10 10 10 3.7649819144603653 26.56055255296837 0.0 3 0.9818721496303673 9.152314929835587 3973.0 18.345613046985 0.0 - - - - - - - 248.25 7 4 MTX3 metaxin 3 1475 188 C20140711_OR018_03 C20140711_OR018_03 TB422350.[MT7]-RPASVSSSAAVEHEQR.3y7_1.heavy 618.989 / 868.427 347.0 17.893799781799316 37 12 10 5 10 2.313528575299385 34.47329373620681 0.04039955139160156 3 0.8856823832451467 3.614755668983194 347.0 8.974137931034482 0.0 - - - - - - - 0.0 0 0 IRF2BP2 interferon regulatory factor 2 binding protein 2 1477 188 C20140711_OR018_03 C20140711_OR018_03 TB422350.[MT7]-RPASVSSSAAVEHEQR.3y6_1.heavy 618.989 / 797.39 578.0 17.893799781799316 37 12 10 5 10 2.313528575299385 34.47329373620681 0.04039955139160156 3 0.8856823832451467 3.614755668983194 578.0 13.951724137931034 0.0 - - - - - - - 0.0 1 0 IRF2BP2 interferon regulatory factor 2 binding protein 2 1479 188 C20140711_OR018_03 C20140711_OR018_03 TB422350.[MT7]-RPASVSSSAAVEHEQR.3y5_1.heavy 618.989 / 698.322 1156.0 17.893799781799316 37 12 10 5 10 2.313528575299385 34.47329373620681 0.04039955139160156 3 0.8856823832451467 3.614755668983194 1156.0 21.126896551724137 0.0 - - - - - - - 98.4 2 10 IRF2BP2 interferon regulatory factor 2 binding protein 2 1481 188 C20140711_OR018_03 C20140711_OR018_03 TB422350.[MT7]-RPASVSSSAAVEHEQR.3y4_1.heavy 618.989 / 569.279 1040.0 17.893799781799316 37 12 10 5 10 2.313528575299385 34.47329373620681 0.04039955139160156 3 0.8856823832451467 3.614755668983194 1040.0 20.614402149574563 0.0 - - - - - - - 156.1 2 10 IRF2BP2 interferon regulatory factor 2 binding protein 2 1483 189 C20140711_OR018_03 C20140711_OR018_03 TB422357.[MT7]-AMAIADALGK[MT7].3y3_1.heavy 416.912 / 461.32 8066.0 35.46070098876953 36 10 10 10 6 4.692993109862975 21.30836284200719 0.0 5 0.838272136997368 3.026461150907676 8066.0 53.38270983159869 0.0 - - - - - - - 336.0 16 4 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1485 189 C20140711_OR018_03 C20140711_OR018_03 TB422357.[MT7]-AMAIADALGK[MT7].3b6_1.heavy 416.912 / 717.372 1833.0 35.46070098876953 36 10 10 10 6 4.692993109862975 21.30836284200719 0.0 5 0.838272136997368 3.026461150907676 1833.0 -0.72 1.0 - - - - - - - 0.0 6 0 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1487 189 C20140711_OR018_03 C20140711_OR018_03 TB422357.[MT7]-AMAIADALGK[MT7].3b4_1.heavy 416.912 / 531.308 9165.0 35.46070098876953 36 10 10 10 6 4.692993109862975 21.30836284200719 0.0 5 0.838272136997368 3.026461150907676 9165.0 144.38631147540983 0.0 - - - - - - - 325.6666666666667 18 3 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1489 189 C20140711_OR018_03 C20140711_OR018_03 TB422357.[MT7]-AMAIADALGK[MT7].3b5_1.heavy 416.912 / 602.345 2322.0 35.46070098876953 36 10 10 10 6 4.692993109862975 21.30836284200719 0.0 5 0.838272136997368 3.026461150907676 2322.0 18.366639344262296 2.0 - - - - - - - 228.875 10 8 UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1491 190 C20140711_OR018_03 C20140711_OR018_03 TB422791.[MT7]-VGTERWWLDGPLVHVK[MT7].4b11_2.heavy 545.811 / 721.371 2304.0 40.40575122833252 34 18 2 6 8 3.5679252621237167 28.02749291348035 0.033000946044921875 4 0.9824092931020485 9.291418708731685 2304.0 -2.8012158054711245 0.0 - - - - - - - 274.3333333333333 4 6 GLT6D1 glycosyltransferase 6 domain containing 1 1493 190 C20140711_OR018_03 C20140711_OR018_03 TB422791.[MT7]-VGTERWWLDGPLVHVK[MT7].4y3_1.heavy 545.811 / 527.342 5595.0 40.40575122833252 34 18 2 6 8 3.5679252621237167 28.02749291348035 0.033000946044921875 4 0.9824092931020485 9.291418708731685 5595.0 40.72182923459519 0.0 - - - - - - - 702.2 11 10 GLT6D1 glycosyltransferase 6 domain containing 1 1495 190 C20140711_OR018_03 C20140711_OR018_03 TB422791.[MT7]-VGTERWWLDGPLVHVK[MT7].4b9_2.heavy 545.811 / 644.334 2743.0 40.40575122833252 34 18 2 6 8 3.5679252621237167 28.02749291348035 0.033000946044921875 4 0.9824092931020485 9.291418708731685 2743.0 -0.6669908814589665 1.0 - - - - - - - 315.375 34 8 GLT6D1 glycosyltransferase 6 domain containing 1 1497 190 C20140711_OR018_03 C20140711_OR018_03 TB422791.[MT7]-VGTERWWLDGPLVHVK[MT7].4b10_2.heavy 545.811 / 672.844 7131.0 40.40575122833252 34 18 2 6 8 3.5679252621237167 28.02749291348035 0.033000946044921875 4 0.9824092931020485 9.291418708731685 7131.0 42.951700939245484 0.0 - - - - - - - 219.42857142857142 14 7 GLT6D1 glycosyltransferase 6 domain containing 1 1499 191 C20140711_OR018_03 C20140711_OR018_03 TB422359.[MT7]-SADDSLSGVVR.2y8_1.heavy 625.329 / 832.452 2641.0 27.213449478149414 37 12 10 5 10 1.0071839514758634 57.29665755098725 0.042499542236328125 3 0.884107285211421 3.589615477782051 2641.0 2.6810909090909094 1.0 - - - - - - - 238.33333333333334 5 6 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1501 191 C20140711_OR018_03 C20140711_OR018_03 TB422359.[MT7]-SADDSLSGVVR.2b4_1.heavy 625.329 / 533.232 4512.0 27.213449478149414 37 12 10 5 10 1.0071839514758634 57.29665755098725 0.042499542236328125 3 0.884107285211421 3.589615477782051 4512.0 1.4399818264425261 1.0 - - - - - - - 220.0 9 8 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1503 191 C20140711_OR018_03 C20140711_OR018_03 TB422359.[MT7]-SADDSLSGVVR.2y10_1.heavy 625.329 / 1018.52 5283.0 27.213449478149414 37 12 10 5 10 1.0071839514758634 57.29665755098725 0.042499542236328125 3 0.884107285211421 3.589615477782051 5283.0 55.71163636363635 0.0 - - - - - - - 178.75 10 8 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1505 191 C20140711_OR018_03 C20140711_OR018_03 TB422359.[MT7]-SADDSLSGVVR.2y7_1.heavy 625.329 / 717.425 3742.0 27.213449478149414 37 12 10 5 10 1.0071839514758634 57.29665755098725 0.042499542236328125 3 0.884107285211421 3.589615477782051 3742.0 7.588942927909628 0.0 - - - - - - - 275.0 7 8 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1507 192 C20140711_OR018_03 C20140711_OR018_03 TB422152.[MT7]-TAEGAPGAGLQR.3y6_1.heavy 424.566 / 601.342 2296.0 21.14092493057251 38 20 9 3 6 11.538297151490212 8.666790141306478 0.07430076599121094 6 0.9900467542588093 12.360018685022519 2296.0 16.31 0.0 - - - - - - - 187.42857142857142 4 7 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1509 192 C20140711_OR018_03 C20140711_OR018_03 TB422152.[MT7]-TAEGAPGAGLQR.3b4_1.heavy 424.566 / 503.258 1722.0 21.14092493057251 38 20 9 3 6 11.538297151490212 8.666790141306478 0.07430076599121094 6 0.9900467542588093 12.360018685022519 1722.0 18.605999999999998 0.0 - - - - - - - 221.4 3 10 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1511 192 C20140711_OR018_03 C20140711_OR018_03 TB422152.[MT7]-TAEGAPGAGLQR.3b5_1.heavy 424.566 / 574.295 1230.0 21.14092493057251 38 20 9 3 6 11.538297151490212 8.666790141306478 0.07430076599121094 6 0.9900467542588093 12.360018685022519 1230.0 2.0999999999999996 3.0 - - - - - - - 200.44444444444446 5 18 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1513 192 C20140711_OR018_03 C20140711_OR018_03 TB422152.[MT7]-TAEGAPGAGLQR.3y5_1.heavy 424.566 / 544.32 1230.0 21.14092493057251 38 20 9 3 6 11.538297151490212 8.666790141306478 0.07430076599121094 6 0.9900467542588093 12.360018685022519 1230.0 3.375 0.0 - - - - - - - 273.3333333333333 2 6 PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1515 193 C20140711_OR018_03 C20140711_OR018_03 TB422290.[MT7]-APSTAATPDR.2y8_1.heavy 565.8 / 818.4 841.0 17.44925022125244 45 20 10 5 10 2.6008219389443137 27.908703720032634 0.04049873352050781 3 0.993884140351863 15.772917279102526 841.0 2.977826530612245 1.0 - - - - - - - 0.0 1 0 C1QL3 complement component 1, q subcomponent-like 3 1517 193 C20140711_OR018_03 C20140711_OR018_03 TB422290.[MT7]-APSTAATPDR.2y9_1.heavy 565.8 / 915.453 17091.0 17.44925022125244 45 20 10 5 10 2.6008219389443137 27.908703720032634 0.04049873352050781 3 0.993884140351863 15.772917279102526 17091.0 135.7978775510204 0.0 - - - - - - - 200.0 34 7 C1QL3 complement component 1, q subcomponent-like 3 1519 193 C20140711_OR018_03 C20140711_OR018_03 TB422290.[MT7]-APSTAATPDR.2y6_1.heavy 565.8 / 630.321 1289.0 17.44925022125244 45 20 10 5 10 2.6008219389443137 27.908703720032634 0.04049873352050781 3 0.993884140351863 15.772917279102526 1289.0 18.33755952380952 0.0 - - - - - - - 168.0 2 5 C1QL3 complement component 1, q subcomponent-like 3 1521 193 C20140711_OR018_03 C20140711_OR018_03 TB422290.[MT7]-APSTAATPDR.2y7_1.heavy 565.8 / 731.368 841.0 17.44925022125244 45 20 10 5 10 2.6008219389443137 27.908703720032634 0.04049873352050781 3 0.993884140351863 15.772917279102526 841.0 13.5085625 0.0 - - - - - - - 0.0 1 0 C1QL3 complement component 1, q subcomponent-like 3 1523 194 C20140711_OR018_03 C20140711_OR018_03 TB422799.