Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140711_OR018_04 C20140711_OR018_04 TB422851.[MT7]-ATTSLC[CAM]ESELHGK[MT7]PNYSAGR.4y9_2.heavy 617.313 / 547.297 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 3 1 C20140711_OR018_04 C20140711_OR018_04 TB422851.[MT7]-ATTSLC[CAM]ESELHGK[MT7]PNYSAGR.4y10_2.heavy 617.313 / 615.827 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 5 1 C20140711_OR018_04 C20140711_OR018_04 TB422851.[MT7]-ATTSLC[CAM]ESELHGK[MT7]PNYSAGR.4b4_1.heavy 617.313 / 505.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 7 1 C20140711_OR018_04 C20140711_OR018_04 TB422851.[MT7]-ATTSLC[CAM]ESELHGK[MT7]PNYSAGR.4y7_1.heavy 617.313 / 764.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 9 2 C20140711_OR018_04 C20140711_OR018_04 TB422199.[MT7]-TSPLTK[MT7].2y4_1.heavy 467.794 / 602.399 4804.0 21.09130048751831 43 20 10 3 10 5.867325157921406 17.043541530162376 0.06699943542480469 3 0.992105541040696 13.880817991415244 4804.0 30.187297297297295 0.0 - - - - - - - 185.0 9 8 ULK4 unc-51-like kinase 4 (C. elegans) 11 2 C20140711_OR018_04 C20140711_OR018_04 TB422199.[MT7]-TSPLTK[MT7].2y5_1.heavy 467.794 / 689.431 2661.0 21.09130048751831 43 20 10 3 10 5.867325157921406 17.043541530162376 0.06699943542480469 3 0.992105541040696 13.880817991415244 2661.0 25.770945945945947 0.0 - - - - - - - 166.5 5 12 ULK4 unc-51-like kinase 4 (C. elegans) 13 2 C20140711_OR018_04 C20140711_OR018_04 TB422199.[MT7]-TSPLTK[MT7].2b4_1.heavy 467.794 / 543.326 370.0 21.09130048751831 43 20 10 3 10 5.867325157921406 17.043541530162376 0.06699943542480469 3 0.992105541040696 13.880817991415244 370.0 -0.25000000000000006 10.0 - - - - - - - 0.0 0 0 ULK4 unc-51-like kinase 4 (C. elegans) 15 2 C20140711_OR018_04 C20140711_OR018_04 TB422199.[MT7]-TSPLTK[MT7].2y3_1.heavy 467.794 / 505.347 1774.0 21.09130048751831 43 20 10 3 10 5.867325157921406 17.043541530162376 0.06699943542480469 3 0.992105541040696 13.880817991415244 1774.0 5.7535135135135125 0.0 - - - - - - - 221.85714285714286 3 14 ULK4 unc-51-like kinase 4 (C. elegans) 17 3 C20140711_OR018_04 C20140711_OR018_04 TB422446.[MT7]-VQWLQGFAK[MT7].3y3_1.heavy 455.602 / 509.32 1341.0 39.93337535858154 39 16 10 5 8 2.5722409922324263 38.87660615858969 0.045101165771484375 4 0.9681503505687463 6.896846719027042 1341.0 13.922950819672131 0.0 - - - - - - - 284.6666666666667 2 3 TEX13B testis expressed 13B 19 3 C20140711_OR018_04 C20140711_OR018_04 TB422446.[MT7]-VQWLQGFAK[MT7].3b4_1.heavy 455.602 / 671.4 487.0 39.93337535858154 39 16 10 5 8 2.5722409922324263 38.87660615858969 0.045101165771484375 4 0.9681503505687463 6.896846719027042 487.0 4.390983606557377 6.0 - - - - - - - 219.4 2 5 TEX13B testis expressed 13B 21 3 C20140711_OR018_04 C20140711_OR018_04 TB422446.[MT7]-VQWLQGFAK[MT7].3b3_1.heavy 455.602 / 558.316 1950.0 39.93337535858154 39 16 10 5 8 2.5722409922324263 38.87660615858969 0.045101165771484375 4 0.9681503505687463 6.896846719027042 1950.0 -6.39344262295082 1.0 - - - - - - - 284.3333333333333 3 3 TEX13B testis expressed 13B 23 3 C20140711_OR018_04 C20140711_OR018_04 TB422446.[MT7]-VQWLQGFAK[MT7].3y4_1.heavy 455.602 / 566.342 1950.0 39.93337535858154 39 16 10 5 8 2.5722409922324263 38.87660615858969 0.045101165771484375 4 0.9681503505687463 6.896846719027042 1950.0 -0.03995901639344268 0.0 - - - - - - - 316.8 3 5 TEX13B testis expressed 13B 25 4 C20140711_OR018_04 C20140711_OR018_04 TB422447.[MT7]-EGEYFSAFK[MT7].3y3_1.heavy 455.902 / 509.32 1162.0 35.28517436981201 44 20 10 6 8 13.42394299577288 7.4493760910255205 0.039501190185546875 4 0.9962427232913723 20.12749398167449 1162.0 -1.440495867768595 0.0 - - - - - - - 314.5 2 4 XDH xanthine dehydrogenase 27 4 C20140711_OR018_04 C20140711_OR018_04 TB422447.[MT7]-EGEYFSAFK[MT7].3b4_1.heavy 455.902 / 623.279 3873.0 35.28517436981201 44 20 10 6 8 13.42394299577288 7.4493760910255205 0.039501190185546875 4 0.9962427232913723 20.12749398167449 3873.0 59.69211340206185 0.0 - - - - - - - 193.75 7 4 XDH xanthine dehydrogenase 29 4 C20140711_OR018_04 C20140711_OR018_04 TB422447.[MT7]-EGEYFSAFK[MT7].3y4_1.heavy 455.902 / 596.352 2130.0 35.28517436981201 44 20 10 6 8 13.42394299577288 7.4493760910255205 0.039501190185546875 4 0.9962427232913723 20.12749398167449 2130.0 5.828196521208422 1.0 - - - - - - - 135.6 10 5 XDH xanthine dehydrogenase 31 4 C20140711_OR018_04 C20140711_OR018_04 TB422447.[MT7]-EGEYFSAFK[MT7].3b3_1.heavy 455.902 / 460.216 5228.0 35.28517436981201 44 20 10 6 8 13.42394299577288 7.4493760910255205 0.039501190185546875 4 0.9962427232913723 20.12749398167449 5228.0 -6.480991735537191 0.0 - - - - - - - 218.0 10 8 XDH xanthine dehydrogenase 33 5 C20140711_OR018_04 C20140711_OR018_04 TB422443.[MT7]-LGC[CAM]GEGGC[CAM]GAC[CAM]TVMLSK[MT7].3b9_1.heavy 682.322 / 992.405 3777.0 31.24049949645996 41 11 10 10 10 2.073699893944634 48.222985540004046 0.0 3 0.8786731323010545 3.506645312500813 3777.0 35.060420039192294 1.0 - - - - - - - 145.5 7 4 XDH xanthine dehydrogenase 35 5 C20140711_OR018_04 C20140711_OR018_04 TB422443.[MT7]-LGC[CAM]GEGGC[CAM]GAC[CAM]TVMLSK[MT7].3b6_1.heavy 682.322 / 718.331 968.0 31.24049949645996 41 11 10 10 10 2.073699893944634 48.222985540004046 0.0 3 0.8786731323010545 3.506645312500813 968.0 1.84 1.0 - - - - - - - 0.0 1 0 XDH xanthine dehydrogenase 37 5 C20140711_OR018_04 C20140711_OR018_04 TB422443.[MT7]-LGC[CAM]GEGGC[CAM]GAC[CAM]TVMLSK[MT7].3b5_1.heavy 682.322 / 661.31 3583.0 31.24049949645996 41 11 10 10 10 2.073699893944634 48.222985540004046 0.0 3 0.8786731323010545 3.506645312500813 3583.0 23.84848770611897 0.0 - - - - - - - 242.16666666666666 7 6 XDH xanthine dehydrogenase 39 5 C20140711_OR018_04 C20140711_OR018_04 TB422443.[MT7]-LGC[CAM]GEGGC[CAM]GAC[CAM]TVMLSK[MT7].3y4_1.heavy 682.322 / 622.371 10943.0 31.24049949645996 41 11 10 10 10 2.073699893944634 48.222985540004046 0.0 3 0.8786731323010545 3.506645312500813 10943.0 57.79480486960228 0.0 - - - - - - - 276.85714285714283 21 7 XDH xanthine dehydrogenase 41 6 C20140711_OR018_04 C20140711_OR018_04 TB443796.[MT7]-STVVSTAVALAAYK[MT7].3y3_1.heavy 556.997 / 525.315 14926.0 39.58894920349121 42 17 10 5 10 2.875555732391356 27.86669200459527 0.044300079345703125 3 0.9715259688257648 7.2962878624269285 14926.0 41.54794675206283 0.0 - - - - - - - 283.625 29 8 XDH xanthine dehydrogenase 43 6 C20140711_OR018_04 C20140711_OR018_04 TB443796.[MT7]-STVVSTAVALAAYK[MT7].3b4_1.heavy 556.997 / 531.326 10866.0 39.58894920349121 42 17 10 5 10 2.875555732391356 27.86669200459527 0.044300079345703125 3 0.9715259688257648 7.2962878624269285 10866.0 34.679650370211974 0.0 - - - - - - - 274.6 21 10 XDH xanthine dehydrogenase 45 6 C20140711_OR018_04 C20140711_OR018_04 TB443796.[MT7]-STVVSTAVALAAYK[MT7].3y4_1.heavy 556.997 / 596.352 16956.0 39.58894920349121 42 17 10 5 10 2.875555732391356 27.86669200459527 0.044300079345703125 3 0.9715259688257648 7.2962878624269285 16956.0 77.0374166101774 0.0 - - - - - - - 274.6 33 10 XDH xanthine dehydrogenase 47 6 C20140711_OR018_04 C20140711_OR018_04 TB443796.[MT7]-STVVSTAVALAAYK[MT7].3b7_1.heavy 556.997 / 790.443 6448.0 39.58894920349121 42 17 10 5 10 2.875555732391356 27.86669200459527 0.044300079345703125 3 0.9715259688257648 7.2962878624269285 6448.0 75.2262888084104 0.0 - - - - - - - 310.4 12 5 XDH xanthine dehydrogenase 49 7 C20140711_OR018_04 C20140711_OR018_04 TB422584.[MT7]-NADPETTLLAYLR.2y8_1.heavy 810.939 / 950.567 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 51 7 C20140711_OR018_04 C20140711_OR018_04 TB422584.[MT7]-NADPETTLLAYLR.2b4_1.heavy 810.939 / 542.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 53 7 C20140711_OR018_04 C20140711_OR018_04 TB422584.[MT7]-NADPETTLLAYLR.2y6_1.heavy 810.939 / 748.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 55 7 C20140711_OR018_04 C20140711_OR018_04 TB422584.[MT7]-NADPETTLLAYLR.2y10_1.heavy 810.939 / 1176.66 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 57 8 C20140711_OR018_04 C20140711_OR018_04 TB422306.[MT7]-NTTVLNSK[MT7].2y4_1.heavy 582.845 / 605.374 1415.0 21.62285041809082 44 18 10 6 10 5.6595788177194555 17.669159352797088 0.03459930419921875 3 0.9888911148530084 11.698340716461207 1415.0 4.765681604965 0.0 - - - - - - - 212.57142857142858 2 14 BAI1 brain-specific angiogenesis inhibitor 1 59 8 C20140711_OR018_04 C20140711_OR018_04 TB422306.[MT7]-NTTVLNSK[MT7].2y5_1.heavy 582.845 / 704.442 447.0 21.62285041809082 44 18 10 6 10 5.6595788177194555 17.669159352797088 0.03459930419921875 3 0.9888911148530084 11.698340716461207 447.0 0.6000000000000001 4.0 - - - - - - - 0.0 1 0 BAI1 brain-specific angiogenesis inhibitor 1 61 8 C20140711_OR018_04 C20140711_OR018_04 TB422306.[MT7]-NTTVLNSK[MT7].2y6_1.heavy 582.845 / 805.49 596.0 21.62285041809082 44 18 10 6 10 5.6595788177194555 17.669159352797088 0.03459930419921875 3 0.9888911148530084 11.698340716461207 596.0 9.894054054054054 0.0 - - - - - - - 0.0 1 0 BAI1 brain-specific angiogenesis inhibitor 1 63 8 C20140711_OR018_04 C20140711_OR018_04 TB422306.[MT7]-NTTVLNSK[MT7].2y7_1.heavy 582.845 / 906.538 894.0 21.62285041809082 44 18 10 6 10 5.6595788177194555 17.669159352797088 0.03459930419921875 3 0.9888911148530084 11.698340716461207 894.0 19.317648648648646 0.0 - - - - - - - 0.0 1 0 BAI1 brain-specific angiogenesis inhibitor 1 65 9 C20140711_OR018_04 C20140711_OR018_04 TB422583.[MT7]-NFEQVAFDETK[MT7].3b5_1.heavy 539.278 / 762.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDIA2 protein disulfide isomerase family A, member 2 67 9 C20140711_OR018_04 C20140711_OR018_04 TB422583.[MT7]-NFEQVAFDETK[MT7].3y4_1.heavy 539.278 / 636.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDIA2 protein disulfide isomerase family A, member 2 69 9 C20140711_OR018_04 C20140711_OR018_04 TB422583.[MT7]-NFEQVAFDETK[MT7].3b3_1.heavy 539.278 / 535.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDIA2 protein disulfide isomerase family A, member 2 71 9 C20140711_OR018_04 C20140711_OR018_04 TB422583.[MT7]-NFEQVAFDETK[MT7].3y5_1.heavy 539.278 / 783.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDIA2 protein disulfide isomerase family A, member 2 73 10 C20140711_OR018_04 C20140711_OR018_04 TB422856.[MT7]-DLEQLVGIANYYALLHQQK[MT7].4y4_1.heavy 626.849 / 684.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 75 10 C20140711_OR018_04 C20140711_OR018_04 TB422856.[MT7]-DLEQLVGIANYYALLHQQK[MT7].4b4_1.heavy 626.849 / 630.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 77 10 C20140711_OR018_04 C20140711_OR018_04 TB422856.[MT7]-DLEQLVGIANYYALLHQQK[MT7].4b5_1.heavy 626.849 / 743.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 79 10 C20140711_OR018_04 C20140711_OR018_04 TB422856.[MT7]-DLEQLVGIANYYALLHQQK[MT7].4b3_1.heavy 626.849 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 81 11 C20140711_OR018_04 C20140711_OR018_04 TB422857.[MT7]-STLEGQLNESMFLLSSRPTPR.4y12_2.heavy 627.582 / 696.377 1721.0 36.51890182495117 43 18 9 10 6 4.509536256224362 17.614967978323957 0.0 5 0.9888765154412436 11.690646963481926 1721.0 7.054234417344174 2.0 - - - - - - - 225.5 3 12 ULK4 unc-51-like kinase 4 (C. elegans) 83 11 C20140711_OR018_04 C20140711_OR018_04 TB422857.[MT7]-STLEGQLNESMFLLSSRPTPR.4b4_1.heavy 627.582 / 575.316 3072.0 36.51890182495117 43 18 9 10 6 4.509536256224362 17.614967978323957 0.0 5 0.9888765154412436 11.690646963481926 3072.0 -0.3127391324605134 3.0 - - - - - - - 344.4 9 10 ULK4 unc-51-like kinase 4 (C. elegans) 85 11 C20140711_OR018_04 C20140711_OR018_04 TB422857.[MT7]-STLEGQLNESMFLLSSRPTPR.4b5_1.heavy 627.582 / 632.337 2212.0 36.51890182495117 43 18 9 10 6 4.509536256224362 17.614967978323957 0.0 5 0.9888765154412436 11.690646963481926 2212.0 6.6962984218077475 3.0 - - - - - - - 413.72727272727275 7 11 ULK4 unc-51-like kinase 4 (C. elegans) 87 11 C20140711_OR018_04 C20140711_OR018_04 TB422857.[MT7]-STLEGQLNESMFLLSSRPTPR.4b6_1.heavy 627.582 / 760.396 3195.0 36.51890182495117 43 18 9 10 6 4.509536256224362 17.614967978323957 0.0 5 0.9888765154412436 11.690646963481926 3195.0 8.535706182643223 0.0 - - - - - - - 268.3636363636364 6 11 ULK4 unc-51-like kinase 4 (C. elegans) 89 12 C20140711_OR018_04 C20140711_OR018_04 TB443895.[MT7]-GGPDLVLDPK[MT7].2b8_1.heavy 649.882 / 911.495 14403.0 31.8945255279541 33 10 10 3 10 1.6179050419941738 61.80832459533191 0.0699005126953125 3 0.8482847518619029 3.1275016858309503 14403.0 86.49482990039496 0.0 - - - - - - - 195.7 28 10 AHRR aryl-hydrocarbon receptor repressor 91 12 C20140711_OR018_04 C20140711_OR018_04 TB443895.[MT7]-GGPDLVLDPK[MT7].2b6_1.heavy 649.882 / 683.385 2675.0 31.8945255279541 33 10 10 3 10 1.6179050419941738 61.80832459533191 0.0699005126953125 3 0.8482847518619029 3.1275016858309503 2675.0 11.605935914986912 0.0 - - - - - - - 206.0 5 12 AHRR aryl-hydrocarbon receptor repressor 93 12 C20140711_OR018_04 C20140711_OR018_04 TB443895.[MT7]-GGPDLVLDPK[MT7].2b7_1.heavy 649.882 / 796.469 2469.0 31.8945255279541 33 10 10 3 10 1.6179050419941738 61.80832459533191 0.0699005126953125 3 0.8482847518619029 3.1275016858309503 2469.0 4.194902912621359 0.0 - - - - - - - 206.0 4 11 AHRR aryl-hydrocarbon receptor repressor 95 12 C20140711_OR018_04 C20140711_OR018_04 TB443895.[MT7]-GGPDLVLDPK[MT7].2b5_1.heavy 649.882 / 584.316 2881.0 31.8945255279541 33 10 10 3 10 1.6179050419941738 61.80832459533191 0.0699005126953125 3 0.8482847518619029 3.1275016858309503 2881.0 5.594174757281553 2.0 - - - - - - - 253.53846153846155 5 13 AHRR aryl-hydrocarbon receptor repressor 97 13 C20140711_OR018_04 C20140711_OR018_04 TB422579.[MT7]-QQQEPTGEPSPK[MT7].2b8_1.heavy 807.422 / 1042.49 N/A N/A - - - - - - - - - 0.0 - - - - - - - HMGA2 high mobility group AT-hook 2 99 13 C20140711_OR018_04 C20140711_OR018_04 TB422579.[MT7]-QQQEPTGEPSPK[MT7].2b3_1.heavy 807.422 / 529.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - HMGA2 high mobility group AT-hook 2 101 13 C20140711_OR018_04 C20140711_OR018_04 TB422579.[MT7]-QQQEPTGEPSPK[MT7].2y8_1.heavy 807.422 / 956.517 N/A N/A - - - - - - - - - 0.0 - - - - - - - HMGA2 high mobility group AT-hook 2 103 13 C20140711_OR018_04 C20140711_OR018_04 TB422579.[MT7]-QQQEPTGEPSPK[MT7].2b4_1.heavy 807.422 / 658.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - HMGA2 high mobility group AT-hook 2 105 14 C20140711_OR018_04 C20140711_OR018_04 TB443903.[MT7]-ALLETQNLLR.2y8_1.heavy 657.897 / 986.563 16466.0 37.7848014831543 46 16 10 10 10 6.823185370417236 14.65591136268441 0.0 3 0.9677754965635786 6.856398596959741 16466.0 78.15031877213696 0.0 - - - - - - - 242.0 32 5 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 107 14 C20140711_OR018_04 C20140711_OR018_04 TB443903.[MT7]-ALLETQNLLR.2y9_1.heavy 657.897 / 1099.65 11986.0 37.7848014831543 46 16 10 10 10 6.823185370417236 14.65591136268441 0.0 3 0.9677754965635786 6.856398596959741 11986.0 44.057158598976784 0.0 - - - - - - - 242.0 23 6 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 109 14 C20140711_OR018_04 C20140711_OR018_04 TB443903.[MT7]-ALLETQNLLR.2y6_1.heavy 657.897 / 744.436 13076.0 37.7848014831543 46 16 10 10 10 6.823185370417236 14.65591136268441 0.0 3 0.9677754965635786 6.856398596959741 13076.0 46.82865013774104 0.0 - - - - - - - 295.77777777777777 26 9 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 111 14 C20140711_OR018_04 C20140711_OR018_04 TB443903.[MT7]-ALLETQNLLR.2y7_1.heavy 657.897 / 873.479 18645.0 37.7848014831543 46 16 10 10 10 6.823185370417236 14.65591136268441 0.0 3 0.9677754965635786 6.856398596959741 18645.0 71.64493506493505 0.0 - - - - - - - 257.125 37 8 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 113 15 C20140711_OR018_04 C20140711_OR018_04 TB444112.[MT7]-DILC[CAM]DVTLIVERK[MT7].4y4_1.heavy 466.272 / 675.427 N/A N/A - - - - - - - - - 0.0 - - - - - - - BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 115 15 C20140711_OR018_04 C20140711_OR018_04 TB444112.[MT7]-DILC[CAM]DVTLIVERK[MT7].4b5_1.heavy 466.272 / 761.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 117 15 C20140711_OR018_04 C20140711_OR018_04 TB444112.[MT7]-DILC[CAM]DVTLIVERK[MT7].4y7_2.heavy 466.272 / 501.825 N/A N/A - - - - - - - - - 0.0 - - - - - - - BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 119 15 C20140711_OR018_04 C20140711_OR018_04 TB444112.[MT7]-DILC[CAM]DVTLIVERK[MT7].4b3_1.heavy 466.272 / 486.304 N/A N/A - - - - - - - - - 0.0 - - - - - - - BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 121 16 C20140711_OR018_04 C20140711_OR018_04 TB443789.[MT7]-SLSSLSSK[MT7].2y4_1.heavy 548.826 / 578.363 1538.0 25.46940040588379 37 12 10 5 10 3.3668963629665143 29.700943901906065 0.04759979248046875 3 0.8880794648380762 3.6540220852650127 1538.0 7.5501818181818185 0.0 - - - - - - - 216.25 3 8 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 123 16 C20140711_OR018_04 C20140711_OR018_04 TB443789.[MT7]-SLSSLSSK[MT7].2y5_1.heavy 548.826 / 665.395 1538.0 25.46940040588379 37 12 10 5 10 3.3668963629665143 29.700943901906065 0.04759979248046875 3 0.8880794648380762 3.6540220852650127 1538.0 18.381596753246754 0.0 - - - - - - - 168.125 3 8 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 125 16 C20140711_OR018_04 C20140711_OR018_04 TB443789.[MT7]-SLSSLSSK[MT7].2b4_1.heavy 548.826 / 519.289 673.0 25.46940040588379 37 12 10 5 10 3.3668963629665143 29.700943901906065 0.04759979248046875 3 0.8880794648380762 3.6540220852650127 673.0 0.7700277392510402 24.0 - - - - - - - 253.92857142857142 5 14 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 127 16 C20140711_OR018_04 C20140711_OR018_04 TB443789.[MT7]-SLSSLSSK[MT7].2y6_1.heavy 548.826 / 752.427 4326.0 25.46940040588379 37 12 10 5 10 3.3668963629665143 29.700943901906065 0.04759979248046875 3 0.8880794648380762 3.6540220852650127 4326.0 41.908125 0.0 - - - - - - - 134.4 8 5 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 129 17 C20140711_OR018_04 C20140711_OR018_04 TB422435.[MT7]-FWEGLPAQVR.2y8_1.heavy 673.87 / 869.484 4427.0 39.09149932861328 48 18 10 10 10 3.041542222877244 26.176501505347986 0.0 3 0.9854517118389827 10.219472806308703 4427.0 18.622689144817446 0.0 - - - - - - - 207.44444444444446 8 9 MMP25 matrix metallopeptidase 25 131 17 C20140711_OR018_04 C20140711_OR018_04 TB422435.[MT7]-FWEGLPAQVR.2y5_1.heavy 673.87 / 570.336 7923.0 39.09149932861328 48 18 10 10 10 3.041542222877244 26.176501505347986 0.0 3 0.9854517118389827 10.219472806308703 7923.0 21.992838104448744 1.0 - - - - - - - 306.125 16 8 MMP25 matrix metallopeptidase 25 133 17 C20140711_OR018_04 C20140711_OR018_04 TB422435.[MT7]-FWEGLPAQVR.2y9_1.heavy 673.87 / 1055.56 11068.0 39.09149932861328 48 18 10 10 10 3.041542222877244 26.176501505347986 0.0 3 0.9854517118389827 10.219472806308703 11068.0 136.4164190601959 0.0 - - - - - - - 175.125 22 8 MMP25 matrix metallopeptidase 25 135 17 C20140711_OR018_04 C20140711_OR018_04 TB422435.[MT7]-FWEGLPAQVR.2y7_1.heavy 673.87 / 740.441 7457.0 39.09149932861328 48 18 10 10 10 3.041542222877244 26.176501505347986 0.0 3 0.9854517118389827 10.219472806308703 7457.0 51.28322004904966 0.0 - - - - - - - 210.0 14 10 MMP25 matrix metallopeptidase 25 137 18 C20140711_OR018_04 C20140711_OR018_04 TB422438.[MT7]-FC[CAM]NIALC[CAM]PGR.2b3_1.heavy 676.34 / 566.251 3364.0 33.319549560546875 44 18 10 6 10 4.738389306308543 21.104217812340394 0.035797119140625 3 0.9882919130830221 11.39448650998103 3364.0 16.909946524064168 0.0 - - - - - - - 215.46153846153845 6 13 BAI1 brain-specific angiogenesis inhibitor 1 139 18 C20140711_OR018_04 C20140711_OR018_04 TB422438.[MT7]-FC[CAM]NIALC[CAM]PGR.2b4_1.heavy 676.34 / 679.335 1589.0 33.319549560546875 44 18 10 6 10 4.738389306308543 21.104217812340394 0.035797119140625 3 0.9882919130830221 11.39448650998103 1589.0 4.107040998217469 0.0 - - - - - - - 308.2 3 10 BAI1 brain-specific angiogenesis inhibitor 1 141 18 C20140711_OR018_04 C20140711_OR018_04 TB422438.[MT7]-FC[CAM]NIALC[CAM]PGR.2y9_1.heavy 676.34 / 1060.5 4112.0 33.319549560546875 44 18 10 6 10 4.738389306308543 21.104217812340394 0.035797119140625 3 0.9882919130830221 11.39448650998103 4112.0 41.56215053763441 0.0 - - - - - - - 220.63636363636363 8 11 BAI1 brain-specific angiogenesis inhibitor 1 143 18 C20140711_OR018_04 C20140711_OR018_04 TB422438.[MT7]-FC[CAM]NIALC[CAM]PGR.2y6_1.heavy 676.34 / 673.345 3832.0 33.319549560546875 44 18 10 6 10 4.738389306308543 21.104217812340394 0.035797119140625 3 0.9882919130830221 11.39448650998103 3832.0 6.420819964349376 0.0 - - - - - - - 286.46666666666664 7 15 BAI1 brain-specific angiogenesis inhibitor 1 145 19 C20140711_OR018_04 C20140711_OR018_04 TB422434.[MT7]-ETPGPTK[MT7]PLPWTAGK[MT7].3y6_1.heavy 671.39 / 803.453 4328.0 30.528250217437744 36 13 10 3 10 0.9971028803108912 59.013646110463995 0.07610130310058594 3 0.9059629382560485 3.992540101638267 4328.0 21.904305343511453 0.0 - - - - - - - 237.5 8 12 AHRR aryl-hydrocarbon receptor repressor 147 19 C20140711_OR018_04 C20140711_OR018_04 TB422434.[MT7]-ETPGPTK[MT7]PLPWTAGK[MT7].3y4_1.heavy 671.39 / 520.321 2656.0 30.528250217437744 36 13 10 3 10 0.9971028803108912 59.013646110463995 0.07610130310058594 3 0.9059629382560485 3.992540101638267 2656.0 10.806358735498339 0.0 - - - - - - - 270.375 5 8 AHRR aryl-hydrocarbon receptor repressor 149 19 C20140711_OR018_04 C20140711_OR018_04 TB422434.[MT7]-ETPGPTK[MT7]PLPWTAGK[MT7].3y13_2.heavy 671.39 / 819.484 2164.0 30.528250217437744 36 13 10 3 10 0.9971028803108912 59.013646110463995 0.07610130310058594 3 0.9059629382560485 3.992540101638267 2164.0 15.457142857142856 1.0 - - - - - - - 216.3 5 10 AHRR aryl-hydrocarbon receptor repressor 151 19 C20140711_OR018_04 C20140711_OR018_04 TB422434.[MT7]-ETPGPTK[MT7]PLPWTAGK[MT7].3b7_2.heavy 671.39 / 500.289 4623.0 30.528250217437744 36 13 10 3 10 0.9971028803108912 59.013646110463995 0.07610130310058594 3 0.9059629382560485 3.992540101638267 4623.0 12.032839945329428 0.0 - - - - - - - 357.54545454545456 9 11 AHRR aryl-hydrocarbon receptor repressor 153 20 C20140711_OR018_04 C20140711_OR018_04 TB422571.[MT7]-C[CAM]SLPDVLGVAGLVR.2b3_1.heavy 800.454 / 505.256 17473.0 45.22840118408203 40 10 10 10 10 0.6222255001867566 83.91426182791913 0.0 3 0.8335828935203626 2.9822763126391307 17473.0 146.98317596566523 0.0 - - - - - - - 174.5 34 6 MMP25 matrix metallopeptidase 25 155 20 C20140711_OR018_04 C20140711_OR018_04 TB422571.[MT7]-C[CAM]SLPDVLGVAGLVR.2y9_1.heavy 800.454 / 883.572 5358.0 45.22840118408203 40 10 10 10 10 0.6222255001867566 83.91426182791913 0.0 3 0.8335828935203626 2.9822763126391307 5358.0 33.437999926214694 0.0 - - - - - - - 206.77777777777777 10 9 MMP25 matrix metallopeptidase 25 157 20 C20140711_OR018_04 C20140711_OR018_04 TB422571.[MT7]-C[CAM]SLPDVLGVAGLVR.2b5_1.heavy 800.454 / 717.336 3145.0 45.22840118408203 40 10 10 10 10 0.6222255001867566 83.91426182791913 0.0 3 0.8335828935203626 2.9822763126391307 3145.0 13.092918454935623 0.0 - - - - - - - 267.7 6 10 MMP25 matrix metallopeptidase 25 159 20 C20140711_OR018_04 C20140711_OR018_04 TB422571.[MT7]-C[CAM]SLPDVLGVAGLVR.2y11_1.heavy 800.454 / 1095.65 15260.0 45.22840118408203 40 10 10 10 10 0.6222255001867566 83.91426182791913 0.0 3 0.8335828935203626 2.9822763126391307 15260.0 56.109122938622924 0.0 - - - - - - - 213.33333333333334 30 6 MMP25 matrix metallopeptidase 25 161 21 C20140711_OR018_04 C20140711_OR018_04 TB422866.[MT7]-GPEFYFENISLSWEEVEDK[MT7].4b8_1.heavy 652.319 / 1128.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - TEX13B testis expressed 13B 163 21 C20140711_OR018_04 C20140711_OR018_04 TB422866.[MT7]-GPEFYFENISLSWEEVEDK[MT7].4b4_1.heavy 652.319 / 575.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - TEX13B testis expressed 13B 165 21 C20140711_OR018_04 C20140711_OR018_04 TB422866.[MT7]-GPEFYFENISLSWEEVEDK[MT7].4b5_1.heavy 652.319 / 738.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - TEX13B testis expressed 13B 167 21 C20140711_OR018_04 C20140711_OR018_04 TB422866.[MT7]-GPEFYFENISLSWEEVEDK[MT7].4y3_1.heavy 652.319 / 535.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - TEX13B testis expressed 13B 169 22 C20140711_OR018_04 C20140711_OR018_04 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 71828.0 30.253999710083008 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 71828.0 1052.3291426599965 0.0 - - - - - - - 198.375 143 8 171 22 C20140711_OR018_04 C20140711_OR018_04 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 26865.0 30.253999710083008 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 26865.0 194.59167112299463 0.0 - - - - - - - 266.57142857142856 53 7 173 22 C20140711_OR018_04 C20140711_OR018_04 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 31809.0 30.253999710083008 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 31809.0 265.54075439266614 0.0 - - - - - - - 248.75 63 12 175 23 C20140711_OR018_04 C20140711_OR018_04 TB422572.[MT7]-C[CAM]SLPDVLGVAGLVR.3y7_1.heavy 533.972 / 671.42 16575.0 45.22840118408203 42 12 10 10 10 2.6371423275021986 32.184574888179604 0.0 3 0.8885225288938361 3.6614172779065104 16575.0 165.4709136331192 0.0 - - - - - - - 233.5 33 6 MMP25 matrix metallopeptidase 25 177 23 C20140711_OR018_04 C20140711_OR018_04 TB422572.[MT7]-C[CAM]SLPDVLGVAGLVR.3b5_1.heavy 533.972 / 717.336 7353.0 45.22840118408203 42 12 10 10 10 2.6371423275021986 32.184574888179604 0.0 3 0.8885225288938361 3.6614172779065104 7353.0 91.87945856718389 0.0 - - - - - - - 262.25 14 4 MMP25 matrix metallopeptidase 25 179 23 C20140711_OR018_04 C20140711_OR018_04 TB422572.[MT7]-C[CAM]SLPDVLGVAGLVR.3b3_1.heavy 533.972 / 505.256 14357.0 45.22840118408203 42 12 10 10 10 2.6371423275021986 32.184574888179604 0.0 3 0.8885225288938361 3.6614172779065104 14357.0 89.50458369098713 0.0 - - - - - - - 233.42857142857142 28 7 MMP25 matrix metallopeptidase 25 181 23 C20140711_OR018_04 C20140711_OR018_04 TB422572.[MT7]-C[CAM]SLPDVLGVAGLVR.3y5_1.heavy 533.972 / 515.33 16224.0 45.22840118408203 42 12 10 10 10 2.6371423275021986 32.184574888179604 0.0 3 0.8885225288938361 3.6614172779065104 16224.0 85.84694347026364 0.0 - - - - - - - 311.0 32 6 MMP25 matrix metallopeptidase 25 183 24 C20140711_OR018_04 C20140711_OR018_04 TB422864.[MT7]-AVLAAC[CAM]SEY[MT7]FWQALVGQTK[MT7].4y5_1.heavy 644.349 / 676.411 792.0 44.62289810180664 34 18 2 10 4 4.906700228555495 20.38029538018862 0.0 8 0.9800118034728512 8.7146410151879 792.0 7.476106194690266 8.0 - - - - - - - 0.0 1 0 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 185 24 C20140711_OR018_04 C20140711_OR018_04 TB422864.[MT7]-AVLAAC[CAM]SEY[MT7]FWQALVGQTK[MT7].4y4_1.heavy 644.349 / 577.343 905.0 44.62289810180664 34 18 2 10 4 4.906700228555495 20.38029538018862 0.0 8 0.9800118034728512 8.7146410151879 905.0 4.605309734513274 11.0 - - - - - - - 205.45454545454547 6 11 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 187 24 C20140711_OR018_04 C20140711_OR018_04 TB422864.[MT7]-AVLAAC[CAM]SEY[MT7]FWQALVGQTK[MT7].4b5_1.heavy 644.349 / 570.373 452.0 44.62289810180664 34 18 2 10 4 4.906700228555495 20.38029538018862 0.0 8 0.9800118034728512 8.7146410151879 452.0 2.5266666666666664 30.0 - - - - - - - 271.2 2 10 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 189 24 C20140711_OR018_04 C20140711_OR018_04 TB422864.[MT7]-AVLAAC[CAM]SEY[MT7]FWQALVGQTK[MT7].4b9_2.heavy 644.349 / 627.326 1131.0 44.62289810180664 34 18 2 10 4 4.906700228555495 20.38029538018862 0.0 8 0.9800118034728512 8.7146410151879 1131.0 7.523318584070797 5.0 - - - - - - - 301.3333333333333 2 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 191 25 C20140711_OR018_04 C20140711_OR018_04 TB422575.[MT7]-SLQHQLPQPGAQR.2y5_1.heavy 802.443 / 528.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 193 25 C20140711_OR018_04 C20140711_OR018_04 TB422575.[MT7]-SLQHQLPQPGAQR.2y9_1.heavy 802.443 / 994.543 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 195 25 C20140711_OR018_04 C20140711_OR018_04 TB422575.[MT7]-SLQHQLPQPGAQR.2y10_1.heavy 802.443 / 1131.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 197 25 C20140711_OR018_04 C20140711_OR018_04 TB422575.[MT7]-SLQHQLPQPGAQR.2y7_1.heavy 802.443 / 753.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 199 26 C20140711_OR018_04 C20140711_OR018_04 TB444102.[MT7]-LDPTFASATLLFQK[MT7].3b6_1.heavy 614.02 / 789.426 2942.0 45.68464946746826 43 18 10 5 10 5.459212101035118 18.317661623925375 0.041400909423828125 3 0.9892293015330932 11.880914193541159 2942.0 25.010867659947415 0.0 - - - - - - - 140.0 5 7 XDH xanthine dehydrogenase 201 26 C20140711_OR018_04 C20140711_OR018_04 TB444102.[MT7]-LDPTFASATLLFQK[MT7].3y3_1.heavy 614.02 / 566.342 5149.0 45.68464946746826 43 18 10 5 10 5.459212101035118 18.317661623925375 0.041400909423828125 3 0.9892293015330932 11.880914193541159 5149.0 77.12554486462295 0.0 - - - - - - - 163.625 10 8 XDH xanthine dehydrogenase 203 26 C20140711_OR018_04 C20140711_OR018_04 TB444102.[MT7]-LDPTFASATLLFQK[MT7].3b5_1.heavy 614.02 / 718.389 4250.0 45.68464946746826 43 18 10 5 10 5.459212101035118 18.317661623925375 0.041400909423828125 3 0.9892293015330932 11.880914193541159 4250.0 14.556159872261864 0.0 - - - - - - - 261.4 8 10 XDH xanthine dehydrogenase 205 26 C20140711_OR018_04 C20140711_OR018_04 TB444102.[MT7]-LDPTFASATLLFQK[MT7].3y4_1.heavy 614.02 / 679.426 4005.0 45.68464946746826 43 18 10 5 10 5.459212101035118 18.317661623925375 0.041400909423828125 3 0.9892293015330932 11.880914193541159 4005.0 53.914995022399204 0.0 - - - - - - - 253.2 8 10 XDH xanthine dehydrogenase 207 27 C20140711_OR018_04 C20140711_OR018_04 TB444103.[MT7]-TVIAQDENLPEDVVR.3b6_1.heavy 614.662 / 772.432 13136.0 34.07379913330078 50 20 10 10 10 7.198570742110184 13.891646492409972 0.0 3 0.9935957271883243 15.413292027601337 13136.0 59.53134821918103 0.0 - - - - - - - 246.5 26 14 ULK4 unc-51-like kinase 4 (C. elegans) 209 27 C20140711_OR018_04 C20140711_OR018_04 TB444103.[MT7]-TVIAQDENLPEDVVR.3y6_1.heavy 614.662 / 714.378 77371.0 34.07379913330078 50 20 10 10 10 7.198570742110184 13.891646492409972 0.0 3 0.9935957271883243 15.413292027601337 77371.0 105.23412055295077 0.0 - - - - - - - 1224.7142857142858 154 7 ULK4 unc-51-like kinase 4 (C. elegans) 211 27 C20140711_OR018_04 C20140711_OR018_04 TB444103.[MT7]-TVIAQDENLPEDVVR.3b4_1.heavy 614.662 / 529.347 19371.0 34.07379913330078 50 20 10 10 10 7.198570742110184 13.891646492409972 0.0 3 0.9935957271883243 15.413292027601337 19371.0 24.277057720081604 0.0 - - - - - - - 1224.5 38 8 ULK4 unc-51-like kinase 4 (C. elegans) 213 27 C20140711_OR018_04 C20140711_OR018_04 TB444103.[MT7]-TVIAQDENLPEDVVR.3y5_1.heavy 614.662 / 617.325 10799.0 34.07379913330078 50 20 10 10 10 7.198570742110184 13.891646492409972 0.0 3 0.9935957271883243 15.413292027601337 10799.0 21.37632215753311 0.0 - - - - - - - 303.72727272727275 21 11 ULK4 unc-51-like kinase 4 (C. elegans) 215 28 C20140711_OR018_04 C20140711_OR018_04 TB422569.[MT7]-LWSLWGEC[CAM]TRDC[CAM]GGGLQTR.3y18_2.heavy 799.383 / 1069.98 7633.0 41.13120142618815 36 11 10 5 10 1.1461240195137736 57.511353455036556 0.042301177978515625 3 0.8605417047545488 3.265568432129145 7633.0 -12.411382113821137 0.0 - - - - - - - 246.0 15 4 BAI1 brain-specific angiogenesis inhibitor 1 217 28 C20140711_OR018_04 C20140711_OR018_04 TB422569.[MT7]-LWSLWGEC[CAM]TRDC[CAM]GGGLQTR.3y17_2.heavy 799.383 / 976.939 2586.0 41.13120142618815 36 11 10 5 10 1.1461240195137736 57.511353455036556 0.042301177978515625 3 0.8605417047545488 3.265568432129145 2586.0 -1.681951219512193 0.0 - - - - - - - 369.0 5 3 BAI1 brain-specific angiogenesis inhibitor 1 219 28 C20140711_OR018_04 C20140711_OR018_04 TB422569.[MT7]-LWSLWGEC[CAM]TRDC[CAM]GGGLQTR.3b3_1.heavy 799.383 / 531.305 2216.0 41.13120142618815 36 11 10 5 10 1.1461240195137736 57.511353455036556 0.042301177978515625 3 0.8605417047545488 3.265568432129145 2216.0 -7.206504065040651 1.0 - - - - - - - 221.4 4 5 BAI1 brain-specific angiogenesis inhibitor 1 221 28 C20140711_OR018_04 C20140711_OR018_04 TB422569.[MT7]-LWSLWGEC[CAM]TRDC[CAM]GGGLQTR.3y8_1.heavy 799.383 / 848.404 N/A 41.13120142618815 36 11 10 5 10 1.1461240195137736 57.511353455036556 0.042301177978515625 3 0.8605417047545488 3.265568432129145 0.0 0.0 23.0 - - - - - - - 246.0 3 3 BAI1 brain-specific angiogenesis inhibitor 1 223 29 C20140711_OR018_04 C20140711_OR018_04 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 25270.0 16.350200653076172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 25270.0 55.88394886736489 0.0 - - - - - - - 274.85714285714283 50 7 225 29 C20140711_OR018_04 C20140711_OR018_04 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 9300.0 16.350200653076172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 9300.0 91.97337662337662 0.0 - - - - - - - 267.3333333333333 18 6 227 29 C20140711_OR018_04 C20140711_OR018_04 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 21293.0 16.350200653076172 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 21293.0 278.2265226628895 0.0 - - - - - - - 205.2 42 5 229 30 C20140711_OR018_04 C20140711_OR018_04 TB443778.[MT7]-SLQHQLPQPGAQR.3y7_1.heavy 535.298 / 753.4 17528.0 23.479774475097656 46 20 10 6 10 6.410078328442183 15.60043339194306 0.03549957275390625 3 0.9941385070289708 16.1118675358716 17528.0 70.54750003124492 0.0 - - - - - - - 313.0 35 6 AHRR aryl-hydrocarbon receptor repressor 231 30 C20140711_OR018_04 C20140711_OR018_04 TB443778.[MT7]-SLQHQLPQPGAQR.3b4_1.heavy 535.298 / 610.343 3666.0 23.479774475097656 46 20 10 6 10 6.410078328442183 15.60043339194306 0.03549957275390625 3 0.9941385070289708 16.1118675358716 3666.0 10.943283582089553 1.0 - - - - - - - 138.77777777777777 7 9 AHRR aryl-hydrocarbon receptor repressor 233 30 C20140711_OR018_04 C20140711_OR018_04 TB443778.[MT7]-SLQHQLPQPGAQR.3b5_1.heavy 535.298 / 738.401 1520.0 23.479774475097656 46 20 10 6 10 6.410078328442183 15.60043339194306 0.03549957275390625 3 0.9941385070289708 16.1118675358716 1520.0 -0.4720496894409938 2.0 - - - - - - - 230.83333333333334 4 12 AHRR aryl-hydrocarbon receptor repressor 235 30 C20140711_OR018_04 C20140711_OR018_04 TB443778.[MT7]-SLQHQLPQPGAQR.3y5_1.heavy 535.298 / 528.289 11178.0 23.479774475097656 46 20 10 6 10 6.410078328442183 15.60043339194306 0.03549957275390625 3 0.9941385070289708 16.1118675358716 11178.0 -0.5580071884984026 2.0 - - - - - - - 148.83333333333334 22 6 AHRR aryl-hydrocarbon receptor repressor 237 31 C20140711_OR018_04 C20140711_OR018_04 TB422468.[MT7]-TGSNSDAFQLGGL.2b8_1.heavy 705.853 / 924.418 11692.0 40.99835014343262 38 13 10 5 10 1.795915594781285 47.49808673348632 0.041500091552734375 3 0.9275581409297131 4.557327994554494 11692.0 87.74465772357725 0.0 - - - - - - - 199.875 23 8 TEX13B testis expressed 13B 239 31 C20140711_OR018_04 C20140711_OR018_04 TB422468.[MT7]-TGSNSDAFQLGGL.2b4_1.heavy 705.853 / 504.253 3815.0 40.99835014343262 38 13 10 5 10 1.795915594781285 47.49808673348632 0.041500091552734375 3 0.9275581409297131 4.557327994554494 3815.0 19.540243902439023 0.0 - - - - - - - 328.0 7 6 TEX13B testis expressed 13B 241 31 C20140711_OR018_04 C20140711_OR018_04 TB422468.[MT7]-TGSNSDAFQLGGL.2b7_1.heavy 705.853 / 777.349 25353.0 40.99835014343262 38 13 10 5 10 1.795915594781285 47.49808673348632 0.041500091552734375 3 0.9275581409297131 4.557327994554494 25353.0 39.077640998966345 0.0 - - - - - - - 276.75 50 8 TEX13B testis expressed 13B 243 31 C20140711_OR018_04 C20140711_OR018_04 TB422468.[MT7]-TGSNSDAFQLGGL.2b9_1.heavy 705.853 / 1052.48 17969.0 40.99835014343262 38 13 10 5 10 1.795915594781285 47.49808673348632 0.041500091552734375 3 0.9275581409297131 4.557327994554494 17969.0 83.90649100407971 0.0 - - - - - - - 218.66666666666666 35 9 TEX13B testis expressed 13B 245 32 C20140711_OR018_04 C20140711_OR018_04 TB444207.[MT7]-AVLAAC[CAM]SEYFWQALVGQTK[MT7].3y7_1.heavy 810.763 / 860.532 2514.0 50.34315013885498 39 13 10 6 10 2.6359310285126853 37.93725970759738 0.038997650146484375 3 0.9203290403201907 4.342960625896135 2514.0 61.67846447669977 0.0 - - - - - - - 184.7 5 10 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 247 32 C20140711_OR018_04 C20140711_OR018_04 TB444207.[MT7]-AVLAAC[CAM]SEYFWQALVGQTK[MT7].3b5_1.heavy 810.763 / 570.373 2360.0 50.34315013885498 39 13 10 6 10 2.6359310285126853 37.93725970759738 0.038997650146484375 3 0.9203290403201907 4.342960625896135 2360.0 51.29988555733577 0.0 - - - - - - - 142.55555555555554 4 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 249 32 C20140711_OR018_04 C20140711_OR018_04 TB444207.[MT7]-AVLAAC[CAM]SEYFWQALVGQTK[MT7].3y4_1.heavy 810.763 / 577.343 9954.0 50.34315013885498 39 13 10 6 10 2.6359310285126853 37.93725970759738 0.038997650146484375 3 0.9203290403201907 4.342960625896135 9954.0 62.37409090909091 0.0 - - - - - - - 188.22222222222223 19 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 251 32 C20140711_OR018_04 C20140711_OR018_04 TB444207.[MT7]-AVLAAC[CAM]SEYFWQALVGQTK[MT7].3b8_1.heavy 810.763 / 946.478 4105.0 50.34315013885498 39 13 10 6 10 2.6359310285126853 37.93725970759738 0.038997650146484375 3 0.9203290403201907 4.342960625896135 4105.0 105.9735484485056 0.0 - - - - - - - 142.55555555555554 8 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 253 33 C20140711_OR018_04 C20140711_OR018_04 TB444000.[MT7]-GGSGDREEEQHR.3y6_1.heavy 500.902 / 827.364 133.0 12.278300285339355 43 15 10 10 8 1.9283722018347444 40.79279284283459 0.0 4 0.955359830573675 5.8192964785986865 133.0 8.917045454545455 0.0 - - - - - - - 0.0 0 0 AHRR aryl-hydrocarbon receptor repressor 255 33 C20140711_OR018_04 C20140711_OR018_04 TB444000.[MT7]-GGSGDREEEQHR.3b5_1.heavy 500.902 / 518.233 622.0 12.278300285339355 43 15 10 10 8 1.9283722018347444 40.79279284283459 0.0 4 0.955359830573675 5.8192964785986865 622.0 33.560149253731346 0.0 - - - - - - - 0.0 1 0 AHRR aryl-hydrocarbon receptor repressor 257 33 C20140711_OR018_04 C20140711_OR018_04 TB444000.[MT7]-GGSGDREEEQHR.3b10_2.heavy 500.902 / 595.264 200.0 12.278300285339355 43 15 10 10 8 1.9283722018347444 40.79279284283459 0.0 4 0.955359830573675 5.8192964785986865 200.0 17.81818181818182 2.0 - - - - - - - 0.0 0 0 AHRR aryl-hydrocarbon receptor repressor 259 33 C20140711_OR018_04 C20140711_OR018_04 TB444000.[MT7]-GGSGDREEEQHR.3y4_1.heavy 500.902 / 569.279 444.0 12.278300285339355 43 15 10 10 8 1.9283722018347444 40.79279284283459 0.0 4 0.955359830573675 5.8192964785986865 444.0 16.85181818181818 0.0 - - - - - - - 0.0 0 0 AHRR aryl-hydrocarbon receptor repressor 261 34 C20140711_OR018_04 C20140711_OR018_04 TB444002.[MT7]-HGNVVAFIIEK[MT7].3b6_1.heavy 505.636 / 722.407 10899.0 36.387699127197266 44 14 10 10 10 1.9470005595658995 40.76811505227228 0.0 3 0.9398990905622826 5.008669227996233 10899.0 64.50428571428571 0.0 - - - - - - - 203.83333333333334 21 6 TEX13B testis expressed 13B 263 34 C20140711_OR018_04 C20140711_OR018_04 TB444002.[MT7]-HGNVVAFIIEK[MT7].3y3_1.heavy 505.636 / 533.341 24737.0 36.387699127197266 44 14 10 10 10 1.9470005595658995 40.76811505227228 0.0 3 0.9398990905622826 5.008669227996233 24737.0 100.36759539565145 0.0 - - - - - - - 275.4166666666667 49 12 TEX13B testis expressed 13B 265 34 C20140711_OR018_04 C20140711_OR018_04 TB444002.[MT7]-HGNVVAFIIEK[MT7].3b4_1.heavy 505.636 / 552.301 13838.0 36.387699127197266 44 14 10 10 10 1.9470005595658995 40.76811505227228 0.0 3 0.9398990905622826 5.008669227996233 13838.0 136.0188825694212 0.0 - - - - - - - 269.2 27 5 TEX13B testis expressed 13B 267 34 C20140711_OR018_04 C20140711_OR018_04 TB444002.[MT7]-HGNVVAFIIEK[MT7].3b5_1.heavy 505.636 / 651.37 7348.0 36.387699127197266 44 14 10 10 10 1.9470005595658995 40.76811505227228 0.0 3 0.9398990905622826 5.008669227996233 7348.0 33.09099319727891 0.0 - - - - - - - 183.5 14 4 TEX13B testis expressed 13B 269 35 C20140711_OR018_04 C20140711_OR018_04 TB444208.[MT7]-DQMLPEPISFEAAAIPVAEK[MT7].3b8_1.heavy 815.438 / 1068.55 1988.0 43.98400020599365 36 14 10 2 10 1.7070543795139979 49.49115206311267 0.08269882202148438 3 0.9306816790128419 4.660120361538155 1988.0 19.915245545771043 1.0 - - - - - - - 221.0 3 6 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 271 35 C20140711_OR018_04 C20140711_OR018_04 TB444208.[MT7]-DQMLPEPISFEAAAIPVAEK[MT7].3y5_1.heavy 815.438 / 687.416 15624.0 43.98400020599365 36 14 10 2 10 1.7070543795139979 49.49115206311267 0.08269882202148438 3 0.9306816790128419 4.660120361538155 15624.0 93.21476160392433 0.0 - - - - - - - 242.0 31 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 273 35 C20140711_OR018_04 C20140711_OR018_04 TB444208.[MT7]-DQMLPEPISFEAAAIPVAEK[MT7].3b4_1.heavy 815.438 / 632.319 9658.0 43.98400020599365 36 14 10 2 10 1.7070543795139979 49.49115206311267 0.08269882202148438 3 0.9306816790128419 4.660120361538155 9658.0 46.04851018630637 0.0 - - - - - - - 201.125 19 8 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 275 35 C20140711_OR018_04 C20140711_OR018_04 TB444208.[MT7]-DQMLPEPISFEAAAIPVAEK[MT7].3b3_1.heavy 815.438 / 519.235 3882.0 43.98400020599365 36 14 10 2 10 1.7070543795139979 49.49115206311267 0.08269882202148438 3 0.9306816790128419 4.660120361538155 3882.0 20.555924309775296 1.0 - - - - - - - 199.77777777777777 7 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 277 36 C20140711_OR018_04 C20140711_OR018_04 TB432238.[MT7]-K[MT7]DILC[CAM]DVTLIVERK[MT7].4y5_1.heavy 534.321 / 788.511 848.0 41.08185005187988 37 12 10 5 10 1.0826266368151882 57.862521344539076 0.042301177978515625 3 0.8820072323222938 3.556877226081564 848.0 3.6442975206611568 0.0 - - - - - - - 0.0 1 0 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 279 36 C20140711_OR018_04 C20140711_OR018_04 TB432238.[MT7]-K[MT7]DILC[CAM]DVTLIVERK[MT7].4y10_2.heavy 534.321 / 688.888 4240.0 41.08185005187988 37 12 10 5 10 1.0826266368151882 57.862521344539076 0.042301177978515625 3 0.8820072323222938 3.556877226081564 4240.0 49.75867768595042 0.0 - - - - - - - 224.85714285714286 8 7 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 281 36 C20140711_OR018_04 C20140711_OR018_04 TB432238.[MT7]-K[MT7]DILC[CAM]DVTLIVERK[MT7].4y7_1.heavy 534.321 / 1002.64 1333.0 41.08185005187988 37 12 10 5 10 1.0826266368151882 57.862521344539076 0.042301177978515625 3 0.8820072323222938 3.556877226081564 1333.0 -1.101652892561983 0.0 - - - - - - - 242.0 2 4 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 283 36 C20140711_OR018_04 C20140711_OR018_04 TB432238.[MT7]-K[MT7]DILC[CAM]DVTLIVERK[MT7].4b6_2.heavy 534.321 / 517.283 4119.0 41.08185005187988 37 12 10 5 10 1.0826266368151882 57.862521344539076 0.042301177978515625 3 0.8820072323222938 3.556877226081564 4119.0 15.53500894606799 0.0 - - - - - - - 333.0833333333333 8 12 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 285 37 C20140711_OR018_04 C20140711_OR018_04 TB422564.[MT7]-ANENSLPSTQLK[MT7].3y6_1.heavy 530.629 / 817.49 7335.0 26.611099243164062 46 16 10 10 10 2.4505793762052694 34.861010791578835 0.0 3 0.9655180874351793 6.626905684420538 7335.0 35.0318725307168 0.0 - - - - - - - 258.1111111111111 14 9 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 287 37 C20140711_OR018_04 C20140711_OR018_04 TB422564.[MT7]-ANENSLPSTQLK[MT7].3b4_1.heavy 530.629 / 573.275 5014.0 26.611099243164062 46 16 10 10 10 2.4505793762052694 34.861010791578835 0.0 3 0.9655180874351793 6.626905684420538 5014.0 31.010216984228105 0.0 - - - - - - - 264.3076923076923 10 13 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 289 37 C20140711_OR018_04 C20140711_OR018_04 TB422564.[MT7]-ANENSLPSTQLK[MT7].3b5_1.heavy 530.629 / 660.307 14207.0 26.611099243164062 46 16 10 10 10 2.4505793762052694 34.861010791578835 0.0 3 0.9655180874351793 6.626905684420538 14207.0 100.64476900259547 0.0 - - - - - - - 285.6923076923077 28 13 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 291 37 C20140711_OR018_04 C20140711_OR018_04 TB422564.[MT7]-ANENSLPSTQLK[MT7].3y5_1.heavy 530.629 / 720.437 2321.0 26.611099243164062 46 16 10 10 10 2.4505793762052694 34.861010791578835 0.0 3 0.9655180874351793 6.626905684420538 2321.0 7.335595468710519 1.0 - - - - - - - 154.88888888888889 6 9 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 293 38 C20140711_OR018_04 C20140711_OR018_04 TB422563.[MT7]-GFWC[CAM]QLLEGGK[MT7].3b5_1.heavy 528.281 / 823.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST1;NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1;N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 295 38 C20140711_OR018_04 C20140711_OR018_04 TB422563.[MT7]-GFWC[CAM]QLLEGGK[MT7].3b3_1.heavy 528.281 / 535.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST1;NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1;N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 297 38 C20140711_OR018_04 C20140711_OR018_04 TB422563.[MT7]-GFWC[CAM]QLLEGGK[MT7].3y4_1.heavy 528.281 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST1;NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1;N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 299 38 C20140711_OR018_04 C20140711_OR018_04 TB422563.[MT7]-GFWC[CAM]QLLEGGK[MT7].3y5_1.heavy 528.281 / 647.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST1;NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1;N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 301 39 C20140711_OR018_04 C20140711_OR018_04 TB422708.[MT7]-LC[CAM]DPSAPLAFLQASK[MT7].3b6_1.heavy 636.016 / 788.373 12712.0 42.54657554626465 40 14 10 6 10 2.007322471815103 49.81760599211343 0.03949737548828125 3 0.9466244200814707 5.317899845710102 12712.0 176.4971900826446 0.0 - - - - - - - 276.57142857142856 25 7 BAI1 brain-specific angiogenesis inhibitor 1 303 39 C20140711_OR018_04 C20140711_OR018_04 TB422708.[MT7]-LC[CAM]DPSAPLAFLQASK[MT7].3b5_1.heavy 636.016 / 717.336 4359.0 42.54657554626465 40 14 10 6 10 2.007322471815103 49.81760599211343 0.03949737548828125 3 0.9466244200814707 5.317899845710102 4359.0 3.0878394332939787 1.0 - - - - - - - 242.0 8 10 BAI1 brain-specific angiogenesis inhibitor 1 305 39 C20140711_OR018_04 C20140711_OR018_04 TB422708.[MT7]-LC[CAM]DPSAPLAFLQASK[MT7].3y4_1.heavy 636.016 / 577.343 10049.0 42.54657554626465 40 14 10 6 10 2.007322471815103 49.81760599211343 0.03949737548828125 3 0.9466244200814707 5.317899845710102 10049.0 20.29305224050345 0.0 - - - - - - - 282.3333333333333 20 12 BAI1 brain-specific angiogenesis inhibitor 1 307 39 C20140711_OR018_04 C20140711_OR018_04 TB422708.[MT7]-LC[CAM]DPSAPLAFLQASK[MT7].3b3_1.heavy 636.016 / 533.251 15134.0 42.54657554626465 40 14 10 6 10 2.007322471815103 49.81760599211343 0.03949737548828125 3 0.9466244200814707 5.317899845710102 15134.0 45.852956251421645 0.0 - - - - - - - 344.38461538461536 30 13 BAI1 brain-specific angiogenesis inhibitor 1 309 40 C20140711_OR018_04 C20140711_OR018_04 TB422557.[MT7]-IGIIDDDIFEEDEHFFVR.3b4_1.heavy 785.054 / 541.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 311 40 C20140711_OR018_04 C20140711_OR018_04 TB422557.[MT7]-IGIIDDDIFEEDEHFFVR.3y4_1.heavy 785.054 / 568.324 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 313 40 C20140711_OR018_04 C20140711_OR018_04 TB422557.[MT7]-IGIIDDDIFEEDEHFFVR.3b7_1.heavy 785.054 / 886.464 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 315 40 C20140711_OR018_04 C20140711_OR018_04 TB422557.[MT7]-IGIIDDDIFEEDEHFFVR.3y9_1.heavy 785.054 / 1207.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 317 41 C20140711_OR018_04 C20140711_OR018_04 TB422558.[MT7]-AEAPHAPAAPSALAR.3y6_1.heavy 525.29 / 614.362 19273.0 24.849899291992188 48 18 10 10 10 4.590398623291788 21.78460046859497 0.0 3 0.9835222258270222 9.60096609851598 19273.0 77.81493662997414 0.0 - - - - - - - 218.66666666666666 38 6 IRX1 iroquois homeobox 1 319 41 C20140711_OR018_04 C20140711_OR018_04 TB422558.[MT7]-AEAPHAPAAPSALAR.3b4_1.heavy 525.29 / 513.279 13942.0 24.849899291992188 48 18 10 10 10 4.590398623291788 21.78460046859497 0.0 3 0.9835222258270222 9.60096609851598 13942.0 80.54905487804879 0.0 - - - - - - - 254.2 27 10 IRX1 iroquois homeobox 1 321 41 C20140711_OR018_04 C20140711_OR018_04 TB422558.[MT7]-AEAPHAPAAPSALAR.3y8_1.heavy 525.29 / 756.436 5823.0 24.849899291992188 48 18 10 10 10 4.590398623291788 21.78460046859497 0.0 3 0.9835222258270222 9.60096609851598 5823.0 14.25777320240735 0.0 - - - - - - - 246.0 11 5 IRX1 iroquois homeobox 1 323 41 C20140711_OR018_04 C20140711_OR018_04 TB422558.[MT7]-AEAPHAPAAPSALAR.3y9_1.heavy 525.29 / 853.489 21488.0 24.849899291992188 48 18 10 10 10 4.590398623291788 21.78460046859497 0.0 3 0.9835222258270222 9.60096609851598 21488.0 381.9360975609756 0.0 - - - - - - - 232.33333333333334 42 6 IRX1 iroquois homeobox 1 325 42 C20140711_OR018_04 C20140711_OR018_04 TB431981.[MT7]-ADTAATADAK[MT7].2y5_1.heavy 611.83 / 649.364 1495.0 17.017799854278564 38 20 4 6 8 14.692561668779318 6.806165068715901 0.03840065002441406 4 0.9941710869258351 16.156876270805636 1495.0 14.399642857142858 0.0 - - - - - - - 166.11111111111111 2 9 AHRR aryl-hydrocarbon receptor repressor 327 42 C20140711_OR018_04 C20140711_OR018_04 TB431981.[MT7]-ADTAATADAK[MT7].2b4_1.heavy 611.83 / 503.258 1690.0 17.017799854278564 38 20 4 6 8 14.692561668779318 6.806165068715901 0.03840065002441406 4 0.9941710869258351 16.156876270805636 1690.0 17.745 0.0 - - - - - - - 158.88888888888889 3 9 AHRR aryl-hydrocarbon receptor repressor 329 42 C20140711_OR018_04 C20140711_OR018_04 TB431981.[MT7]-ADTAATADAK[MT7].2y6_1.heavy 611.83 / 720.401 975.0 17.017799854278564 38 20 4 6 8 14.692561668779318 6.806165068715901 0.03840065002441406 4 0.9941710869258351 16.156876270805636 975.0 10.5 0.0 - - - - - - - 0.0 1 0 AHRR aryl-hydrocarbon receptor repressor 331 42 C20140711_OR018_04 C20140711_OR018_04 TB431981.[MT7]-ADTAATADAK[MT7].2b5_1.heavy 611.83 / 574.295 1690.0 17.017799854278564 38 20 4 6 8 14.692561668779318 6.806165068715901 0.03840065002441406 4 0.9941710869258351 16.156876270805636 1690.0 10.530000000000001 1.0 - - - - - - - 165.45454545454547 6 11 AHRR aryl-hydrocarbon receptor repressor 333 43 C20140711_OR018_04 C20140711_OR018_04 TB432109.[MT7]-LEDEAAAQALIGGR.2b3_1.heavy 779.421 / 502.263 4345.0 36.39879894256592 38 13 10 5 10 2.1047469087400383 47.5116507285253 0.044399261474609375 3 0.9044845740161855 3.961016165182009 4345.0 54.34014664889104 0.0 - - - - - - - 178.1 8 10 PDIA2 protein disulfide isomerase family A, member 2 335 43 C20140711_OR018_04 C20140711_OR018_04 TB432109.[MT7]-LEDEAAAQALIGGR.2y12_1.heavy 779.421 / 1171.61 1114.0 36.39879894256592 38 13 10 5 10 2.1047469087400383 47.5116507285253 0.044399261474609375 3 0.9044845740161855 3.961016165182009 1114.0 4.396412556053812 0.0 - - - - - - - 189.3 2 10 PDIA2 protein disulfide isomerase family A, member 2 337 43 C20140711_OR018_04 C20140711_OR018_04 TB432109.[MT7]-LEDEAAAQALIGGR.2y10_1.heavy 779.421 / 927.537 1114.0 36.39879894256592 38 13 10 5 10 2.1047469087400383 47.5116507285253 0.044399261474609375 3 0.9044845740161855 3.961016165182009 1114.0 11.85714903244051 1.0 - - - - - - - 238.57142857142858 2 7 PDIA2 protein disulfide isomerase family A, member 2 339 43 C20140711_OR018_04 C20140711_OR018_04 TB432109.[MT7]-LEDEAAAQALIGGR.2b5_1.heavy 779.421 / 702.343 1226.0 36.39879894256592 38 13 10 5 10 2.1047469087400383 47.5116507285253 0.044399261474609375 3 0.9044845740161855 3.961016165182009 1226.0 9.003483794742355 0.0 - - - - - - - 151.72727272727272 2 11 PDIA2 protein disulfide isomerase family A, member 2 341 44 C20140711_OR018_04 C20140711_OR018_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 147027.0 19.25429916381836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 147027.0 766.6353073999553 0.0 - - - - - - - 212.84615384615384 294 13 343 44 C20140711_OR018_04 C20140711_OR018_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 91165.0 19.25429916381836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 91165.0 649.5515317896077 0.0 - - - - - - - 245.46153846153845 182 13 345 44 C20140711_OR018_04 C20140711_OR018_04 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 94923.0 19.25429916381836 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 94923.0 1473.3748304888154 0.0 - - - - - - - 189.13333333333333 189 15 347 45 C20140711_OR018_04 C20140711_OR018_04 TB432104.[MT7]-SGIIIGAEGDPPK[MT7].2b8_1.heavy 771.443 / 885.516 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 349 45 C20140711_OR018_04 C20140711_OR018_04 TB432104.[MT7]-SGIIIGAEGDPPK[MT7].2y8_1.heavy 771.443 / 914.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 351 45 C20140711_OR018_04 C20140711_OR018_04 TB432104.[MT7]-SGIIIGAEGDPPK[MT7].2b4_1.heavy 771.443 / 515.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 353 45 C20140711_OR018_04 C20140711_OR018_04 TB432104.[MT7]-SGIIIGAEGDPPK[MT7].2b10_1.heavy 771.443 / 1057.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 355 46 C20140711_OR018_04 C20140711_OR018_04 TB431989.[MT7]-QRPAVGAEK[MT7].2b8_1.heavy 622.372 / 953.529 775.0 16.784900665283203 48 18 10 10 10 4.511298234159533 22.166568204868476 0.0 3 0.9845154634159361 9.904926603956847 775.0 17.81067382230173 0.0 - - - - - - - 0.0 1 0 AHRR aryl-hydrocarbon receptor repressor 357 46 C20140711_OR018_04 C20140711_OR018_04 TB431989.