[MT7]-EVQLMHRAPVVAIAVLDGR.4y5_1.heavy 555.321 / 559.32 11388.0 38.562275886535645 40 17 9 6 8 4.458153420860226 22.430811719508846 0.037097930908203125 4 0.9739986378410057 7.6369294868928 11388.0 15.1246875 2.0 - - - - - - - 329.14285714285717 27 7 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1525 194 C20140711_OR018_03 C20140711_OR018_03 TB422799.[MT7]-EVQLMHRAPVVAIAVLDGR.4y6_1.heavy 555.321 / 630.357 11772.0 38.562275886535645 40 17 9 6 8 4.458153420860226 22.430811719508846 0.037097930908203125 4 0.9739986378410057 7.6369294868928 11772.0 64.378125 0.0 - - - - - - - 256.0 23 10 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1527 194 C20140711_OR018_03 C20140711_OR018_03 TB422799.[MT7]-EVQLMHRAPVVAIAVLDGR.4b3_1.heavy 555.321 / 501.279 4862.0 38.562275886535645 40 17 9 6 8 4.458153420860226 22.430811719508846 0.037097930908203125 4 0.9739986378410057 7.6369294868928 4862.0 -0.4220486111111108 0.0 - - - - - - - 192.0 9 4 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1529 194 C20140711_OR018_03 C20140711_OR018_03 TB422799.[MT7]-EVQLMHRAPVVAIAVLDGR.4b10_2.heavy 555.321 / 653.365 9341.0 38.562275886535645 40 17 9 6 8 4.458153420860226 22.430811719508846 0.037097930908203125 4 0.9739986378410057 7.6369294868928 9341.0 43.056171875 0.0 - - - - - - - 227.55555555555554 18 9 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1531 195 C20140711_OR018_03 C20140711_OR018_03 TB432286.[MT7]-C[CAM]LWRDDLLEPATK[MT7]PSIAGK[MT7].3y6_1.heavy 868.151 / 716.442 1044.0 35.21419906616211 20 7 2 5 6 0.5745905446333044 90.6177788491177 0.04740142822265625 5 0.7196552563136177 2.274072339613089 1044.0 5.119999999999999 2.0 - - - - - - - 209.1 7 10 TGM6 transglutaminase 6 1533 195 C20140711_OR018_03 C20140711_OR018_03 TB432286.[MT7]-C[CAM]LWRDDLLEPATK[MT7]PSIAGK[MT7].3b6_1.heavy 868.151 / 990.458 N/A 35.21419906616211 20 7 2 5 6 0.5745905446333044 90.6177788491177 0.04740142822265625 5 0.7196552563136177 2.274072339613089 261.0 1.8146290310017137 16.0 - - - - - - - 304.8333333333333 2 6 TGM6 transglutaminase 6 1535 195 C20140711_OR018_03 C20140711_OR018_03 TB432286.[MT7]-C[CAM]LWRDDLLEPATK[MT7]PSIAGK[MT7].3y5_1.heavy 868.151 / 619.39 1697.0 35.21419906616211 20 7 2 5 6 0.5745905446333044 90.6177788491177 0.04740142822265625 5 0.7196552563136177 2.274072339613089 1697.0 6.281314997263273 0.0 - - - - - - - 186.85714285714286 3 7 TGM6 transglutaminase 6 1537 195 C20140711_OR018_03 C20140711_OR018_03 TB432286.[MT7]-C[CAM]LWRDDLLEPATK[MT7]PSIAGK[MT7].3b7_1.heavy 868.151 / 1103.54 1566.0 35.21419906616211 20 7 2 5 6 0.5745905446333044 90.6177788491177 0.04740142822265625 5 0.7196552563136177 2.274072339613089 1566.0 10.892111959287531 1.0 - - - - - - - 261.3333333333333 4 3 TGM6 transglutaminase 6 1539 196 C20140711_OR018_03 C20140711_OR018_03 TB432281.[MT7]-ISSLVAQEVLSLGADVLPEYK[MT7].4y4_1.heavy 630.611 / 680.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1541 196 C20140711_OR018_03 C20140711_OR018_03 TB432281.[MT7]-ISSLVAQEVLSLGADVLPEYK[MT7].4b4_1.heavy 630.611 / 545.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1543 196 C20140711_OR018_03 C20140711_OR018_03 TB432281.[MT7]-ISSLVAQEVLSLGADVLPEYK[MT7].4b5_1.heavy 630.611 / 644.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1545 196 C20140711_OR018_03 C20140711_OR018_03 TB432281.[MT7]-ISSLVAQEVLSLGADVLPEYK[MT7].4b6_1.heavy 630.611 / 715.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1547 197 C20140711_OR018_03 C20140711_OR018_03 TB432187.[MT7]-RPASVSSSAAVEHEQR.4y4_1.heavy 464.494 / 569.279 1212.0 17.893799781799316 40 15 10 5 10 3.9255987848771183 25.47382080543676 0.04039955139160156 3 0.9535785442491767 5.705693777096235 1212.0 7.182222222222222 0.0 - - - - - - - 128.0 2 10 IRF2BP2 interferon regulatory factor 2 binding protein 2 1549 197 C20140711_OR018_03 C20140711_OR018_03 TB432187.[MT7]-RPASVSSSAAVEHEQR.4y5_1.heavy 464.494 / 698.322 606.0 17.893799781799316 40 15 10 5 10 3.9255987848771183 25.47382080543676 0.04039955139160156 3 0.9535785442491767 5.705693777096235 606.0 8.941866666666666 0.0 - - - - - - - 0.0 1 0 IRF2BP2 interferon regulatory factor 2 binding protein 2 1551 197 C20140711_OR018_03 C20140711_OR018_03 TB432187.[MT7]-RPASVSSSAAVEHEQR.4y7_1.heavy 464.494 / 868.427 135.0 17.893799781799316 40 15 10 5 10 3.9255987848771183 25.47382080543676 0.04039955139160156 3 0.9535785442491767 5.705693777096235 135.0 1.6683168316831685 6.0 - - - - - - - 0.0 0 0 IRF2BP2 interferon regulatory factor 2 binding protein 2 1553 197 C20140711_OR018_03 C20140711_OR018_03 TB432187.[MT7]-RPASVSSSAAVEHEQR.4b9_2.heavy 464.494 / 494.271 404.0 17.893799781799316 40 15 10 5 10 3.9255987848771183 25.47382080543676 0.04039955139160156 3 0.9535785442491767 5.705693777096235 404.0 1.6400000000000001 3.0 - - - - - - - 0.0 0 0 IRF2BP2 interferon regulatory factor 2 binding protein 2 1555 198 C20140711_OR018_03 C20140711_OR018_03 TB422151.[MT7]-AGAGPSSR.2y4_1.heavy 423.731 / 446.236 373.0 13.218299865722656 50 20 10 10 10 20.851410615279146 4.795838605121693 0.0 3 0.9965281974196101 20.939153960706317 373.0 6.385540464063384 0.0 - - - - - - - 0.0 0 0 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1557 198 C20140711_OR018_03 C20140711_OR018_03 TB422151.[MT7]-AGAGPSSR.2b7_1.heavy 423.731 / 672.343 102.0 13.218299865722656 50 20 10 10 10 20.851410615279146 4.795838605121693 0.0 3 0.9965281974196101 20.939153960706317 102.0 -0.5 8.0 - - - - - - - 0.0 0 0 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1559 198 C20140711_OR018_03 C20140711_OR018_03 TB422151.[MT7]-AGAGPSSR.2y5_1.heavy 423.731 / 503.257 634.0 13.218299865722656 50 20 10 10 10 20.851410615279146 4.795838605121693 0.0 3 0.9965281974196101 20.939153960706317 634.0 16.539130434782606 1.0 - - - - - - - 0.0 1 0 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1561 198 C20140711_OR018_03 C20140711_OR018_03 TB422151.[MT7]-AGAGPSSR.2y7_1.heavy 423.731 / 631.316 2037.0 13.218299865722656 50 20 10 10 10 20.851410615279146 4.795838605121693 0.0 3 0.9965281974196101 20.939153960706317 2037.0 45.86658634538152 1.0 - - - - - - - 152.8125 4 16 KCNH2 potassium voltage-gated channel, subfamily H (eag-related), member 2 1563 199 C20140711_OR018_03 C20140711_OR018_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 145813.0 44.22629928588867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 145813.0 233.94101283375932 0.0 - - - - - - - 240.25 291 16 1565 199 C20140711_OR018_03 C20140711_OR018_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 216863.0 44.22629928588867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 216863.0 347.71510851625214 0.0 - - - - - - - 748.1428571428571 433 7 1567 199 C20140711_OR018_03 C20140711_OR018_03 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 204933.0 44.22629928588867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 204933.0 699.449923788965 0.0 - - - - - - - 265.1333333333333 409 15 1569 200 C20140711_OR018_03 C20140711_OR018_03 TB431878.[MT7]-IMAIGTR.2b3_1.heavy 453.272 / 460.271 7507.0 29.157024383544922 46 20 10 6 10 13.805648540455895 7.24341197785539 0.03530120849609375 3 0.9961795169839668 19.96019906512704 7507.0 49.77078843288181 0.0 - - - - - - - 224.5 15 8 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1571 200 C20140711_OR018_03 C20140711_OR018_03 TB431878.[MT7]-IMAIGTR.2y5_1.heavy 453.272 / 517.309 7296.0 29.157024383544922 46 20 10 6 10 13.805648540455895 7.24341197785539 0.03530120849609375 3 0.9961795169839668 19.96019906512704 7296.0 78.09808057113717 0.0 - - - - - - - 198.25 14 8 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1573 200 C20140711_OR018_03 C20140711_OR018_03 TB431878.[MT7]-IMAIGTR.2b6_1.heavy 453.272 / 731.424 423.0 29.157024383544922 46 20 10 6 10 13.805648540455895 7.24341197785539 0.03530120849609375 3 0.9961795169839668 19.96019906512704 423.0 3.751132075471698 12.0 - - - - - - - 246.66666666666666 6 9 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1575 200 C20140711_OR018_03 C20140711_OR018_03 TB431878.[MT7]-IMAIGTR.2y6_1.heavy 453.272 / 648.35 26750.0 29.157024383544922 46 20 10 6 10 13.805648540455895 7.24341197785539 0.03530120849609375 3 0.9961795169839668 19.96019906512704 26750.0 87.02647099163352 0.0 - - - - - - - 211.2 53 10 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1577 201 C20140711_OR018_03 C20140711_OR018_03 TB422362.[MT7]-DAATVTQMHFLTGQGR.3y7_1.heavy 626.32 / 778.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL1 lethal giant larvae homolog 1 (Drosophila) 1579 201 C20140711_OR018_03 C20140711_OR018_03 TB422362.[MT7]-DAATVTQMHFLTGQGR.3y6_1.heavy 626.32 / 631.352 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL1 lethal giant larvae homolog 1 (Drosophila) 1581 201 C20140711_OR018_03 C20140711_OR018_03 TB422362.