[MT7]-QRPAVGAEK[MT7].2y4_1.heavy 622.372 / 548.316 323.0 16.784900665283203 48 18 10 10 10 4.511298234159533 22.166568204868476 0.0 3 0.9845154634159361 9.904926603956847 323.0 2.3286046511627907 8.0 - - - - - - - 0.0 0 0 AHRR aryl-hydrocarbon receptor repressor 359 46 C20140711_OR018_04 C20140711_OR018_04 TB431989.[MT7]-QRPAVGAEK[MT7].2y8_1.heavy 622.372 / 971.575 1033.0 16.784900665283203 48 18 10 10 10 4.511298234159533 22.166568204868476 0.0 3 0.9845154634159361 9.904926603956847 1033.0 30.672153846153847 0.0 - - - - - - - 147.57142857142858 2 7 AHRR aryl-hydrocarbon receptor repressor 361 46 C20140711_OR018_04 C20140711_OR018_04 TB431989.[MT7]-QRPAVGAEK[MT7].2y7_1.heavy 622.372 / 815.474 904.0 16.784900665283203 48 18 10 10 10 4.511298234159533 22.166568204868476 0.0 3 0.9845154634159361 9.904926603956847 904.0 17.411568276684555 0.0 - - - - - - - 0.0 1 0 AHRR aryl-hydrocarbon receptor repressor 363 47 C20140711_OR018_04 C20140711_OR018_04 TB432103.[MT7]-LPLSLSFLHLTR.3y7_1.heavy 514.316 / 873.494 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 365 47 C20140711_OR018_04 C20140711_OR018_04 TB432103.[MT7]-LPLSLSFLHLTR.3b4_1.heavy 514.316 / 555.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 367 47 C20140711_OR018_04 C20140711_OR018_04 TB432103.[MT7]-LPLSLSFLHLTR.3y4_1.heavy 514.316 / 526.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 369 47 C20140711_OR018_04 C20140711_OR018_04 TB432103.[MT7]-LPLSLSFLHLTR.3y5_1.heavy 514.316 / 639.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 371 48 C20140711_OR018_04 C20140711_OR018_04 TB422591.[MT7]-EMAPAWEALAEK[MT7].3b6_1.heavy 545.288 / 830.399 5911.0 39.174400329589844 35 13 4 10 8 2.034655217684437 49.14837616262384 0.0 4 0.9157618131784928 4.221929490287295 5911.0 -0.3708862745098038 0.0 - - - - - - - 174.0 11 6 PDIA2 protein disulfide isomerase family A, member 2 373 48 C20140711_OR018_04 C20140711_OR018_04 TB422591.[MT7]-EMAPAWEALAEK[MT7].3b5_1.heavy 545.288 / 644.319 13793.0 39.174400329589844 35 13 4 10 8 2.034655217684437 49.14837616262384 0.0 4 0.9157618131784928 4.221929490287295 13793.0 64.60514367816091 0.0 - - - - - - - 322.22222222222223 27 9 PDIA2 protein disulfide isomerase family A, member 2 375 48 C20140711_OR018_04 C20140711_OR018_04 TB422591.[MT7]-EMAPAWEALAEK[MT7].3y4_1.heavy 545.288 / 604.379 11822.0 39.174400329589844 35 13 4 10 8 2.034655217684437 49.14837616262384 0.0 4 0.9157618131784928 4.221929490287295 11822.0 47.24303084429009 1.0 - - - - - - - 348.0 54 11 PDIA2 protein disulfide isomerase family A, member 2 377 48 C20140711_OR018_04 C20140711_OR018_04 TB422591.[MT7]-EMAPAWEALAEK[MT7].3y5_1.heavy 545.288 / 675.416 6375.0 39.174400329589844 35 13 4 10 8 2.034655217684437 49.14837616262384 0.0 4 0.9157618131784928 4.221929490287295 6375.0 -0.376133720421757 2.0 - - - - - - - 248.57142857142858 13 7 PDIA2 protein disulfide isomerase family A, member 2 379 49 C20140711_OR018_04 C20140711_OR018_04 TB431984.[MT7]-LDAVYLNK[MT7].3y3_1.heavy 408.579 / 518.342 9853.0 32.66569900512695 31 13 6 6 6 1.5773206768792694 51.415767716363916 0.037200927734375 5 0.9078604096414935 4.034101151359294 9853.0 100.57207253886011 2.0 - - - - - - - 386.25 52 4 TSHR thyroid stimulating hormone receptor 381 49 C20140711_OR018_04 C20140711_OR018_04 TB431984.[MT7]-LDAVYLNK[MT7].3b4_1.heavy 408.579 / 543.326 16519.0 32.66569900512695 31 13 6 6 6 1.5773206768792694 51.415767716363916 0.037200927734375 5 0.9078604096414935 4.034101151359294 16519.0 125.39033678756476 0.0 - - - - - - - 212.6 33 10 TSHR thyroid stimulating hormone receptor 383 49 C20140711_OR018_04 C20140711_OR018_04 TB431984.[MT7]-LDAVYLNK[MT7].3b5_1.heavy 408.579 / 706.389 1739.0 32.66569900512695 31 13 6 6 6 1.5773206768792694 51.415767716363916 0.037200927734375 5 0.9078604096414935 4.034101151359294 1739.0 21.55083686768869 2.0 - - - - - - - 116.2 10 5 TSHR thyroid stimulating hormone receptor 385 49 C20140711_OR018_04 C20140711_OR018_04 TB431984.[MT7]-LDAVYLNK[MT7].3b3_1.heavy 408.579 / 444.258 10916.0 32.66569900512695 31 13 6 6 6 1.5773206768792694 51.415767716363916 0.037200927734375 5 0.9078604096414935 4.034101151359294 10916.0 124.41251972982579 0.0 - - - - - - - 157.125 21 8 TSHR thyroid stimulating hormone receptor 387 50 C20140711_OR018_04 C20140711_OR018_04 TB422553.[MT7]-EAC[CAM]TWGSLALGVR.3b4_1.heavy 521.94 / 606.267 4368.0 39.246225357055664 28 3 10 5 10 1.3976071835239967 71.55086291689986 0.04109954833984375 3 0.5738422481526559 1.8187967163496936 4368.0 52.471525423728814 0.0 - - - - - - - 262.22222222222223 8 9 TEX13B;TEX13A testis expressed 13B;testis expressed 13A 389 50 C20140711_OR018_04 C20140711_OR018_04 TB422553.[MT7]-EAC[CAM]TWGSLALGVR.3b3_1.heavy 521.94 / 505.22 122199.0 39.246225357055664 28 3 10 5 10 1.3976071835239967 71.55086291689986 0.04109954833984375 3 0.5738422481526559 1.8187967163496936 122199.0 287.11101074961425 0.0 - - - - - - - 236.0 244 3 TEX13B;TEX13A testis expressed 13B;testis expressed 13A 391 50 C20140711_OR018_04 C20140711_OR018_04 TB422553.[MT7]-EAC[CAM]TWGSLALGVR.3y8_1.heavy 521.94 / 772.468 6494.0 39.246225357055664 28 3 10 5 10 1.3976071835239967 71.55086291689986 0.04109954833984375 3 0.5738422481526559 1.8187967163496936 6494.0 71.58075706214689 0.0 - - - - - - - 212.4 12 5 TEX13B;TEX13A testis expressed 13B;testis expressed 13A 393 50 C20140711_OR018_04 C20140711_OR018_04 TB422553.[MT7]-EAC[CAM]TWGSLALGVR.3y5_1.heavy 521.94 / 515.33 3188.0 39.246225357055664 28 3 10 5 10 1.3976071835239967 71.55086291689986 0.04109954833984375 3 0.5738422481526559 1.8187967163496936 3188.0 3.919947978684773 0.0 - - - - - - - 185.42857142857142 6 7 TEX13B;TEX13A testis expressed 13B;testis expressed 13A 395 51 C20140711_OR018_04 C20140711_OR018_04 TB422849.[MT7]-ELIYTDSDLVVTPIIDNPK[MT7].4b8_1.heavy 609.09 / 1081.52 2298.0 42.94839859008789 47 17 10 10 10 2.0361838207455536 38.227340173541066 0.0 3 0.977851966810284 8.27732386630962 2298.0 21.27074380165289 0.0 - - - - - - - 322.6666666666667 4 3 ULK4 unc-51-like kinase 4 (C. elegans) 397 51 C20140711_OR018_04 C20140711_OR018_04 TB422849.[MT7]-ELIYTDSDLVVTPIIDNPK[MT7].4b4_1.heavy 609.09 / 663.383 1814.0 42.94839859008789 47 17 10 10 10 2.0361838207455536 38.227340173541066 0.0 3 0.977851966810284 8.27732386630962 1814.0 12.892892561983473 1.0 - - - - - - - 252.08333333333334 3 12 ULK4 unc-51-like kinase 4 (C. elegans) 399 51 C20140711_OR018_04 C20140711_OR018_04 TB422849.[MT7]-ELIYTDSDLVVTPIIDNPK[MT7].4y3_1.heavy 609.09 / 502.311 3749.0 42.94839859008789 47 17 10 10 10 2.0361838207455536 38.227340173541066 0.0 3 0.977851966810284 8.27732386630962 3749.0 9.54290909090909 1.0 - - - - - - - 760.1428571428571 7 7 ULK4 unc-51-like kinase 4 (C. elegans) 401 51 C20140711_OR018_04 C20140711_OR018_04 TB422849.[MT7]-ELIYTDSDLVVTPIIDNPK[MT7].4b3_1.heavy 609.09 / 500.32 6409.0 42.94839859008789 47 17 10 10 10 2.0361838207455536 38.227340173541066 0.0 3 0.977851966810284 8.27732386630962 6409.0 14.175093028622218 0.0 - - - - - - - 286.0 12 11 ULK4 unc-51-like kinase 4 (C. elegans) 403 52 C20140711_OR018_04 C20140711_OR018_04 TB422552.[MT7]-APQTPYDK[MT7]PTR.3y7_1.heavy 521.291 / 1020.56 345.0 20.541900157928467 33 7 10 6 10 1.3907520589569042 47.055819149527785 0.03280067443847656 3 0.7447615241018127 2.3888366649439345 345.0 4.35 3.0 - - - - - - - 0.0 0 0 MMP25 matrix metallopeptidase 25 405 52 C20140711_OR018_04 C20140711_OR018_04 TB422552.[MT7]-APQTPYDK[MT7]PTR.3y10_2.heavy 521.291 / 673.863 1518.0 20.541900157928467 33 7 10 6 10 1.3907520589569042 47.055819149527785 0.03280067443847656 3 0.7447615241018127 2.3888366649439345 1518.0 10.120000000000001 0.0 - - - - - - - 103.5 3 8 MMP25 matrix metallopeptidase 25 407 52 C20140711_OR018_04 C20140711_OR018_04 TB422552.[MT7]-APQTPYDK[MT7]PTR.3y7_2.heavy 521.291 / 510.783 621.0 20.541900157928467 33 7 10 6 10 1.3907520589569042 47.055819149527785 0.03280067443847656 3 0.7447615241018127 2.3888366649439345 621.0 6.171428571428571 3.0 - - - - - - - 0.0 1 0 MMP25 matrix metallopeptidase 25 409 52 C20140711_OR018_04 C20140711_OR018_04 TB422552.[MT7]-APQTPYDK[MT7]PTR.3y4_1.heavy 521.291 / 645.416 1242.0 20.541900157928467 33 7 10 6 10 1.3907520589569042 47.055819149527785 0.03280067443847656 3 0.7447615241018127 2.3888366649439345 1242.0 16.56 0.0 - - - - - - - 181.125 2 8 MMP25 matrix metallopeptidase 25 411 53 C20140711_OR018_04 C20140711_OR018_04 TB422848.[MT7]-ELIYTDSDLVVTPIIDNPK[MT7].3y7_1.heavy 811.784 / 940.558 8225.0 42.94839859008789 42 12 10 10 10 0.8916889203880918 74.1121774645281 0.0 3 0.8974370018470913 3.820175370836171 8225.0 83.74545454545454 0.0 - - - - - - - 328.42857142857144 16 7 ULK4 unc-51-like kinase 4 (C. elegans) 413 53 C20140711_OR018_04 C20140711_OR018_04 TB422848.[MT7]-ELIYTDSDLVVTPIIDNPK[MT7].3b4_1.heavy 811.784 / 663.383 3871.0 42.94839859008789 42 12 10 10 10 0.8916889203880918 74.1121774645281 0.0 3 0.8974370018470913 3.820175370836171 3871.0 28.152727272727272 0.0 - - - - - - - 242.0 7 7 ULK4 unc-51-like kinase 4 (C. elegans) 415 53 C20140711_OR018_04 C20140711_OR018_04 TB422848.[MT7]-ELIYTDSDLVVTPIIDNPK[MT7].3b3_1.heavy 811.784 / 500.32 4596.0 42.94839859008789 42 12 10 10 10 0.8916889203880918 74.1121774645281 0.0 3 0.8974370018470913 3.820175370836171 4596.0 45.07371900826446 0.0 - - - - - - - 242.0 9 9 ULK4 unc-51-like kinase 4 (C. elegans) 417 53 C20140711_OR018_04 C20140711_OR018_04 TB422848.[MT7]-ELIYTDSDLVVTPIIDNPK[MT7].3b8_1.heavy 811.784 / 1081.52 8588.0 42.94839859008789 42 12 10 10 10 0.8916889203880918 74.1121774645281 0.0 3 0.8974370018470913 3.820175370836171 8588.0 32.4540763550256 1.0 - - - - - - - 224.71428571428572 17 7 ULK4 unc-51-like kinase 4 (C. elegans) 419 54 C20140711_OR018_04 C20140711_OR018_04 TB432247.[MT7]-ITYEELPAIITIEDAIK[MT7].2b4_1.heavy 1110.63 / 651.347 1528.0 51.787601470947266 42 16 10 10 6 5.103945097243404 19.592687243835975 0.0 5 0.9657199271445576 6.646499752467043 1528.0 3.6513001902215825 0.0 - - - - - - - 244.57142857142858 3 7 XDH xanthine dehydrogenase 421 54 C20140711_OR018_04 C20140711_OR018_04 TB432247.[MT7]-ITYEELPAIITIEDAIK[MT7].2y3_1.heavy 1110.63 / 475.336 428.0 51.787601470947266 42 16 10 10 6 5.103945097243404 19.592687243835975 0.0 5 0.9657199271445576 6.646499752467043 428.0 1.5433768881972578 10.0 - - - - - - - 0.0 1 0 XDH xanthine dehydrogenase 423 54 C20140711_OR018_04 C20140711_OR018_04 TB432247.[MT7]-ITYEELPAIITIEDAIK[MT7].2b6_1.heavy 1110.63 / 893.474 1162.0 51.787601470947266 42 16 10 10 6 5.103945097243404 19.592687243835975 0.0 5 0.9657199271445576 6.646499752467043 1162.0 -0.5068702290076336 2.0 - - - - - - - 128.2 3 10 XDH xanthine dehydrogenase 425 54 C20140711_OR018_04 C20140711_OR018_04 TB432247.[MT7]-ITYEELPAIITIEDAIK[MT7].2b5_1.heavy 1110.63 / 780.39 1590.0 51.787601470947266 42 16 10 10 6 5.103945097243404 19.592687243835975 0.0 5 0.9657199271445576 6.646499752467043 1590.0 0.07321538900486269 2.0 - - - - - - - 161.0909090909091 4 11 XDH xanthine dehydrogenase 427 55 C20140711_OR018_04 C20140711_OR018_04 TB422846.[MT7]-FY[MT7]HTGTEEEDEGDDLLLR.4y5_1.heavy 607.544 / 629.398 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 429 55 C20140711_OR018_04 C20140711_OR018_04 TB422846.[MT7]-FY[MT7]HTGTEEEDEGDDLLLR.4y4_1.heavy 607.544 / 514.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 431 55 C20140711_OR018_04 C20140711_OR018_04 TB422846.[MT7]-FY[MT7]HTGTEEEDEGDDLLLR.4y7_1.heavy 607.544 / 801.446 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 433 55 C20140711_OR018_04 C20140711_OR018_04 TB422846.[MT7]-FY[MT7]HTGTEEEDEGDDLLLR.4y6_1.heavy 607.544 / 744.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 435 56 C20140711_OR018_04 C20140711_OR018_04 TB422844.[MT7]-ASSDFINLLDGLLQRDPQK[MT7].3y3_1.heavy 806.779 / 516.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 437 56 C20140711_OR018_04 C20140711_OR018_04 TB422844.[MT7]-ASSDFINLLDGLLQRDPQK[MT7].3b4_1.heavy 806.779 / 505.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 439 56 C20140711_OR018_04 C20140711_OR018_04 TB422844.[MT7]-ASSDFINLLDGLLQRDPQK[MT7].3b5_1.heavy 806.779 / 652.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 441 56 C20140711_OR018_04 C20140711_OR018_04 TB422844.[MT7]-ASSDFINLLDGLLQRDPQK[MT7].3y9_1.heavy 806.779 / 1198.7 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 443 57 C20140711_OR018_04 C20140711_OR018_04 TB422202.[MT7]-SPPLETR.2y5_1.heavy 472.27 / 615.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 445 57 C20140711_OR018_04 C20140711_OR018_04 TB422202.[MT7]-SPPLETR.2b4_1.heavy 472.27 / 539.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 447 57 C20140711_OR018_04 C20140711_OR018_04 TB422202.[MT7]-SPPLETR.2y6_1.heavy 472.27 / 712.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 449 57 C20140711_OR018_04 C20140711_OR018_04 TB422202.[MT7]-SPPLETR.2b5_1.heavy 472.27 / 668.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 451 58 C20140711_OR018_04 C20140711_OR018_04 TB422407.[MT7]-DGLQQLYGK[MT7].3y3_1.heavy 437.25 / 511.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 453 58 C20140711_OR018_04 C20140711_OR018_04 TB422407.[MT7]-DGLQQLYGK[MT7].3b4_1.heavy 437.25 / 558.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 455 58 C20140711_OR018_04 C20140711_OR018_04 TB422407.[MT7]-DGLQQLYGK[MT7].3b5_1.heavy 437.25 / 686.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 457 58 C20140711_OR018_04 C20140711_OR018_04 TB422407.[MT7]-DGLQQLYGK[MT7].3y4_1.heavy 437.25 / 624.384 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 459 59 C20140711_OR018_04 C20140711_OR018_04 TB422717.[MT7]-IWSLAETATSPDGAPK[MT7].3b6_1.heavy 644.682 / 844.469 15803.0 38.172401428222656 43 13 10 10 10 2.1589145729398016 36.94511790900288 0.0 3 0.9254917299848338 4.49289196667829 15803.0 59.86490695014466 0.0 - - - - - - - 222.6 31 10 IRX1 iroquois homeobox 1 461 59 C20140711_OR018_04 C20140711_OR018_04 TB422717.[MT7]-IWSLAETATSPDGAPK[MT7].3y6_1.heavy 644.682 / 728.406 31161.0 38.172401428222656 43 13 10 10 10 2.1589145729398016 36.94511790900288 0.0 3 0.9254917299848338 4.49289196667829 31161.0 80.8693109160994 0.0 - - - - - - - 244.8 62 5 IRX1 iroquois homeobox 1 463 59 C20140711_OR018_04 C20140711_OR018_04 TB422717.[MT7]-IWSLAETATSPDGAPK[MT7].3b5_1.heavy 644.682 / 715.426 17361.0 38.172401428222656 43 13 10 10 10 2.1589145729398016 36.94511790900288 0.0 3 0.9254917299848338 4.49289196667829 17361.0 63.99073066804396 0.0 - - - - - - - 306.125 34 8 IRX1 iroquois homeobox 1 465 59 C20140711_OR018_04 C20140711_OR018_04 TB422717.[MT7]-IWSLAETATSPDGAPK[MT7].3b3_1.heavy 644.682 / 531.305 9014.0 38.172401428222656 43 13 10 10 10 2.1589145729398016 36.94511790900288 0.0 3 0.9254917299848338 4.49289196667829 9014.0 3.874777682841154 3.0 - - - - - - - 779.0 20 7 IRX1 iroquois homeobox 1 467 60 C20140711_OR018_04 C20140711_OR018_04 TB432119.[MT7]-GFWC[CAM]QLLEGGK[MT7].2y4_1.heavy 791.918 / 534.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST1;NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1;N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 469 60 C20140711_OR018_04 C20140711_OR018_04 TB432119.[MT7]-GFWC[CAM]QLLEGGK[MT7].2b3_1.heavy 791.918 / 535.279 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST1;NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1;N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 471 60 C20140711_OR018_04 C20140711_OR018_04 TB432119.[MT7]-GFWC[CAM]QLLEGGK[MT7].2y6_1.heavy 791.918 / 760.469 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST1;NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1;N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 473 60 C20140711_OR018_04 C20140711_OR018_04 TB432119.[MT7]-GFWC[CAM]QLLEGGK[MT7].2b5_1.heavy 791.918 / 823.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST1;NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1;N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 475 61 C20140711_OR018_04 C20140711_OR018_04 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 105486.0 38.172401428222656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 105486.0 986.9853010625737 0.0 - - - - - - - 290.4 210 5 477 61 C20140711_OR018_04 C20140711_OR018_04 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 80808.0 38.172401428222656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 80808.0 996.743305785124 0.0 - - - - - - - 201.66666666666666 161 9 479 61 C20140711_OR018_04 C20140711_OR018_04 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 118067.0 38.172401428222656 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 118067.0 427.70827823691457 0.0 - - - - - - - 259.2857142857143 236 7 481 62 C20140711_OR018_04 C20140711_OR018_04 TB422403.[MT7]-FYLTVLQK[MT7].2b3_1.heavy 650.399 / 568.325 986.0 40.41460037231445 29 13 0 10 6 1.1319698538823306 50.889789961966436 0.0 5 0.9081002432522909 4.039445244105046 986.0 1.3603896103896103 15.0 - - - - - - - 235.45454545454547 2 11 XDH xanthine dehydrogenase 483 62 C20140711_OR018_04 C20140711_OR018_04 TB422403.[MT7]-FYLTVLQK[MT7].2y5_1.heavy 650.399 / 732.474 2342.0 40.41460037231445 29 13 0 10 6 1.1319698538823306 50.889789961966436 0.0 5 0.9081002432522909 4.039445244105046 2342.0 26.607034857312136 1.0 - - - - - - - 328.77777777777777 34 9 XDH xanthine dehydrogenase 485 62 C20140711_OR018_04 C20140711_OR018_04 TB422403.[MT7]-FYLTVLQK[MT7].2y3_1.heavy 650.399 / 532.357 2342.0 40.41460037231445 29 13 0 10 6 1.1319698538823306 50.889789961966436 0.0 5 0.9081002432522909 4.039445244105046 2342.0 1.1139667116824805 1.0 - - - - - - - 295.8 6 10 XDH xanthine dehydrogenase 487 62 C20140711_OR018_04 C20140711_OR018_04 TB422403.[MT7]-FYLTVLQK[MT7].2y7_1.heavy 650.399 / 1008.62 2835.0 40.41460037231445 29 13 0 10 6 1.1319698538823306 50.889789961966436 0.0 5 0.9081002432522909 4.039445244105046 2835.0 7.013209665040293 1.0 - - - - - - - 257.72727272727275 9 11 XDH xanthine dehydrogenase 489 63 C20140711_OR018_04 C20140711_OR018_04 TB443852.[MT7]-MDPGTVATMR.2y8_1.heavy 611.806 / 832.435 63905.0 28.308799743652344 46 20 10 6 10 5.22624208510093 19.134207404031645 0.036998748779296875 3 0.99878342551314 35.379279022537084 63905.0 216.13307953082793 0.0 - - - - - - - 291.8888888888889 127 9 MMP25 matrix metallopeptidase 25 491 63 C20140711_OR018_04 C20140711_OR018_04 TB443852.[MT7]-MDPGTVATMR.2y9_1.heavy 611.806 / 947.461 8462.0 28.308799743652344 46 20 10 6 10 5.22624208510093 19.134207404031645 0.036998748779296875 3 0.99878342551314 35.379279022537084 8462.0 59.28587304726122 0.0 - - - - - - - 194.66666666666666 16 9 MMP25 matrix metallopeptidase 25 493 63 C20140711_OR018_04 C20140711_OR018_04 TB443852.[MT7]-MDPGTVATMR.2b5_1.heavy 611.806 / 646.299 1070.0 28.308799743652344 46 20 10 6 10 5.22624208510093 19.134207404031645 0.036998748779296875 3 0.99878342551314 35.379279022537084 1070.0 1.4140969162995596 3.0 - - - - - - - 173.78571428571428 2 14 MMP25 matrix metallopeptidase 25 495 63 C20140711_OR018_04 C20140711_OR018_04 TB443852.[MT7]-MDPGTVATMR.2y7_1.heavy 611.806 / 735.382 1945.0 28.308799743652344 46 20 10 6 10 5.22624208510093 19.134207404031645 0.036998748779296875 3 0.99878342551314 35.379279022537084 1945.0 5.033241946538725 1.0 - - - - - - - 291.7 3 10 MMP25 matrix metallopeptidase 25 497 64 C20140711_OR018_04 C20140711_OR018_04 TB422612.[MT7]-ILC[CAM]EDPLPPIPK[MT7].4b4_1.heavy 420.747 / 660.351 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 499 64 C20140711_OR018_04 C20140711_OR018_04 TB422612.[MT7]-ILC[CAM]EDPLPPIPK[MT7].4b5_1.heavy 420.747 / 775.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 501 64 C20140711_OR018_04 C20140711_OR018_04 TB422612.[MT7]-ILC[CAM]EDPLPPIPK[MT7].4b6_1.heavy 420.747 / 872.43 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 503 64 C20140711_OR018_04 C20140711_OR018_04 TB422612.[MT7]-ILC[CAM]EDPLPPIPK[MT7].4b3_1.heavy 420.747 / 531.308 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 505 65 C20140711_OR018_04 C20140711_OR018_04 TB443853.[MT7]-ADTAATADAK[MT7].3y3_1.heavy 408.222 / 477.279 3768.0 17.046600341796875 47 17 10 10 10 3.776766854178498 20.9066470351937 0.0 3 0.9774764677855746 8.207777584677755 3768.0 56.7148869513817 0.0 - - - - - - - 134.57142857142858 7 7 AHRR aryl-hydrocarbon receptor repressor 507 65 C20140711_OR018_04 C20140711_OR018_04 TB443853.[MT7]-ADTAATADAK[MT7].3b4_1.heavy 408.222 / 503.258 2893.0 17.046600341796875 47 17 10 10 10 3.776766854178498 20.9066470351937 0.0 3 0.9774764677855746 8.207777584677755 2893.0 49.512039800995026 0.0 - - - - - - - 195.2 5 10 AHRR aryl-hydrocarbon receptor repressor 509 65 C20140711_OR018_04 C20140711_OR018_04 TB443853.[MT7]-ADTAATADAK[MT7].3b5_1.heavy 408.222 / 574.295 1817.0 17.046600341796875 47 17 10 10 10 3.776766854178498 20.9066470351937 0.0 3 0.9774764677855746 8.207777584677755 1817.0 26.582037037037036 0.0 - - - - - - - 118.0 3 4 AHRR aryl-hydrocarbon receptor repressor 511 65 C20140711_OR018_04 C20140711_OR018_04 TB443853.[MT7]-ADTAATADAK[MT7].3y4_1.heavy 408.222 / 548.316 1548.0 17.046600341796875 47 17 10 10 10 3.776766854178498 20.9066470351937 0.0 3 0.9774764677855746 8.207777584677755 1548.0 18.18726072241025 0.0 - - - - - - - 213.0 3 6 AHRR aryl-hydrocarbon receptor repressor 513 66 C20140711_OR018_04 C20140711_OR018_04 TB422613.[MT7]-ILC[CAM]EDPLPPIPK[MT7].3b4_1.heavy 560.66 / 660.351 5071.0 39.32219886779785 35 20 2 5 8 16.037813954775626 6.23526375115623 0.044399261474609375 4 0.9977681065352938 26.11829552241652 5071.0 7.091052716184333 2.0 - - - - - - - 226.25 113 8 ULK4 unc-51-like kinase 4 (C. elegans) 515 66 C20140711_OR018_04 C20140711_OR018_04 TB422613.[MT7]-ILC[CAM]EDPLPPIPK[MT7].3b5_1.heavy 560.66 / 775.378 21492.0 39.32219886779785 35 20 2 5 8 16.037813954775626 6.23526375115623 0.044399261474609375 4 0.9977681065352938 26.11829552241652 21492.0 170.3307883817427 0.0 - - - - - - - 241.25 42 4 ULK4 unc-51-like kinase 4 (C. elegans) 517 66 C20140711_OR018_04 C20140711_OR018_04 TB422613.[MT7]-ILC[CAM]EDPLPPIPK[MT7].3y4_1.heavy 560.66 / 598.404 5071.0 39.32219886779785 35 20 2 5 8 16.037813954775626 6.23526375115623 0.044399261474609375 4 0.9977681065352938 26.11829552241652 5071.0 9.774016563146999 1.0 - - - - - - - 258.57142857142856 10 7 ULK4 unc-51-like kinase 4 (C. elegans) 519 66 C20140711_OR018_04 C20140711_OR018_04 TB422613.[MT7]-ILC[CAM]EDPLPPIPK[MT7].3b3_1.heavy 560.66 / 531.308 5916.0 39.32219886779785 35 20 2 5 8 16.037813954775626 6.23526375115623 0.044399261474609375 4 0.9977681065352938 26.11829552241652 5916.0 17.434569536423844 0.0 - - - - - - - 289.6 11 5 ULK4 unc-51-like kinase 4 (C. elegans) 521 67 C20140711_OR018_04 C20140711_OR018_04 TB432016.[MT7]-YALSGSVWK[MT7].2y8_1.heavy 649.871 / 991.569 4321.0 34.569650650024414 43 17 10 6 10 2.89866208993552 27.36057885993924 0.03820037841796875 3 0.9715666736457955 7.301533663843494 4321.0 11.70911758360302 0.0 - - - - - - - 261.46153846153845 8 13 MMP25 matrix metallopeptidase 25 523 67 C20140711_OR018_04 C20140711_OR018_04 TB432016.[MT7]-YALSGSVWK[MT7].2y5_1.heavy 649.871 / 720.416 1852.0 34.569650650024414 43 17 10 6 10 2.89866208993552 27.36057885993924 0.03820037841796875 3 0.9715666736457955 7.301533663843494 1852.0 16.721941747572817 1.0 - - - - - - - 206.0 3 11 MMP25 matrix metallopeptidase 25 525 67 C20140711_OR018_04 C20140711_OR018_04 TB432016.[MT7]-YALSGSVWK[MT7].2y6_1.heavy 649.871 / 807.448 4218.0 34.569650650024414 43 17 10 6 10 2.89866208993552 27.36057885993924 0.03820037841796875 3 0.9715666736457955 7.301533663843494 4218.0 12.852252836304698 0.0 - - - - - - - 206.0 8 11 MMP25 matrix metallopeptidase 25 527 67 C20140711_OR018_04 C20140711_OR018_04 TB432016.[MT7]-YALSGSVWK[MT7].2y7_1.heavy 649.871 / 920.532 2366.0 34.569650650024414 43 17 10 6 10 2.89866208993552 27.36057885993924 0.03820037841796875 3 0.9715666736457955 7.301533663843494 2366.0 26.195287295530957 0.0 - - - - - - - 167.375 4 8 MMP25 matrix metallopeptidase 25 529 68 C20140711_OR018_04 C20140711_OR018_04 TB432018.[MT7]-DAEGIAEWLR.2b4_1.heavy 652.342 / 517.237 1694.0 41.145301818847656 37 17 2 10 8 3.5319747886600528 28.31277287739011 0.0 4 0.9743827959073155 7.694227139525607 1694.0 6.265000000000001 4.0 - - - - - - - 290.4 5 10 PDIA2 protein disulfide isomerase family A, member 2 531 68 C20140711_OR018_04 C20140711_OR018_04 TB432018.[MT7]-DAEGIAEWLR.2y9_1.heavy 652.342 / 1044.55 2419.0 41.145301818847656 37 17 2 10 8 3.5319747886600528 28.31277287739011 0.0 4 0.9743827959073155 7.694227139525607 2419.0 6.697231404958677 0.0 - - - - - - - 338.8 4 5 PDIA2 protein disulfide isomerase family A, member 2 533 68 C20140711_OR018_04 C20140711_OR018_04 TB432018.[MT7]-DAEGIAEWLR.2b6_1.heavy 652.342 / 701.359 1815.0 41.145301818847656 37 17 2 10 8 3.5319747886600528 28.31277287739011 0.0 4 0.9743827959073155 7.694227139525607 1815.0 9.3 1.0 - - - - - - - 272.25 3 8 PDIA2 protein disulfide isomerase family A, member 2 535 68 C20140711_OR018_04 C20140711_OR018_04 TB432018.[MT7]-DAEGIAEWLR.2y7_1.heavy 652.342 / 844.468 2782.0 41.145301818847656 37 17 2 10 8 3.5319747886600528 28.31277287739011 0.0 4 0.9743827959073155 7.694227139525607 2782.0 25.98066115702479 1.0 - - - - - - - 242.0 12 5 PDIA2 protein disulfide isomerase family A, member 2 537 69 C20140711_OR018_04 C20140711_OR018_04 TB443956.[MT7]-FLGIFNTGLK[MT7].2y4_1.heavy 699.423 / 562.368 2592.0 44.9281005859375 48 18 10 10 10 5.832464958493254 17.145409481522847 0.0 3 0.9838061685930085 9.685002583336383 2592.0 17.376536312849165 0.0 - - - - - - - 242.71428571428572 5 7 TSHR thyroid stimulating hormone receptor 539 69 C20140711_OR018_04 C20140711_OR018_04 TB443956.[MT7]-FLGIFNTGLK[MT7].2y8_1.heavy 699.423 / 993.585 3665.0 44.9281005859375 48 18 10 10 10 5.832464958493254 17.145409481522847 0.0 3 0.9838061685930085 9.685002583336383 3665.0 57.14786579624631 0.0 - - - - - - - 259.2 7 10 TSHR thyroid stimulating hormone receptor 541 69 C20140711_OR018_04 C20140711_OR018_04 TB443956.[MT7]-FLGIFNTGLK[MT7].2y9_1.heavy 699.423 / 1106.67 4112.0 44.9281005859375 48 18 10 10 10 5.832464958493254 17.145409481522847 0.0 3 0.9838061685930085 9.685002583336383 4112.0 32.17117218452002 0.0 - - - - - - - 154.27272727272728 8 11 TSHR thyroid stimulating hormone receptor 543 69 C20140711_OR018_04 C20140711_OR018_04 TB443956.[MT7]-FLGIFNTGLK[MT7].2y6_1.heavy 699.423 / 823.479 4559.0 44.9281005859375 48 18 10 10 10 5.832464958493254 17.145409481522847 0.0 3 0.9838061685930085 9.685002583336383 4559.0 20.041241610738254 0.0 - - - - - - - 279.25 9 8 TSHR thyroid stimulating hormone receptor 545 70 C20140711_OR018_04 C20140711_OR018_04 TB432218.[MT7]-VGDAQGMFEPDGGGRPK[MT7].3y6_1.heavy 669.338 / 715.433 4358.0 28.475299835205078 44 14 10 10 10 2.062595340297555 38.24277755167657 0.0 3 0.9435052748021304 5.167640514748192 4358.0 12.605785123966943 0.0 - - - - - - - 274.5 8 12 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 547 70 C20140711_OR018_04 C20140711_OR018_04 TB432218.[MT7]-VGDAQGMFEPDGGGRPK[MT7].3b6_1.heavy 669.338 / 672.343 6682.0 28.475299835205078 44 14 10 10 10 2.062595340297555 38.24277755167657 0.0 3 0.9435052748021304 5.167640514748192 6682.0 10.35077452667814 1.0 - - - - - - - 276.7142857142857 13 7 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 549 70 C20140711_OR018_04 C20140711_OR018_04 TB432218.[MT7]-VGDAQGMFEPDGGGRPK[MT7].3y8_1.heavy 669.338 / 927.513 12589.0 28.475299835205078 44 14 10 10 10 2.062595340297555 38.24277755167657 0.0 3 0.9435052748021304 5.167640514748192 12589.0 140.19969249605194 0.0 - - - - - - - 218.08333333333334 25 12 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 551 70 C20140711_OR018_04 C20140711_OR018_04 TB432218.[MT7]-VGDAQGMFEPDGGGRPK[MT7].3b7_1.heavy 669.338 / 803.384 4939.0 28.475299835205078 44 14 10 10 10 2.062595340297555 38.24277755167657 0.0 3 0.9435052748021304 5.167640514748192 4939.0 20.670137420718817 0.0 - - - - - - - 274.5833333333333 9 12 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 553 71 C20140711_OR018_04 C20140711_OR018_04 TB432012.[MT7]-TRLHPVQER.2y5_1.heavy 640.371 / 628.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 555 71 C20140711_OR018_04 C20140711_OR018_04 TB432012.[MT7]-TRLHPVQER.2b4_1.heavy 640.371 / 652.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 557 71 C20140711_OR018_04 C20140711_OR018_04 TB432012.[MT7]-TRLHPVQER.2y6_1.heavy 640.371 / 765.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 559 71 C20140711_OR018_04 C20140711_OR018_04 TB432012.[MT7]-TRLHPVQER.2y7_1.heavy 640.371 / 878.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 561 72 C20140711_OR018_04 C20140711_OR018_04 TB432015.[MT7]-WLDAC[CAM]LAGSR.2b3_1.heavy 646.831 / 559.3 3270.0 36.47549819946289 43 13 10 10 10 1.25001116241226 52.50735800607864 0.0 3 0.9084004857782203 4.0461647976756 3270.0 5.1814171156185616 2.0 - - - - - - - 236.9 8 10 BAI1 brain-specific angiogenesis inhibitor 1 563 72 C20140711_OR018_04 C20140711_OR018_04 TB432015.[MT7]-WLDAC[CAM]LAGSR.2y8_1.heavy 646.831 / 849.388 3946.0 36.47549819946289 43 13 10 10 10 1.25001116241226 52.50735800607864 0.0 3 0.9084004857782203 4.0461647976756 3946.0 19.140318424539814 1.0 - - - - - - - 241.78571428571428 7 14 BAI1 brain-specific angiogenesis inhibitor 1 565 72 C20140711_OR018_04 C20140711_OR018_04 TB432015.[MT7]-WLDAC[CAM]LAGSR.2y9_1.heavy 646.831 / 962.472 8344.0 36.47549819946289 43 13 10 10 10 1.25001116241226 52.50735800607864 0.0 3 0.9084004857782203 4.0461647976756 8344.0 141.7003185840708 0.0 - - - - - - - 188.0 16 6 BAI1 brain-specific angiogenesis inhibitor 1 567 72 C20140711_OR018_04 C20140711_OR018_04 TB432015.[MT7]-WLDAC[CAM]LAGSR.2y7_1.heavy 646.831 / 734.361 6089.0 36.47549819946289 43 13 10 10 10 1.25001116241226 52.50735800607864 0.0 3 0.9084004857782203 4.0461647976756 6089.0 59.827587397225884 0.0 - - - - - - - 205.0909090909091 12 11 BAI1 brain-specific angiogenesis inhibitor 1 569 73 C20140711_OR018_04 C20140711_OR018_04 TB432215.[MT7]-ILLFSGPQFWVFQDR.2y4_1.heavy 999.042 / 565.273 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 571 73 C20140711_OR018_04 C20140711_OR018_04 TB432215.[MT7]-ILLFSGPQFWVFQDR.2y5_1.heavy 999.042 / 664.341 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 573 73 C20140711_OR018_04 C20140711_OR018_04 TB432215.[MT7]-ILLFSGPQFWVFQDR.2y9_1.heavy 999.042 / 1222.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 575 73 C20140711_OR018_04 C20140711_OR018_04 TB432215.[MT7]-ILLFSGPQFWVFQDR.2y6_1.heavy 999.042 / 850.421 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 577 74 C20140711_OR018_04 C20140711_OR018_04 TB422543.[MT7]-RIHTGERPYK[MT7].2y8_1.heavy 772.949 / 1131.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF716;ZFP62;ZNF735;ZNF559;ZNF479 zinc finger protein 716;zinc finger protein 62 homolog (mouse);zinc finger protein 735;zinc finger protein 559;zinc finger protein 479 579 74 C20140711_OR018_04 C20140711_OR018_04 TB422543.[MT7]-RIHTGERPYK[MT7].2y9_1.heavy 772.949 / 1244.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF716;ZFP62;ZNF735;ZNF559;ZNF479 zinc finger protein 716;zinc finger protein 62 homolog (mouse);zinc finger protein 735;zinc finger protein 559;zinc finger protein 479 581 74 C20140711_OR018_04 C20140711_OR018_04 TB422543.[MT7]-RIHTGERPYK[MT7].2b6_1.heavy 772.949 / 838.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF716;ZFP62;ZNF735;ZNF559;ZNF479 zinc finger protein 716;zinc finger protein 62 homolog (mouse);zinc finger protein 735;zinc finger protein 559;zinc finger protein 479 583 74 C20140711_OR018_04 C20140711_OR018_04 TB422543.[MT7]-RIHTGERPYK[MT7].2y6_1.heavy 772.949 / 893.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF716;ZFP62;ZNF735;ZNF559;ZNF479 zinc finger protein 716;zinc finger protein 62 homolog (mouse);zinc finger protein 735;zinc finger protein 559;zinc finger protein 479 585 75 C20140711_OR018_04 C20140711_OR018_04 TB422817.[MT7]-TDYTPFTGNYGQPHVGQK[MT7].4y5_1.heavy 575.29 / 712.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 587 75 C20140711_OR018_04 C20140711_OR018_04 TB422817.[MT7]-TDYTPFTGNYGQPHVGQK[MT7].4b4_1.heavy 575.29 / 625.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 589 75 C20140711_OR018_04 C20140711_OR018_04 TB422817.[MT7]-TDYTPFTGNYGQPHVGQK[MT7].4y6_1.heavy 575.29 / 809.475 N/A N/A - - - - - - - - - 0.0 - - - - - - - BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 591 75 C20140711_OR018_04 C20140711_OR018_04 TB422817.[MT7]-TDYTPFTGNYGQPHVGQK[MT7].4b3_1.heavy 575.29 / 524.247 N/A N/A - - - - - - - - - 0.0 - - - - - - - BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 593 76 C20140711_OR018_04 C20140711_OR018_04 TB444223.[MT7]-DQDWNDFLQQVC[CAM]SQIDSTEK[MT7].4y5_1.heavy 686.823 / 723.364 1354.0 48.14175033569336 39 13 10 6 10 1.9446509891311654 51.423109112591035 0.03890228271484375 3 0.9268876033117915 4.536121035490561 1354.0 9.617196261682242 0.0 - - - - - - - 245.77777777777777 2 9 ULK4 unc-51-like kinase 4 (C. elegans) 595 76 C20140711_OR018_04 C20140711_OR018_04 TB444223.[MT7]-DQDWNDFLQQVC[CAM]SQIDSTEK[MT7].4b7_1.heavy 686.823 / 1065.44 1639.0 48.14175033569336 39 13 10 6 10 1.9446509891311654 51.423109112591035 0.03890228271484375 3 0.9268876033117915 4.536121035490561 1639.0 13.764557872034509 0.0 - - - - - - - 149.6 3 10 ULK4 unc-51-like kinase 4 (C. elegans) 597 76 C20140711_OR018_04 C20140711_OR018_04 TB444223.[MT7]-DQDWNDFLQQVC[CAM]SQIDSTEK[MT7].4b6_1.heavy 686.823 / 918.371 1781.0 48.14175033569336 39 13 10 6 10 1.9446509891311654 51.423109112591035 0.03890228271484375 3 0.9268876033117915 4.536121035490561 1781.0 30.052880479136498 0.0 - - - - - - - 213.88888888888889 3 9 ULK4 unc-51-like kinase 4 (C. elegans) 599 76 C20140711_OR018_04 C20140711_OR018_04 TB444223.[MT7]-DQDWNDFLQQVC[CAM]SQIDSTEK[MT7].4b3_1.heavy 686.823 / 503.222 1710.0 48.14175033569336 39 13 10 6 10 1.9446509891311654 51.423109112591035 0.03890228271484375 3 0.9268876033117915 4.536121035490561 1710.0 3.196261682242991 0.0 - - - - - - - 223.33333333333334 3 15 ULK4 unc-51-like kinase 4 (C. elegans) 601 77 C20140711_OR018_04 C20140711_OR018_04 TB422819.[MT7]-FSNWTNSAFLAQGSLLNMR.3y7_1.heavy 767.724 / 790.424 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRX1 iroquois homeobox 1 603 77 C20140711_OR018_04 C20140711_OR018_04 TB422819.[MT7]-FSNWTNSAFLAQGSLLNMR.3b4_1.heavy 767.724 / 679.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRX1 iroquois homeobox 1 605 77 C20140711_OR018_04 C20140711_OR018_04 TB422819.[MT7]-FSNWTNSAFLAQGSLLNMR.3y8_1.heavy 767.724 / 918.483 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRX1 iroquois homeobox 1 607 77 C20140711_OR018_04 C20140711_OR018_04 TB422819.[MT7]-FSNWTNSAFLAQGSLLNMR.3y9_1.heavy 767.724 / 989.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - IRX1 iroquois homeobox 1 609 78 C20140711_OR018_04 C20140711_OR018_04 TB422910.[MT7]-DLSLWEGAPPSPDDVTVSNAGDTYFFK[MT7].4y5_1.heavy 804.896 / 849.463 22949.0 41.655351638793945 22 0 10 6 6 0.2597440659260822 148.93118139871376 0.039699554443359375 5 0.30516806830306115 1.3844332362811516 22949.0 33.30483590682673 0.0 - - - - - - - 253.57142857142858 45 7 MMP25 matrix metallopeptidase 25 611 78 C20140711_OR018_04 C20140711_OR018_04 TB422910.[MT7]-DLSLWEGAPPSPDDVTVSNAGDTYFFK[MT7].4b7_1.heavy 804.896 / 945.48 1183.0 41.655351638793945 22 0 10 6 6 0.2597440659260822 148.93118139871376 0.039699554443359375 5 0.30516806830306115 1.3844332362811516 1183.0 0.0 0.0 - - - - - - - 227.53846153846155 2 13 MMP25 matrix metallopeptidase 25 613 78 C20140711_OR018_04 C20140711_OR018_04 TB422910.[MT7]-DLSLWEGAPPSPDDVTVSNAGDTYFFK[MT7].4b4_1.heavy 804.896 / 573.336 710.0 41.655351638793945 22 0 10 6 6 0.2597440659260822 148.93118139871376 0.039699554443359375 5 0.30516806830306115 1.3844332362811516 710.0 3.5530717834809677 11.0 - - - - - - - 0.0 1 0 MMP25 matrix metallopeptidase 25 615 78 C20140711_OR018_04 C20140711_OR018_04 TB422910.[MT7]-DLSLWEGAPPSPDDVTVSNAGDTYFFK[MT7].4y3_1.heavy 804.896 / 585.352 710.0 41.655351638793945 22 0 10 6 6 0.2597440659260822 148.93118139871376 0.039699554443359375 5 0.30516806830306115 1.3844332362811516 710.0 4.365822784810126 7.0 - - - - - - - 168.85714285714286 2 7 MMP25 matrix metallopeptidase 25 617 79 C20140711_OR018_04 C20140711_OR018_04 TB422911.[MT7]-APSGAMLPPRLSLFC[CAM]IAAPVLLPSAAEMK[MT7].4b7_1.heavy 824.96 / 772.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 619 79 C20140711_OR018_04 C20140711_OR018_04 TB422911.[MT7]-APSGAMLPPRLSLFC[CAM]IAAPVLLPSAAEMK[MT7].4b5_1.heavy 824.96 / 528.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 621 79 C20140711_OR018_04 C20140711_OR018_04 TB422911.[MT7]-APSGAMLPPRLSLFC[CAM]IAAPVLLPSAAEMK[MT7].4y7_1.heavy 824.96 / 877.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 623 79 C20140711_OR018_04 C20140711_OR018_04 TB422911.[MT7]-APSGAMLPPRLSLFC[CAM]IAAPVLLPSAAEMK[MT7].4b6_1.heavy 824.96 / 659.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 625 80 C20140711_OR018_04 C20140711_OR018_04 TB432113.[MT7]-AEAPHAPAAPSALAR.2y12_1.heavy 787.432 / 1158.64 1165.0 24.86949920654297 37 11 10 6 10 1.1382252983279046 57.235746948817294 0.0391998291015625 3 0.8774584684579605 3.488852837923105 1165.0 13.284326505276226 0.0 - - - - - - - 192.0 2 7 IRX1 iroquois homeobox 1 627 80 C20140711_OR018_04 C20140711_OR018_04 TB432113.[MT7]-AEAPHAPAAPSALAR.2y9_1.heavy 787.432 / 853.489 806.0 24.86949920654297 37 11 10 6 10 1.1382252983279046 57.235746948817294 0.0391998291015625 3 0.8774584684579605 3.488852837923105 806.0 -0.45027932960893846 0.0 - - - - - - - 0.0 1 0 IRX1 iroquois homeobox 1 629 80 C20140711_OR018_04 C20140711_OR018_04 TB432113.[MT7]-AEAPHAPAAPSALAR.2y6_1.heavy 787.432 / 614.362 269.0 24.86949920654297 37 11 10 6 10 1.1382252983279046 57.235746948817294 0.0391998291015625 3 0.8774584684579605 3.488852837923105 269.0 2.19 12.0 - - - - - - - 0.0 1 0 IRX1 iroquois homeobox 1 631 80 C20140711_OR018_04 C20140711_OR018_04 TB432113.[MT7]-AEAPHAPAAPSALAR.2y10_1.heavy 787.432 / 924.526 538.0 24.86949920654297 37 11 10 6 10 1.1382252983279046 57.235746948817294 0.0391998291015625 3 0.8774584684579605 3.488852837923105 538.0 5.798444444444445 1.0 - - - - - - - 0.0 1 0 IRX1 iroquois homeobox 1 633 81 C20140711_OR018_04 C20140711_OR018_04 TB443748.[MT7]-VVQAAYAR.2y5_1.heavy 511.299 / 551.294 5458.0 23.296974658966064 36 10 10 6 10 0.8387744464459426 70.49545946467178 0.03669929504394531 3 0.8373473415359141 3.0175977065026904 5458.0 79.77076923076922 0.0 - - - - - - - 91.0 10 4 MMP25 matrix metallopeptidase 25 635 81 C20140711_OR018_04 C20140711_OR018_04 TB443748.[MT7]-VVQAAYAR.2b4_1.heavy 511.299 / 542.342 2820.0 23.296974658966064 36 10 10 6 10 0.8387744464459426 70.49545946467178 0.03669929504394531 3 0.8373473415359141 3.0175977065026904 2820.0 38.11648351648352 0.0 - - - - - - - 273.0 5 6 MMP25 matrix metallopeptidase 25 637 81 C20140711_OR018_04 C20140711_OR018_04 TB443748.[MT7]-VVQAAYAR.2y6_1.heavy 511.299 / 679.352 6822.0 23.296974658966064 36 10 10 6 10 0.8387744464459426 70.49545946467178 0.03669929504394531 3 0.8373473415359141 3.0175977065026904 6822.0 43.60582417582417 0.0 - - - - - - - 182.0 13 8 MMP25 matrix metallopeptidase 25 639 81 C20140711_OR018_04 C20140711_OR018_04 TB443748.[MT7]-VVQAAYAR.2y7_1.heavy 511.299 / 778.421 4730.0 23.296974658966064 36 10 10 6 10 0.8387744464459426 70.49545946467178 0.03669929504394531 3 0.8373473415359141 3.0175977065026904 4730.0 74.32857142857142 0.0 - - - - - - - 182.0 9 6 MMP25 matrix metallopeptidase 25 641 82 C20140711_OR018_04 C20140711_OR018_04 TB422728.[MT7]-SALATLVPPQASGC[CAM]TFLP.2b7_1.heavy 987.528 / 800.5 4159.0 47.8308744430542 36 14 10 2 10 2.290361675099548 36.68210425090546 0.08510208129882812 3 0.932895940341989 4.737278890927928 4159.0 -0.20589108910890985 0.0 - - - - - - - 152.0 8 4 AHRR aryl-hydrocarbon receptor repressor 643 82 C20140711_OR018_04 C20140711_OR018_04 TB422728.[MT7]-SALATLVPPQASGC[CAM]TFLP.2b5_1.heavy 987.528 / 588.347 2130.0 47.8308744430542 36 14 10 2 10 2.290361675099548 36.68210425090546 0.08510208129882812 3 0.932895940341989 4.737278890927928 2130.0 5.503536007940049 1.0 - - - - - - - 304.25 4 4 AHRR aryl-hydrocarbon receptor repressor 645 82 C20140711_OR018_04 C20140711_OR018_04 TB422728.[MT7]-SALATLVPPQASGC[CAM]TFLP.2y11_1.heavy 987.528 / 1174.56 2638.0 47.8308744430542 36 14 10 2 10 2.290361675099548 36.68210425090546 0.08510208129882812 3 0.932895940341989 4.737278890927928 2638.0 3.6158923580907256 0.0 - - - - - - - 217.14285714285714 5 7 AHRR aryl-hydrocarbon receptor repressor 647 82 C20140711_OR018_04 C20140711_OR018_04 TB422728.[MT7]-SALATLVPPQASGC[CAM]TFLP.2b6_1.heavy 987.528 / 701.431 3044.0 47.8308744430542 36 14 10 2 10 2.290361675099548 36.68210425090546 0.08510208129882812 3 0.932895940341989 4.737278890927928 3044.0 5.075915675171259 1.0 - - - - - - - 270.3333333333333 6 6 AHRR aryl-hydrocarbon receptor repressor 649 83 C20140711_OR018_04 C20140711_OR018_04 TB422727.[MT7]-FFGYFSAAAVFPANASR.3y7_1.heavy 656.336 / 762.389 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAI1 brain-specific angiogenesis inhibitor 1 651 83 C20140711_OR018_04 C20140711_OR018_04 TB422727.[MT7]-FFGYFSAAAVFPANASR.3y6_1.heavy 656.336 / 615.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAI1 brain-specific angiogenesis inhibitor 1 653 83 C20140711_OR018_04 C20140711_OR018_04 TB422727.[MT7]-FFGYFSAAAVFPANASR.3b5_1.heavy 656.336 / 806.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAI1 brain-specific angiogenesis inhibitor 1 655 83 C20140711_OR018_04 C20140711_OR018_04 TB422727.[MT7]-FFGYFSAAAVFPANASR.3y8_1.heavy 656.336 / 861.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAI1 brain-specific angiogenesis inhibitor 1 657 84 C20140711_OR018_04 C20140711_OR018_04 TB443746.[MT7]-ELLDLK[MT7].2y4_1.heavy 509.823 / 632.41 2888.0 34.40082359313965 39 15 10 6 8 2.096949498138261 39.73369970974486 0.03749847412109375 4 0.9530545476501299 5.673509391949645 2888.0 9.267080469962314 0.0 - - - - - - - 173.66666666666666 5 6 XDH;SHCBP1 xanthine dehydrogenase;SHC SH2-domain binding protein 1 659 84 C20140711_OR018_04 C20140711_OR018_04 TB443746.[MT7]-ELLDLK[MT7].2y5_1.heavy 509.823 / 745.494 5198.0 34.40082359313965 39 15 10 6 8 2.096949498138261 39.73369970974486 0.03749847412109375 4 0.9530545476501299 5.673509391949645 5198.0 14.249572161666103 0.0 - - - - - - - 247.85714285714286 10 7 XDH;SHCBP1 xanthine dehydrogenase;SHC SH2-domain binding protein 1 661 84 C20140711_OR018_04 C20140711_OR018_04 TB443746.[MT7]-ELLDLK[MT7].2b4_1.heavy 509.823 / 615.347 10973.0 34.40082359313965 39 15 10 6 8 2.096949498138261 39.73369970974486 0.03749847412109375 4 0.9530545476501299 5.673509391949645 10973.0 122.74701157706448 0.0 - - - - - - - 231.33333333333334 21 6 XDH;SHCBP1 xanthine dehydrogenase;SHC SH2-domain binding protein 1 663 84 C20140711_OR018_04 C20140711_OR018_04 TB443746.[MT7]-ELLDLK[MT7].2y3_1.heavy 509.823 / 519.326 4274.0 34.40082359313965 39 15 10 6 8 2.096949498138261 39.73369970974486 0.03749847412109375 4 0.9530545476501299 5.673509391949645 4274.0 17.577056277056275 1.0 - - - - - - - 213.53846153846155 8 13 XDH;SHCBP1 xanthine dehydrogenase;SHC SH2-domain binding protein 1 665 85 C20140711_OR018_04 C20140711_OR018_04 TB443744.[MT7]-RVQWLQGFAK[MT7].3b4_1.heavy 507.636 / 714.417 7675.0 35.304924964904785 42 16 10 6 10 3.1121822541699724 32.13179429514814 0.039501190185546875 3 0.9674792810622211 6.824930856707888 7675.0 29.139005683465754 0.0 - - - - - - - 311.14285714285717 15 7 TEX13B testis expressed 13B 667 85 C20140711_OR018_04 C20140711_OR018_04 TB443744.[MT7]-RVQWLQGFAK[MT7].3b5_1.heavy 507.636 / 827.501 3208.0 35.304924964904785 42 16 10 6 10 3.1121822541699724 32.13179429514814 0.039501190185546875 3 0.9674792810622211 6.824930856707888 3208.0 34.8439840516423 0.0 - - - - - - - 278.42857142857144 6 7 TEX13B testis expressed 13B 669 85 C20140711_OR018_04 C20140711_OR018_04 TB443744.[MT7]-RVQWLQGFAK[MT7].3b3_1.heavy 507.636 / 528.337 13861.0 35.304924964904785 42 16 10 6 10 3.1121822541699724 32.13179429514814 0.039501190185546875 3 0.9674792810622211 6.824930856707888 13861.0 67.51820914108065 0.0 - - - - - - - 267.3333333333333 27 9 TEX13B testis expressed 13B 671 85 C20140711_OR018_04 C20140711_OR018_04 TB443744.[MT7]-RVQWLQGFAK[MT7].3y4_1.heavy 507.636 / 566.342 23484.0 35.304924964904785 42 16 10 6 10 3.1121822541699724 32.13179429514814 0.039501190185546875 3 0.9674792810622211 6.824930856707888 23484.0 293.4630552496677 0.0 - - - - - - - 216.55555555555554 46 9 TEX13B testis expressed 13B 673 86 C20140711_OR018_04 C20140711_OR018_04 TB443743.[MT7]-QC[CAM]NREAC[CAM]GPAGR.3y7_1.heavy 507.237 / 688.32 2278.0 16.834500630696613 34 15 10 3 6 1.7776429243278713 56.254267171124994 0.07439994812011719 5 0.9536702059055642 5.7113796147091165 2278.0 28.59747311827957 0.0 - - - - - - - 170.16666666666666 4 12 BAI1 brain-specific angiogenesis inhibitor 1 675 86 C20140711_OR018_04 C20140711_OR018_04 TB443743.[MT7]-QC[CAM]NREAC[CAM]GPAGR.3y8_1.heavy 507.237 / 817.362 N/A 16.834500630696613 34 15 10 3 6 1.7776429243278713 56.254267171124994 0.07439994812011719 5 0.9536702059055642 5.7113796147091165 0.0 0.0 4.0 - - - - - - - 0.0 0 0 BAI1 brain-specific angiogenesis inhibitor 1 677 86 C20140711_OR018_04 C20140711_OR018_04 TB443743.[MT7]-QC[CAM]NREAC[CAM]GPAGR.3y6_1.heavy 507.237 / 617.282 1627.0 16.834500630696613 34 15 10 3 6 1.7776429243278713 56.254267171124994 0.07439994812011719 5 0.9536702059055642 5.7113796147091165 1627.0 23.226827586206895 0.0 - - - - - - - 119.28571428571429 3 7 BAI1 brain-specific angiogenesis inhibitor 1 679 86 C20140711_OR018_04 C20140711_OR018_04 TB443743.[MT7]-QC[CAM]NREAC[CAM]GPAGR.3b3_1.heavy 507.237 / 547.242 232.0 16.834500630696613 34 15 10 3 6 1.7776429243278713 56.254267171124994 0.07439994812011719 5 0.9536702059055642 5.7113796147091165 232.0 1.7 5.0 - - - - - - - 0.0 0 0 BAI1 brain-specific angiogenesis inhibitor 1 681 87 C20140711_OR018_04 C20140711_OR018_04 TB432224.[MT7]-DNFFIELGQPQWLK[MT7].2b3_1.heavy 1012.05 / 521.248 3344.0 48.071425437927246 39 14 10 5 10 1.6280409591021465 42.40062389571445 0.040699005126953125 3 0.9443796691415969 5.208489248833986 3344.0 26.530298342541435 0.0 - - - - - - - 192.125 6 8 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 683 87 C20140711_OR018_04 C20140711_OR018_04 TB432224.[MT7]-DNFFIELGQPQWLK[MT7].2y5_1.heavy 1012.05 / 815.49 5062.0 48.071425437927246 39 14 10 5 10 1.6280409591021465 42.40062389571445 0.040699005126953125 3 0.9443796691415969 5.208489248833986 5062.0 44.74696132596685 0.0 - - - - - - - 192.125 10 8 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 685 87 C20140711_OR018_04 C20140711_OR018_04 TB432224.[MT7]-DNFFIELGQPQWLK[MT7].2y9_1.heavy 1012.05 / 1242.7 1446.0 48.071425437927246 39 14 10 5 10 1.6280409591021465 42.40062389571445 0.040699005126953125 3 0.9443796691415969 5.208489248833986 1446.0 1.9206495118048525 0.0 - - - - - - - 229.9090909090909 2 11 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 687 87 C20140711_OR018_04 C20140711_OR018_04 TB432224.[MT7]-DNFFIELGQPQWLK[MT7].2b4_1.heavy 1012.05 / 668.316 4067.0 48.071425437927246 39 14 10 5 10 1.6280409591021465 42.40062389571445 0.040699005126953125 3 0.9443796691415969 5.208489248833986 4067.0 52.13449600982197 0.0 - - - - - - - 219.42857142857142 8 7 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 689 88 C20140711_OR018_04 C20140711_OR018_04 TB422539.[MT7]-GFIHNSIMVLPR.3y7_1.heavy 509.958 / 815.481 1226.0 36.47549819946289 36 16 2 10 8 4.5088429694080014 22.17863888329864 0.0 4 0.968455838014588 6.930340794215664 1226.0 11.809264705882352 0.0 - - - - - - - 265.6 2 5 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 691 88 C20140711_OR018_04 C20140711_OR018_04 TB422539.[MT7]-GFIHNSIMVLPR.3y6_1.heavy 509.958 / 728.449 409.0 36.47549819946289 36 16 2 10 8 4.5088429694080014 22.17863888329864 0.0 4 0.968455838014588 6.930340794215664 409.0 -0.20016313213703096 14.0 - - - - - - - 175.14285714285714 6 7 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 693 88 C20140711_OR018_04 C20140711_OR018_04 TB422539.[MT7]-GFIHNSIMVLPR.3b3_1.heavy 509.958 / 462.283 8585.0 36.47549819946289 36 16 2 10 8 4.5088429694080014 22.17863888329864 0.0 4 0.968455838014588 6.930340794215664 8585.0 23.19034155078201 0.0 - - - - - - - 283.8888888888889 17 9 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 695 88 C20140711_OR018_04 C20140711_OR018_04 TB422539.[MT7]-GFIHNSIMVLPR.3y5_1.heavy 509.958 / 615.365 4804.0 36.47549819946289 36 16 2 10 8 4.5088429694080014 22.17863888329864 0.0 4 0.968455838014588 6.930340794215664 4804.0 23.949410893336413 1.0 - - - - - - - 272.6666666666667 34 9 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 697 89 C20140711_OR018_04 C20140711_OR018_04 TB443847.[MT7]-GGRGSC[CAM]GGSK[MT7].3y7_1.heavy 404.212 / 796.374 N/A N/A - - - - - - - - - 0.0 - - - - - - - KRTAP5-8 keratin associated protein 5-8 699 89 C20140711_OR018_04 C20140711_OR018_04 TB443847.[MT7]-GGRGSC[CAM]GGSK[MT7].3y3_1.heavy 404.212 / 435.268 N/A N/A - - - - - - - - - 0.0 - - - - - - - KRTAP5-8 keratin associated protein 5-8 701 89 C20140711_OR018_04 C20140711_OR018_04 TB443847.[MT7]-GGRGSC[CAM]GGSK[MT7].3y4_1.heavy 404.212 / 492.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - KRTAP5-8 keratin associated protein 5-8 703 89 C20140711_OR018_04 C20140711_OR018_04 TB443847.[MT7]-GGRGSC[CAM]GGSK[MT7].3y5_1.heavy 404.212 / 652.32 N/A N/A - - - - - - - - - 0.0 - - - - - - - KRTAP5-8 keratin associated protein 5-8 705 90 C20140711_OR018_04 C20140711_OR018_04 TB443846.[MT7]-K[MT7]LPLSLSFLHLTR.3y7_1.heavy 605.048 / 873.494 6032.0 41.356300354003906 45 15 10 10 10 3.2301476290057636 25.253594392848168 0.0 3 0.9596179683395909 6.1206263966394845 6032.0 71.1880333119795 0.0 - - - - - - - 156.4 12 5 TSHR thyroid stimulating hormone receptor 707 90 C20140711_OR018_04 C20140711_OR018_04 TB443846.[MT7]-K[MT7]LPLSLSFLHLTR.3y6_1.heavy 605.048 / 786.462 2904.0 41.356300354003906 45 15 10 10 10 3.2301476290057636 25.253594392848168 0.0 3 0.9596179683395909 6.1206263966394845 2904.0 14.639015862392077 0.0 - - - - - - - 204.83333333333334 5 6 TSHR thyroid stimulating hormone receptor 709 90 C20140711_OR018_04 C20140711_OR018_04 TB443846.[MT7]-K[MT7]LPLSLSFLHLTR.3y4_1.heavy 605.048 / 526.31 7708.0 41.356300354003906 45 15 10 10 10 3.2301476290057636 25.253594392848168 0.0 3 0.9596179683395909 6.1206263966394845 7708.0 26.480874364177005 0.0 - - - - - - - 260.6 15 15 TSHR thyroid stimulating hormone receptor 711 90 C20140711_OR018_04 C20140711_OR018_04 TB443846.[MT7]-K[MT7]LPLSLSFLHLTR.3y9_1.heavy 605.048 / 1073.61 2234.0 41.356300354003906 45 15 10 10 10 3.2301476290057636 25.253594392848168 0.0 3 0.9596179683395909 6.1206263966394845 2234.0 27.761314061499043 0.0 - - - - - - - 223.375 4 8 TSHR thyroid stimulating hormone receptor 713 91 C20140711_OR018_04 C20140711_OR018_04 TB432024.[MT7]-RPEITNWVR.2y8_1.heavy 657.874 / 1014.54 5728.0 30.956967035929363 40 20 10 6 4 5.241754105486697 19.077583188293225 0.03890037536621094 7 0.9969647052087911 22.39504911729785 5728.0 39.32721680352039 0.0 - - - - - - - 281.8181818181818 11 11 ULK4 unc-51-like kinase 4 (C. elegans) 715 91 C20140711_OR018_04 C20140711_OR018_04 TB432024.[MT7]-RPEITNWVR.2b6_1.heavy 657.874 / 855.481 1408.0 30.956967035929363 40 20 10 6 4 5.241754105486697 19.077583188293225 0.03890037536621094 7 0.9969647052087911 22.39504911729785 1408.0 16.18277004037563 1.0 - - - - - - - 222.0909090909091 4 11 ULK4 unc-51-like kinase 4 (C. elegans) 717 91 C20140711_OR018_04 C20140711_OR018_04 TB432024.[MT7]-RPEITNWVR.2y6_1.heavy 657.874 / 788.441 469.0 30.956967035929363 40 20 10 6 4 5.241754105486697 19.077583188293225 0.03890037536621094 7 0.9969647052087911 22.39504911729785 469.0 1.0467021276595743 12.0 - - - - - - - 0.0 1 0 ULK4 unc-51-like kinase 4 (C. elegans) 719 91 C20140711_OR018_04 C20140711_OR018_04 TB432024.[MT7]-RPEITNWVR.2b7_1.heavy 657.874 / 1041.56 N/A 30.956967035929363 40 20 10 6 4 5.241754105486697 19.077583188293225 0.03890037536621094 7 0.9969647052087911 22.39504911729785 657.0 2.8914847274000532 12.0 - - - - - - - 316.875 3 8 ULK4 unc-51-like kinase 4 (C. elegans) 721 92 C20140711_OR018_04 C20140711_OR018_04 TB422339.[MT7]-LDAVYLNK[MT7].2y4_1.heavy 612.366 / 681.405 10664.0 32.65639877319336 47 17 10 10 10 3.561076863130776 28.081393309798834 0.0 3 0.9775999306085371 8.230451355237703 10664.0 50.41979525685257 0.0 - - - - - - - 226.25 21 12 TSHR thyroid stimulating hormone receptor 723 92 C20140711_OR018_04 C20140711_OR018_04 TB422339.[MT7]-LDAVYLNK[MT7].2b4_1.heavy 612.366 / 543.326 12535.0 32.65639877319336 47 17 10 10 10 3.561076863130776 28.081393309798834 0.0 3 0.9775999306085371 8.230451355237703 12535.0 50.3542735042735 0.0 - - - - - - - 255.45454545454547 25 11 TSHR thyroid stimulating hormone receptor 725 92 C20140711_OR018_04 C20140711_OR018_04 TB422339.