[MT7]-DAATVTQMHFLTGQGR.3y11_2.heavy 626.32 / 638.317 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL1 lethal giant larvae homolog 1 (Drosophila) 1583 201 C20140711_OR018_03 C20140711_OR018_03 TB422362.[MT7]-DAATVTQMHFLTGQGR.3b4_1.heavy 626.32 / 503.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - LLGL1 lethal giant larvae homolog 1 (Drosophila) 1585 202 C20140711_OR018_03 C20140711_OR018_03 TB422365.[MT7]-VDITDLYK[MT7].2y5_1.heavy 627.863 / 783.437 4427.0 35.60020065307617 48 18 10 10 10 16.617523166245213 6.017743980229717 0.0 3 0.9844944858777016 9.898206705389937 4427.0 26.99390243902439 0.0 - - - - - - - 276.75 8 8 TGM6 transglutaminase 6 1587 202 C20140711_OR018_03 C20140711_OR018_03 TB422365.[MT7]-VDITDLYK[MT7].2y3_1.heavy 627.863 / 567.362 5288.0 35.60020065307617 48 18 10 10 10 16.617523166245213 6.017743980229717 0.0 3 0.9844944858777016 9.898206705389937 5288.0 29.019512195121955 0.0 - - - - - - - 297.25 10 12 TGM6 transglutaminase 6 1589 202 C20140711_OR018_03 C20140711_OR018_03 TB422365.[MT7]-VDITDLYK[MT7].2y6_1.heavy 627.863 / 896.521 2337.0 35.60020065307617 48 18 10 10 10 16.617523166245213 6.017743980229717 0.0 3 0.9844944858777016 9.898206705389937 2337.0 28.310000000000002 0.0 - - - - - - - 184.5 4 8 TGM6 transglutaminase 6 1591 202 C20140711_OR018_03 C20140711_OR018_03 TB422365.[MT7]-VDITDLYK[MT7].2b5_1.heavy 627.863 / 688.363 5411.0 35.60020065307617 48 18 10 10 10 16.617523166245213 6.017743980229717 0.0 3 0.9844944858777016 9.898206705389937 5411.0 52.79024390243902 0.0 - - - - - - - 223.63636363636363 10 11 TGM6 transglutaminase 6 1593 203 C20140711_OR018_03 C20140711_OR018_03 TB432076.[MT7]-LIGEHIDGVSK[MT7].3b4_1.heavy 485.952 / 557.341 17033.0 28.654550075531006 46 20 10 6 10 6.934862382925079 14.419896816729715 0.03619956970214844 3 0.9920077042598645 13.795483346667002 17033.0 75.40889021361153 0.0 - - - - - - - 310.0 34 11 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1595 203 C20140711_OR018_03 C20140711_OR018_03 TB432076.[MT7]-LIGEHIDGVSK[MT7].3b5_1.heavy 485.952 / 694.4 5385.0 28.654550075531006 46 20 10 6 10 6.934862382925079 14.419896816729715 0.03619956970214844 3 0.9920077042598645 13.795483346667002 5385.0 35.9 0.0 - - - - - - - 110.0 10 6 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1597 203 C20140711_OR018_03 C20140711_OR018_03 TB432076.[MT7]-LIGEHIDGVSK[MT7].3y4_1.heavy 485.952 / 534.337 12418.0 28.654550075531006 46 20 10 6 10 6.934862382925079 14.419896816729715 0.03619956970214844 3 0.9920077042598645 13.795483346667002 12418.0 21.192963395275694 0.0 - - - - - - - 183.33333333333334 24 9 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1599 203 C20140711_OR018_03 C20140711_OR018_03 TB432076.[MT7]-LIGEHIDGVSK[MT7].3y5_1.heavy 485.952 / 649.364 12308.0 28.654550075531006 46 20 10 6 10 6.934862382925079 14.419896816729715 0.03619956970214844 3 0.9920077042598645 13.795483346667002 12308.0 120.86934804800663 0.0 - - - - - - - 207.77777777777777 24 9 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1601 204 C20140711_OR018_03 C20140711_OR018_03 TB432074.[MT7]-STQGVTLTDLK[MT7].3b6_1.heavy 484.283 / 718.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1603 204 C20140711_OR018_03 C20140711_OR018_03 TB432074.[MT7]-STQGVTLTDLK[MT7].3b4_1.heavy 484.283 / 518.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1605 204 C20140711_OR018_03 C20140711_OR018_03 TB432074.[MT7]-STQGVTLTDLK[MT7].3b5_1.heavy 484.283 / 617.338 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1607 204 C20140711_OR018_03 C20140711_OR018_03 TB432074.[MT7]-STQGVTLTDLK[MT7].3y4_1.heavy 484.283 / 620.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - PPP1R12C protein phosphatase 1, regulatory (inhibitor) subunit 12C 1609 205 C20140711_OR018_03 C20140711_OR018_03 TB444041.[MT7]-EVEAQIYRDAK[MT7].3y10_2.heavy 537.298 / 668.871 6510.0 26.43939971923828 40 10 10 10 10 1.0824785114394182 61.58705781421668 0.0 3 0.8296384915189009 2.9465166189500445 6510.0 27.742179897385412 0.0 - - - - - - - 220.66666666666666 13 6 MTX3 metaxin 3 1611 205 C20140711_OR018_03 C20140711_OR018_03 TB444041.[MT7]-EVEAQIYRDAK[MT7].3b4_1.heavy 537.298 / 573.3 1324.0 26.43939971923828 40 10 10 10 10 1.0824785114394182 61.58705781421668 0.0 3 0.8296384915189009 2.9465166189500445 1324.0 10.816388317564789 3.0 - - - - - - - 176.4 3 5 MTX3 metaxin 3 1613 205 C20140711_OR018_03 C20140711_OR018_03 TB444041.[MT7]-EVEAQIYRDAK[MT7].3b5_1.heavy 537.298 / 701.359 4303.0 26.43939971923828 40 10 10 10 10 1.0824785114394182 61.58705781421668 0.0 3 0.8296384915189009 2.9465166189500445 4303.0 62.58909090909091 0.0 - - - - - - - 220.625 8 8 MTX3 metaxin 3 1615 205 C20140711_OR018_03 C20140711_OR018_03 TB444041.[MT7]-EVEAQIYRDAK[MT7].3b3_1.heavy 537.298 / 502.263 3641.0 26.43939971923828 40 10 10 10 10 1.0824785114394182 61.58705781421668 0.0 3 0.8296384915189009 2.9465166189500445 3641.0 9.57 0.0 - - - - - - - 695.2 7 10 MTX3 metaxin 3 1617 206 C20140711_OR018_03 C20140711_OR018_03 TB432279.[MT7]-GAGVTLNVLEMTSEDLENALK[MT7].3b6_1.heavy 831.443 / 643.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1619 206 C20140711_OR018_03 C20140711_OR018_03 TB432279.[MT7]-GAGVTLNVLEMTSEDLENALK[MT7].3b5_1.heavy 831.443 / 530.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1621 206 C20140711_OR018_03 C20140711_OR018_03 TB432279.[MT7]-GAGVTLNVLEMTSEDLENALK[MT7].3b8_1.heavy 831.443 / 856.501 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1623 206 C20140711_OR018_03 C20140711_OR018_03 TB432279.[MT7]-GAGVTLNVLEMTSEDLENALK[MT7].3b7_1.heavy 831.443 / 757.432 N/A N/A - - - - - - - - - 0.0 - - - - - - - UGT1A10;UGT1A8;UGT1A7;UGT1A6;UGT1A5;UGT1A9;UGT1A4;UGT1A1;UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A10;UDP glucuronosyltransferase 1 family, polypeptide A8;UDP glucuronosyltransferase 1 family, polypeptide A7;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glucuronosyltransferase 1 family, polypeptide A5;UDP glucuronosyltransferase 1 family, polypeptide A9;UDP glucuronosyltransferase 1 family, polypeptide A4;UDP glucuronosyltransferase 1 family, polypeptide A1;UDP glucuronosyltransferase 1 family, polypeptide A3 1625 207 C20140711_OR018_03 C20140711_OR018_03 TB431871.[MT7]-SLEELR.2y4_1.heavy 445.757 / 546.288 5398.0 26.72719955444336 50 20 10 10 10 6.031962140776777 16.578353389187935 0.0 3 0.9921826134576618 13.949166217670482 5398.0 39.50354545454545 0.0 - - - - - - - 220.0 10 6 NUP98;KDM5C;HES7 nucleoporin 98kDa;lysine (K)-specific demethylase 5C;hairy and enhancer of split 7 (Drosophila) 1627 207 C20140711_OR018_03 C20140711_OR018_03 TB431871.[MT7]-SLEELR.2b3_1.heavy 445.757 / 474.268 12999.0 26.72719955444336 50 20 10 10 10 6.031962140776777 16.578353389187935 0.0 3 0.9921826134576618 13.949166217670482 12999.0 88.23563636363636 1.0 - - - - - - - 235.85714285714286 25 7 NUP98;KDM5C;HES7 nucleoporin 98kDa;lysine (K)-specific demethylase 5C;hairy and enhancer of split 7 (Drosophila) 1629 207 C20140711_OR018_03 C20140711_OR018_03 TB431871.[MT7]-SLEELR.2y5_1.heavy 445.757 / 659.372 10024.0 26.72719955444336 50 20 10 10 10 6.031962140776777 16.578353389187935 0.0 3 0.9921826134576618 13.949166217670482 10024.0 127.48705454545454 0.0 - - - - - - - 176.0 20 5 NUP98;KDM5C;HES7 nucleoporin 98kDa;lysine (K)-specific demethylase 5C;hairy and enhancer of split 7 (Drosophila) 1631 207 C20140711_OR018_03 C20140711_OR018_03 TB431871.[MT7]-SLEELR.2b4_1.heavy 445.757 / 603.311 10795.0 26.72719955444336 50 20 10 10 10 6.031962140776777 16.578353389187935 0.0 3 0.9921826134576618 13.949166217670482 10795.0 43.921644460165865 0.0 - - - - - - - 188.57142857142858 21 7 NUP98;KDM5C;HES7 nucleoporin 98kDa;lysine (K)-specific demethylase 5C;hairy and enhancer of split 7 (Drosophila) 1633 208 C20140711_OR018_03 C20140711_OR018_03 TB432177.[MT7]-GLMQSLPTFIQGPK[MT7].3b6_1.heavy 602.346 / 774.43 6111.0 43.16719913482666 41 18 10 3 10 9.329742754478445 10.718409138558316 0.0699005126953125 3 0.9870663303495947 10.84007504308537 6111.0 14.854154600146874 0.0 - - - - - - - 281.2857142857143 12 14 C1QL3 complement component 1, q subcomponent-like 3 1635 208 C20140711_OR018_03 C20140711_OR018_03 TB432177.[MT7]-GLMQSLPTFIQGPK[MT7].3b4_1.heavy 602.346 / 574.314 6450.0 43.16719913482666 41 18 10 3 10 9.329742754478445 10.718409138558316 0.0699005126953125 3 0.9870663303495947 10.84007504308537 6450.0 13.331699952993358 0.0 - - - - - - - 659.5714285714286 12 7 C1QL3 complement component 1, q subcomponent-like 3 1637 208 C20140711_OR018_03 C20140711_OR018_03 TB432177.[MT7]-GLMQSLPTFIQGPK[MT7].3b5_1.heavy 602.346 / 661.346 6789.0 43.16719913482666 41 18 10 3 10 9.329742754478445 10.718409138558316 0.0699005126953125 3 0.9870663303495947 10.84007504308537 6789.0 20.46508880552208 0.0 - - - - - - - 199.26666666666668 13 15 C1QL3 complement component 1, q subcomponent-like 3 1639 208 C20140711_OR018_03 C20140711_OR018_03 TB432177.