[MT7]-LDAVYLNK[MT7].2y3_1.heavy 612.366 / 518.342 5613.0 32.65639877319336 47 17 10 10 10 3.561076863130776 28.081393309798834 0.0 3 0.9775999306085371 8.230451355237703 5613.0 5.181746050982321 1.0 - - - - - - - 721.4285714285714 26 7 TSHR thyroid stimulating hormone receptor 727 92 C20140711_OR018_04 C20140711_OR018_04 TB422339.[MT7]-LDAVYLNK[MT7].2y7_1.heavy 612.366 / 966.538 7390.0 32.65639877319336 47 17 10 10 10 3.561076863130776 28.081393309798834 0.0 3 0.9775999306085371 8.230451355237703 7390.0 17.278013023391175 0.0 - - - - - - - 307.57142857142856 14 7 TSHR thyroid stimulating hormone receptor 729 93 C20140711_OR018_04 C20140711_OR018_04 TB422530.[MT7]-RVQWLQGFAK[MT7].2b3_1.heavy 760.951 / 528.337 N/A N/A - - - - - - - - - 0.0 - - - - - - - TEX13B testis expressed 13B 731 93 C20140711_OR018_04 C20140711_OR018_04 TB422530.[MT7]-RVQWLQGFAK[MT7].2y4_1.heavy 760.951 / 566.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - TEX13B testis expressed 13B 733 93 C20140711_OR018_04 C20140711_OR018_04 TB422530.[MT7]-RVQWLQGFAK[MT7].2y6_1.heavy 760.951 / 807.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - TEX13B testis expressed 13B 735 93 C20140711_OR018_04 C20140711_OR018_04 TB422530.[MT7]-RVQWLQGFAK[MT7].2b9_1.heavy 760.951 / 1230.69 N/A N/A - - - - - - - - - 0.0 - - - - - - - TEX13B testis expressed 13B 737 94 C20140711_OR018_04 C20140711_OR018_04 TB443647.[MT7]-SPAC[CAM]PFDK[MT7].3y3_1.heavy 403.877 / 553.31 1158.0 25.9512996673584 45 15 10 10 10 2.6644817351749075 29.166932692232912 0.0 3 0.9565375173107764 5.898199511865079 1158.0 13.25 0.0 - - - - - - - 192.66666666666666 2 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 739 94 C20140711_OR018_04 C20140711_OR018_04 TB443647.[MT7]-SPAC[CAM]PFDK[MT7].3b4_1.heavy 403.877 / 560.262 1930.0 25.9512996673584 45 15 10 10 10 2.6644817351749075 29.166932692232912 0.0 3 0.9565375173107764 5.898199511865079 1930.0 12.6 0.0 - - - - - - - 206.57142857142858 3 7 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 741 94 C20140711_OR018_04 C20140711_OR018_04 TB443647.[MT7]-SPAC[CAM]PFDK[MT7].3b3_1.heavy 403.877 / 400.231 3473.0 25.9512996673584 45 15 10 10 10 2.6644817351749075 29.166932692232912 0.0 3 0.9565375173107764 5.898199511865079 3473.0 32.30069948186529 0.0 - - - - - - - 160.66666666666666 6 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 743 94 C20140711_OR018_04 C20140711_OR018_04 TB443647.[MT7]-SPAC[CAM]PFDK[MT7].3y4_1.heavy 403.877 / 650.363 1351.0 25.9512996673584 45 15 10 10 10 2.6644817351749075 29.166932692232912 0.0 3 0.9565375173107764 5.898199511865079 1351.0 9.744101659751037 1.0 - - - - - - - 269.8 2 10 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 745 95 C20140711_OR018_04 C20140711_OR018_04 TB432120.[MT7]-ALFHMDNC[CAM]YK[MT7].3y3_1.heavy 529.595 / 614.309 2149.0 31.2490496635437 42 20 10 6 6 3.694213466701357 21.088752691459877 0.03420066833496094 5 0.9923125842755458 14.066743749801567 2149.0 10.12869914346895 1.0 - - - - - - - 221.6875 7 16 XDH xanthine dehydrogenase 747 95 C20140711_OR018_04 C20140711_OR018_04 TB432120.[MT7]-ALFHMDNC[CAM]YK[MT7].3b3_1.heavy 529.595 / 476.299 3923.0 31.2490496635437 42 20 10 6 6 3.694213466701357 21.088752691459877 0.03420066833496094 5 0.9923125842755458 14.066743749801567 3923.0 13.639303995159366 1.0 - - - - - - - 220.21428571428572 7 14 XDH xanthine dehydrogenase 749 95 C20140711_OR018_04 C20140711_OR018_04 TB432120.[MT7]-ALFHMDNC[CAM]YK[MT7].3y4_1.heavy 529.595 / 728.352 1495.0 31.2490496635437 42 20 10 6 6 3.694213466701357 21.088752691459877 0.03420066833496094 5 0.9923125842755458 14.066743749801567 1495.0 7.674866310160428 1.0 - - - - - - - 168.0 3 10 XDH xanthine dehydrogenase 751 95 C20140711_OR018_04 C20140711_OR018_04 TB432120.[MT7]-ALFHMDNC[CAM]YK[MT7].3y5_1.heavy 529.595 / 843.379 1308.0 31.2490496635437 42 20 10 6 6 3.694213466701357 21.088752691459877 0.03420066833496094 5 0.9923125842755458 14.066743749801567 1308.0 14.52663594470046 0.0 - - - - - - - 176.22222222222223 2 9 XDH xanthine dehydrogenase 753 96 C20140711_OR018_04 C20140711_OR018_04 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 988624.0 35.16949971516927 23 -3 10 6 10 null 0.0 0.039897918701171875 3 0.0 0.0 988624.0 912.4823825033099 0.0 - - - - - - - 192.84615384615384 1977 13 755 96 C20140711_OR018_04 C20140711_OR018_04 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 192978.0 35.16949971516927 23 -3 10 6 10 null 0.0 0.039897918701171875 3 0.0 0.0 192978.0 846.6747155058732 0.0 - - - - - - - 293.46153846153845 385 13 757 96 C20140711_OR018_04 C20140711_OR018_04 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 295631.0 35.16949971516927 23 -3 10 6 10 null 0.0 0.039897918701171875 3 0.0 0.0 295631.0 332.32146449100173 0.0 - - - - - - - 763.875 591 8 759 97 C20140711_OR018_04 C20140711_OR018_04 TB422829.[MT7]-IRGILESLMC[CAM]NESSMQSLR.3y7_1.heavy 790.068 / 808.398 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 761 97 C20140711_OR018_04 C20140711_OR018_04 TB422829.[MT7]-IRGILESLMC[CAM]NESSMQSLR.3b8_1.heavy 790.068 / 1026.64 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 763 97 C20140711_OR018_04 C20140711_OR018_04 TB422829.[MT7]-IRGILESLMC[CAM]NESSMQSLR.3b7_1.heavy 790.068 / 913.559 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 765 97 C20140711_OR018_04 C20140711_OR018_04 TB422829.[MT7]-IRGILESLMC[CAM]NESSMQSLR.3y9_1.heavy 790.068 / 1051.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 767 98 C20140711_OR018_04 C20140711_OR018_04 TB422921.[MT7]-LFHAELAPPQGQGQATVFPGLATAGGDWTEGAGEQEK[MT7].4b7_1.heavy 1014.26 / 926.522 N/A N/A - - - - - - - - - 0.0 - - - - - - - TEX13B testis expressed 13B 769 98 C20140711_OR018_04 C20140711_OR018_04 TB422921.[MT7]-LFHAELAPPQGQGQATVFPGLATAGGDWTEGAGEQEK[MT7].4y9_1.heavy 1014.26 / 1092.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - TEX13B testis expressed 13B 771 98 C20140711_OR018_04 C20140711_OR018_04 TB422921.[MT7]-LFHAELAPPQGQGQATVFPGLATAGGDWTEGAGEQEK[MT7].4b5_1.heavy 1014.26 / 742.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - TEX13B testis expressed 13B 773 98 C20140711_OR018_04 C20140711_OR018_04 TB422921.[MT7]-LFHAELAPPQGQGQATVFPGLATAGGDWTEGAGEQEK[MT7].4b6_1.heavy 1014.26 / 855.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - TEX13B testis expressed 13B 775 99 C20140711_OR018_04 C20140711_OR018_04 TB432122.[MT7]-TEVFRGVLEQLR.3b9_2.heavy 530.974 / 588.331 852.0 38.534799575805664 22 13 2 5 2 1.8351926771432159 43.51044296725642 0.042797088623046875 13 0.9298435425595006 4.631868207586174 852.0 1.015917942337859 14.0 - - - - - - - 218.8 5 5 XDH xanthine dehydrogenase 777 99 C20140711_OR018_04 C20140711_OR018_04 TB432122.[MT7]-TEVFRGVLEQLR.3y7_1.heavy 530.974 / 814.478 1095.0 38.534799575805664 22 13 2 5 2 1.8351926771432159 43.51044296725642 0.042797088623046875 13 0.9298435425595006 4.631868207586174 1095.0 5.583703703703703 1.0 - - - - - - - 122.0 3 3 XDH xanthine dehydrogenase 779 99 C20140711_OR018_04 C20140711_OR018_04 TB432122.[MT7]-TEVFRGVLEQLR.3y4_1.heavy 530.974 / 545.304 730.0 38.534799575805664 22 13 2 5 2 1.8351926771432159 43.51044296725642 0.042797088623046875 13 0.9298435425595006 4.631868207586174 730.0 2.0316467780429597 14.0 - - - - - - - 243.33333333333334 7 6 XDH xanthine dehydrogenase 781 99 C20140711_OR018_04 C20140711_OR018_04 TB432122.[MT7]-TEVFRGVLEQLR.3y5_1.heavy 530.974 / 658.388 1582.0 38.534799575805664 22 13 2 5 2 1.8351926771432159 43.51044296725642 0.042797088623046875 13 0.9298435425595006 4.631868207586174 1582.0 3.3135359275425644 1.0 - - - - - - - 212.75 3 4 XDH xanthine dehydrogenase 783 100 C20140711_OR018_04 C20140711_OR018_04 TB444091.[MT7]-TIPSHAFSNLPNISR.3b4_1.heavy 599.996 / 543.326 27703.0 33.51279830932617 47 17 10 10 10 3.3269587066805077 30.05748156693402 0.0 3 0.9702778974162509 7.140703767022514 27703.0 22.938015412484724 0.0 - - - - - - - 763.6666666666666 55 9 TSHR thyroid stimulating hormone receptor 785 100 C20140711_OR018_04 C20140711_OR018_04 TB444091.[MT7]-TIPSHAFSNLPNISR.3y8_1.heavy 599.996 / 900.49 21368.0 33.51279830932617 47 17 10 10 10 3.3269587066805077 30.05748156693402 0.0 3 0.9702778974162509 7.140703767022514 21368.0 124.27885598728875 0.0 - - - - - - - 247.1 42 10 TSHR thyroid stimulating hormone receptor 787 100 C20140711_OR018_04 C20140711_OR018_04 TB444091.[MT7]-TIPSHAFSNLPNISR.3y5_1.heavy 599.996 / 586.331 50682.0 33.51279830932617 47 17 10 10 10 3.3269587066805077 30.05748156693402 0.0 3 0.9702778974162509 7.140703767022514 50682.0 73.14441340782122 0.0 - - - - - - - 721.0 101 7 TSHR thyroid stimulating hormone receptor 789 100 C20140711_OR018_04 C20140711_OR018_04 TB444091.[MT7]-TIPSHAFSNLPNISR.3y9_1.heavy 599.996 / 1047.56 20939.0 33.51279830932617 47 17 10 10 10 3.3269587066805077 30.05748156693402 0.0 3 0.9702778974162509 7.140703767022514 20939.0 270.59140665072806 0.0 - - - - - - - 187.75 41 12 TSHR thyroid stimulating hormone receptor 791 101 C20140711_OR018_04 C20140711_OR018_04 TB422733.[MT7]-SVELSGLPSTSQQHFAR.3b6_1.heavy 663.349 / 717.39 16812.0 30.711000442504883 47 20 9 10 8 7.590022613621385 13.175191312412647 0.0 4 0.9916377744158925 13.48647110101691 16812.0 -1.4953494282083888 1.0 - - - - - - - 207.55555555555554 33 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 793 101 C20140711_OR018_04 C20140711_OR018_04 TB422733.[MT7]-SVELSGLPSTSQQHFAR.3b4_1.heavy 663.349 / 573.336 7964.0 30.711000442504883 47 20 9 10 8 7.590022613621385 13.175191312412647 0.0 4 0.9916377744158925 13.48647110101691 7964.0 -0.8102906976744197 1.0 - - - - - - - 363.7 37 10 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 795 101 C20140711_OR018_04 C20140711_OR018_04 TB422733.[MT7]-SVELSGLPSTSQQHFAR.3y4_1.heavy 663.349 / 530.283 7374.0 30.711000442504883 47 20 9 10 8 7.590022613621385 13.175191312412647 0.0 4 0.9916377744158925 13.48647110101691 7374.0 -0.583254237288136 0.0 - - - - - - - 309.14285714285717 14 7 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 797 101 C20140711_OR018_04 C20140711_OR018_04 TB422733.[MT7]-SVELSGLPSTSQQHFAR.3y10_1.heavy 663.349 / 1158.56 8357.0 30.711000442504883 47 20 9 10 8 7.590022613621385 13.175191312412647 0.0 4 0.9916377744158925 13.48647110101691 8357.0 -4.263775510204084 0.0 - - - - - - - 147.5 16 2 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 799 102 C20140711_OR018_04 C20140711_OR018_04 TB444249.[MT7]-YQDHEDIIIAELDATANELDAFAVHGFPTLK[MT7].4y4_1.heavy 936.98 / 602.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDIA2 protein disulfide isomerase family A, member 2 801 102 C20140711_OR018_04 C20140711_OR018_04 TB444249.[MT7]-YQDHEDIIIAELDATANELDAFAVHGFPTLK[MT7].4b7_1.heavy 936.98 / 1045.47 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDIA2 protein disulfide isomerase family A, member 2 803 102 C20140711_OR018_04 C20140711_OR018_04 TB444249.[MT7]-YQDHEDIIIAELDATANELDAFAVHGFPTLK[MT7].4b3_1.heavy 936.98 / 551.258 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDIA2 protein disulfide isomerase family A, member 2 805 102 C20140711_OR018_04 C20140711_OR018_04 TB444249.[MT7]-YQDHEDIIIAELDATANELDAFAVHGFPTLK[MT7].4b6_1.heavy 936.98 / 932.387 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDIA2 protein disulfide isomerase family A, member 2 807 103 C20140711_OR018_04 C20140711_OR018_04 TB422425.[MT7]-ILLEGPGTLK[MT7].3y3_1.heavy 443.618 / 505.347 4839.0 36.39879894256592 41 16 10 5 10 3.351723931960207 29.835392779952628 0.044399261474609375 3 0.9694114298466932 7.038327695566644 4839.0 87.56285714285714 1.0 - - - - - - - 175.16666666666666 9 6 ULK4 unc-51-like kinase 4 (C. elegans) 809 103 C20140711_OR018_04 C20140711_OR018_04 TB422425.[MT7]-ILLEGPGTLK[MT7].3b5_1.heavy 443.618 / 670.426 4839.0 36.39879894256592 41 16 10 5 10 3.351723931960207 29.835392779952628 0.044399261474609375 3 0.9694114298466932 7.038327695566644 4839.0 67.97642857142857 0.0 - - - - - - - 126.0 9 5 ULK4 unc-51-like kinase 4 (C. elegans) 811 103 C20140711_OR018_04 C20140711_OR018_04 TB422425.[MT7]-ILLEGPGTLK[MT7].3b3_1.heavy 443.618 / 484.362 5470.0 36.39879894256592 41 16 10 5 10 3.351723931960207 29.835392779952628 0.044399261474609375 3 0.9694114298466932 7.038327695566644 5470.0 65.41579264617239 0.0 - - - - - - - 195.28571428571428 10 7 ULK4 unc-51-like kinase 4 (C. elegans) 813 103 C20140711_OR018_04 C20140711_OR018_04 TB422425.[MT7]-ILLEGPGTLK[MT7].3y4_1.heavy 443.618 / 562.368 4313.0 36.39879894256592 41 16 10 5 10 3.351723931960207 29.835392779952628 0.044399261474609375 3 0.9694114298466932 7.038327695566644 4313.0 23.825146088276856 0.0 - - - - - - - 368.5 8 2 ULK4 unc-51-like kinase 4 (C. elegans) 815 104 C20140711_OR018_04 C20140711_OR018_04 TB443735.[MT7]-ELPLLK[MT7].2y4_1.heavy 500.836 / 614.436 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 817 104 C20140711_OR018_04 C20140711_OR018_04 TB443735.[MT7]-ELPLLK[MT7].2y5_1.heavy 500.836 / 727.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 819 104 C20140711_OR018_04 C20140711_OR018_04 TB443735.[MT7]-ELPLLK[MT7].2b4_1.heavy 500.836 / 597.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 821 104 C20140711_OR018_04 C20140711_OR018_04 TB443735.[MT7]-ELPLLK[MT7].2y3_1.heavy 500.836 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 823 105 C20140711_OR018_04 C20140711_OR018_04 TB432139.[MT7]-LQPSGQLVSPRPAR.3b6_1.heavy 550.657 / 755.417 2545.0 26.08289909362793 46 20 10 10 6 9.60578102831321 10.410397624643768 0.0 5 0.9979274477343987 27.10407481174367 2545.0 53.06595744680851 1.0 - - - - - - - 146.55555555555554 6 9 MMP25 matrix metallopeptidase 25 825 105 C20140711_OR018_04 C20140711_OR018_04 TB432139.[MT7]-LQPSGQLVSPRPAR.3y11_2.heavy 550.657 / 584.333 1979.0 26.08289909362793 46 20 10 10 6 9.60578102831321 10.410397624643768 0.0 5 0.9979274477343987 27.10407481174367 1979.0 5.0764560877152896 1.0 - - - - - - - 235.7 3 10 MMP25 matrix metallopeptidase 25 827 105 C20140711_OR018_04 C20140711_OR018_04 TB432139.[MT7]-LQPSGQLVSPRPAR.3y12_2.heavy 550.657 / 632.86 22528.0 26.08289909362793 46 20 10 10 6 9.60578102831321 10.410397624643768 0.0 5 0.9979274477343987 27.10407481174367 22528.0 236.8419894179894 0.0 - - - - - - - 251.44444444444446 45 9 MMP25 matrix metallopeptidase 25 829 105 C20140711_OR018_04 C20140711_OR018_04 TB432139.[MT7]-LQPSGQLVSPRPAR.3y13_2.heavy 550.657 / 696.889 4336.0 26.08289909362793 46 20 10 10 6 9.60578102831321 10.410397624643768 0.0 5 0.9979274477343987 27.10407481174367 4336.0 -0.366129488617969 2.0 - - - - - - - 188.33333333333334 10 3 MMP25 matrix metallopeptidase 25 831 106 C20140711_OR018_04 C20140711_OR018_04 TB422738.[MT7]-EFGIDLISGLHHLHK[MT7].4y4_1.heavy 501.787 / 678.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 833 106 C20140711_OR018_04 C20140711_OR018_04 TB422738.[MT7]-EFGIDLISGLHHLHK[MT7].4y8_2.heavy 501.787 / 536.81 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 835 106 C20140711_OR018_04 C20140711_OR018_04 TB422738.[MT7]-EFGIDLISGLHHLHK[MT7].4b5_1.heavy 501.787 / 706.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 837 106 C20140711_OR018_04 C20140711_OR018_04 TB422738.[MT7]-EFGIDLISGLHHLHK[MT7].4y3_1.heavy 501.787 / 541.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 839 107 C20140711_OR018_04 C20140711_OR018_04 TB443935.[MT7]-LFQQFGLTK[MT7].2b3_1.heavy 685.408 / 533.32 3435.0 40.012298583984375 50 20 10 10 10 7.71838446614175 12.95607914307329 0.0 3 0.9952698831915548 17.937218549401653 3435.0 3.478970663701676 0.0 - - - - - - - 315.77777777777777 6 9 PDIA2 protein disulfide isomerase family A, member 2 841 107 C20140711_OR018_04 C20140711_OR018_04 TB443935.[MT7]-LFQQFGLTK[MT7].2y4_1.heavy 685.408 / 562.368 3909.0 40.012298583984375 50 20 10 10 10 7.71838446614175 12.95607914307329 0.0 3 0.9952698831915548 17.937218549401653 3909.0 15.192573277502856 0.0 - - - - - - - 236.55555555555554 7 9 PDIA2 protein disulfide isomerase family A, member 2 843 107 C20140711_OR018_04 C20140711_OR018_04 TB443935.[MT7]-LFQQFGLTK[MT7].2y8_1.heavy 685.408 / 1112.62 2961.0 40.012298583984375 50 20 10 10 10 7.71838446614175 12.95607914307329 0.0 3 0.9952698831915548 17.937218549401653 2961.0 2.1430639324487335 0.0 - - - - - - - 207.0 5 4 PDIA2 protein disulfide isomerase family A, member 2 845 107 C20140711_OR018_04 C20140711_OR018_04 TB443935.[MT7]-LFQQFGLTK[MT7].2y5_1.heavy 685.408 / 709.437 4264.0 40.012298583984375 50 20 10 10 10 7.71838446614175 12.95607914307329 0.0 3 0.9952698831915548 17.937218549401653 4264.0 40.808804397617955 0.0 - - - - - - - 189.2 8 5 PDIA2 protein disulfide isomerase family A, member 2 847 108 C20140711_OR018_04 C20140711_OR018_04 TB443879.[MT7]-NLGSFLALQR.2y8_1.heavy 631.87 / 891.505 1760.0 40.23469924926758 34 12 2 10 10 1.6068895409704333 52.41567573385185 0.0 3 0.8951340240614294 3.777240983768212 1760.0 29.634188034188035 0.0 - - - - - - - 293.0 3 2 BAI1 brain-specific angiogenesis inhibitor 1 849 108 C20140711_OR018_04 C20140711_OR018_04 TB443879.[MT7]-NLGSFLALQR.2y9_1.heavy 631.87 / 1004.59 2933.0 40.23469924926758 34 12 2 10 10 1.6068895409704333 52.41567573385185 0.0 3 0.8951340240614294 3.777240983768212 2933.0 4.552766700221982 0.0 - - - - - - - 273.6666666666667 5 9 BAI1 brain-specific angiogenesis inhibitor 1 851 108 C20140711_OR018_04 C20140711_OR018_04 TB443879.[MT7]-NLGSFLALQR.2b7_1.heavy 631.87 / 847.479 1760.0 40.23469924926758 34 12 2 10 10 1.6068895409704333 52.41567573385185 0.0 3 0.8951340240614294 3.777240983768212 1760.0 5.497872340425531 1.0 - - - - - - - 252.69230769230768 3 13 BAI1 brain-specific angiogenesis inhibitor 1 853 108 C20140711_OR018_04 C20140711_OR018_04 TB443879.[MT7]-NLGSFLALQR.2b5_1.heavy 631.87 / 663.358 117.0 40.23469924926758 34 12 2 10 10 1.6068895409704333 52.41567573385185 0.0 3 0.8951340240614294 3.777240983768212 117.0 0.16619318181818182 39.0 - - - - - - - 234.46153846153845 17 13 BAI1 brain-specific angiogenesis inhibitor 1 855 109 C20140711_OR018_04 C20140711_OR018_04 TB422529.[MT7]-EYPGGPQELDK[MT7].2y8_1.heavy 760.895 / 987.523 545.0 26.530799865722656 45 15 10 10 10 5.239511056497277 19.085750353746192 0.0 3 0.9567811242507157 5.914921028158747 545.0 0.450413223140496 1.0 - - - - - - - 0.0 1 0 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 857 109 C20140711_OR018_04 C20140711_OR018_04 TB422529.[MT7]-EYPGGPQELDK[MT7].2y9_1.heavy 760.895 / 1084.58 1271.0 26.530799865722656 45 15 10 10 10 5.239511056497277 19.085750353746192 0.0 3 0.9567811242507157 5.914921028158747 1271.0 22.067912087912088 0.0 - - - - - - - 113.75 2 4 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 859 109 C20140711_OR018_04 C20140711_OR018_04 TB422529.[MT7]-EYPGGPQELDK[MT7].2y3_1.heavy 760.895 / 519.326 91.0 26.530799865722656 45 15 10 10 10 5.239511056497277 19.085750353746192 0.0 3 0.9567811242507157 5.914921028158747 91.0 0.3 26.0 - - - - - - - 0.0 1 0 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 861 109 C20140711_OR018_04 C20140711_OR018_04 TB422529.[MT7]-EYPGGPQELDK[MT7].2y10_1.heavy 760.895 / 1247.64 545.0 26.530799865722656 45 15 10 10 10 5.239511056497277 19.085750353746192 0.0 3 0.9567811242507157 5.914921028158747 545.0 7.413162572721396 0.0 - - - - - - - 0.0 1 0 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 863 110 C20140711_OR018_04 C20140711_OR018_04 TB443936.[MT7]-DC[CAM]FVNPQSPLLHITK[MT7].3b4_1.heavy 686.375 / 666.304 5065.0 36.819000244140625 43 13 10 10 10 1.0865134920592783 54.6073393349383 0.0 3 0.9187561155151605 4.300133244755883 5065.0 9.018690303054125 0.0 - - - - - - - 713.7777777777778 10 9 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 865 110 C20140711_OR018_04 C20140711_OR018_04 TB443936.[MT7]-DC[CAM]FVNPQSPLLHITK[MT7].3b5_1.heavy 686.375 / 780.347 6670.0 36.819000244140625 43 13 10 10 10 1.0865134920592783 54.6073393349383 0.0 3 0.9187561155151605 4.300133244755883 6670.0 61.90895912237169 0.0 - - - - - - - 282.57142857142856 13 7 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 867 110 C20140711_OR018_04 C20140711_OR018_04 TB443936.[MT7]-DC[CAM]FVNPQSPLLHITK[MT7].3y4_1.heavy 686.375 / 642.406 7164.0 36.819000244140625 43 13 10 10 10 1.0865134920592783 54.6073393349383 0.0 3 0.9187561155151605 4.300133244755883 7164.0 12.616761133603239 0.0 - - - - - - - 346.0 14 10 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 869 110 C20140711_OR018_04 C20140711_OR018_04 TB443936.[MT7]-DC[CAM]FVNPQSPLLHITK[MT7].3b3_1.heavy 686.375 / 567.235 3829.0 36.819000244140625 43 13 10 10 10 1.0865134920592783 54.6073393349383 0.0 3 0.9187561155151605 4.300133244755883 3829.0 9.542530816565543 1.0 - - - - - - - 355.5 9 8 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 871 111 C20140711_OR018_04 C20140711_OR018_04 TB443933.[MT7]-EGEYFSAFK[MT7].2y4_1.heavy 683.35 / 596.352 2206.0 35.275299072265625 48 20 10 10 8 20.14769359508611 4.963347269902364 0.0 4 0.9992216133949001 44.23199400952224 2206.0 3.3280172413793103 3.0 - - - - - - - 276.61538461538464 6 13 XDH xanthine dehydrogenase 873 111 C20140711_OR018_04 C20140711_OR018_04 TB443933.[MT7]-EGEYFSAFK[MT7].2y8_1.heavy 683.35 / 1092.55 2322.0 35.275299072265625 48 20 10 10 8 20.14769359508611 4.963347269902364 0.0 4 0.9992216133949001 44.23199400952224 2322.0 11.61 0.0 - - - - - - - 248.57142857142858 4 7 XDH xanthine dehydrogenase 875 111 C20140711_OR018_04 C20140711_OR018_04 TB443933.[MT7]-EGEYFSAFK[MT7].2b4_1.heavy 683.35 / 623.279 2787.0 35.275299072265625 48 20 10 10 8 20.14769359508611 4.963347269902364 0.0 4 0.9992216133949001 44.23199400952224 2787.0 4.799630996309963 0.0 - - - - - - - 348.0 5 8 XDH xanthine dehydrogenase 877 111 C20140711_OR018_04 C20140711_OR018_04 TB443933.[MT7]-EGEYFSAFK[MT7].2y6_1.heavy 683.35 / 906.484 1974.0 35.275299072265625 48 20 10 10 8 20.14769359508611 4.963347269902364 0.0 4 0.9992216133949001 44.23199400952224 1974.0 10.777586206896551 0.0 - - - - - - - 180.44444444444446 3 9 XDH xanthine dehydrogenase 879 112 C20140711_OR018_04 C20140711_OR018_04 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 9191.0 23.01289939880371 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 9191.0 207.60847058823526 0.0 - - - - - - - 127.5 18 6 881 112 C20140711_OR018_04 C20140711_OR018_04 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 13276.0 23.01289939880371 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 13276.0 210.8541176470588 0.0 - - - - - - - 157.85714285714286 26 7 883 112 C20140711_OR018_04 C20140711_OR018_04 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 19403.0 23.01289939880371 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 19403.0 90.09884200128414 0.0 - - - - - - - 170.125 38 8 885 113 C20140711_OR018_04 C20140711_OR018_04 TB432130.[MT7]-NADPETTLLAYLR.3y6_1.heavy 540.962 / 748.472 4200.0 45.79515075683594 43 17 10 6 10 2.844186532845977 29.481180820833107 0.0381011962890625 3 0.972151740106996 7.378197740911205 4200.0 41.9221430249863 0.0 - - - - - - - 184.2 8 5 XDH xanthine dehydrogenase 887 113 C20140711_OR018_04 C20140711_OR018_04 TB432130.[MT7]-NADPETTLLAYLR.3b5_1.heavy 540.962 / 671.312 4712.0 45.79515075683594 43 17 10 6 10 2.844186532845977 29.481180820833107 0.0381011962890625 3 0.972151740106996 7.378197740911205 4712.0 22.987161585365854 0.0 - - - - - - - 239.0 9 6 XDH xanthine dehydrogenase 889 113 C20140711_OR018_04 C20140711_OR018_04 TB432130.[MT7]-NADPETTLLAYLR.3y4_1.heavy 540.962 / 522.304 16389.0 45.79515075683594 43 17 10 6 10 2.844186532845977 29.481180820833107 0.0381011962890625 3 0.972151740106996 7.378197740911205 16389.0 101.02162428819267 0.0 - - - - - - - 179.25 32 4 XDH xanthine dehydrogenase 891 113 C20140711_OR018_04 C20140711_OR018_04 TB432130.[MT7]-NADPETTLLAYLR.3y5_1.heavy 540.962 / 635.388 14135.0 45.79515075683594 43 17 10 6 10 2.844186532845977 29.481180820833107 0.0381011962890625 3 0.972151740106996 7.378197740911205 14135.0 205.4611142993783 0.0 - - - - - - - 190.0 28 7 XDH xanthine dehydrogenase 893 114 C20140711_OR018_04 C20140711_OR018_04 TB443722.[MT7]-ELDASRR.2b3_1.heavy 495.776 / 502.263 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 895 114 C20140711_OR018_04 C20140711_OR018_04 TB443722.[MT7]-ELDASRR.2b4_1.heavy 495.776 / 573.3 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 897 114 C20140711_OR018_04 C20140711_OR018_04 TB443722.[MT7]-ELDASRR.2b6_1.heavy 495.776 / 816.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 899 114 C20140711_OR018_04 C20140711_OR018_04 TB443722.[MT7]-ELDASRR.2y6_1.heavy 495.776 / 717.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 901 115 C20140711_OR018_04 C20140711_OR018_04 TB422745.[MT7]-DNFFIELGQPQWLK[MT7].3b6_1.heavy 675.035 / 910.443 104.0 42.05782508850098 29 11 8 6 4 1.4686159300285886 54.54050612139868 0.03910064697265625 7 0.8717513783153145 3.4086419595349975 104.0 0.1337620578778135 35.0 - - - - - - - 226.54545454545453 2 11 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 903 115 C20140711_OR018_04 C20140711_OR018_04 TB422745.[MT7]-DNFFIELGQPQWLK[MT7].3b4_1.heavy 675.035 / 668.316 1557.0 42.05782508850098 29 11 8 6 4 1.4686159300285886 54.54050612139868 0.03910064697265625 7 0.8717513783153145 3.4086419595349975 1557.0 1.5007228915662651 0.0 - - - - - - - 264.1818181818182 3 11 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 905 115 C20140711_OR018_04 C20140711_OR018_04 TB422745.[MT7]-DNFFIELGQPQWLK[MT7].3b3_1.heavy 675.035 / 521.248 519.0 42.05782508850098 29 11 8 6 4 1.4686159300285886 54.54050612139868 0.03910064697265625 7 0.8717513783153145 3.4086419595349975 519.0 1.6187459807073954 14.0 - - - - - - - 237.35714285714286 3 14 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 907 115 C20140711_OR018_04 C20140711_OR018_04 TB422745.[MT7]-DNFFIELGQPQWLK[MT7].3y5_1.heavy 675.035 / 815.49 831.0 42.05782508850098 29 11 8 6 4 1.4686159300285886 54.54050612139868 0.03910064697265625 7 0.8717513783153145 3.4086419595349975 831.0 2.6586655948553055 4.0 - - - - - - - 259.5 3 6 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 909 116 C20140711_OR018_04 C20140711_OR018_04 TB444237.[MT7]-GRLVAPLLATVTILDDDHAGIFSFQDR.4y8_1.heavy 771.92 / 969.479 1712.0 51.00429916381836 33 18 2 5 8 2.599474152044555 30.72430347823853 0.046600341796875 4 0.9812992785979406 9.010607151184846 1712.0 15.212867132867132 0.0 - - - - - - - 134.0909090909091 3 11 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 911 116 C20140711_OR018_04 C20140711_OR018_04 TB444237.