[MT7]-GLMQSLPTFIQGPK[MT7].3y5_1.heavy 602.346 / 686.432 3259.0 43.16719913482666 41 18 10 3 10 9.329742754478445 10.718409138558316 0.0699005126953125 3 0.9870663303495947 10.84007504308537 3259.0 18.828803024280965 0.0 - - - - - - - 215.05555555555554 6 18 C1QL3 complement component 1, q subcomponent-like 3 1641 209 C20140711_OR018_03 C20140711_OR018_03 TB422370.[MT7]-VNVIDNTWR.2y4_1.heavy 630.844 / 576.289 18797.0 33.44960021972656 47 17 10 10 10 3.5334627004654955 22.469122064630675 0.0 3 0.9759320303578229 7.9390351395315975 18797.0 32.537193254421275 0.0 - - - - - - - 299.0 37 5 MTX3 metaxin 3 1643 209 C20140711_OR018_03 C20140711_OR018_03 TB422370.[MT7]-VNVIDNTWR.2y8_1.heavy 630.844 / 1017.51 28410.0 33.44960021972656 47 17 10 10 10 3.5334627004654955 22.469122064630675 0.0 3 0.9759320303578229 7.9390351395315975 28410.0 203.36714369158878 0.0 - - - - - - - 233.0 56 11 MTX3 metaxin 3 1645 209 C20140711_OR018_03 C20140711_OR018_03 TB422370.[MT7]-VNVIDNTWR.2y6_1.heavy 630.844 / 804.4 9292.0 33.44960021972656 47 17 10 10 10 3.5334627004654955 22.469122064630675 0.0 3 0.9759320303578229 7.9390351395315975 9292.0 48.264144631273886 0.0 - - - - - - - 183.28571428571428 18 7 MTX3 metaxin 3 1647 209 C20140711_OR018_03 C20140711_OR018_03 TB422370.[MT7]-VNVIDNTWR.2y7_1.heavy 630.844 / 903.468 5447.0 33.44960021972656 47 17 10 10 10 3.5334627004654955 22.469122064630675 0.0 3 0.9759320303578229 7.9390351395315975 5447.0 34.83856890335679 0.0 - - - - - - - 160.375 10 8 MTX3 metaxin 3 1649 210 C20140711_OR018_03 C20140711_OR018_03 TB422876.[MT7]-IVSAGEQQSPQPVSSALSWPITGGR.3b6_1.heavy 899.476 / 701.395 6791.0 41.10175037384033 39 13 10 6 10 3.7922203691234544 26.36977555793107 0.031002044677734375 3 0.9148470949412716 4.198861759886037 6791.0 68.18600081284292 1.0 - - - - - - - 221.33333333333334 13 12 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1651 210 C20140711_OR018_03 C20140711_OR018_03 TB422876.[MT7]-IVSAGEQQSPQPVSSALSWPITGGR.3y6_1.heavy 899.476 / 600.346 16142.0 41.10175037384033 39 13 10 6 10 3.7922203691234544 26.36977555793107 0.031002044677734375 3 0.9148470949412716 4.198861759886037 16142.0 81.93908629441624 1.0 - - - - - - - 185.77777777777777 32 9 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1653 210 C20140711_OR018_03 C20140711_OR018_03 TB422876.[MT7]-IVSAGEQQSPQPVSSALSWPITGGR.3y12_1.heavy 899.476 / 1231.64 2264.0 41.10175037384033 39 13 10 6 10 3.7922203691234544 26.36977555793107 0.031002044677734375 3 0.9148470949412716 4.198861759886037 2264.0 0.8052845528455284 2.0 - - - - - - - 216.4 6 10 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1655 210 C20140711_OR018_03 C20140711_OR018_03 TB422876.[MT7]-IVSAGEQQSPQPVSSALSWPITGGR.3y8_1.heavy 899.476 / 873.458 6988.0 41.10175037384033 39 13 10 6 10 3.7922203691234544 26.36977555793107 0.031002044677734375 3 0.9148470949412716 4.198861759886037 6988.0 18.801644511904783 0.0 - - - - - - - 281.14285714285717 13 14 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1657 211 C20140711_OR018_03 C20140711_OR018_03 TB431885.[MT7]-AAAAAAAK[MT7].2y4_1.heavy 466.792 / 504.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHF20L1;CDK12 PHD finger protein 20-like 1;cyclin-dependent kinase 12 1659 211 C20140711_OR018_03 C20140711_OR018_03 TB431885.[MT7]-AAAAAAAK[MT7].2y5_1.heavy 466.792 / 575.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHF20L1;CDK12 PHD finger protein 20-like 1;cyclin-dependent kinase 12 1661 211 C20140711_OR018_03 C20140711_OR018_03 TB431885.[MT7]-AAAAAAAK[MT7].2b4_1.heavy 466.792 / 429.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHF20L1;CDK12 PHD finger protein 20-like 1;cyclin-dependent kinase 12 1663 211 C20140711_OR018_03 C20140711_OR018_03 TB431885.[MT7]-AAAAAAAK[MT7].2y7_1.heavy 466.792 / 717.438 N/A N/A - - - - - - - - - 0.0 - - - - - - - PHF20L1;CDK12 PHD finger protein 20-like 1;cyclin-dependent kinase 12 1665 212 C20140711_OR018_03 C20140711_OR018_03 TB431888.[MT7]-ANFSISR.2b3_1.heavy 469.762 / 477.258 5026.0 26.481000900268555 47 17 10 10 10 3.367621447521602 29.694548974201034 0.0 3 0.9754045739071011 7.853097962622794 5026.0 51.87047930185723 0.0 - - - - - - - 145.66666666666666 10 3 KIR2DL1;KIR2DS1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 1667 212 C20140711_OR018_03 C20140711_OR018_03 TB431888.[MT7]-ANFSISR.2y5_1.heavy 469.762 / 609.336 6228.0 26.481000900268555 47 17 10 10 10 3.367621447521602 29.694548974201034 0.0 3 0.9754045739071011 7.853097962622794 6228.0 29.591508730133857 0.0 - - - - - - - 240.6 12 5 KIR2DL1;KIR2DS1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 1669 212 C20140711_OR018_03 C20140711_OR018_03 TB431888.[MT7]-ANFSISR.2b4_1.heavy 469.762 / 564.29 4370.0 26.481000900268555 47 17 10 10 10 3.367621447521602 29.694548974201034 0.0 3 0.9754045739071011 7.853097962622794 4370.0 58.04698588245151 0.0 - - - - - - - 185.6 8 10 KIR2DL1;KIR2DS1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 1671 212 C20140711_OR018_03 C20140711_OR018_03 TB431888.[MT7]-ANFSISR.2y6_1.heavy 469.762 / 723.378 9178.0 26.481000900268555 47 17 10 10 10 3.367621447521602 29.694548974201034 0.0 3 0.9754045739071011 7.853097962622794 9178.0 15.948372803666922 1.0 - - - - - - - 191.25 19 4 KIR2DL1;KIR2DS1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 1673 213 C20140711_OR018_03 C20140711_OR018_03 TB422271.[MT7]-LFGVEASGR.2y8_1.heavy 540.302 / 822.41 15116.0 31.73270034790039 48 18 10 10 10 3.985092411364061 25.093520972019547 0.0 3 0.9895469401461434 12.060397312360726 15116.0 177.69844310641435 0.0 - - - - - - - 220.22222222222223 30 9 TGM6 transglutaminase 6 1675 213 C20140711_OR018_03 C20140711_OR018_03 TB422271.[MT7]-LFGVEASGR.2y5_1.heavy 540.302 / 519.252 4900.0 31.73270034790039 48 18 10 10 10 3.985092411364061 25.093520972019547 0.0 3 0.9895469401461434 12.060397312360726 4900.0 7.401300436161137 0.0 - - - - - - - 239.8 9 10 TGM6 transglutaminase 6 1677 213 C20140711_OR018_03 C20140711_OR018_03 TB422271.[MT7]-LFGVEASGR.2b4_1.heavy 540.302 / 561.352 2085.0 31.73270034790039 48 18 10 10 10 3.985092411364061 25.093520972019547 0.0 3 0.9895469401461434 12.060397312360726 2085.0 11.483253588516746 1.0 - - - - - - - 278.1111111111111 6 9 TGM6 transglutaminase 6 1679 213 C20140711_OR018_03 C20140711_OR018_03 TB422271.[MT7]-LFGVEASGR.2y7_1.heavy 540.302 / 675.342 7819.0 31.73270034790039 48 18 10 10 10 3.985092411364061 25.093520972019547 0.0 3 0.9895469401461434 12.060397312360726 7819.0 61.728947368421046 0.0 - - - - - - - 224.84615384615384 15 13 TGM6 transglutaminase 6 1681 214 C20140711_OR018_03 C20140711_OR018_03 TB422171.[MT7]-GNFSIGR.2b3_1.heavy 447.749 / 463.242 5726.0 25.71285057067871 45 20 10 5 10 8.109496579451166 12.331221675756325 0.045299530029296875 3 0.9957531234277996 18.93100764050977 5726.0 32.08006659962236 0.0 - - - - - - - 208.0 11 5 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1683 214 C20140711_OR018_03 C20140711_OR018_03 TB422171.[MT7]-GNFSIGR.2y5_1.heavy 447.749 / 579.325 4477.0 25.71285057067871 45 20 10 5 10 8.109496579451166 12.331221675756325 0.045299530029296875 3 0.9957531234277996 18.93100764050977 4477.0 62.24751923076923 0.0 - - - - - - - 173.33333333333334 8 3 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1685 214 C20140711_OR018_03 C20140711_OR018_03 TB422171.[MT7]-GNFSIGR.2b4_1.heavy 447.749 / 550.274 5830.0 25.71285057067871 45 20 10 5 10 8.109496579451166 12.331221675756325 0.045299530029296875 3 0.9957531234277996 18.93100764050977 5830.0 40.22139423076923 0.0 - - - - - - - 249.6 11 5 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1687 214 C20140711_OR018_03 C20140711_OR018_03 TB422171.[MT7]-GNFSIGR.2y6_1.heavy 447.749 / 693.368 4268.0 25.71285057067871 45 20 10 5 10 8.109496579451166 12.331221675756325 0.045299530029296875 3 0.9957531234277996 18.93100764050977 4268.0 28.213942307692307 0.0 - - - - - - - 312.0 8 3 KIR2DS5 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 1689 215 C20140711_OR018_03 C20140711_OR018_03 TB422872.[MT7]-VISAMVNSNNDRGVVQGQWQGK[MT7].3y6_1.heavy 892.469 / 847.454 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1691 215 C20140711_OR018_03 C20140711_OR018_03 TB422872.[MT7]-VISAMVNSNNDRGVVQGQWQGK[MT7].3b4_1.heavy 892.469 / 515.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1693 215 C20140711_OR018_03 C20140711_OR018_03 TB422872.[MT7]-VISAMVNSNNDRGVVQGQWQGK[MT7].3y4_1.heavy 892.469 / 662.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1695 215 C20140711_OR018_03 C20140711_OR018_03 TB422872.[MT7]-VISAMVNSNNDRGVVQGQWQGK[MT7].3y21_2.heavy 892.469 / 1216.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - TGM6 transglutaminase 6 1697 216 C20140711_OR018_03 C20140711_OR018_03 TB422170.[MT7]-LLAYIR.2b3_1.heavy 446.79 / 442.315 775.0 37.33839988708496 41 20 10 5 6 11.051874839410928 9.048238552557663 0.045803070068359375 6 0.9972715383093265 23.621346147004203 775.0 2.3023905557304865 4.0 - - - - - - - 301.0 2 3 KLHL5 kelch-like 5 (Drosophila) 1699 216 C20140711_OR018_03 C20140711_OR018_03 TB422170.[MT7]-LLAYIR.2y4_1.heavy 446.79 / 522.304 517.0 37.33839988708496 41 20 10 5 6 11.051874839410928 9.048238552557663 0.045803070068359375 6 0.9972715383093265 23.621346147004203 517.0 4.2076224056014 3.0 - - - - - - - 0.0 1 0 KLHL5 kelch-like 5 (Drosophila) 1701 216 C20140711_OR018_03 C20140711_OR018_03 TB422170.[MT7]-LLAYIR.2y5_1.heavy 446.79 / 635.388 1421.0 37.33839988708496 41 20 10 5 6 11.051874839410928 9.048238552557663 0.045803070068359375 6 0.9972715383093265 23.621346147004203 1421.0 4.406201550387596 0.0 - - - - - - - 258.0 2 3 KLHL5 kelch-like 5 (Drosophila) 1703 216 C20140711_OR018_03 C20140711_OR018_03 TB422170.[MT7]-LLAYIR.2b4_1.heavy 446.79 / 605.378 387.0 37.33839988708496 41 20 10 5 6 11.051874839410928 9.048238552557663 0.045803070068359375 6 0.9972715383093265 23.621346147004203 387.0 1.9999999999999998 7.0 - - - - - - - 0.0 1 0 KLHL5 kelch-like 5 (Drosophila) 1705 217 C20140711_OR018_03 C20140711_OR018_03 TB422273.[MT7]-ILEIFFR.2y4_1.heavy 541.33 / 582.34 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2 dual oxidase 2 1707 217 C20140711_OR018_03 C20140711_OR018_03 TB422273.[MT7]-ILEIFFR.2b3_1.heavy 541.33 / 500.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2 dual oxidase 2 1709 217 C20140711_OR018_03 C20140711_OR018_03 TB422273.[MT7]-ILEIFFR.2y5_1.heavy 541.33 / 711.382 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2 dual oxidase 2 1711 217 C20140711_OR018_03 C20140711_OR018_03 TB422273.[MT7]-ILEIFFR.2y6_1.heavy 541.33 / 824.466 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2 dual oxidase 2 1713 218 C20140711_OR018_03 C20140711_OR018_03 TB422277.[MT7]-GSVAILQK[MT7].2y4_1.heavy 552.355 / 645.442 7550.0 28.241350173950195 43 18 10 5 10 4.775926103862456 20.938347416876187 0.040500640869140625 3 0.9878724620931016 11.195310934032726 7550.0 15.275944087946318 0.0 - - - - - - - 284.5 15 10 TGM6 transglutaminase 6 1715 218 C20140711_OR018_03 C20140711_OR018_03 TB422277.[MT7]-GSVAILQK[MT7].2y5_1.heavy 552.355 / 716.479 9629.0 28.241350173950195 43 18 10 5 10 4.775926103862456 20.938347416876187 0.040500640869140625 3 0.9878724620931016 11.195310934032726 9629.0 65.25500055685488 0.0 - - - - - - - 198.72727272727272 19 11 TGM6 transglutaminase 6 1717 218 C20140711_OR018_03 C20140711_OR018_03 TB422277.[MT7]-GSVAILQK[MT7].2y3_1.heavy 552.355 / 532.357 13569.0 28.241350173950195 43 18 10 5 10 4.775926103862456 20.938347416876187 0.040500640869140625 3 0.9878724620931016 11.195310934032726 13569.0 20.6848377117108 0.0 - - - - - - - 284.5 27 10 TGM6 transglutaminase 6 1719 218 C20140711_OR018_03 C20140711_OR018_03 TB422277.[MT7]-GSVAILQK[MT7].2b5_1.heavy 552.355 / 572.352 12037.0 28.241350173950195 43 18 10 5 10 4.775926103862456 20.938347416876187 0.040500640869140625 3 0.9878724620931016 11.195310934032726 12037.0 32.611068051259394 0.0 - - - - - - - 191.375 24 8 TGM6 transglutaminase 6 1721 219 C20140711_OR018_03 C20140711_OR018_03 TB432091.[MT7]-DFLGSSEESEK[MT7].2y6_1.heavy 758.374 / 852.407 330.0 27.79170036315918 33 13 10 6 4 0.9983446204936921 63.780772779957545 0.039600372314453125 7 0.9226051138083723 4.407218768487065 330.0 2.4975 4.0 - - - - - - - 0.0 1 0 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1723 219 C20140711_OR018_03 C20140711_OR018_03 TB432091.[MT7]-DFLGSSEESEK[MT7].2b3_1.heavy 758.374 / 520.289 1321.0 27.79170036315918 33 13 10 6 4 0.9983446204936921 63.780772779957545 0.039600372314453125 7 0.9226051138083723 4.407218768487065 1321.0 7.601754545454545 0.0 - - - - - - - 192.5 2 8 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1725 219 C20140711_OR018_03 C20140711_OR018_03 TB432091.[MT7]-DFLGSSEESEK[MT7].2y8_1.heavy 758.374 / 996.46 2091.0 27.79170036315918 33 13 10 6 4 0.9983446204936921 63.780772779957545 0.039600372314453125 7 0.9226051138083723 4.407218768487065 2091.0 27.734263636363636 0.0 - - - - - - - 201.66666666666666 4 6 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1727 219 C20140711_OR018_03 C20140711_OR018_03 TB432091.[MT7]-DFLGSSEESEK[MT7].2y9_1.heavy 758.374 / 1109.54 330.0 27.79170036315918 33 13 10 6 4 0.9983446204936921 63.780772779957545 0.039600372314453125 7 0.9226051138083723 4.407218768487065 330.0 2.8499999999999996 2.0 - - - - - - - 0.0 0 0 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1729 220 C20140711_OR018_03 C20140711_OR018_03 TB422684.[MT7]-VLVVPIDGSHWLSMR.3b4_1.heavy 618.346 / 555.399 13365.0 43.21087455749512 36 15 10 3 8 2.4270201537442118 32.48535024909614 0.0699005126953125 4 0.9572751981534606 5.949271964752183 13365.0 17.296973422105772 0.0 - - - - - - - 220.85714285714286 26 14 UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A3 1731 220 C20140711_OR018_03 C20140711_OR018_03 TB422684.[MT7]-VLVVPIDGSHWLSMR.3y4_1.heavy 618.346 / 506.276 5408.0 43.21087455749512 36 15 10 3 8 2.4270201537442118 32.48535024909614 0.0699005126953125 4 0.9572751981534606 5.949271964752183 5408.0 4.897283311772315 2.0 - - - - - - - 249.11111111111111 13 9 UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A3 1733 220 C20140711_OR018_03 C20140711_OR018_03 TB422684.[MT7]-VLVVPIDGSHWLSMR.3y5_1.heavy 618.346 / 692.355 7803.0 43.21087455749512 36 15 10 3 8 2.4270201537442118 32.48535024909614 0.0699005126953125 4 0.9572751981534606 5.949271964752183 7803.0 59.584007632222296 0.0 - - - - - - - 285.9 15 10 UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A3 1735 220 C20140711_OR018_03 C20140711_OR018_03 TB422684.[MT7]-VLVVPIDGSHWLSMR.3y9_1.heavy 618.346 / 1088.49 4326.0 43.21087455749512 36 15 10 3 8 2.4270201537442118 32.48535024909614 0.0699005126953125 4 0.9572751981534606 5.949271964752183 4326.0 37.24498331479422 0.0 - - - - - - - 160.0 8 14 UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A3 1737 221 C20140711_OR018_03 C20140711_OR018_03 TB422686.[MT7]-STVGTLFAVGGMDSTK[MT7].3y7_1.heavy 620.332 / 839.405 24850.0 39.129276275634766 44 18 10 6 10 3.6047524707548386 27.74115582451072 0.0363006591796875 3 0.982954943239563 9.439398607257756 24850.0 74.24593147751607 0.0 - - - - - - - 366.7142857142857 49 7 KLHL5 kelch-like 5 (Drosophila) 1739 221 C20140711_OR018_03 C20140711_OR018_03 TB422686.[MT7]-STVGTLFAVGGMDSTK[MT7].3b6_1.heavy 620.332 / 703.411 25434.0 39.129276275634766 44 18 10 6 10 3.6047524707548386 27.74115582451072 0.0363006591796875 3 0.982954943239563 9.439398607257756 25434.0 38.02665862644059 0.0 - - - - - - - 258.42857142857144 50 14 KLHL5 kelch-like 5 (Drosophila) 1741 221 C20140711_OR018_03 C20140711_OR018_03 TB422686.[MT7]-STVGTLFAVGGMDSTK[MT7].3b5_1.heavy 620.332 / 590.327 11900.0 39.129276275634766 44 18 10 6 10 3.6047524707548386 27.74115582451072 0.0363006591796875 3 0.982954943239563 9.439398607257756 11900.0 28.976691785684366 0.0 - - - - - - - 318.27272727272725 23 11 KLHL5 kelch-like 5 (Drosophila) 1743 221 C20140711_OR018_03 C20140711_OR018_03 TB422686.[MT7]-STVGTLFAVGGMDSTK[MT7].3b7_1.heavy 620.332 / 850.479 10383.0 39.129276275634766 44 18 10 6 10 3.6047524707548386 27.74115582451072 0.0363006591796875 3 0.982954943239563 9.439398607257756 10383.0 57.00625883412522 0.0 - - - - - - - 214.0 20 12 KLHL5 kelch-like 5 (Drosophila) 1745 222 C20140711_OR018_03 C20140711_OR018_03 TB432095.[MT7]-ILLAAMC[CAM]LVTK[MT7].2y8_1.heavy 760.961 / 1037.56 3478.0 48.458998680114746 44 18 10 6 10 5.363169800544267 18.645689716900584 0.037998199462890625 3 0.9866062972165166 10.651876245377824 3478.0 82.18177419354838 0.0 - - - - - - - 103.33333333333333 6 9 TGM6 transglutaminase 6 1747 222 C20140711_OR018_03 C20140711_OR018_03 TB432095.[MT7]-ILLAAMC[CAM]LVTK[MT7].2y9_1.heavy 760.961 / 1150.64 1056.0 48.458998680114746 44 18 10 6 10 5.363169800544267 18.645689716900584 0.037998199462890625 3 0.9866062972165166 10.651876245377824 1056.0 2.9064516129032256 1.0 - - - - - - - 159.0625 2 16 TGM6 transglutaminase 6 1749 222 C20140711_OR018_03 C20140711_OR018_03 TB432095.[MT7]-ILLAAMC[CAM]LVTK[MT7].2b4_1.heavy 760.961 / 555.399 2671.0 48.458998680114746 44 18 10 6 10 5.363169800544267 18.645689716900584 0.037998199462890625 3 0.9866062972165166 10.651876245377824 2671.0 20.157815013404825 0.0 - - - - - - - 205.30769230769232 5 13 TGM6 transglutaminase 6 1751 222 C20140711_OR018_03 C20140711_OR018_03 TB432095.