[MT7]-GRLVAPLLATVTILDDDHAGIFSFQDR.4b5_1.heavy 771.92 / 641.422 1903.0 51.00429916381836 33 18 2 5 8 2.599474152044555 30.72430347823853 0.046600341796875 4 0.9812992785979406 9.010607151184846 1903.0 18.896081805775825 2.0 - - - - - - - 180.8 12 15 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 913 116 C20140711_OR018_04 C20140711_OR018_04 TB444237.[MT7]-GRLVAPLLATVTILDDDHAGIFSFQDR.4b7_1.heavy 771.92 / 851.558 2616.0 51.00429916381836 33 18 2 5 8 2.599474152044555 30.72430347823853 0.046600341796875 4 0.9812992785979406 9.010607151184846 2616.0 27.180434329065903 0.0 - - - - - - - 178.5 5 12 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 915 116 C20140711_OR018_04 C20140711_OR018_04 TB444237.[MT7]-GRLVAPLLATVTILDDDHAGIFSFQDR.4y9_1.heavy 771.92 / 1040.52 2331.0 51.00429916381836 33 18 2 5 8 2.599474152044555 30.72430347823853 0.046600341796875 4 0.9812992785979406 9.010607151184846 2331.0 52.79546751968503 0.0 - - - - - - - 127.06666666666666 4 15 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 917 117 C20140711_OR018_04 C20140711_OR018_04 TB422748.[MT7]-AFAGADQESSVEDLSLSR.3y7_1.heavy 676 / 819.421 11596.0 34.59830093383789 50 20 10 10 10 7.884239310351425 12.683531798522068 0.0 3 0.99430836337398 16.350746471072576 11596.0 32.7346290491118 0.0 - - - - - - - 242.42857142857142 23 7 ULK4 unc-51-like kinase 4 (C. elegans) 919 117 C20140711_OR018_04 C20140711_OR018_04 TB422748.[MT7]-AFAGADQESSVEDLSLSR.3y6_1.heavy 676 / 690.378 5468.0 34.59830093383789 50 20 10 10 10 7.884239310351425 12.683531798522068 0.0 3 0.99430836337398 16.350746471072576 5468.0 -0.966077738515903 0.0 - - - - - - - 235.75 10 8 ULK4 unc-51-like kinase 4 (C. elegans) 921 117 C20140711_OR018_04 C20140711_OR018_04 TB422748.[MT7]-AFAGADQESSVEDLSLSR.3b5_1.heavy 676 / 562.311 8391.0 34.59830093383789 50 20 10 10 10 7.884239310351425 12.683531798522068 0.0 3 0.99430836337398 16.350746471072576 8391.0 -1.1860070671378118 0.0 - - - - - - - 255.85714285714286 16 7 ULK4 unc-51-like kinase 4 (C. elegans) 923 117 C20140711_OR018_04 C20140711_OR018_04 TB422748.[MT7]-AFAGADQESSVEDLSLSR.3y5_1.heavy 676 / 575.351 7825.0 34.59830093383789 50 20 10 10 10 7.884239310351425 12.683531798522068 0.0 3 0.99430836337398 16.350746471072576 7825.0 -0.8306794055201703 0.0 - - - - - - - 282.9 15 10 ULK4 unc-51-like kinase 4 (C. elegans) 925 118 C20140711_OR018_04 C20140711_OR018_04 TB443724.[MT7]-GPWFWR.2y4_1.heavy 496.765 / 694.346 695.0 40.80970001220703 37 9 10 10 8 0.9056999243383089 71.13601393830479 0.0 4 0.8157386964375349 2.8296922653558383 695.0 6.785970883434363 0.0 - - - - - - - 0.0 1 0 MMP25 matrix metallopeptidase 25 927 118 C20140711_OR018_04 C20140711_OR018_04 TB443724.[MT7]-GPWFWR.2y5_1.heavy 496.765 / 791.399 811.0 40.80970001220703 37 9 10 10 8 0.9056999243383089 71.13601393830479 0.0 4 0.8157386964375349 2.8296922653558383 811.0 7.271517479602167 1.0 - - - - - - - 0.0 1 0 MMP25 matrix metallopeptidase 25 929 118 C20140711_OR018_04 C20140711_OR018_04 TB443724.[MT7]-GPWFWR.2b4_1.heavy 496.765 / 632.331 811.0 40.80970001220703 37 9 10 10 8 0.9056999243383089 71.13601393830479 0.0 4 0.8157386964375349 2.8296922653558383 811.0 3.695689655172414 2.0 - - - - - - - 0.0 1 0 MMP25 matrix metallopeptidase 25 931 118 C20140711_OR018_04 C20140711_OR018_04 TB443724.[MT7]-GPWFWR.2y3_1.heavy 496.765 / 508.267 1042.0 40.80970001220703 37 9 10 10 8 0.9056999243383089 71.13601393830479 0.0 4 0.8157386964375349 2.8296922653558383 1042.0 4.800736766660196 0.0 - - - - - - - 289.5 2 2 MMP25 matrix metallopeptidase 25 933 119 C20140711_OR018_04 C20140711_OR018_04 TB422213.[MT7]-DAEGIAEWLRR.3y10_2.heavy 487.264 / 600.828 1373.0 32.4211680094401 21 -1 10 6 6 0.1910500824360009 193.45595925929956 0.03730010986328125 5 0.20724992657697158 1.2814145079699995 1373.0 7.548246445497631 0.0 - - - - - - - 158.5 2 4 PDIA2 protein disulfide isomerase family A, member 2 935 119 C20140711_OR018_04 C20140711_OR018_04 TB422213.[MT7]-DAEGIAEWLRR.3b6_1.heavy 487.264 / 701.359 N/A 32.4211680094401 21 -1 10 6 6 0.1910500824360009 193.45595925929956 0.03730010986328125 5 0.20724992657697158 1.2814145079699995 0.0 0.0 15.0 - - - - - - - 0.0 1 0 PDIA2 protein disulfide isomerase family A, member 2 937 119 C20140711_OR018_04 C20140711_OR018_04 TB422213.[MT7]-DAEGIAEWLRR.3b4_1.heavy 487.264 / 517.237 422.0 32.4211680094401 21 -1 10 6 6 0.1910500824360009 193.45595925929956 0.03730010986328125 5 0.20724992657697158 1.2814145079699995 422.0 -0.33280757097791797 12.0 - - - - - - - 232.4 4 5 PDIA2 protein disulfide isomerase family A, member 2 939 119 C20140711_OR018_04 C20140711_OR018_04 TB422213.[MT7]-DAEGIAEWLRR.3y8_2.heavy 487.264 / 500.788 11615.0 32.4211680094401 21 -1 10 6 6 0.1910500824360009 193.45595925929956 0.03730010986328125 5 0.20724992657697158 1.2814145079699995 11615.0 36.95681818181818 0.0 - - - - - - - 264.0 23 2 PDIA2 protein disulfide isomerase family A, member 2 941 120 C20140711_OR018_04 C20140711_OR018_04 TB443725.[MT7]-EITITK[MT7].2y4_1.heavy 496.815 / 606.394 5428.0 26.292299270629883 43 15 10 10 8 2.5360897443548773 34.38823936977572 0.0 4 0.9570217699894789 5.931578328810348 5428.0 40.943161512027494 0.0 - - - - - - - 323.3333333333333 10 6 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 943 120 C20140711_OR018_04 C20140711_OR018_04 TB443725.[MT7]-EITITK[MT7].2y5_1.heavy 496.815 / 719.478 2036.0 26.292299270629883 43 15 10 10 8 2.5360897443548773 34.38823936977572 0.0 4 0.9570217699894789 5.931578328810348 2036.0 20.709677779649148 1.0 - - - - - - - 145.5 4 4 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 945 120 C20140711_OR018_04 C20140711_OR018_04 TB443725.[MT7]-EITITK[MT7].2b4_1.heavy 496.815 / 601.368 1454.0 26.292299270629883 43 15 10 10 8 2.5360897443548773 34.38823936977572 0.0 4 0.9570217699894789 5.931578328810348 1454.0 14.090309278350515 0.0 - - - - - - - 220.45454545454547 2 11 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 947 120 C20140711_OR018_04 C20140711_OR018_04 TB443725.[MT7]-EITITK[MT7].2y3_1.heavy 496.815 / 505.347 2617.0 26.292299270629883 43 15 10 10 8 2.5360897443548773 34.38823936977572 0.0 4 0.9570217699894789 5.931578328810348 2617.0 24.281443298969073 1.0 - - - - - - - 254.625 5 8 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 949 121 C20140711_OR018_04 C20140711_OR018_04 TB422311.[MT7]-YQLAC[CAM]TK[MT7].2y4_1.heavy 586.323 / 623.33 1781.0 24.622075080871582 38 15 10 3 10 4.484129797789274 22.300870962589244 0.0756988525390625 3 0.9552841927927351 5.814335400493302 1781.0 15.061543209876543 0.0 - - - - - - - 206.1818181818182 3 11 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 951 121 C20140711_OR018_04 C20140711_OR018_04 TB422311.[MT7]-YQLAC[CAM]TK[MT7].2y5_1.heavy 586.323 / 736.414 1376.0 24.622075080871582 38 15 10 3 10 4.484129797789274 22.300870962589244 0.0756988525390625 3 0.9552841927927351 5.814335400493302 1376.0 24.929382716049385 1.0 - - - - - - - 162.0 2 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 953 121 C20140711_OR018_04 C20140711_OR018_04 TB422311.[MT7]-YQLAC[CAM]TK[MT7].2y3_1.heavy 586.323 / 552.293 728.0 24.622075080871582 38 15 10 3 10 4.484129797789274 22.300870962589244 0.0756988525390625 3 0.9552841927927351 5.814335400493302 728.0 0.8368850432632879 8.0 - - - - - - - 315.0 2 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 955 121 C20140711_OR018_04 C20140711_OR018_04 TB422311.[MT7]-YQLAC[CAM]TK[MT7].2y6_1.heavy 586.323 / 864.473 890.0 24.622075080871582 38 15 10 3 10 4.484129797789274 22.300870962589244 0.0756988525390625 3 0.9552841927927351 5.814335400493302 890.0 13.07530864197531 0.0 - - - - - - - 0.0 1 0 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 957 122 C20140711_OR018_04 C20140711_OR018_04 TB422606.[MT7]-TYLGVESFDEVLR.3y7_1.heavy 557.962 / 865.441 2903.0 43.3182487487793 40 15 10 5 10 2.0265979266404983 39.374550783835474 0.042999267578125 3 0.9549387485356282 5.791836343635027 2903.0 -0.007997245179063306 0.0 - - - - - - - 363.0 5 1 BAI1 brain-specific angiogenesis inhibitor 1 959 122 C20140711_OR018_04 C20140711_OR018_04 TB422606.[MT7]-TYLGVESFDEVLR.3b4_1.heavy 557.962 / 579.326 4839.0 43.3182487487793 40 15 10 5 10 2.0265979266404983 39.374550783835474 0.042999267578125 3 0.9549387485356282 5.791836343635027 4839.0 -0.7998347107438022 0.0 - - - - - - - 302.5 9 4 BAI1 brain-specific angiogenesis inhibitor 1 961 122 C20140711_OR018_04 C20140711_OR018_04 TB422606.[MT7]-TYLGVESFDEVLR.3y4_1.heavy 557.962 / 516.314 3750.0 43.3182487487793 40 15 10 5 10 2.0265979266404983 39.374550783835474 0.042999267578125 3 0.9549387485356282 5.791836343635027 3750.0 9.917355371900827 0.0 - - - - - - - 328.42857142857144 7 7 BAI1 brain-specific angiogenesis inhibitor 1 963 122 C20140711_OR018_04 C20140711_OR018_04 TB422606.[MT7]-TYLGVESFDEVLR.3y5_1.heavy 557.962 / 631.341 5444.0 43.3182487487793 40 15 10 5 10 2.0265979266404983 39.374550783835474 0.042999267578125 3 0.9549387485356282 5.791836343635027 5444.0 42.29223140495868 0.0 - - - - - - - 181.5 10 4 BAI1 brain-specific angiogenesis inhibitor 1 965 123 C20140711_OR018_04 C20140711_OR018_04 TB422310.[MT7]-C[CAM]SLPDVLGVAGLVRR.3b6_1.heavy 586.005 / 816.404 2333.0 41.60647678375244 42 18 10 6 8 5.202799407349892 19.220421963363027 0.038700103759765625 4 0.9825059958459221 9.317139276175231 2333.0 0.0 2.0 - - - - - - - 233.5 9 10 MMP25 matrix metallopeptidase 25 967 123 C20140711_OR018_04 C20140711_OR018_04 TB422310.[MT7]-C[CAM]SLPDVLGVAGLVRR.3y6_1.heavy 586.005 / 671.431 2333.0 41.60647678375244 42 18 10 6 8 5.202799407349892 19.220421963363027 0.038700103759765625 4 0.9825059958459221 9.317139276175231 2333.0 -3.1655359565807326 2.0 - - - - - - - 225.33333333333334 4 6 MMP25 matrix metallopeptidase 25 969 123 C20140711_OR018_04 C20140711_OR018_04 TB422310.[MT7]-C[CAM]SLPDVLGVAGLVRR.3b5_1.heavy 586.005 / 717.336 6385.0 41.60647678375244 42 18 10 6 8 5.202799407349892 19.220421963363027 0.038700103759765625 4 0.9825059958459221 9.317139276175231 6385.0 72.41524390243902 0.0 - - - - - - - 225.33333333333334 12 6 MMP25 matrix metallopeptidase 25 971 123 C20140711_OR018_04 C20140711_OR018_04 TB422310.[MT7]-C[CAM]SLPDVLGVAGLVRR.3b3_1.heavy 586.005 / 505.256 6262.0 41.60647678375244 42 18 10 6 8 5.202799407349892 19.220421963363027 0.038700103759765625 4 0.9825059958459221 9.317139276175231 6262.0 5.739103869653768 2.0 - - - - - - - 327.44444444444446 12 9 MMP25 matrix metallopeptidase 25 973 124 C20140711_OR018_04 C20140711_OR018_04 TB432006.[MT7]-K[MT7]AEATGEK[MT7].3y3_1.heavy 422.586 / 477.279 4134.0 14.446800231933594 37 15 4 10 8 4.0166970231786845 24.896077404629146 0.0 4 0.955115837348226 5.803337915023593 4134.0 55.46074539932107 1.0 - - - - - - - 99.14285714285714 14 7 HMGA2 high mobility group AT-hook 2 975 124 C20140711_OR018_04 C20140711_OR018_04 TB432006.[MT7]-K[MT7]AEATGEK[MT7].3b3_1.heavy 422.586 / 617.386 850.0 14.446800231933594 37 15 4 10 8 4.0166970231786845 24.896077404629146 0.0 4 0.955115837348226 5.803337915023593 850.0 29.522144522144522 0.0 - - - - - - - 0.0 1 0 HMGA2 high mobility group AT-hook 2 977 124 C20140711_OR018_04 C20140711_OR018_04 TB432006.[MT7]-K[MT7]AEATGEK[MT7].3y4_1.heavy 422.586 / 578.327 1700.0 14.446800231933594 37 15 4 10 8 4.0166970231786845 24.896077404629146 0.0 4 0.955115837348226 5.803337915023593 1700.0 16.1357825567503 0.0 - - - - - - - 141.66666666666666 3 6 HMGA2 high mobility group AT-hook 2 979 124 C20140711_OR018_04 C20140711_OR018_04 TB432006.[MT7]-K[MT7]AEATGEK[MT7].3y5_1.heavy 422.586 / 649.364 850.0 14.446800231933594 37 15 4 10 8 4.0166970231786845 24.896077404629146 0.0 4 0.955115837348226 5.803337915023593 850.0 28.389699381078692 0.0 - - - - - - - 0.0 1 0 HMGA2 high mobility group AT-hook 2 981 125 C20140711_OR018_04 C20140711_OR018_04 TB432201.[MT7]-LC[CAM]DPSAPLAFLQASK[MT7].2b3_1.heavy 953.521 / 533.251 9832.0 42.53670120239258 41 17 10 10 4 2.5063643024393563 39.89842973053578 0.0 9 0.9743787623652101 7.693618855401557 9832.0 42.18791009686812 0.0 - - - - - - - 295.875 19 8 BAI1 brain-specific angiogenesis inhibitor 1 983 125 C20140711_OR018_04 C20140711_OR018_04 TB432201.[MT7]-LC[CAM]DPSAPLAFLQASK[MT7].2b5_1.heavy 953.521 / 717.336 237.0 42.53670120239258 41 17 10 10 4 2.5063643024393563 39.89842973053578 0.0 9 0.9743787623652101 7.693618855401557 237.0 2.2179661016949153 22.0 - - - - - - - 177.33333333333334 3 6 BAI1 brain-specific angiogenesis inhibitor 1 985 125 C20140711_OR018_04 C20140711_OR018_04 TB432201.[MT7]-LC[CAM]DPSAPLAFLQASK[MT7].2y5_1.heavy 953.521 / 690.427 474.0 42.53670120239258 41 17 10 10 4 2.5063643024393563 39.89842973053578 0.0 9 0.9743787623652101 7.693618855401557 474.0 0.7 14.0 - - - - - - - 0.0 1 0 BAI1 brain-specific angiogenesis inhibitor 1 987 125 C20140711_OR018_04 C20140711_OR018_04 TB432201.[MT7]-LC[CAM]DPSAPLAFLQASK[MT7].2y9_1.heavy 953.521 / 1118.67 1777.0 42.53670120239258 41 17 10 10 4 2.5063643024393563 39.89842973053578 0.0 9 0.9743787623652101 7.693618855401557 1777.0 14.21549166845455 0.0 - - - - - - - 192.125 3 8 BAI1 brain-specific angiogenesis inhibitor 1 989 126 C20140711_OR018_04 C20140711_OR018_04 TB422515.[MT7]-IPAFGSIPIEFR.3b6_1.heavy 497.621 / 717.405 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 991 126 C20140711_OR018_04 C20140711_OR018_04 TB422515.[MT7]-IPAFGSIPIEFR.3b5_1.heavy 497.621 / 630.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 993 126 C20140711_OR018_04 C20140711_OR018_04 TB422515.[MT7]-IPAFGSIPIEFR.3y4_1.heavy 497.621 / 564.314 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 995 126 C20140711_OR018_04 C20140711_OR018_04 TB422515.[MT7]-IPAFGSIPIEFR.3y5_1.heavy 497.621 / 661.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 997 127 C20140711_OR018_04 C20140711_OR018_04 TB422801.[MT7]-ITLSAFEAIIQYPILLK[MT7].3b6_1.heavy 741.12 / 777.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 999 127 C20140711_OR018_04 C20140711_OR018_04 TB422801.[MT7]-ITLSAFEAIIQYPILLK[MT7].3b8_1.heavy 741.12 / 977.542 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 1001 127 C20140711_OR018_04 C20140711_OR018_04 TB422801.[MT7]-ITLSAFEAIIQYPILLK[MT7].3b7_1.heavy 741.12 / 906.505 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 1003 127 C20140711_OR018_04 C20140711_OR018_04 TB422801.[MT7]-ITLSAFEAIIQYPILLK[MT7].3y5_1.heavy 741.12 / 727.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 1005 128 C20140711_OR018_04 C20140711_OR018_04 TB432208.[MT7]-IWSLAETATSPDGAPK[MT7].2b3_1.heavy 966.519 / 531.305 2443.0 38.172401428222656 32 14 0 10 8 2.6760803310671912 26.095174458263614 0.0 4 0.9400197831047082 5.0137574973738115 2443.0 15.8795 1.0 - - - - - - - 195.2 23 5 IRX1 iroquois homeobox 1 1007 128 C20140711_OR018_04 C20140711_OR018_04 TB432208.[MT7]-IWSLAETATSPDGAPK[MT7].2y4_1.heavy 966.519 / 516.326 2198.0 38.172401428222656 32 14 0 10 8 2.6760803310671912 26.095174458263614 0.0 4 0.9400197831047082 5.0137574973738115 2198.0 14.213114754098363 1.0 - - - - - - - 244.11111111111111 4 9 IRX1 iroquois homeobox 1 1009 128 C20140711_OR018_04 C20140711_OR018_04 TB432208.[MT7]-IWSLAETATSPDGAPK[MT7].2y10_1.heavy 966.519 / 1088.57 1954.0 38.172401428222656 32 14 0 10 8 2.6760803310671912 26.095174458263614 0.0 4 0.9400197831047082 5.0137574973738115 1954.0 12.546174863387979 0.0 - - - - - - - 195.2 3 10 IRX1 iroquois homeobox 1 1011 128 C20140711_OR018_04 C20140711_OR018_04 TB432208.[MT7]-IWSLAETATSPDGAPK[MT7].2b5_1.heavy 966.519 / 715.426 2443.0 38.172401428222656 32 14 0 10 8 2.6760803310671912 26.095174458263614 0.0 4 0.9400197831047082 5.0137574973738115 2443.0 19.173545081967212 0.0 - - - - - - - 289.875 4 8 IRX1 iroquois homeobox 1 1013 129 C20140711_OR018_04 C20140711_OR018_04 TB432002.[MT7]-EAVAAAGAAGGK[MT7].2y8_1.heavy 630.861 / 746.428 4778.0 30.83674955368042 42 16 10 6 10 2.1546440877254684 39.019394496193144 0.03899955749511719 3 0.9654888903292215 6.624085518424733 4778.0 57.64929961384115 0.0 - - - - - - - 208.33333333333334 9 9 TEX13B testis expressed 13B 1015 129 C20140711_OR018_04 C20140711_OR018_04 TB432002.[MT7]-EAVAAAGAAGGK[MT7].2b4_1.heavy 630.861 / 515.295 5247.0 30.83674955368042 42 16 10 6 10 2.1546440877254684 39.019394496193144 0.03899955749511719 3 0.9654888903292215 6.624085518424733 5247.0 16.371706463414636 0.0 - - - - - - - 272.45454545454544 10 11 TEX13B testis expressed 13B 1017 129 C20140711_OR018_04 C20140711_OR018_04 TB432002.[MT7]-EAVAAAGAAGGK[MT7].2y9_1.heavy 630.861 / 817.465 5715.0 30.83674955368042 42 16 10 6 10 2.1546440877254684 39.019394496193144 0.03899955749511719 3 0.9654888903292215 6.624085518424733 5715.0 33.151067615658356 0.0 - - - - - - - 234.2 11 10 TEX13B testis expressed 13B 1019 129 C20140711_OR018_04 C20140711_OR018_04 TB432002.[MT7]-EAVAAAGAAGGK[MT7].2y10_1.heavy 630.861 / 916.533 3092.0 30.83674955368042 42 16 10 6 10 2.1546440877254684 39.019394496193144 0.03899955749511719 3 0.9654888903292215 6.624085518424733 3092.0 19.61939937394026 0.0 - - - - - - - 204.45454545454547 6 11 TEX13B testis expressed 13B 1021 130 C20140711_OR018_04 C20140711_OR018_04 TB443665.[MT7]-HAADASR.2y5_1.heavy 436.229 / 519.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1023 130 C20140711_OR018_04 C20140711_OR018_04 TB443665.[MT7]-HAADASR.2b4_1.heavy 436.229 / 539.269 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1025 130 C20140711_OR018_04 C20140711_OR018_04 TB443665.[MT7]-HAADASR.2y3_1.heavy 436.229 / 333.188 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1027 130 C20140711_OR018_04 C20140711_OR018_04 TB443665.[MT7]-HAADASR.2y6_1.heavy 436.229 / 590.289 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1029 131 C20140711_OR018_04 C20140711_OR018_04 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 78182.0 32.50830078125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 78182.0 419.61052770173626 0.0 - - - - - - - 270.4 156 5 1031 131 C20140711_OR018_04 C20140711_OR018_04 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 69302.0 32.50830078125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 69302.0 360.1721204301963 0.0 - - - - - - - 217.25 138 8 1033 131 C20140711_OR018_04 C20140711_OR018_04 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 147002.0 32.50830078125 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 147002.0 177.6280546377319 0.0 - - - - - - - 303.7142857142857 294 7 1035 132 C20140711_OR018_04 C20140711_OR018_04 TB432146.[MT7]-ILC[CAM]EDPLPPIPK[MT7].2b4_1.heavy 840.486 / 660.351 1832.0 39.333298683166504 37 12 10 5 10 1.2735159331811443 50.22988943709179 0.044399261474609375 3 0.8864757164988548 3.62761437425216 1832.0 8.20896174863388 0.0 - - - - - - - 299.45454545454544 3 11 ULK4 unc-51-like kinase 4 (C. elegans) 1037 132 C20140711_OR018_04 C20140711_OR018_04 TB432146.[MT7]-ILC[CAM]EDPLPPIPK[MT7].2b6_1.heavy 840.486 / 872.43 1709.0 39.333298683166504 37 12 10 5 10 1.2735159331811443 50.22988943709179 0.044399261474609375 3 0.8864757164988548 3.62761437425216 1709.0 2.9619787310178243 0.0 - - - - - - - 284.6666666666667 3 6 ULK4 unc-51-like kinase 4 (C. elegans) 1039 132 C20140711_OR018_04 C20140711_OR018_04 TB432146.[MT7]-ILC[CAM]EDPLPPIPK[MT7].2b7_1.heavy 840.486 / 985.515 5373.0 39.333298683166504 37 12 10 5 10 1.2735159331811443 50.22988943709179 0.044399261474609375 3 0.8864757164988548 3.62761437425216 5373.0 15.843221271229641 0.0 - - - - - - - 298.22222222222223 10 9 ULK4 unc-51-like kinase 4 (C. elegans) 1041 132 C20140711_OR018_04 C20140711_OR018_04 TB432146.[MT7]-ILC[CAM]EDPLPPIPK[MT7].2b5_1.heavy 840.486 / 775.378 4762.0 39.333298683166504 37 12 10 5 10 1.2735159331811443 50.22988943709179 0.044399261474609375 3 0.8864757164988548 3.62761437425216 4762.0 12.195188470885192 0.0 - - - - - - - 277.27272727272725 9 11 ULK4 unc-51-like kinase 4 (C. elegans) 1043 133 C20140711_OR018_04 C20140711_OR018_04 TB444230.[MT7]-DAFGGVYSGPSLLDVSQTSVTALPSK[MT7].4b7_1.heavy 721.885 / 854.417 3444.0 43.76530075073242 48 18 10 10 10 7.163150486387783 13.960337729890101 0.0 3 0.989055263789863 11.785901848111086 3444.0 49.11794053662074 0.0 - - - - - - - 178.72727272727272 6 11 TSHR thyroid stimulating hormone receptor 1045 133 C20140711_OR018_04 C20140711_OR018_04 TB444230.[MT7]-DAFGGVYSGPSLLDVSQTSVTALPSK[MT7].4b4_1.heavy 721.885 / 535.263 2558.0 43.76530075073242 48 18 10 10 10 7.163150486387783 13.960337729890101 0.0 3 0.989055263789863 11.785901848111086 2558.0 8.234807220614577 0.0 - - - - - - - 277.45454545454544 5 11 TSHR thyroid stimulating hormone receptor 1047 133 C20140711_OR018_04 C20140711_OR018_04 TB444230.[MT7]-DAFGGVYSGPSLLDVSQTSVTALPSK[MT7].4b5_1.heavy 721.885 / 592.285 9250.0 43.76530075073242 48 18 10 10 10 7.163150486387783 13.960337729890101 0.0 3 0.989055263789863 11.785901848111086 9250.0 32.41040963886506 0.0 - - - - - - - 315.0 18 10 TSHR thyroid stimulating hormone receptor 1049 133 C20140711_OR018_04 C20140711_OR018_04 TB444230.[MT7]-DAFGGVYSGPSLLDVSQTSVTALPSK[MT7].4b6_1.heavy 721.885 / 691.353 11316.0 43.76530075073242 48 18 10 10 10 7.163150486387783 13.960337729890101 0.0 3 0.989055263789863 11.785901848111086 11316.0 141.5224130058803 0.0 - - - - - - - 245.9 22 10 TSHR thyroid stimulating hormone receptor 1051 134 C20140711_OR018_04 C20140711_OR018_04 TB422218.[MT7]-LSVSYLR.2y4_1.heavy 491.296 / 538.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHR;AHRR aryl hydrocarbon receptor;aryl-hydrocarbon receptor repressor 1053 134 C20140711_OR018_04 C20140711_OR018_04 TB422218.[MT7]-LSVSYLR.2y5_1.heavy 491.296 / 637.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHR;AHRR aryl hydrocarbon receptor;aryl-hydrocarbon receptor repressor 1055 134 C20140711_OR018_04 C20140711_OR018_04 TB422218.[MT7]-LSVSYLR.2b4_1.heavy 491.296 / 531.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHR;AHRR aryl hydrocarbon receptor;aryl-hydrocarbon receptor repressor 1057 134 C20140711_OR018_04 C20140711_OR018_04 TB422218.[MT7]-LSVSYLR.2y6_1.heavy 491.296 / 724.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHR;AHRR aryl hydrocarbon receptor;aryl-hydrocarbon receptor repressor 1059 135 C20140711_OR018_04 C20140711_OR018_04 TB422808.[MT7]-SPFQPVRDNSLAPQEGTPR.4y5_1.heavy 560.794 / 559.284 8544.0 29.509249687194824 43 17 10 6 10 2.204383844452754 36.25191298754068 0.03809928894042969 3 0.9745782850015804 7.723881214436008 8544.0 33.896990576133106 0.0 - - - - - - - 343.8 17 10 IRX1 iroquois homeobox 1 1061 135 C20140711_OR018_04 C20140711_OR018_04 TB422808.[MT7]-SPFQPVRDNSLAPQEGTPR.4y7_1.heavy 560.794 / 784.395 6088.0 29.509249687194824 43 17 10 6 10 2.204383844452754 36.25191298754068 0.03809928894042969 3 0.9745782850015804 7.723881214436008 6088.0 61.49616359782202 0.0 - - - - - - - 245.375 12 8 IRX1 iroquois homeobox 1 1063 135 C20140711_OR018_04 C20140711_OR018_04 TB422808.[MT7]-SPFQPVRDNSLAPQEGTPR.4y6_1.heavy 560.794 / 687.342 5499.0 29.509249687194824 43 17 10 6 10 2.204383844452754 36.25191298754068 0.03809928894042969 3 0.9745782850015804 7.723881214436008 5499.0 23.0087509522551 0.0 - - - - - - - 264.46153846153845 10 13 IRX1 iroquois homeobox 1 1065 135 C20140711_OR018_04 C20140711_OR018_04 TB422808.[MT7]-SPFQPVRDNSLAPQEGTPR.4b10_2.heavy 560.794 / 636.826 8053.0 29.509249687194824 43 17 10 6 10 2.204383844452754 36.25191298754068 0.03809928894042969 3 0.9745782850015804 7.723881214436008 8053.0 -4.10169779286927 0.0 - - - - - - - 196.4 16 5 IRX1 iroquois homeobox 1 1067 136 C20140711_OR018_04 C20140711_OR018_04 TB422741.[MT7]-ETPGPTK[MT7]PLPWTAGK[MT7].4y4_1.heavy 503.794 / 520.321 3148.0 30.509199619293213 40 14 10 6 10 1.446331777799719 46.238919531868426 0.03800010681152344 3 0.9447816342580202 5.227591362074299 3148.0 21.258841153893773 0.0 - - - - - - - 250.36363636363637 6 11 AHRR aryl-hydrocarbon receptor repressor 1069 136 C20140711_OR018_04 C20140711_OR018_04 TB422741.[MT7]-ETPGPTK[MT7]PLPWTAGK[MT7].4b7_2.heavy 503.794 / 500.289 3837.0 30.509199619293213 40 14 10 6 10 1.446331777799719 46.238919531868426 0.03800010681152344 3 0.9447816342580202 5.227591362074299 3837.0 19.661122157916495 0.0 - - - - - - - 268.3636363636364 7 11 AHRR aryl-hydrocarbon receptor repressor 1071 136 C20140711_OR018_04 C20140711_OR018_04 TB422741.[MT7]-ETPGPTK[MT7]PLPWTAGK[MT7].4b4_1.heavy 503.794 / 529.274 2164.0 30.509199619293213 40 14 10 6 10 1.446331777799719 46.238919531868426 0.03800010681152344 3 0.9447816342580202 5.227591362074299 2164.0 6.602033898305085 0.0 - - - - - - - 268.27272727272725 4 11 AHRR aryl-hydrocarbon receptor repressor 1073 136 C20140711_OR018_04 C20140711_OR018_04 TB422741.[MT7]-ETPGPTK[MT7]PLPWTAGK[MT7].4b9_2.heavy 503.794 / 605.358 3443.0 30.509199619293213 40 14 10 6 10 1.446331777799719 46.238919531868426 0.03800010681152344 3 0.9447816342580202 5.227591362074299 3443.0 2.682751771617095 0.0 - - - - - - - 334.6 6 5 AHRR aryl-hydrocarbon receptor repressor 1075 137 C20140711_OR018_04 C20140711_OR018_04 TB422411.[MT7]-RPEITNWVR.3b6_1.heavy 438.918 / 855.481 687.0 30.9439754486084 35 12 10 3 10 1.842559566227707 44.98020199052688 0.07789993286132812 3 0.8984613875717051 3.8397377570016706 687.0 -1.048854961832061 0.0 - - - - - - - 0.0 1 0 ULK4 unc-51-like kinase 4 (C. elegans) 1077 137 C20140711_OR018_04 C20140711_OR018_04 TB422411.[MT7]-RPEITNWVR.3y4_1.heavy 438.918 / 574.31 5303.0 30.9439754486084 35 12 10 3 10 1.842559566227707 44.98020199052688 0.07789993286132812 3 0.8984613875717051 3.8397377570016706 5303.0 -3.787857142857149 0.0 - - - - - - - 163.66666666666666 10 3 ULK4 unc-51-like kinase 4 (C. elegans) 1079 137 C20140711_OR018_04 C20140711_OR018_04 TB422411.[MT7]-RPEITNWVR.3b3_1.heavy 438.918 / 527.306 2750.0 30.9439754486084 35 12 10 3 10 1.842559566227707 44.98020199052688 0.07789993286132812 3 0.8984613875717051 3.8397377570016706 2750.0 -1.6802443991853364 0.0 - - - - - - - 314.2 5 5 ULK4 unc-51-like kinase 4 (C. elegans) 1081 137 C20140711_OR018_04 C20140711_OR018_04 TB422411.[MT7]-RPEITNWVR.3y5_1.heavy 438.918 / 675.357 2062.0 30.9439754486084 35 12 10 3 10 1.842559566227707 44.98020199052688 0.07789993286132812 3 0.8984613875717051 3.8397377570016706 2062.0 -3.156122448979593 0.0 - - - - - - - 196.22222222222223 4 9 ULK4 unc-51-like kinase 4 (C. elegans) 1083 138 C20140711_OR018_04 C20140711_OR018_04 TB422807.[MT7]-SPFQPVRDNSLAPQEGTPR.3y18_2.heavy 747.39 / 1005.01 12472.0 29.509249687194824 43 17 10 6 10 5.674125380510575 17.623861528241676 0.03809928894042969 3 0.9762082245746565 7.9851689654044975 12472.0 -0.06363265306122656 0.0 - - - - - - - 245.5 24 6 IRX1 iroquois homeobox 1 1085 138 C20140711_OR018_04 C20140711_OR018_04 TB422807.