[MT7]-ILLAAMC[CAM]LVTK[MT7].2y7_1.heavy 760.961 / 966.523 2112.0 48.458998680114746 44 18 10 6 10 5.363169800544267 18.645689716900584 0.037998199462890625 3 0.9866062972165166 10.651876245377824 2112.0 19.57833419769733 0.0 - - - - - - - 148.0 4 13 TGM6 transglutaminase 6 1753 223 C20140711_OR018_03 C20140711_OR018_03 TB422682.[MT7]-NQEFVLLPASEIAK[MT7].3y7_1.heavy 616.355 / 859.5 21264.0 40.38100051879883 43 13 10 10 10 1.4936381491997759 44.368292525478424 0.0 3 0.9288929601513236 4.600429704707856 21264.0 112.65498635477584 0.0 - - - - - - - 244.75 42 12 KLHL5 kelch-like 5 (Drosophila) 1755 223 C20140711_OR018_03 C20140711_OR018_03 TB422682.[MT7]-NQEFVLLPASEIAK[MT7].3b6_1.heavy 616.355 / 875.474 18530.0 40.38100051879883 43 13 10 10 10 1.4936381491997759 44.368292525478424 0.0 3 0.9288929601513236 4.600429704707856 18530.0 232.5762181144223 0.0 - - - - - - - 157.55555555555554 37 9 KLHL5 kelch-like 5 (Drosophila) 1757 223 C20140711_OR018_03 C20140711_OR018_03 TB422682.[MT7]-NQEFVLLPASEIAK[MT7].3b4_1.heavy 616.355 / 663.322 19543.0 40.38100051879883 43 13 10 10 10 1.4936381491997759 44.368292525478424 0.0 3 0.9288929601513236 4.600429704707856 19543.0 64.30029753307528 0.0 - - - - - - - 222.8 39 10 KLHL5 kelch-like 5 (Drosophila) 1759 223 C20140711_OR018_03 C20140711_OR018_03 TB422682.[MT7]-NQEFVLLPASEIAK[MT7].3b3_1.heavy 616.355 / 516.253 15492.0 40.38100051879883 43 13 10 10 10 1.4936381491997759 44.368292525478424 0.0 3 0.9288929601513236 4.600429704707856 15492.0 70.46984592809979 0.0 - - - - - - - 217.21428571428572 30 14 KLHL5 kelch-like 5 (Drosophila) 1761 224 C20140711_OR018_03 C20140711_OR018_03 TB422489.[MT7]-C[CAM]LYFADTFLR.2y4_1.heavy 725.37 / 536.319 8105.0 44.21689987182617 43 17 10 6 10 3.5270718636075937 28.352130001036333 0.03759765625 3 0.9707163719937121 7.194231076828507 8105.0 53.005017301038066 0.0 - - - - - - - 208.88888888888889 16 9 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1763 224 C20140711_OR018_03 C20140711_OR018_03 TB422489.[MT7]-C[CAM]LYFADTFLR.2y8_1.heavy 725.37 / 1032.51 7382.0 44.21689987182617 43 17 10 6 10 3.5270718636075937 28.352130001036333 0.03759765625 3 0.9707163719937121 7.194231076828507 7382.0 112.6785942295887 0.0 - - - - - - - 168.77777777777777 14 9 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1765 224 C20140711_OR018_03 C20140711_OR018_03 TB422489.[MT7]-C[CAM]LYFADTFLR.2y9_1.heavy 725.37 / 1145.6 3329.0 44.21689987182617 43 17 10 6 10 3.5270718636075937 28.352130001036333 0.03759765625 3 0.9707163719937121 7.194231076828507 3329.0 22.440127184928244 0.0 - - - - - - - 180.78571428571428 6 14 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1767 224 C20140711_OR018_03 C20140711_OR018_03 TB422489.[MT7]-C[CAM]LYFADTFLR.2y7_1.heavy 725.37 / 869.452 4197.0 44.21689987182617 43 17 10 6 10 3.5270718636075937 28.352130001036333 0.03759765625 3 0.9707163719937121 7.194231076828507 4197.0 66.70866061130334 0.0 - - - - - - - 177.45454545454547 8 11 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1769 225 C20140711_OR018_03 C20140711_OR018_03 TB432092.[MT7]-NAAVMDQEPAGNR.3b6_1.heavy 506.248 / 746.362 968.0 21.68589973449707 47 17 10 10 10 5.4848798094628295 18.23194007414242 0.0 3 0.9774982132046717 8.211757573651116 968.0 4.4 1.0 - - - - - - - 0.0 1 0 KIR2DS2;KIR2DS1;KIR2DS4;KIR3DL1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 1771 225 C20140711_OR018_03 C20140711_OR018_03 TB432092.[MT7]-NAAVMDQEPAGNR.3b4_1.heavy 506.248 / 500.295 3522.0 21.68589973449707 47 17 10 10 10 5.4848798094628295 18.23194007414242 0.0 3 0.9774982132046717 8.211757573651116 3522.0 1.8821643286573146 2.0 - - - - - - - 234.66666666666666 8 9 KIR2DS2;KIR2DS1;KIR2DS4;KIR3DL1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 1773 225 C20140711_OR018_03 C20140711_OR018_03 TB432092.[MT7]-NAAVMDQEPAGNR.3b5_1.heavy 506.248 / 631.335 1145.0 21.68589973449707 47 17 10 10 10 5.4848798094628295 18.23194007414242 0.0 3 0.9774982132046717 8.211757573651116 1145.0 12.946306818181819 0.0 - - - - - - - 188.57142857142858 2 7 KIR2DS2;KIR2DS1;KIR2DS4;KIR3DL1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 1775 225 C20140711_OR018_03 C20140711_OR018_03 TB432092.[MT7]-NAAVMDQEPAGNR.3y5_1.heavy 506.248 / 514.273 7572.0 21.68589973449707 47 17 10 10 10 5.4848798094628295 18.23194007414242 0.0 3 0.9774982132046717 8.211757573651116 7572.0 145.84704545454545 0.0 - - - - - - - 161.33333333333334 15 6 KIR2DS2;KIR2DS1;KIR2DS4;KIR3DL1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 1777 226 C20140711_OR018_03 C20140711_OR018_03 TB422683.[MT7]-GLYEEISMPLLADVR.2b8_2.heavy 925.496 / 534.264 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 1779 226 C20140711_OR018_03 C20140711_OR018_03 TB422683.[MT7]-GLYEEISMPLLADVR.2y9_1.heavy 925.496 / 1001.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 1781 226 C20140711_OR018_03 C20140711_OR018_03 TB422683.[MT7]-GLYEEISMPLLADVR.2b4_1.heavy 925.496 / 607.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 1783 226 C20140711_OR018_03 C20140711_OR018_03 TB422683.[MT7]-GLYEEISMPLLADVR.2b5_1.heavy 925.496 / 736.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - ITIH5L inter-alpha (globulin) inhibitor H5-like 1785 227 C20140711_OR018_03 C20140711_OR018_03 TB422388.[MT7]-VQLQEHLK[MT7].2b4_1.heavy 641.89 / 613.379 1106.0 25.462400436401367 36 13 9 10 4 1.12856939152815 59.071836580997505 0.0 7 0.915975356687038 4.227368605148329 1106.0 19.699940594059406 5.0 - - - - - - - 226.375 3 16 MTX3 metaxin 3 1787 227 C20140711_OR018_03 C20140711_OR018_03 TB422388.[MT7]-VQLQEHLK[MT7].2y3_1.heavy 641.89 / 541.358 1006.0 25.462400436401367 36 13 9 10 4 1.12856939152815 59.071836580997505 0.0 7 0.915975356687038 4.227368605148329 1006.0 3.7983120819742346 2.0 - - - - - - - 251.5 3 12 MTX3 metaxin 3 1789 227 C20140711_OR018_03 C20140711_OR018_03 TB422388.[MT7]-VQLQEHLK[MT7].2y6_1.heavy 641.89 / 911.543 1710.0 25.462400436401367 36 13 9 10 4 1.12856939152815 59.071836580997505 0.0 7 0.915975356687038 4.227368605148329 1710.0 25.370096054381555 0.0 - - - - - - - 176.125 3 8 MTX3 metaxin 3 1791 227 C20140711_OR018_03 C20140711_OR018_03 TB422388.[MT7]-VQLQEHLK[MT7].2b5_1.heavy 641.89 / 742.422 905.0 25.462400436401367 36 13 9 10 4 1.12856939152815 59.071836580997505 0.0 7 0.915975356687038 4.227368605148329 905.0 8.332455760486585 3.0 - - - - - - - 237.9090909090909 2 11 MTX3 metaxin 3 1793 228 C20140711_OR018_03 C20140711_OR018_03 TB431899.[MT7]-EGEAHER.2y4_1.heavy 486.237 / 512.258 1379.0 12.26759958267212 47 20 10 7 10 26.409502897564693 3.7865158003114603 0.02460002899169922 3 0.9979749143567376 27.419993964362394 1379.0 63.47777777777779 0.0 - - - - - - - 69.6875 2 16 KIR2DS2;LOC100506203;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL2;LOC727787 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DS2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2-like 1795 228 C20140711_OR018_03 C20140711_OR018_03 TB431899.[MT7]-EGEAHER.2b4_1.heavy 486.237 / 531.253 1442.0 12.26759958267212 47 20 10 7 10 26.409502897564693 3.7865158003114603 0.02460002899169922 3 0.9979749143567376 27.419993964362394 1442.0 149.2813333333333 0.0 - - - - - - - 67.52941176470588 2 17 KIR2DS2;LOC100506203;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL2;LOC727787 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DS2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2-like 1797 228 C20140711_OR018_03 C20140711_OR018_03 TB431899.[MT7]-EGEAHER.2y6_1.heavy 486.237 / 698.322 2037.0 12.26759958267212 47 20 10 7 10 26.409502897564693 3.7865158003114603 0.02460002899169922 3 0.9979749143567376 27.419993964362394 2037.0 132.89 0.0 - - - - - - - 38.0 4 14 KIR2DS2;LOC100506203;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL2;LOC727787 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DS2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2-like 1799 228 C20140711_OR018_03 C20140711_OR018_03 TB431899.[MT7]-EGEAHER.2b5_1.heavy 486.237 / 668.312 585.0 12.26759958267212 47 20 10 7 10 26.409502897564693 3.7865158003114603 0.02460002899169922 3 0.9979749143567376 27.419993964362394 585.0 61.146428571428565 0.0 - - - - - - - 0.0 1 0 KIR2DS2;LOC100506203;KIR2DL1;KIR2DL3;KIR2DS1;KIR2DS4;KIR2DS5;KIR3DL2;LOC727787 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2;killer cell immunoglobulin-like receptor 2DS2-like;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4;killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2;killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2-like 1801 229 C20140711_OR018_03 C20140711_OR018_03 TB431956.[MT7]-ASEALHTK[MT7].2b4_1.heavy 572.832 / 503.258 3072.0 17.83329963684082 41 15 8 10 8 2.423482557193573 34.306550127694564 0.0 4 0.9525065440778767 5.64042037450818 3072.0 12.88951048951049 0.0 - - - - - - - 214.375 6 8 TGM6 transglutaminase 6 1803 229 C20140711_OR018_03 C20140711_OR018_03 TB431956.