[MT7]-SPFQPVRDNSLAPQEGTPR.3y7_1.heavy 747.39 / 784.395 6972.0 29.509249687194824 43 17 10 6 10 5.674125380510575 17.623861528241676 0.03809928894042969 3 0.9762082245746565 7.9851689654044975 6972.0 -2.363389830508474 0.0 - - - - - - - 216.0 13 5 IRX1 iroquois homeobox 1 1087 138 C20140711_OR018_04 C20140711_OR018_04 TB422807.[MT7]-SPFQPVRDNSLAPQEGTPR.3y15_2.heavy 747.39 / 818.924 3633.0 29.509249687194824 43 17 10 6 10 5.674125380510575 17.623861528241676 0.03809928894042969 3 0.9762082245746565 7.9851689654044975 3633.0 39.656995637949834 0.0 - - - - - - - 196.33333333333334 7 6 IRX1 iroquois homeobox 1 1089 138 C20140711_OR018_04 C20140711_OR018_04 TB422807.[MT7]-SPFQPVRDNSLAPQEGTPR.3y8_1.heavy 747.39 / 855.432 2160.0 29.509249687194824 43 17 10 6 10 5.674125380510575 17.623861528241676 0.03809928894042969 3 0.9762082245746565 7.9851689654044975 2160.0 28.85030785195434 0.0 - - - - - - - 275.0 4 5 IRX1 iroquois homeobox 1 1091 139 C20140711_OR018_04 C20140711_OR018_04 TB422740.[MT7]-VGDAQGMFEPDGGGRPK[MT7].4b16_2.heavy 502.256 / 858.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1093 139 C20140711_OR018_04 C20140711_OR018_04 TB422740.[MT7]-VGDAQGMFEPDGGGRPK[MT7].4b11_2.heavy 502.256 / 646.291 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1095 139 C20140711_OR018_04 C20140711_OR018_04 TB422740.[MT7]-VGDAQGMFEPDGGGRPK[MT7].4y6_1.heavy 502.256 / 715.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1097 139 C20140711_OR018_04 C20140711_OR018_04 TB422740.[MT7]-VGDAQGMFEPDGGGRPK[MT7].4b6_1.heavy 502.256 / 672.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1099 140 C20140711_OR018_04 C20140711_OR018_04 TB431922.[MT7]-ESTSTLK[MT7].2y4_1.heavy 527.305 / 592.379 2759.0 18.844600677490234 48 18 10 10 10 6.099840403311312 16.393871542231626 0.0 3 0.9891681001377212 11.847241766531829 2759.0 27.889891304347827 0.0 - - - - - - - 172.5 5 6 IRX3;IRX1 iroquois homeobox 3;iroquois homeobox 1 1101 140 C20140711_OR018_04 C20140711_OR018_04 TB431922.[MT7]-ESTSTLK[MT7].2y5_1.heavy 527.305 / 693.426 2139.0 18.844600677490234 48 18 10 10 10 6.099840403311312 16.393871542231626 0.0 3 0.9891681001377212 11.847241766531829 2139.0 38.85333333333333 0.0 - - - - - - - 124.2 4 5 IRX3;IRX1 iroquois homeobox 3;iroquois homeobox 1 1103 140 C20140711_OR018_04 C20140711_OR018_04 TB431922.[MT7]-ESTSTLK[MT7].2y3_1.heavy 527.305 / 505.347 1932.0 18.844600677490234 48 18 10 10 10 6.099840403311312 16.393871542231626 0.0 3 0.9891681001377212 11.847241766531829 1932.0 1.366666666666667 4.0 - - - - - - - 201.69230769230768 5 13 IRX3;IRX1 iroquois homeobox 3;iroquois homeobox 1 1105 140 C20140711_OR018_04 C20140711_OR018_04 TB431922.[MT7]-ESTSTLK[MT7].2y6_1.heavy 527.305 / 780.458 6071.0 18.844600677490234 48 18 10 10 10 6.099840403311312 16.393871542231626 0.0 3 0.9891681001377212 11.847241766531829 6071.0 108.22217391304348 0.0 - - - - - - - 131.72727272727272 12 11 IRX3;IRX1 iroquois homeobox 3;iroquois homeobox 1 1107 141 C20140711_OR018_04 C20140711_OR018_04 TB431921.[MT7]-NTWTLK[MT7].2y4_1.heavy 525.813 / 691.426 1967.0 29.891499996185303 44 18 10 6 10 2.402699063776621 32.796652067800046 0.03880119323730469 3 0.9814018782350903 9.035505010335896 1967.0 6.001016949152543 1.0 - - - - - - - 196.54545454545453 3 11 TSHR thyroid stimulating hormone receptor 1109 141 C20140711_OR018_04 C20140711_OR018_04 TB431921.[MT7]-NTWTLK[MT7].2y5_1.heavy 525.813 / 792.474 3738.0 29.891499996185303 44 18 10 6 10 2.402699063776621 32.796652067800046 0.03880119323730469 3 0.9814018782350903 9.035505010335896 3738.0 26.56446700507614 0.0 - - - - - - - 229.33333333333334 7 12 TSHR thyroid stimulating hormone receptor 1111 141 C20140711_OR018_04 C20140711_OR018_04 TB431921.[MT7]-NTWTLK[MT7].2b4_1.heavy 525.813 / 647.327 984.0 29.891499996185303 44 18 10 6 10 2.402699063776621 32.796652067800046 0.03880119323730469 3 0.9814018782350903 9.035505010335896 984.0 4.595329949238579 6.0 - - - - - - - 0.0 1 0 TSHR thyroid stimulating hormone receptor 1113 141 C20140711_OR018_04 C20140711_OR018_04 TB431921.[MT7]-NTWTLK[MT7].2y3_1.heavy 525.813 / 505.347 5311.0 29.891499996185303 44 18 10 6 10 2.402699063776621 32.796652067800046 0.03880119323730469 3 0.9814018782350903 9.035505010335896 5311.0 67.6835603597371 0.0 - - - - - - - 245.91666666666666 10 12 TSHR thyroid stimulating hormone receptor 1115 142 C20140711_OR018_04 C20140711_OR018_04 TB422751.[MT7]-GIDWYMDFFPTPSNTTSDFLFEK[MT7].3y3_1.heavy 1016.15 / 567.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1117 142 C20140711_OR018_04 C20140711_OR018_04 TB422751.[MT7]-GIDWYMDFFPTPSNTTSDFLFEK[MT7].3b5_1.heavy 1016.15 / 779.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1119 142 C20140711_OR018_04 C20140711_OR018_04 TB422751.[MT7]-GIDWYMDFFPTPSNTTSDFLFEK[MT7].3y4_1.heavy 1016.15 / 680.41 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1121 142 C20140711_OR018_04 C20140711_OR018_04 TB422751.[MT7]-GIDWYMDFFPTPSNTTSDFLFEK[MT7].3b7_1.heavy 1016.15 / 1025.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1123 143 C20140711_OR018_04 C20140711_OR018_04 TB422399.[MT7]-GGPDLVLDPK[MT7].3b6_1.heavy 433.59 / 683.385 1031.0 31.894500732421875 48 18 10 10 10 4.673554132195462 21.39699191908658 0.0 3 0.98308618842567 9.476055320251362 1031.0 5.5133689839572195 1.0 - - - - - - - 168.6 2 5 AHRR aryl-hydrocarbon receptor repressor 1125 143 C20140711_OR018_04 C20140711_OR018_04 TB422399.[MT7]-GGPDLVLDPK[MT7].3b4_1.heavy 433.59 / 471.232 10403.0 31.894500732421875 48 18 10 10 10 4.673554132195462 21.39699191908658 0.0 3 0.98308618842567 9.476055320251362 10403.0 81.15155921568628 0.0 - - - - - - - 281.0 20 8 AHRR aryl-hydrocarbon receptor repressor 1127 143 C20140711_OR018_04 C20140711_OR018_04 TB422399.[MT7]-GGPDLVLDPK[MT7].3b5_1.heavy 433.59 / 584.316 6748.0 31.894500732421875 48 18 10 10 10 4.673554132195462 21.39699191908658 0.0 3 0.98308618842567 9.476055320251362 6748.0 57.21295145298495 0.0 - - - - - - - 140.5 13 6 AHRR aryl-hydrocarbon receptor repressor 1129 143 C20140711_OR018_04 C20140711_OR018_04 TB422399.[MT7]-GGPDLVLDPK[MT7].3y4_1.heavy 433.59 / 616.379 843.0 31.894500732421875 48 18 10 10 10 4.673554132195462 21.39699191908658 0.0 3 0.98308618842567 9.476055320251362 843.0 -1.7999999999999998 2.0 - - - - - - - 200.71428571428572 3 7 AHRR aryl-hydrocarbon receptor repressor 1131 144 C20140711_OR018_04 C20140711_OR018_04 TB422398.[MT7]-YALSGSVWK[MT7].3b6_1.heavy 433.583 / 723.379 571.0 34.569650650024414 22 10 0 6 6 1.1869139325203966 66.61771282358089 0.03820037841796875 5 0.8343554585253613 2.989427917819396 571.0 1.9042105263157896 1.0 - - - - - - - 0.0 1 0 MMP25 matrix metallopeptidase 25 1133 144 C20140711_OR018_04 C20140711_OR018_04 TB422398.[MT7]-YALSGSVWK[MT7].3b4_1.heavy 433.583 / 579.326 951.0 34.569650650024414 22 10 0 6 6 1.1869139325203966 66.61771282358089 0.03820037841796875 5 0.8343554585253613 2.989427917819396 951.0 3.0031578947368422 1.0 - - - - - - - 0.0 1 0 MMP25 matrix metallopeptidase 25 1135 144 C20140711_OR018_04 C20140711_OR018_04 TB422398.[MT7]-YALSGSVWK[MT7].3b5_1.heavy 433.583 / 636.347 1617.0 34.569650650024414 22 10 0 6 6 1.1869139325203966 66.61771282358089 0.03820037841796875 5 0.8343554585253613 2.989427917819396 1617.0 22.978421052631578 0.0 - - - - - - - 205.83333333333334 3 6 MMP25 matrix metallopeptidase 25 1137 144 C20140711_OR018_04 C20140711_OR018_04 TB422398.[MT7]-YALSGSVWK[MT7].3b3_1.heavy 433.583 / 492.294 951.0 34.569650650024414 22 10 0 6 6 1.1869139325203966 66.61771282358089 0.03820037841796875 5 0.8343554585253613 2.989427917819396 951.0 11.987605263157892 2.0 - - - - - - - 154.375 12 8 MMP25 matrix metallopeptidase 25 1139 145 C20140711_OR018_04 C20140711_OR018_04 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 157400.0 26.89150047302246 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 157400.0 532.2707044581259 0.0 - - - - - - - 1377.0 314 1 1141 145 C20140711_OR018_04 C20140711_OR018_04 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 194979.0 26.89150047302246 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 194979.0 233.9858929176517 0.0 - - - - - - - 2803.5 389 2 1143 145 C20140711_OR018_04 C20140711_OR018_04 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 250955.0 26.89150047302246 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 250955.0 318.36027928358357 0.0 - - - - - - - 1869.0 501 1 1145 146 C20140711_OR018_04 C20140711_OR018_04 TB431927.[MT7]-TQSFVAK[MT7].2y5_2.heavy 534.818 / 348.214 171.0 23.248899459838867 33 9 6 10 8 3.209880674976121 24.38135532947284 0.0 4 0.8154253054812496 2.8272097223810837 171.0 -0.5 41.0 - - - - - - - 237.92857142857142 2 14 XDH xanthine dehydrogenase 1147 146 C20140711_OR018_04 C20140711_OR018_04 TB431927.[MT7]-TQSFVAK[MT7].2y5_1.heavy 534.818 / 695.421 2137.0 23.248899459838867 33 9 6 10 8 3.209880674976121 24.38135532947284 0.0 4 0.8154253054812496 2.8272097223810837 2137.0 12.713285201937133 0.0 - - - - - - - 234.75 4 8 XDH xanthine dehydrogenase 1149 146 C20140711_OR018_04 C20140711_OR018_04 TB431927.[MT7]-TQSFVAK[MT7].2y6_1.heavy 534.818 / 823.479 940.0 23.248899459838867 33 9 6 10 8 3.209880674976121 24.38135532947284 0.0 4 0.8154253054812496 2.8272097223810837 940.0 11.384121087031302 1.0 - - - - - - - 217.36363636363637 7 11 XDH xanthine dehydrogenase 1151 146 C20140711_OR018_04 C20140711_OR018_04 TB431927.[MT7]-TQSFVAK[MT7].2b5_1.heavy 534.818 / 707.385 769.0 23.248899459838867 33 9 6 10 8 3.209880674976121 24.38135532947284 0.0 4 0.8154253054812496 2.8272097223810837 769.0 2.8346323458920524 0.0 - - - - - - - 0.0 1 0 XDH xanthine dehydrogenase 1153 147 C20140711_OR018_04 C20140711_OR018_04 TB422259.[MT7]-AQHPDAK[MT7].2y6_1.heavy 527.798 / 839.449 24.0 13.538000106811523 48 18 10 10 10 5.652306886421525 17.69189147182169 0.0 3 0.985527690673882 10.246328749789301 24.0 1.912 14.0 - - - - - - - 0.0 0 0 XDH xanthine dehydrogenase 1155 147 C20140711_OR018_04 C20140711_OR018_04 TB422259.[MT7]-AQHPDAK[MT7].2y4_1.heavy 527.798 / 574.332 2069.0 13.538000106811523 48 18 10 10 10 5.652306886421525 17.69189147182169 0.0 3 0.985527690673882 10.246328749789301 2069.0 30.7886285115304 0.0 - - - - - - - 115.9090909090909 4 11 XDH xanthine dehydrogenase 1157 147 C20140711_OR018_04 C20140711_OR018_04 TB422259.[MT7]-AQHPDAK[MT7].2b5_1.heavy 527.798 / 693.344 722.0 13.538000106811523 48 18 10 10 10 5.652306886421525 17.69189147182169 0.0 3 0.985527690673882 10.246328749789301 722.0 38.105555555555554 0.0 - - - - - - - 0.0 1 0 XDH xanthine dehydrogenase 1159 147 C20140711_OR018_04 C20140711_OR018_04 TB422259.[MT7]-AQHPDAK[MT7].2y5_1.heavy 527.798 / 711.391 457.0 13.538000106811523 48 18 10 10 10 5.652306886421525 17.69189147182169 0.0 3 0.985527690673882 10.246328749789301 457.0 12.662708333333333 0.0 - - - - - - - 0.0 0 0 XDH xanthine dehydrogenase 1161 148 C20140711_OR018_04 C20140711_OR018_04 TB422502.[MT7]-TLLSPEEILLSIEIPYSR.3b4_1.heavy 739.755 / 559.357 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 1163 148 C20140711_OR018_04 C20140711_OR018_04 TB422502.[MT7]-TLLSPEEILLSIEIPYSR.3y4_1.heavy 739.755 / 522.267 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 1165 148 C20140711_OR018_04 C20140711_OR018_04 TB422502.[MT7]-TLLSPEEILLSIEIPYSR.3y8_1.heavy 739.755 / 964.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 1167 148 C20140711_OR018_04 C20140711_OR018_04 TB422502.[MT7]-TLLSPEEILLSIEIPYSR.3b7_1.heavy 739.755 / 914.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 1169 149 C20140711_OR018_04 C20140711_OR018_04 TB422656.[MT7]-K[MT7]LPLSLSFLHLTR.4y5_1.heavy 454.038 / 639.394 1482.0 41.356300354003906 43 13 10 10 10 2.0595926479448607 37.081881758639966 0.0 3 0.9083863600640742 4.0458479220134445 1482.0 -9.639024390243904 0.0 - - - - - - - 246.5 2 2 TSHR thyroid stimulating hormone receptor 1171 149 C20140711_OR018_04 C20140711_OR018_04 TB422656.[MT7]-K[MT7]LPLSLSFLHLTR.4y4_1.heavy 454.038 / 526.31 3581.0 41.356300354003906 43 13 10 10 10 2.0595926479448607 37.081881758639966 0.0 3 0.9083863600640742 4.0458479220134445 3581.0 0.0 0.0 - - - - - - - 185.0 7 2 TSHR thyroid stimulating hormone receptor 1173 149 C20140711_OR018_04 C20140711_OR018_04 TB422656.[MT7]-K[MT7]LPLSLSFLHLTR.4y7_1.heavy 454.038 / 873.494 988.0 41.356300354003906 43 13 10 10 10 2.0595926479448607 37.081881758639966 0.0 3 0.9083863600640742 4.0458479220134445 988.0 -0.16065040650406548 0.0 - - - - - - - 0.0 1 0 TSHR thyroid stimulating hormone receptor 1175 149 C20140711_OR018_04 C20140711_OR018_04 TB422656.[MT7]-K[MT7]LPLSLSFLHLTR.4y3_1.heavy 454.038 / 389.251 6916.0 41.356300354003906 43 13 10 10 10 2.0595926479448607 37.081881758639966 0.0 3 0.9083863600640742 4.0458479220134445 6916.0 -4.498211382113816 0.0 - - - - - - - 246.75 13 4 TSHR thyroid stimulating hormone receptor 1177 150 C20140711_OR018_04 C20140711_OR018_04 TB444076.[MT7]-SAALVLASNLTELK[MT7].3y3_1.heavy 573.348 / 533.341 75532.0 44.18280029296875 48 18 10 10 10 7.111567195633441 14.06159813288424 0.0 3 0.9895732733472491 12.075643867362649 75532.0 194.37423143350605 0.0 - - - - - - - 799.4285714285714 151 7 TEX13B testis expressed 13B 1179 150 C20140711_OR018_04 C20140711_OR018_04 TB444076.[MT7]-SAALVLASNLTELK[MT7].3b6_1.heavy 573.348 / 699.452 65114.0 44.18280029296875 48 18 10 10 10 7.111567195633441 14.06159813288424 0.0 3 0.9895732733472491 12.075643867362649 65114.0 272.75641299420477 0.0 - - - - - - - 171.22222222222223 130 9 TEX13B testis expressed 13B 1181 150 C20140711_OR018_04 C20140711_OR018_04 TB444076.[MT7]-SAALVLASNLTELK[MT7].3b5_1.heavy 573.348 / 586.368 241354.0 44.18280029296875 48 18 10 10 10 7.111567195633441 14.06159813288424 0.0 3 0.9895732733472491 12.075643867362649 241354.0 366.8334658055626 0.0 - - - - - - - 730.5714285714286 482 7 TEX13B testis expressed 13B 1183 150 C20140711_OR018_04 C20140711_OR018_04 TB444076.[MT7]-SAALVLASNLTELK[MT7].3y4_1.heavy 573.348 / 634.389 145179.0 44.18280029296875 48 18 10 10 10 7.111567195633441 14.06159813288424 0.0 3 0.9895732733472491 12.075643867362649 145179.0 669.3709227145597 0.0 - - - - - - - 305.1666666666667 290 6 TEX13B testis expressed 13B 1185 151 C20140711_OR018_04 C20140711_OR018_04 TB422659.[MT7]-DQGSPLAAADVLK[MT7]PQDSPLGLAK[MT7].3y7_1.heavy 908.515 / 829.526 4006.0 38.86739921569824 46 20 10 6 10 9.327424181182455 10.721073477256914 0.039402008056640625 3 0.9927323911836201 14.467824218630666 4006.0 36.98305617100734 0.0 - - - - - - - 146.85714285714286 8 7 IRX1 iroquois homeobox 1 1187 151 C20140711_OR018_04 C20140711_OR018_04 TB422659.[MT7]-DQGSPLAAADVLK[MT7]PQDSPLGLAK[MT7].3b10_1.heavy 908.515 / 1070.52 1602.0 38.86739921569824 46 20 10 6 10 9.327424181182455 10.721073477256914 0.039402008056640625 3 0.9927323911836201 14.467824218630666 1602.0 5.596506550218341 1.0 - - - - - - - 240.2 3 10 IRX1 iroquois homeobox 1 1189 151 C20140711_OR018_04 C20140711_OR018_04 TB422659.[MT7]-DQGSPLAAADVLK[MT7]PQDSPLGLAK[MT7].3b8_1.heavy 908.515 / 884.459 916.0 38.86739921569824 46 20 10 6 10 9.327424181182455 10.721073477256914 0.039402008056640625 3 0.9927323911836201 14.467824218630666 916.0 1.8405594405594405 2.0 - - - - - - - 0.0 1 0 IRX1 iroquois homeobox 1 1191 151 C20140711_OR018_04 C20140711_OR018_04 TB422659.[MT7]-DQGSPLAAADVLK[MT7]PQDSPLGLAK[MT7].3b7_1.heavy 908.515 / 813.422 2060.0 38.86739921569824 46 20 10 6 10 9.327424181182455 10.721073477256914 0.039402008056640625 3 0.9927323911836201 14.467824218630666 2060.0 5.802246151916988 1.0 - - - - - - - 228.66666666666666 4 9 IRX1 iroquois homeobox 1 1193 152 C20140711_OR018_04 C20140711_OR018_04 TB444078.[MT7]-EAVAAAGAAGGK[MT7]GEER.4y10_2.heavy 433.736 / 538.284 7737.0 19.42970085144043 39 9 10 10 10 1.147075501172283 60.5638907869472 0.0 3 0.8017439069682888 2.724569759271729 7737.0 41.008703139699904 0.0 - - - - - - - 130.0 15 5 TEX13B testis expressed 13B 1195 152 C20140711_OR018_04 C20140711_OR018_04 TB444078.[MT7]-EAVAAAGAAGGK[MT7]GEER.4b4_1.heavy 433.736 / 515.295 2675.0 19.42970085144043 39 9 10 10 10 1.147075501172283 60.5638907869472 0.0 3 0.8017439069682888 2.724569759271729 2675.0 26.52385984427141 0.0 - - - - - - - 156.66666666666666 5 6 TEX13B testis expressed 13B 1197 152 C20140711_OR018_04 C20140711_OR018_04 TB444078.[MT7]-EAVAAAGAAGGK[MT7]GEER.4b5_1.heavy 433.736 / 586.332 6001.0 19.42970085144043 39 9 10 10 10 1.147075501172283 60.5638907869472 0.0 3 0.8017439069682888 2.724569759271729 6001.0 97.24609003831418 0.0 - - - - - - - 134.28571428571428 12 7 TEX13B testis expressed 13B 1199 152 C20140711_OR018_04 C20140711_OR018_04 TB444078.[MT7]-EAVAAAGAAGGK[MT7]GEER.4b3_1.heavy 433.736 / 444.258 5061.0 19.42970085144043 39 9 10 10 10 1.147075501172283 60.5638907869472 0.0 3 0.8017439069682888 2.724569759271729 5061.0 78.67802191464821 0.0 - - - - - - - 209.6 10 10 TEX13B testis expressed 13B 1201 153 C20140711_OR018_04 C20140711_OR018_04 TB444077.[MT7]-RQQPPQHDGLRPR.3b6_1.heavy 576.988 / 879.492 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAI1 brain-specific angiogenesis inhibitor 1 1203 153 C20140711_OR018_04 C20140711_OR018_04 TB444077.[MT7]-RQQPPQHDGLRPR.3b3_1.heavy 576.988 / 557.328 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAI1 brain-specific angiogenesis inhibitor 1 1205 153 C20140711_OR018_04 C20140711_OR018_04 TB444077.[MT7]-RQQPPQHDGLRPR.3b8_1.heavy 576.988 / 1131.58 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAI1 brain-specific angiogenesis inhibitor 1 1207 153 C20140711_OR018_04 C20140711_OR018_04 TB444077.[MT7]-RQQPPQHDGLRPR.3y5_1.heavy 576.988 / 598.378 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAI1 brain-specific angiogenesis inhibitor 1 1209 154 C20140711_OR018_04 C20140711_OR018_04 TB444139.[MT7]-ILLFSGPQFWVFQDR.3y7_1.heavy 666.364 / 997.489 10226.0 53.34550094604492 47 17 10 10 10 2.487789110875446 32.20297262115646 0.0 3 0.9775266258803659 8.216966538795434 10226.0 163.3468947368421 0.0 - - - - - - - 104.5 20 26 MMP25 matrix metallopeptidase 25 1211 154 C20140711_OR018_04 C20140711_OR018_04 TB444139.[MT7]-ILLFSGPQFWVFQDR.3y6_1.heavy 666.364 / 850.421 11652.0 53.34550094604492 47 17 10 10 10 2.487789110875446 32.20297262115646 0.0 3 0.9775266258803659 8.216966538795434 11652.0 128.78526315789475 0.0 - - - - - - - 111.07692307692308 23 26 MMP25 matrix metallopeptidase 25 1213 154 C20140711_OR018_04 C20140711_OR018_04 TB444139.[MT7]-ILLFSGPQFWVFQDR.3y4_1.heavy 666.364 / 565.273 17564.0 53.34550094604492 47 17 10 10 10 2.487789110875446 32.20297262115646 0.0 3 0.9775266258803659 8.216966538795434 17564.0 273.21777777777777 0.0 - - - - - - - 130.72 35 25 MMP25 matrix metallopeptidase 25 1215 154 C20140711_OR018_04 C20140711_OR018_04 TB444139.[MT7]-ILLFSGPQFWVFQDR.3y5_1.heavy 666.364 / 664.341 14750.0 53.34550094604492 47 17 10 10 10 2.487789110875446 32.20297262115646 0.0 3 0.9775266258803659 8.216966538795434 14750.0 116.95146958304855 0.0 - - - - - - - 135.28 29 25 MMP25 matrix metallopeptidase 25 1217 155 C20140711_OR018_04 C20140711_OR018_04 TB444138.[MT7]-SVASVGGNIITASPISDLNPVFMASGAK[MT7].3y7_1.heavy 997.874 / 855.451 6264.0 47.29825019836426 37 11 10 6 10 0.9718665222207323 68.59652549234039 0.038501739501953125 3 0.871260822123453 3.4019955082349687 6264.0 45.39272727272727 0.0 - - - - - - - 179.0 12 14 XDH xanthine dehydrogenase 1219 155 C20140711_OR018_04 C20140711_OR018_04 TB444138.[MT7]-SVASVGGNIITASPISDLNPVFMASGAK[MT7].3b9_1.heavy 997.874 / 929.517 7864.0 47.29825019836426 37 11 10 6 10 0.9718665222207323 68.59652549234039 0.038501739501953125 3 0.871260822123453 3.4019955082349687 7864.0 67.72508531056663 0.0 - - - - - - - 208.91666666666666 15 12 XDH xanthine dehydrogenase 1221 155 C20140711_OR018_04 C20140711_OR018_04 TB444138.[MT7]-SVASVGGNIITASPISDLNPVFMASGAK[MT7].3b8_1.heavy 997.874 / 816.433 7377.0 47.29825019836426 37 11 10 6 10 0.9718665222207323 68.59652549234039 0.038501739501953125 3 0.871260822123453 3.4019955082349687 7377.0 57.69044856021188 0.0 - - - - - - - 226.16666666666666 14 12 XDH xanthine dehydrogenase 1223 155 C20140711_OR018_04 C20140711_OR018_04 TB444138.[MT7]-SVASVGGNIITASPISDLNPVFMASGAK[MT7].3y9_1.heavy 997.874 / 1051.57 13362.0 47.29825019836426 37 11 10 6 10 0.9718665222207323 68.59652549234039 0.038501739501953125 3 0.871260822123453 3.4019955082349687 13362.0 124.79724401913876 0.0 - - - - - - - 139.4 26 10 XDH xanthine dehydrogenase 1225 156 C20140711_OR018_04 C20140711_OR018_04 TB443805.[MT7]-DLETFSK[MT7].2b3_1.heavy 564.313 / 502.263 4711.0 28.20657444000244 46 20 10 6 10 9.38992893296862 10.649707864017353 0.038898468017578125 3 0.9969076995522997 22.187560290497427 4711.0 15.821346804341317 1.0 - - - - - - - 239.0625 9 16 PDIA2 protein disulfide isomerase family A, member 2 1227 156 C20140711_OR018_04 C20140711_OR018_04 TB443805.[MT7]-DLETFSK[MT7].2y4_1.heavy 564.313 / 626.363 6772.0 28.20657444000244 46 20 10 6 10 9.38992893296862 10.649707864017353 0.038898468017578125 3 0.9969076995522997 22.187560290497427 6772.0 84.5348299319728 0.0 - - - - - - - 215.8 13 10 PDIA2 protein disulfide isomerase family A, member 2 1229 156 C20140711_OR018_04 C20140711_OR018_04 TB443805.[MT7]-DLETFSK[MT7].2y3_1.heavy 564.313 / 525.315 4711.0 28.20657444000244 46 20 10 6 10 9.38992893296862 10.649707864017353 0.038898468017578125 3 0.9969076995522997 22.187560290497427 4711.0 14.098239569326008 0.0 - - - - - - - 266.2857142857143 9 14 PDIA2 protein disulfide isomerase family A, member 2 1231 156 C20140711_OR018_04 C20140711_OR018_04 TB443805.[MT7]-DLETFSK[MT7].2y6_1.heavy 564.313 / 868.49 3828.0 28.20657444000244 46 20 10 6 10 9.38992893296862 10.649707864017353 0.038898468017578125 3 0.9969076995522997 22.187560290497427 3828.0 45.50632653061224 0.0 - - - - - - - 134.75 7 8 PDIA2 protein disulfide isomerase family A, member 2 1233 157 C20140711_OR018_04 C20140711_OR018_04 TB444070.[MT7]-LVVGNTEIGIEMK[MT7].2y5_1.heavy 845.986 / 721.404 4113.0 38.47050094604492 46 16 10 10 10 3.875579173496868 20.60592385792381 0.0 3 0.9699979284297674 7.107140728044932 4113.0 54.216818181818184 0.0 - - - - - - - 155.57142857142858 8 7 XDH xanthine dehydrogenase 1235 157 C20140711_OR018_04 C20140711_OR018_04 TB444070.[MT7]-LVVGNTEIGIEMK[MT7].2y3_1.heavy 845.986 / 551.298 4476.0 38.47050094604492 46 16 10 10 10 3.875579173496868 20.60592385792381 0.0 3 0.9699979284297674 7.107140728044932 4476.0 8.508099173553719 0.0 - - - - - - - 290.4 8 5 XDH xanthine dehydrogenase 1237 157 C20140711_OR018_04 C20140711_OR018_04 TB444070.[MT7]-LVVGNTEIGIEMK[MT7].2b7_1.heavy 845.986 / 857.485 2056.0 38.47050094604492 46 16 10 10 10 3.875579173496868 20.60592385792381 0.0 3 0.9699979284297674 7.107140728044932 2056.0 19.540495867768595 0.0 - - - - - - - 242.0 4 6 XDH xanthine dehydrogenase 1239 157 C20140711_OR018_04 C20140711_OR018_04 TB444070.[MT7]-LVVGNTEIGIEMK[MT7].2y10_1.heavy 845.986 / 1235.64 2056.0 38.47050094604492 46 16 10 10 10 3.875579173496868 20.60592385792381 0.0 3 0.9699979284297674 7.107140728044932 2056.0 13.431498665972539 1.0 - - - - - - - 221.83333333333334 5 6 XDH xanthine dehydrogenase 1241 158 C20140711_OR018_04 C20140711_OR018_04 TB444144.[MT7]-ELAEEFGVTEYPTLK[MT7].2b8_1.heavy 1007.53 / 1019.52 4382.0 40.27989959716797 41 11 10 10 10 0.9405265514099397 76.441697001757 0.0 3 0.8694646475358675 3.3779775370217027 4382.0 22.11106442106549 0.0 - - - - - - - 207.125 8 8 PDIA2 protein disulfide isomerase family A, member 2 1243 158 C20140711_OR018_04 C20140711_OR018_04 TB444144.[MT7]-ELAEEFGVTEYPTLK[MT7].2y4_1.heavy 1007.53 / 602.399 4738.0 40.27989959716797 41 11 10 10 10 0.9405265514099397 76.441697001757 0.0 3 0.8694646475358675 3.3779775370217027 4738.0 24.363901299415183 0.0 - - - - - - - 249.88888888888889 9 9 PDIA2 protein disulfide isomerase family A, member 2 1245 158 C20140711_OR018_04 C20140711_OR018_04 TB444144.[MT7]-ELAEEFGVTEYPTLK[MT7].2y9_1.heavy 1007.53 / 1151.64 2014.0 40.27989959716797 41 11 10 10 10 0.9405265514099397 76.441697001757 0.0 3 0.8694646475358675 3.3779775370217027 2014.0 0.3442052878273387 1.0 - - - - - - - 217.0 5 6 PDIA2 protein disulfide isomerase family A, member 2 1247 158 C20140711_OR018_04 C20140711_OR018_04 TB444144.[MT7]-ELAEEFGVTEYPTLK[MT7].2b4_1.heavy 1007.53 / 587.316 4145.0 40.27989959716797 41 11 10 10 10 0.9405265514099397 76.441697001757 0.0 3 0.8694646475358675 3.3779775370217027 4145.0 23.26097046413502 0.0 - - - - - - - 236.85714285714286 8 7 PDIA2 protein disulfide isomerase family A, member 2 1249 159 C20140711_OR018_04 C20140711_OR018_04 TB431933.[MT7]-EAPEPGSTR.2y8_1.heavy 544.279 / 814.405 15046.0 16.45829963684082 47 17 10 10 10 4.757020371964947 21.02156227653357 0.0 3 0.9767338302258919 8.07521841406743 15046.0 145.24405333333334 0.0 - - - - - - - 174.8 30 10 IRX1 iroquois homeobox 1 1251 159 C20140711_OR018_04 C20140711_OR018_04 TB431933.[MT7]-EAPEPGSTR.2y5_1.heavy 544.279 / 517.273 17918.0 16.45829963684082 47 17 10 10 10 4.757020371964947 21.02156227653357 0.0 3 0.9767338302258919 8.07521841406743 17918.0 58.19521367521367 0.0 - - - - - - - 199.66666666666666 35 15 IRX1 iroquois homeobox 1 1253 159 C20140711_OR018_04 C20140711_OR018_04 TB431933.[MT7]-EAPEPGSTR.2b4_1.heavy 544.279 / 571.284 9615.0 16.45829963684082 47 17 10 10 10 4.757020371964947 21.02156227653357 0.0 3 0.9767338302258919 8.07521841406743 9615.0 154.97418247582493 0.0 - - - - - - - 179.375 19 8 IRX1 iroquois homeobox 1 1255 159 C20140711_OR018_04 C20140711_OR018_04 TB431933.[MT7]-EAPEPGSTR.2y7_1.heavy 544.279 / 743.368 14047.0 16.45829963684082 47 17 10 10 10 4.757020371964947 21.02156227653357 0.0 3 0.9767338302258919 8.07521841406743 14047.0 103.38592000000001 0.0 - - - - - - - 182.3846153846154 28 13 IRX1 iroquois homeobox 1 1257 160 C20140711_OR018_04 C20140711_OR018_04 TB432030.[MT7]-ILLEGPGTLK[MT7].2y5_1.heavy 664.923 / 659.421 6893.0 36.387699127197266 46 16 10 10 10 2.0860284634161093 37.99220890731971 0.0 3 0.969711043592983 7.073231662523744 6893.0 14.026017410228508 0.0 - - - - - - - 760.875 13 8 ULK4 unc-51-like kinase 4 (C. elegans) 1259 160 C20140711_OR018_04 C20140711_OR018_04 TB432030.[MT7]-ILLEGPGTLK[MT7].2y9_1.heavy 664.923 / 1071.65 4825.0 36.387699127197266 46 16 10 10 10 2.0860284634161093 37.99220890731971 0.0 3 0.969711043592983 7.073231662523744 4825.0 -0.33718621314696196 2.0 - - - - - - - 191.66666666666666 12 12 ULK4 unc-51-like kinase 4 (C. elegans) 1261 160 C20140711_OR018_04 C20140711_OR018_04 TB432030.