[MT7]-ASEALHTK[MT7].2y3_1.heavy 572.832 / 529.321 2144.0 17.83329963684082 41 15 8 10 8 2.423482557193573 34.306550127694564 0.0 4 0.9525065440778767 5.64042037450818 2144.0 13.893426573426574 2.0 - - - - - - - 207.72727272727272 8 11 TGM6 transglutaminase 6 1805 229 C20140711_OR018_03 C20140711_OR018_03 TB431956.[MT7]-ASEALHTK[MT7].2b5_1.heavy 572.832 / 616.342 2715.0 17.83329963684082 41 15 8 10 8 2.423482557193573 34.306550127694564 0.0 4 0.9525065440778767 5.64042037450818 2715.0 15.179318181818182 0.0 - - - - - - - 178.66666666666666 5 6 TGM6 transglutaminase 6 1807 229 C20140711_OR018_03 C20140711_OR018_03 TB431956.[MT7]-ASEALHTK[MT7].2y7_1.heavy 572.832 / 929.517 1929.0 17.83329963684082 41 15 8 10 8 2.423482557193573 34.306550127694564 0.0 4 0.9525065440778767 5.64042037450818 1929.0 15.512937062937063 0.0 - - - - - - - 95.0 3 3 TGM6 transglutaminase 6 1809 230 C20140711_OR018_03 C20140711_OR018_03 TB431955.[MT7]-GAPC[CAM]PQPK[MT7].2y4_1.heavy 571.815 / 613.379 1560.0 17.26689910888672 47 17 10 10 10 4.5458616230229 21.998029921003656 0.0 3 0.9783733121644954 8.376865571133052 1560.0 24.48 0.0 - - - - - - - 195.0 3 4 DUOX2 dual oxidase 2 1811 230 C20140711_OR018_03 C20140711_OR018_03 TB431955.[MT7]-GAPC[CAM]PQPK[MT7].2y5_1.heavy 571.815 / 773.41 520.0 17.26689910888672 47 17 10 10 10 4.5458616230229 21.998029921003656 0.0 3 0.9783733121644954 8.376865571133052 520.0 6.474666666666666 0.0 - - - - - - - 0.0 1 0 DUOX2 dual oxidase 2 1813 230 C20140711_OR018_03 C20140711_OR018_03 TB431955.[MT7]-GAPC[CAM]PQPK[MT7].2b4_1.heavy 571.815 / 530.251 845.0 17.26689910888672 47 17 10 10 10 4.5458616230229 21.998029921003656 0.0 3 0.9783733121644954 8.376865571133052 845.0 5.72 0.0 - - - - - - - 0.0 1 0 DUOX2 dual oxidase 2 1815 230 C20140711_OR018_03 C20140711_OR018_03 TB431955.[MT7]-GAPC[CAM]PQPK[MT7].2y6_1.heavy 571.815 / 870.462 1170.0 17.26689910888672 47 17 10 10 10 4.5458616230229 21.998029921003656 0.0 3 0.9783733121644954 8.376865571133052 1170.0 9.120000000000001 0.0 - - - - - - - 200.0 2 13 DUOX2 dual oxidase 2 1817 231 C20140711_OR018_03 C20140711_OR018_03 TB422481.[MT7]-GFVIVHVATAK[MT7].3b4_1.heavy 477.297 / 561.352 19978.0 32.07085037231445 42 16 10 6 10 2.197682116370531 38.89691505175962 0.039398193359375 3 0.9647349623047702 6.552478077970722 19978.0 92.68639423076922 0.0 - - - - - - - 282.2857142857143 39 7 TGM6 transglutaminase 6 1819 231 C20140711_OR018_03 C20140711_OR018_03 TB422481.[MT7]-GFVIVHVATAK[MT7].3b5_1.heavy 477.297 / 660.42 8636.0 32.07085037231445 42 16 10 6 10 2.197682116370531 38.89691505175962 0.039398193359375 3 0.9647349623047702 6.552478077970722 8636.0 34.29488461538462 0.0 - - - - - - - 228.8 17 10 TGM6 transglutaminase 6 1821 231 C20140711_OR018_03 C20140711_OR018_03 TB422481.[MT7]-GFVIVHVATAK[MT7].3y4_1.heavy 477.297 / 534.337 22580.0 32.07085037231445 42 16 10 6 10 2.197682116370531 38.89691505175962 0.039398193359375 3 0.9647349623047702 6.552478077970722 22580.0 124.60010683760683 0.0 - - - - - - - 184.88888888888889 45 9 TGM6 transglutaminase 6 1823 231 C20140711_OR018_03 C20140711_OR018_03 TB422481.[MT7]-GFVIVHVATAK[MT7].3y5_1.heavy 477.297 / 633.405 6868.0 32.07085037231445 42 16 10 6 10 2.197682116370531 38.89691505175962 0.039398193359375 3 0.9647349623047702 6.552478077970722 6868.0 22.012820512820515 0.0 - - - - - - - 260.0 13 4 TGM6 transglutaminase 6 1825 232 C20140711_OR018_03 C20140711_OR018_03 TB432296.[MT7]-RVIATYQNIAVYEWLPSFLQK[MT7].4b8_1.heavy 707.649 / 1090.61 678.0 49.488800048828125 41 11 10 10 10 1.3006346137154947 51.532283239186754 0.0 3 0.8637059435512049 3.3041759409361746 678.0 12.651376868607395 1.0 - - - - - - - 0.0 1 0 DUOX2;DUOX1 dual oxidase 2;dual oxidase 1 1827 232 C20140711_OR018_03 C20140711_OR018_03 TB432296.[MT7]-RVIATYQNIAVYEWLPSFLQK[MT7].4b8_2.heavy 707.649 / 545.81 4313.0 49.488800048828125 41 11 10 10 10 1.3006346137154947 51.532283239186754 0.0 3 0.8637059435512049 3.3041759409361746 4313.0 33.31178861788618 0.0 - - - - - - - 178.0 8 9 DUOX2;DUOX1 dual oxidase 2;dual oxidase 1 1829 232 C20140711_OR018_03 C20140711_OR018_03 TB432296.[MT7]-RVIATYQNIAVYEWLPSFLQK[MT7].4y6_1.heavy 707.649 / 863.511 3574.0 49.488800048828125 41 11 10 10 10 1.3006346137154947 51.532283239186754 0.0 3 0.8637059435512049 3.3041759409361746 3574.0 52.87463331373084 1.0 - - - - - - - 178.0 8 9 DUOX2;DUOX1 dual oxidase 2;dual oxidase 1 1831 232 C20140711_OR018_03 C20140711_OR018_03 TB432296.[MT7]-RVIATYQNIAVYEWLPSFLQK[MT7].4b10_2.heavy 707.649 / 637.87 3882.0 49.488800048828125 41 11 10 10 10 1.3006346137154947 51.532283239186754 0.0 3 0.8637059435512049 3.3041759409361746 3882.0 45.321560975609756 0.0 - - - - - - - 159.25 7 12 DUOX2;DUOX1 dual oxidase 2;dual oxidase 1 1833 233 C20140711_OR018_03 C20140711_OR018_03 TB432295.[MT7]-APSTAATPDRGLMQSLPTFIQGPK[MT7].4y8_1.heavy 693.879 / 1031.6 8884.0 40.56570053100586 32 8 10 6 8 1.6893655623023205 59.193819402661944 0.0334014892578125 4 0.7940327739331976 2.6712251256906097 8884.0 50.01073166655525 0.0 - - - - - - - 178.93333333333334 17 15 C1QL3 complement component 1, q subcomponent-like 3 1835 233 C20140711_OR018_03 C20140711_OR018_03 TB432295.[MT7]-APSTAATPDRGLMQSLPTFIQGPK[MT7].4b15_2.heavy 693.879 / 814.913 11230.0 40.56570053100586 32 8 10 6 8 1.6893655623023205 59.193819402661944 0.0334014892578125 4 0.7940327739331976 2.6712251256906097 11230.0 104.44368715613734 0.0 - - - - - - - 131.85714285714286 22 7 C1QL3 complement component 1, q subcomponent-like 3 1837 233 C20140711_OR018_03 C20140711_OR018_03 TB432295.[MT7]-APSTAATPDRGLMQSLPTFIQGPK[MT7].4b9_1.heavy 693.879 / 956.481 1844.0 40.56570053100586 32 8 10 6 8 1.6893655623023205 59.193819402661944 0.0334014892578125 4 0.7940327739331976 2.6712251256906097 1844.0 5.6079681274900395 1.0 - - - - - - - 193.3846153846154 4 13 C1QL3 complement component 1, q subcomponent-like 3 1839 233 C20140711_OR018_03 C20140711_OR018_03 TB432295.[MT7]-APSTAATPDRGLMQSLPTFIQGPK[MT7].4b23_2.heavy 693.879 / 1241.65 670.0 40.56570053100586 32 8 10 6 8 1.6893655623023205 59.193819402661944 0.0334014892578125 4 0.7940327739331976 2.6712251256906097 670.0 0.22827938671209536 21.0 - - - - - - - 193.9375 4 16 C1QL3 complement component 1, q subcomponent-like 3 1841 234 C20140711_OR018_03 C20140711_OR018_03 TB422185.[MT7]-ILNFLR.2y4_1.heavy 460.296 / 549.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 1843 234 C20140711_OR018_03 C20140711_OR018_03 TB422185.[MT7]-ILNFLR.2b3_1.heavy 460.296 / 485.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 1845 234 C20140711_OR018_03 C20140711_OR018_03 TB422185.[MT7]-ILNFLR.2y5_1.heavy 460.296 / 662.398 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 1847 234 C20140711_OR018_03 C20140711_OR018_03 TB422185.[MT7]-ILNFLR.2b4_1.heavy 460.296 / 632.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - MTX3 metaxin 3 1849 235 C20140711_OR018_03 C20140711_OR018_03 TB432298.[MT7]-QGLPGPPGAPGLNAAGAISAATYSTVPK[MT7].3b11_1.heavy 951.19 / 1073.59 920.0 39.69419860839844 48 18 10 10 10 4.749062585071529 21.05678714665619 0.0 3 0.9831951655406358 9.506818019781912 920.0 12.566666666666666 2.0 - - - - - - - 0.0 1 0 C1QL3 complement component 1, q subcomponent-like 3 1851 235 C20140711_OR018_03 C20140711_OR018_03 TB432298.[MT7]-QGLPGPPGAPGLNAAGAISAATYSTVPK[MT7].3b9_1.heavy 951.19 / 919.512 11863.0 39.69419860839844 48 18 10 10 10 4.749062585071529 21.05678714665619 0.0 3 0.9831951655406358 9.506818019781912 11863.0 44.557886473429946 0.0 - - - - - - - 224.88888888888889 23 9 C1QL3 complement component 1, q subcomponent-like 3 1853 235 C20140711_OR018_03 C20140711_OR018_03 TB432298.[MT7]-QGLPGPPGAPGLNAAGAISAATYSTVPK[MT7].3b5_1.heavy 951.19 / 597.348 3954.0 39.69419860839844 48 18 10 10 10 4.749062585071529 21.05678714665619 0.0 3 0.9831951655406358 9.506818019781912 3954.0 21.130978260869565 0.0 - - - - - - - 175.63636363636363 7 11 C1QL3 complement component 1, q subcomponent-like 3 1855 235 C20140711_OR018_03 C20140711_OR018_03 TB432298.[MT7]-QGLPGPPGAPGLNAAGAISAATYSTVPK[MT7].3b8_1.heavy 951.19 / 848.475 920.0 39.69419860839844 48 18 10 10 10 4.749062585071529 21.05678714665619 0.0 3 0.9831951655406358 9.506818019781912 920.0 5.333333333333334 0.0 - - - - - - - 0.0 1 0 C1QL3 complement component 1, q subcomponent-like 3 1857 236 C20140711_OR018_03 C20140711_OR018_03 TB432299.[MT7]-LQEANAQLAEQAC[CAM]PHDVEMTPVQR.3b5_1.heavy 960.468 / 700.375 2702.0 31.439449310302734 38 12 10 6 10 3.6477925197820724 21.608368860070897 0.038299560546875 3 0.8950572735137827 3.7758343552082407 2702.0 33.51519230769231 0.0 - - - - - - - 277.3333333333333 5 6 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1859 236 C20140711_OR018_03 C20140711_OR018_03 TB432299.[MT7]-LQEANAQLAEQAC[CAM]PHDVEMTPVQR.3b7_1.heavy 960.468 / 899.47 4885.0 31.439449310302734 38 12 10 6 10 3.6477925197820724 21.608368860070897 0.038299560546875 3 0.8950572735137827 3.7758343552082407 4885.0 30.71913461538462 0.0 - - - - - - - 299.0 9 8 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1861 236 C20140711_OR018_03 C20140711_OR018_03 TB432299.[MT7]-LQEANAQLAEQAC[CAM]PHDVEMTPVQR.3y10_1.heavy 960.468 / 1211.58 3326.0 31.439449310302734 38 12 10 6 10 3.6477925197820724 21.608368860070897 0.038299560546875 3 0.8950572735137827 3.7758343552082407 3326.0 63.48182692307692 0.0 - - - - - - - 104.0 6 4 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1863 236 C20140711_OR018_03 C20140711_OR018_03 TB432299.[MT7]-LQEANAQLAEQAC[CAM]PHDVEMTPVQR.3y9_1.heavy 960.468 / 1074.52 6755.0 31.439449310302734 38 12 10 6 10 3.6477925197820724 21.608368860070897 0.038299560546875 3 0.8950572735137827 3.7758343552082407 6755.0 45.95348557692307 0.0 - - - - - - - 226.9090909090909 13 11 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1865 237 C20140711_OR018_03 C20140711_OR018_03 TB422182.[MT7]-YLLSIR.2b3_1.heavy 454.788 / 534.341 1945.0 36.318199157714844 50 20 10 10 10 14.297083907093777 6.9944333159003875 0.0 3 0.9976301052849962 25.34615211078553 1945.0 21.27195723195723 0.0 - - - - - - - 181.6 3 5 TGM6 transglutaminase 6 1867 237 C20140711_OR018_03 C20140711_OR018_03 TB422182.[MT7]-YLLSIR.2y4_1.heavy 454.788 / 488.319 5188.0 36.318199157714844 50 20 10 10 10 14.297083907093777 6.9944333159003875 0.0 3 0.9976301052849962 25.34615211078553 5188.0 16.882380646542494 0.0 - - - - - - - 285.2 10 5 TGM6 transglutaminase 6 1869 237 C20140711_OR018_03 C20140711_OR018_03 TB422182.[MT7]-YLLSIR.2y5_1.heavy 454.788 / 601.403 9987.0 36.318199157714844 50 20 10 10 10 14.297083907093777 6.9944333159003875 0.0 3 0.9976301052849962 25.34615211078553 9987.0 88.38354379724322 0.0 - - - - - - - 130.0 19 3 TGM6 transglutaminase 6 1871 237 C20140711_OR018_03 C20140711_OR018_03 TB422182.[MT7]-YLLSIR.2b4_1.heavy 454.788 / 621.373 2335.0 36.318199157714844 50 20 10 10 10 14.297083907093777 6.9944333159003875 0.0 3 0.9976301052849962 25.34615211078553 2335.0 21.047594297594294 0.0 - - - - - - - 227.0 4 4 TGM6 transglutaminase 6 1873 238 C20140711_OR018_03 C20140711_OR018_03 TB422882.[MT7]-DLAQAPDMQGGHAVLIASEEQFK[MT7].4b4_1.heavy 686.605 / 572.316 968.0 34.42015075683594 19 3 10 5 1 0.7292743449470628 89.4923509236028 0.04489898681640625 16 0.5922006065360882 1.8626596211004591 968.0 1.2190476190476187 22.0 - - - - - - - 322.6666666666667 10 9 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1875 238 C20140711_OR018_03 C20140711_OR018_03 TB422882.[MT7]-DLAQAPDMQGGHAVLIASEEQFK[MT7].4b14_2.heavy 686.605 / 768.373 726.0 34.42015075683594 19 3 10 5 1 0.7292743449470628 89.4923509236028 0.04489898681640625 16 0.5922006065360882 1.8626596211004591 726.0 4.199999999999999 6.0 - - - - - - - 217.8 2 15 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1877 238 C20140711_OR018_03 C20140711_OR018_03 TB422882.[MT7]-DLAQAPDMQGGHAVLIASEEQFK[MT7].4b13_2.heavy 686.605 / 718.839 5685.0 34.42015075683594 19 3 10 5 1 0.7292743449470628 89.4923509236028 0.04489898681640625 16 0.5922006065360882 1.8626596211004591 5685.0 21.612396694214873 0.0 - - - - - - - 290.4 11 5 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1879 238 C20140711_OR018_03 C20140711_OR018_03 TB422882.[MT7]-DLAQAPDMQGGHAVLIASEEQFK[MT7].4b5_1.heavy 686.605 / 643.353 605.0 34.42015075683594 19 3 10 5 1 0.7292743449470628 89.4923509236028 0.04489898681640625 16 0.5922006065360882 1.8626596211004591 605.0 0.4242424242424242 31.0 - - - - - - - 322.6666666666667 10 9 LLGL1 lethal giant larvae homolog 1 (Drosophila) 1881 239 C20140711_OR018_03 C20140711_OR018_03 TB422181.[MT7]-MDDNLR.2y4_1.heavy 454.225 / 517.273 4879.0 21.880549430847168 43 17 10 6 10 2.9013111656695325 23.78806512039675 0.03569984436035156 3 0.9799540044924869 8.70202618081337 4879.0 20.132373177206446 0.0 - - - - - - - 342.0 9 1 MTX3 metaxin 3 1883 239 C20140711_OR018_03 C20140711_OR018_03 TB422181.[MT7]-MDDNLR.2b3_1.heavy 454.225 / 506.204 4708.0 21.880549430847168 43 17 10 6 10 2.9013111656695325 23.78806512039675 0.03569984436035156 3 0.9799540044924869 8.70202618081337 4708.0 59.88204506379513 0.0 - - - - - - - 152.33333333333334 9 9 MTX3 metaxin 3 1885 239 C20140711_OR018_03 C20140711_OR018_03 TB422181.[MT7]-MDDNLR.2y5_1.heavy 454.225 / 632.3 3509.0 21.880549430847168 43 17 10 6 10 2.9013111656695325 23.78806512039675 0.03569984436035156 3 0.9799540044924869 8.70202618081337 3509.0 51.73163333634966 0.0 - - - - - - - 264.54545454545456 7 11 MTX3 metaxin 3 1887 239 C20140711_OR018_03 C20140711_OR018_03 TB422181.[MT7]-MDDNLR.2b4_1.heavy 454.225 / 620.247 3509.0 21.880549430847168 43 17 10 6 10 2.9013111656695325 23.78806512039675 0.03569984436035156 3 0.9799540044924869 8.70202618081337 3509.0 54.31948511446928 0.0 - - - - - - - 171.25 7 4 MTX3 metaxin 3 1889 240 C20140711_OR018_03 C20140711_OR018_03 TB422284.[MT7]-RPDVITK[MT7].2y6_1.heavy 558.853 / 816.495 1136.0 21.178100109100342 31 12 10 3 6 3.875514379152039 25.80302644158424 0.07439994812011719 6 0.8841178946700049 3.589783111137857 1136.0 6.659027183320969 0.0 - - - - - - - 101.25 2 4 GLT6D1 glycosyltransferase 6 domain containing 1 1891 240 C20140711_OR018_03 C20140711_OR018_03 TB422284.[MT7]-RPDVITK[MT7].2b3_1.heavy 558.853 / 513.29 2921.0 21.178100109100342 31 12 10 3 6 3.875514379152039 25.80302644158424 0.07439994812011719 6 0.8841178946700049 3.589783111137857 2921.0 11.309172448484007 0.0 - - - - - - - 260.7857142857143 5 14 GLT6D1 glycosyltransferase 6 domain containing 1 1893 240 C20140711_OR018_03 C20140711_OR018_03 TB422284.[MT7]-RPDVITK[MT7].2y4_1.heavy 558.853 / 604.415 81.0 21.178100109100342 31 12 10 3 6 3.875514379152039 25.80302644158424 0.07439994812011719 6 0.8841178946700049 3.589783111137857 81.0 -0.5 39.0 - - - - - - - 0.0 1 0 GLT6D1 glycosyltransferase 6 domain containing 1 1895 240 C20140711_OR018_03 C20140711_OR018_03 TB422284.[MT7]-RPDVITK[MT7].2b4_1.heavy 558.853 / 612.359 487.0 21.178100109100342 31 12 10 3 6 3.875514379152039 25.80302644158424 0.07439994812011719 6 0.8841178946700049 3.589783111137857 487.0 3.847901234567901 8.0 - - - - - - - 0.0 1 0 GLT6D1 glycosyltransferase 6 domain containing 1 1897 241 C20140711_OR018_03 C20140711_OR018_03 TB422884.[MT7]-AAASLAAVSGTAAASLGSAQPTDLGAHK[MT7].4y4_1.heavy 696.379 / 556.332 4219.0 36.44314956665039 42 17 10 5 10 3.1845937882680886 31.401179129468836 0.0493011474609375 3 0.9779923259169802 8.303775121069894 4219.0 40.318669354838704 0.0 - - - - - - - 230.28571428571428 8 7 IRF2BP2 interferon regulatory factor 2 binding protein 2 1899 241 C20140711_OR018_03 C20140711_OR018_03 TB422884.[MT7]-AAASLAAVSGTAAASLGSAQPTDLGAHK[MT7].4y5_1.heavy 696.379 / 669.416 2606.0 36.44314956665039 42 17 10 5 10 3.1845937882680886 31.401179129468836 0.0493011474609375 3 0.9779923259169802 8.303775121069894 2606.0 -0.5604301075268818 0.0 - - - - - - - 248.0 5 7 IRF2BP2 interferon regulatory factor 2 binding protein 2 1901 241 C20140711_OR018_03 C20140711_OR018_03 TB422884.[MT7]-AAASLAAVSGTAAASLGSAQPTDLGAHK[MT7].4y8_1.heavy 696.379 / 982.544 6825.0 36.44314956665039 42 17 10 5 10 3.1845937882680886 31.401179129468836 0.0493011474609375 3 0.9779923259169802 8.303775121069894 6825.0 -4.4032258064516085 0.0 - - - - - - - 186.0 13 8 IRF2BP2 interferon regulatory factor 2 binding protein 2 1903 241 C20140711_OR018_03 C20140711_OR018_03 TB422884.[MT7]-AAASLAAVSGTAAASLGSAQPTDLGAHK[MT7].4b7_1.heavy 696.379 / 700.411 7693.0 36.44314956665039 42 17 10 5 10 3.1845937882680886 31.401179129468836 0.0493011474609375 3 0.9779923259169802 8.303775121069894 7693.0 45.46521639784946 0.0 - - - - - - - 279.0 15 4 IRF2BP2 interferon regulatory factor 2 binding protein 2 1905 242 C20140711_OR018_03 C20140711_OR018_03 TB422881.[MT7]-RVPANYADGVYQALEEPQLPNPR.4b8_1.heavy 686.109 / 1031.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2 dual oxidase 2 1907 242 C20140711_OR018_03 C20140711_OR018_03 TB422881.[MT7]-RVPANYADGVYQALEEPQLPNPR.4y7_1.heavy 686.109 / 821.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2 dual oxidase 2 1909 242 C20140711_OR018_03 C20140711_OR018_03 TB422881.[MT7]-RVPANYADGVYQALEEPQLPNPR.4b9_1.heavy 686.109 / 1088.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2 dual oxidase 2 1911 242 C20140711_OR018_03 C20140711_OR018_03 TB422881.[MT7]-RVPANYADGVYQALEEPQLPNPR.4b9_2.heavy 686.109 / 544.784 N/A N/A - - - - - - - - - 0.0 - - - - - - - DUOX2 dual oxidase 2