[MT7]-ILLEGPGTLK[MT7].2y6_1.heavy 664.923 / 716.442 11259.0 36.387699127197266 46 16 10 10 10 2.0860284634161093 37.99220890731971 0.0 3 0.969711043592983 7.073231662523744 11259.0 22.871814829832466 0.0 - - - - - - - 253.0 22 10 ULK4 unc-51-like kinase 4 (C. elegans) 1263 160 C20140711_OR018_04 C20140711_OR018_04 TB432030.[MT7]-ILLEGPGTLK[MT7].2y7_1.heavy 664.923 / 845.485 9306.0 36.387699127197266 46 16 10 10 10 2.0860284634161093 37.99220890731971 0.0 3 0.969711043592983 7.073231662523744 9306.0 32.054569069895436 0.0 - - - - - - - 153.33333333333334 18 9 ULK4 unc-51-like kinase 4 (C. elegans) 1265 161 C20140711_OR018_04 C20140711_OR018_04 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 161871.0 37.7848014831543 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 161871.0 184.55695679510796 0.0 - - - - - - - 313.15384615384613 323 13 1267 161 C20140711_OR018_04 C20140711_OR018_04 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 358685.0 37.7848014831543 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 358685.0 108.04022106116042 0.0 - - - - - - - 318.6666666666667 717 12 1269 161 C20140711_OR018_04 C20140711_OR018_04 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 382021.0 37.7848014831543 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 382021.0 119.06367968881732 0.0 - - - - - - - 793.5714285714286 764 7 1271 162 C20140711_OR018_04 C20140711_OR018_04 TB431939.[MT7]-DALTQYPR.2y5_1.heavy 554.299 / 664.341 3088.0 25.90719985961914 50 20 10 10 10 10.459997573670536 9.560231663123496 0.0 3 0.9953304577581044 18.0532781843147 3088.0 23.10696329000704 0.0 - - - - - - - 171.83333333333334 6 6 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1273 162 C20140711_OR018_04 C20140711_OR018_04 TB431939.[MT7]-DALTQYPR.2b4_1.heavy 554.299 / 545.305 N/A 25.90719985961914 50 20 10 10 10 10.459997573670536 9.560231663123496 0.0 3 0.9953304577581044 18.0532781843147 1871.0 1.4866603056298835 10.0 - - - - - - - 299.4 6 5 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1275 162 C20140711_OR018_04 C20140711_OR018_04 TB431939.[MT7]-DALTQYPR.2y6_1.heavy 554.299 / 777.425 1871.0 25.90719985961914 50 20 10 10 10 10.459997573670536 9.560231663123496 0.0 3 0.9953304577581044 18.0532781843147 1871.0 2.2840467187802567 1.0 - - - - - - - 252.9 3 10 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1277 162 C20140711_OR018_04 C20140711_OR018_04 TB431939.[MT7]-DALTQYPR.2y7_1.heavy 554.299 / 848.463 4865.0 25.90719985961914 50 20 10 10 10 10.459997573670536 9.560231663123496 0.0 3 0.9953304577581044 18.0532781843147 4865.0 26.588893216556485 0.0 - - - - - - - 168.6 9 5 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1279 163 C20140711_OR018_04 C20140711_OR018_04 TB431938.[MT7]-TLVDAVAK[MT7].2y4_1.heavy 552.847 / 532.357 11112.0 28.95949935913086 44 14 10 10 10 1.321635267745685 54.28434772358752 0.0 3 0.9351904746705672 4.821354186827593 11112.0 48.915486830486934 0.0 - - - - - - - 264.84615384615387 22 13 XDH xanthine dehydrogenase 1281 163 C20140711_OR018_04 C20140711_OR018_04 TB431938.[MT7]-TLVDAVAK[MT7].2y5_1.heavy 552.847 / 647.385 10817.0 28.95949935913086 44 14 10 10 10 1.321635267745685 54.28434772358752 0.0 3 0.9351904746705672 4.821354186827593 10817.0 50.43921335230948 0.0 - - - - - - - 266.85714285714283 21 14 XDH xanthine dehydrogenase 1283 163 C20140711_OR018_04 C20140711_OR018_04 TB431938.[MT7]-TLVDAVAK[MT7].2b4_1.heavy 552.847 / 573.336 7178.0 28.95949935913086 44 14 10 10 10 1.321635267745685 54.28434772358752 0.0 3 0.9351904746705672 4.821354186827593 7178.0 31.35725314963073 0.0 - - - - - - - 249.6153846153846 14 13 XDH xanthine dehydrogenase 1285 163 C20140711_OR018_04 C20140711_OR018_04 TB431938.[MT7]-TLVDAVAK[MT7].2b5_1.heavy 552.847 / 644.374 3540.0 28.95949935913086 44 14 10 10 10 1.321635267745685 54.28434772358752 0.0 3 0.9351904746705672 4.821354186827593 3540.0 15.727346022613663 0.0 - - - - - - - 160.8181818181818 7 11 XDH xanthine dehydrogenase 1287 164 C20140711_OR018_04 C20140711_OR018_04 TB443814.[MT7]-APVPC[CAM]SGPGR.2y6_1.heavy 571.299 / 633.277 465.0 20.296600341796875 36 17 10 3 6 5.570844607420271 17.950599423793243 0.06259918212890625 6 0.9772364825424993 8.164232900419025 465.0 1.6034482758620692 9.0 - - - - - - - 0.0 1 0 BAI1 brain-specific angiogenesis inhibitor 1 1289 164 C20140711_OR018_04 C20140711_OR018_04 TB443814.[MT7]-APVPC[CAM]SGPGR.2y8_1.heavy 571.299 / 829.398 465.0 20.296600341796875 36 17 10 3 6 5.570844607420271 17.950599423793243 0.06259918212890625 6 0.9772364825424993 8.164232900419025 465.0 6.516233766233766 1.0 - - - - - - - 240.88888888888889 2 9 BAI1 brain-specific angiogenesis inhibitor 1 1291 164 C20140711_OR018_04 C20140711_OR018_04 TB443814.[MT7]-APVPC[CAM]SGPGR.2y9_1.heavy 571.299 / 926.451 13786.0 20.296600341796875 36 17 10 3 6 5.570844607420271 17.950599423793243 0.06259918212890625 6 0.9772364825424993 8.164232900419025 13786.0 143.31536095661846 0.0 - - - - - - - 183.75 27 8 BAI1 brain-specific angiogenesis inhibitor 1 1293 164 C20140711_OR018_04 C20140711_OR018_04 TB443814.[MT7]-APVPC[CAM]SGPGR.2y7_1.heavy 571.299 / 730.33 5421.0 20.296600341796875 36 17 10 3 6 5.570844607420271 17.950599423793243 0.06259918212890625 6 0.9772364825424993 8.164232900419025 5421.0 73.20414779019431 0.0 - - - - - - - 232.2 10 5 BAI1 brain-specific angiogenesis inhibitor 1 1295 165 C20140711_OR018_04 C20140711_OR018_04 TB443718.[MT7]-GLEHLK[MT7].2y4_1.heavy 492.808 / 670.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 1297 165 C20140711_OR018_04 C20140711_OR018_04 TB443718.[MT7]-GLEHLK[MT7].2y5_1.heavy 492.808 / 783.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 1299 165 C20140711_OR018_04 C20140711_OR018_04 TB443718.[MT7]-GLEHLK[MT7].2b4_1.heavy 492.808 / 581.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 1301 165 C20140711_OR018_04 C20140711_OR018_04 TB443718.[MT7]-GLEHLK[MT7].2y3_1.heavy 492.808 / 541.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - TSHR thyroid stimulating hormone receptor 1303 166 C20140711_OR018_04 C20140711_OR018_04 TB443810.[MT7]-SIDTSEAK[MT7].2y4_1.heavy 569.813 / 578.327 1706.0 19.58002519607544 43 17 10 6 10 2.207615315917661 35.76614153876239 0.03489875793457031 3 0.9769292164260096 8.10947395811206 1706.0 9.335849375670003 0.0 - - - - - - - 210.33333333333334 3 12 XDH xanthine dehydrogenase 1305 166 C20140711_OR018_04 C20140711_OR018_04 TB443810.[MT7]-SIDTSEAK[MT7].2y5_1.heavy 569.813 / 679.374 4525.0 19.58002519607544 43 17 10 6 10 2.207615315917661 35.76614153876239 0.03489875793457031 3 0.9769292164260096 8.10947395811206 4525.0 77.3818325051509 0.0 - - - - - - - 207.6 9 10 XDH xanthine dehydrogenase 1307 166 C20140711_OR018_04 C20140711_OR018_04 TB443810.[MT7]-SIDTSEAK[MT7].2y6_1.heavy 569.813 / 794.401 3338.0 19.58002519607544 43 17 10 6 10 2.207615315917661 35.76614153876239 0.03489875793457031 3 0.9769292164260096 8.10947395811206 3338.0 43.123351351351346 0.0 - - - - - - - 185.25 6 8 XDH xanthine dehydrogenase 1309 166 C20140711_OR018_04 C20140711_OR018_04 TB443810.[MT7]-SIDTSEAK[MT7].2y7_1.heavy 569.813 / 907.485 1484.0 19.58002519607544 43 17 10 6 10 2.207615315917661 35.76614153876239 0.03489875793457031 3 0.9769292164260096 8.10947395811206 1484.0 33.089189189189185 0.0 - - - - - - - 95.14285714285714 2 7 XDH xanthine dehydrogenase 1311 167 C20140711_OR018_04 C20140711_OR018_04 TB444081.[MT7]-GFPLNLFNNLALK[MT7].3b6_1.heavy 583.682 / 786.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1313 167 C20140711_OR018_04 C20140711_OR018_04 TB444081.[MT7]-GFPLNLFNNLALK[MT7].3b4_1.heavy 583.682 / 559.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1315 167 C20140711_OR018_04 C20140711_OR018_04 TB444081.[MT7]-GFPLNLFNNLALK[MT7].3y4_1.heavy 583.682 / 588.42 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1317 167 C20140711_OR018_04 C20140711_OR018_04 TB444081.[MT7]-GFPLNLFNNLALK[MT7].3b7_1.heavy 583.682 / 933.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1319 168 C20140711_OR018_04 C20140711_OR018_04 TB443817.[MT7]-EDGILVLSR.2y8_1.heavy 573.336 / 872.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDIA2 protein disulfide isomerase family A, member 2 1321 168 C20140711_OR018_04 C20140711_OR018_04 TB443817.[MT7]-EDGILVLSR.2b4_1.heavy 573.336 / 559.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDIA2 protein disulfide isomerase family A, member 2 1323 168 C20140711_OR018_04 C20140711_OR018_04 TB443817.[MT7]-EDGILVLSR.2b5_1.heavy 573.336 / 672.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDIA2 protein disulfide isomerase family A, member 2 1325 168 C20140711_OR018_04 C20140711_OR018_04 TB443817.[MT7]-EDGILVLSR.2y7_1.heavy 573.336 / 757.493 N/A N/A - - - - - - - - - 0.0 - - - - - - - PDIA2 protein disulfide isomerase family A, member 2 1327 169 C20140711_OR018_04 C20140711_OR018_04 TB432066.[MT7]-IVDDEEYEK[MT7].2y8_1.heavy 714.361 / 1170.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1329 169 C20140711_OR018_04 C20140711_OR018_04 TB432066.[MT7]-IVDDEEYEK[MT7].2b4_1.heavy 714.361 / 587.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1331 169 C20140711_OR018_04 C20140711_OR018_04 TB432066.[MT7]-IVDDEEYEK[MT7].2y3_1.heavy 714.361 / 583.321 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1333 169 C20140711_OR018_04 C20140711_OR018_04 TB432066.[MT7]-IVDDEEYEK[MT7].2y6_1.heavy 714.361 / 956.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1335 170 C20140711_OR018_04 C20140711_OR018_04 TB431902.[MT7]-TEDGSAK[MT7].2y4_1.heavy 498.266 / 506.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1337 170 C20140711_OR018_04 C20140711_OR018_04 TB431902.[MT7]-TEDGSAK[MT7].2y5_1.heavy 498.266 / 621.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1339 170 C20140711_OR018_04 C20140711_OR018_04 TB431902.[MT7]-TEDGSAK[MT7].2y6_1.heavy 498.266 / 750.375 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1341 170 C20140711_OR018_04 C20140711_OR018_04 TB431902.[MT7]-TEDGSAK[MT7].2b5_1.heavy 498.266 / 634.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1343 171 C20140711_OR018_04 C20140711_OR018_04 TB431901.[MT7]-QGQLQNR.2y4_1.heavy 494.276 / 530.305 1262.0 15.171699523925781 37 13 8 10 6 1.65926695340868 50.367091144779124 0.0 5 0.9247000164276648 4.4689069279012905 1262.0 6.610577822876147 1.0 - - - - - - - 131.1 3 10 TEX13B testis expressed 13B 1345 171 C20140711_OR018_04 C20140711_OR018_04 TB431901.[MT7]-QGQLQNR.2b4_1.heavy 494.276 / 571.332 825.0 15.171699523925781 37 13 8 10 6 1.65926695340868 50.367091144779124 0.0 5 0.9247000164276648 4.4689069279012905 825.0 21.81279703662287 2.0 - - - - - - - 0.0 1 0 TEX13B testis expressed 13B 1347 171 C20140711_OR018_04 C20140711_OR018_04 TB431901.[MT7]-QGQLQNR.2y6_1.heavy 494.276 / 715.385 1893.0 15.171699523925781 37 13 8 10 6 1.65926695340868 50.367091144779124 0.0 5 0.9247000164276648 4.4689069279012905 1893.0 30.711068353152697 1.0 - - - - - - - 116.8 3 5 TEX13B testis expressed 13B 1349 171 C20140711_OR018_04 C20140711_OR018_04 TB431901.[MT7]-QGQLQNR.2b5_1.heavy 494.276 / 699.391 825.0 15.171699523925781 37 13 8 10 6 1.65926695340868 50.367091144779124 0.0 5 0.9247000164276648 4.4689069279012905 825.0 22.442329466032987 1.0 - - - - - - - 129.66666666666666 4 6 TEX13B testis expressed 13B 1351 172 C20140711_OR018_04 C20140711_OR018_04 TB422632.[MT7]-LTSEQLEFIHDVR.3y6_1.heavy 577.645 / 786.426 12100.0 36.69160079956055 44 14 10 10 10 1.4730589396279448 54.12657789511606 0.0 3 0.9423891871151595 5.116853526524056 12100.0 -1.1980198019802017 0.0 - - - - - - - 285.8333333333333 24 6 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1353 172 C20140711_OR018_04 C20140711_OR018_04 TB422632.[MT7]-LTSEQLEFIHDVR.3b4_1.heavy 577.645 / 575.316 14722.0 36.69160079956055 44 14 10 10 10 1.4730589396279448 54.12657789511606 0.0 3 0.9423891871151595 5.116853526524056 14722.0 -4.170538243626062 0.0 - - - - - - - 222.0 29 5 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1355 172 C20140711_OR018_04 C20140711_OR018_04 TB422632.[MT7]-LTSEQLEFIHDVR.3b5_1.heavy 577.645 / 703.374 26923.0 36.69160079956055 44 14 10 10 10 1.4730589396279448 54.12657789511606 0.0 3 0.9423891871151595 5.116853526524056 26923.0 -4.0083870967742 0.0 - - - - - - - 201.8 53 5 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1357 172 C20140711_OR018_04 C20140711_OR018_04 TB422632.[MT7]-LTSEQLEFIHDVR.3y4_1.heavy 577.645 / 526.273 23394.0 36.69160079956055 44 14 10 10 10 1.4730589396279448 54.12657789511606 0.0 3 0.9423891871151595 5.116853526524056 23394.0 -6.627195467422094 0.0 - - - - - - - 151.5 46 4 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1359 173 C20140711_OR018_04 C20140711_OR018_04 TB422631.[MT7]-RGISALLLNQGDGDR.3b6_1.heavy 576.987 / 742.469 3372.0 33.900824546813965 26 0 10 6 10 0.35514305797968165 120.40050925139931 0.036098480224609375 3 0.39360300743228294 1.4965327354776434 3372.0 11.853221771611526 0.0 - - - - - - - 224.86666666666667 6 15 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1361 173 C20140711_OR018_04 C20140711_OR018_04 TB422631.[MT7]-RGISALLLNQGDGDR.3b5_1.heavy 576.987 / 629.385 2529.0 33.900824546813965 26 0 10 6 10 0.35514305797968165 120.40050925139931 0.036098480224609375 3 0.39360300743228294 1.4965327354776434 2529.0 8.9976 0.0 - - - - - - - 194.6153846153846 5 13 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1363 173 C20140711_OR018_04 C20140711_OR018_04 TB422631.[MT7]-RGISALLLNQGDGDR.3y5_1.heavy 576.987 / 519.216 56488.0 33.900824546813965 26 0 10 6 10 0.35514305797968165 120.40050925139931 0.036098480224609375 3 0.39360300743228294 1.4965327354776434 56488.0 71.65273111587061 0.0 - - - - - - - 718.1111111111111 112 9 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1365 173 C20140711_OR018_04 C20140711_OR018_04 TB422631.[MT7]-RGISALLLNQGDGDR.3b7_1.heavy 576.987 / 855.553 2717.0 33.900824546813965 26 0 10 6 10 0.35514305797968165 120.40050925139931 0.036098480224609375 3 0.39360300743228294 1.4965327354776434 2717.0 16.267770567301653 0.0 - - - - - - - 153.36363636363637 5 11 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1367 174 C20140711_OR018_04 C20140711_OR018_04 TB422906.[MT7]-GIDWYMDFFPTPSNTTSDFLFEK[MT7].4b8_1.heavy 762.366 / 1172.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1369 174 C20140711_OR018_04 C20140711_OR018_04 TB422906.[MT7]-GIDWYMDFFPTPSNTTSDFLFEK[MT7].4b7_1.heavy 762.366 / 1025.45 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1371 174 C20140711_OR018_04 C20140711_OR018_04 TB422906.[MT7]-GIDWYMDFFPTPSNTTSDFLFEK[MT7].4b5_1.heavy 762.366 / 779.385 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1373 174 C20140711_OR018_04 C20140711_OR018_04 TB422906.[MT7]-GIDWYMDFFPTPSNTTSDFLFEK[MT7].4y3_1.heavy 762.366 / 567.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1375 175 C20140711_OR018_04 C20140711_OR018_04 TB432061.[MT7]-GSPVYTAPEVVR.3y6_1.heavy 473.597 / 670.388 983.0 29.14859962463379 35 17 2 10 6 3.748238018540904 20.142516720455944 0.0 5 0.9718468522077872 7.337949069772227 983.0 13.518413964570598 2.0 - - - - - - - 235.9 3 10 ULK4 unc-51-like kinase 4 (C. elegans) 1377 175 C20140711_OR018_04 C20140711_OR018_04 TB432061.[MT7]-GSPVYTAPEVVR.3b4_1.heavy 473.597 / 485.284 2751.0 29.14859962463379 35 17 2 10 6 3.748238018540904 20.142516720455944 0.0 5 0.9718468522077872 7.337949069772227 2751.0 15.32264406779661 0.0 - - - - - - - 245.83333333333334 5 12 ULK4 unc-51-like kinase 4 (C. elegans) 1379 175 C20140711_OR018_04 C20140711_OR018_04 TB432061.[MT7]-GSPVYTAPEVVR.3y4_1.heavy 473.597 / 502.298 590.0 29.14859962463379 35 17 2 10 6 3.748238018540904 20.142516720455944 0.0 5 0.9718468522077872 7.337949069772227 590.0 2.1954314720812182 8.0 - - - - - - - 250.27272727272728 27 11 ULK4 unc-51-like kinase 4 (C. elegans) 1381 175 C20140711_OR018_04 C20140711_OR018_04 TB432061.[MT7]-GSPVYTAPEVVR.3y5_1.heavy 473.597 / 599.351 4225.0 29.14859962463379 35 17 2 10 6 3.748238018540904 20.142516720455944 0.0 5 0.9718468522077872 7.337949069772227 4225.0 54.41642165340713 0.0 - - - - - - - 229.16666666666666 8 6 ULK4 unc-51-like kinase 4 (C. elegans) 1383 176 C20140711_OR018_04 C20140711_OR018_04 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 86614.0 40.59299850463867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 86614.0 325.39901515151513 0.0 - - - - - - - 345.7142857142857 173 7 1385 176 C20140711_OR018_04 C20140711_OR018_04 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 152785.0 40.59299850463867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 152785.0 578.4304210940575 0.0 - - - - - - - 322.6666666666667 305 6 1387 176 C20140711_OR018_04 C20140711_OR018_04 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 204197.0 40.59299850463867 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 204197.0 537.7533836617927 0.0 - - - - - - - 282.3333333333333 408 6 1389 177 C20140711_OR018_04 C20140711_OR018_04 TB444053.[MT7]-QQVYISHLGHGVR.4y5_1.heavy 410.23 / 525.289 3140.0 25.263999938964844 39 11 10 10 8 0.9669867466667407 62.381136426562406 0.0 4 0.8792610842801907 3.5153532301648722 3140.0 45.61263157894737 0.0 - - - - - - - 149.28571428571428 6 7 AHRR aryl-hydrocarbon receptor repressor 1391 177 C20140711_OR018_04 C20140711_OR018_04 TB444053.[MT7]-QQVYISHLGHGVR.4y8_1.heavy 410.23 / 862.464 N/A 25.263999938964844 39 11 10 10 8 0.9669867466667407 62.381136426562406 0.0 4 0.8792610842801907 3.5153532301648722 0.0 0.0 11.0 - - - - - - - 0.0 0 0 AHRR aryl-hydrocarbon receptor repressor 1393 177 C20140711_OR018_04 C20140711_OR018_04 TB444053.[MT7]-QQVYISHLGHGVR.4y6_1.heavy 410.23 / 638.373 1142.0 25.263999938964844 39 11 10 10 8 0.9669867466667407 62.381136426562406 0.0 4 0.8792610842801907 3.5153532301648722 1142.0 10.698736842105262 1.0 - - - - - - - 237.83333333333334 2 6 AHRR aryl-hydrocarbon receptor repressor 1395 177 C20140711_OR018_04 C20140711_OR018_04 TB444053.[MT7]-QQVYISHLGHGVR.4b3_1.heavy 410.23 / 500.295 1332.0 25.263999938964844 39 11 10 10 8 0.9669867466667407 62.381136426562406 0.0 4 0.8792610842801907 3.5153532301648722 1332.0 16.606667219229173 1.0 - - - - - - - 206.0 2 6 AHRR aryl-hydrocarbon receptor repressor 1397 178 C20140711_OR018_04 C20140711_OR018_04 TB422636.[MT7]-IHHDQPVK[MT7]PLDR.3y7_1.heavy 581.668 / 968.601 2030.0 19.263349533081055 43 17 10 6 10 4.085928351326686 24.474242179878257 0.03620147705078125 3 0.9751488924423444 7.812427097702263 2030.0 15.934814814814814 0.0 - - - - - - - 186.0 4 4 LOC100294331;UGT2A1;UGT2A2;UGT2B4;UGT2B17;UGT2A3 UDP-glucuronosyltransferase 2B10-like;UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus;UDP glucuronosyltransferase 2 family, polypeptide A2;UDP glucuronosyltransferase 2 family, polypeptide B4;UDP glucuronosyltransferase 2 family, polypeptide B17;UDP glucuronosyltransferase 2 family, polypeptide A3 1399 178 C20140711_OR018_04 C20140711_OR018_04 TB422636.[MT7]-IHHDQPVK[MT7]PLDR.3b4_1.heavy 581.668 / 647.338 1557.0 19.263349533081055 43 17 10 6 10 4.085928351326686 24.474242179878257 0.03620147705078125 3 0.9751488924423444 7.812427097702263 1557.0 32.249235294117646 0.0 - - - - - - - 122.0 3 10 LOC100294331;UGT2A1;UGT2A2;UGT2B4;UGT2B17;UGT2A3 UDP-glucuronosyltransferase 2B10-like;UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus;UDP glucuronosyltransferase 2 family, polypeptide A2;UDP glucuronosyltransferase 2 family, polypeptide B4;UDP glucuronosyltransferase 2 family, polypeptide B17;UDP glucuronosyltransferase 2 family, polypeptide A3 1401 178 C20140711_OR018_04 C20140711_OR018_04 TB422636.[MT7]-IHHDQPVK[MT7]PLDR.3y4_1.heavy 581.668 / 500.283 2910.0 19.263349533081055 43 17 10 6 10 4.085928351326686 24.474242179878257 0.03620147705078125 3 0.9751488924423444 7.812427097702263 2910.0 18.056779306709323 0.0 - - - - - - - 188.57142857142858 5 14 LOC100294331;UGT2A1;UGT2A2;UGT2B4;UGT2B17;UGT2A3 UDP-glucuronosyltransferase 2B10-like;UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus;UDP glucuronosyltransferase 2 family, polypeptide A2;UDP glucuronosyltransferase 2 family, polypeptide B4;UDP glucuronosyltransferase 2 family, polypeptide B17;UDP glucuronosyltransferase 2 family, polypeptide A3 1403 178 C20140711_OR018_04 C20140711_OR018_04 TB422636.[MT7]-IHHDQPVK[MT7]PLDR.3y8_1.heavy 581.668 / 1096.66 541.0 19.263349533081055 43 17 10 6 10 4.085928351326686 24.474242179878257 0.03620147705078125 3 0.9751488924423444 7.812427097702263 541.0 2.682352941176471 1.0 - - - - - - - 0.0 1 0 LOC100294331;UGT2A1;UGT2A2;UGT2B4;UGT2B17;UGT2A3 UDP-glucuronosyltransferase 2B10-like;UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus;UDP glucuronosyltransferase 2 family, polypeptide A2;UDP glucuronosyltransferase 2 family, polypeptide B4;UDP glucuronosyltransferase 2 family, polypeptide B17;UDP glucuronosyltransferase 2 family, polypeptide A3 1405 179 C20140711_OR018_04 C20140711_OR018_04 TB422236.[MT7]-ESGVLVLR.2b4_1.heavy 508.815 / 517.274 4030.0 31.529475212097168 32 20 2 6 4 11.803687801222162 8.471928577240574 0.033100128173828125 7 0.9982578516752558 29.563560365776215 4030.0 3.234565882441115 1.0 - - - - - - - 761.375 8 8 AHRR aryl-hydrocarbon receptor repressor 1407 179 C20140711_OR018_04 C20140711_OR018_04 TB422236.[MT7]-ESGVLVLR.2y6_1.heavy 508.815 / 656.445 843.0 31.529475212097168 32 20 2 6 4 11.803687801222162 8.471928577240574 0.033100128173828125 7 0.9982578516752558 29.563560365776215 843.0 2.7048128342245987 3.0 - - - - - - - 178.0 9 10 AHRR aryl-hydrocarbon receptor repressor 1409 179 C20140711_OR018_04 C20140711_OR018_04 TB422236.[MT7]-ESGVLVLR.2b5_1.heavy 508.815 / 630.358 2156.0 31.529475212097168 32 20 2 6 4 11.803687801222162 8.471928577240574 0.033100128173828125 7 0.9982578516752558 29.563560365776215 2156.0 0.7672597864768681 3.0 - - - - - - - 197.88888888888889 23 9 AHRR aryl-hydrocarbon receptor repressor 1411 179 C20140711_OR018_04 C20140711_OR018_04 TB422236.[MT7]-ESGVLVLR.2y7_1.heavy 508.815 / 743.477 4405.0 31.529475212097168 32 20 2 6 4 11.803687801222162 8.471928577240574 0.033100128173828125 7 0.9982578516752558 29.563560365776215 4405.0 66.6613977699397 1.0 - - - - - - - 164.0 12 8 AHRR aryl-hydrocarbon receptor repressor 1413 180 C20140711_OR018_04 C20140711_OR018_04 TB422633.[MT7]-EAVAAAGAAGGK[MT7]GEER.2y10_1.heavy 866.465 / 1075.56 1412.0 19.42970085144043 39 9 10 10 10 1.7363117562978618 57.5933438435149 0.0 3 0.8054457362115435 2.7512832611689606 1412.0 40.46328358208955 0.0 - - - - - - - 144.0 2 7 TEX13B testis expressed 13B 1415 180 C20140711_OR018_04 C20140711_OR018_04 TB422633.[MT7]-EAVAAAGAAGGK[MT7]GEER.2y12_1.heavy 866.465 / 1217.64 403.0 19.42970085144043 39 9 10 10 10 1.7363117562978618 57.5933438435149 0.0 3 0.8054457362115435 2.7512832611689606 403.0 8.661492537313432 0.0 - - - - - - - 0.0 0 0 TEX13B testis expressed 13B 1417 180 C20140711_OR018_04 C20140711_OR018_04 TB422633.[MT7]-EAVAAAGAAGGK[MT7]GEER.2y11_1.heavy 866.465 / 1146.6 134.0 19.42970085144043 39 9 10 10 10 1.7363117562978618 57.5933438435149 0.0 3 0.8054457362115435 2.7512832611689606 134.0 -0.0 0.0 - - - - - - - 0.0 0 0 TEX13B testis expressed 13B 1419 180 C20140711_OR018_04 C20140711_OR018_04 TB422633.[MT7]-EAVAAAGAAGGK[MT7]GEER.2b4_1.heavy 866.465 / 515.295 1210.0 19.42970085144043 39 9 10 10 10 1.7363117562978618 57.5933438435149 0.0 3 0.8054457362115435 2.7512832611689606 1210.0 25.644776119402987 0.0 - - - - - - - 201.6 2 5 TEX13B testis expressed 13B 1421 181 C20140711_OR018_04 C20140711_OR018_04 TB422778.[MT7]-TLFATVIQDLGLHDGIQR.4y5_1.heavy 536.051 / 588.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1423 181 C20140711_OR018_04 C20140711_OR018_04 TB422778.[MT7]-TLFATVIQDLGLHDGIQR.4b4_1.heavy 536.051 / 577.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1425 181 C20140711_OR018_04 C20140711_OR018_04 TB422778.[MT7]-TLFATVIQDLGLHDGIQR.4y6_1.heavy 536.051 / 725.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1427 181 C20140711_OR018_04 C20140711_OR018_04 TB422778.[MT7]-TLFATVIQDLGLHDGIQR.4b3_1.heavy 536.051 / 506.31 N/A N/A - - - - - - - - - 0.0 - - - - - - - NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1429 182 C20140711_OR018_04 C20140711_OR018_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 95640.0 35.652099609375 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 95640.0 346.88615441356484 0.0 - - - - - - - 207.9 191 10 1431 182 C20140711_OR018_04 C20140711_OR018_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 22655.0 35.652099609375 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 22655.0 41.30299319727891 1.0 - - - - - - - 171.0 82 5 1433 182 C20140711_OR018_04 C20140711_OR018_04 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 20573.0 35.652099609375 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 20573.0 133.30635889451148 0.0 - - - - - - - 260.0 41 8 1435 183 C20140711_OR018_04 C20140711_OR018_04 TB443829.[MT7]-DLSEPVPK[MT7].2y4_1.heavy 586.842 / 584.389 7292.0 25.02869987487793 29 14 2 5 8 3.9983357390274503 25.010405960636977 0.04199981689453125 4 0.9376620520441847 4.9170406306861585 7292.0 48.61333333333333 1.0 - - - - - - - 326.4 44 5 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1437 183 C20140711_OR018_04 C20140711_OR018_04 TB443829.[MT7]-DLSEPVPK[MT7].2b4_1.heavy 586.842 / 589.295 7292.0 25.02869987487793 29 14 2 5 8 3.9983357390274503 25.010405960636977 0.04199981689453125 4 0.9376620520441847 4.9170406306861585 7292.0 70.16651041666667 0.0 - - - - - - - 245.33333333333334 14 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1439 183 C20140711_OR018_04 C20140711_OR018_04 TB443829.[MT7]-DLSEPVPK[MT7].2b6_1.heavy 586.842 / 785.416 3070.0 25.02869987487793 29 14 2 5 8 3.9983357390274503 25.010405960636977 0.04199981689453125 4 0.9376620520441847 4.9170406306861585 3070.0 8.125042579075425 0.0 - - - - - - - 208.0 6 12 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1441 183 C20140711_OR018_04 C20140711_OR018_04 TB443829.[MT7]-DLSEPVPK[MT7].2b5_1.heavy 586.842 / 686.348 1055.0 25.02869987487793 29 14 2 5 8 3.9983357390274503 25.010405960636977 0.04199981689453125 4 0.9376620520441847 4.9170406306861585 1055.0 12.681979166666666 0.0 - - - - - - - 261.8181818181818 2 11 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1443 184 C20140711_OR018_04 C20140711_OR018_04 TB444052.[MT7]-TYQFDSFLESTR.2b3_1.heavy 819.4 / 537.279 2141.0 40.057498931884766 46 16 10 10 10 7.572852819828607 13.205063188097622 0.0 3 0.9696581185421792 7.067028565753315 2141.0 17.271932773109242 0.0 - - - - - - - 255.0 4 7 BAI1 brain-specific angiogenesis inhibitor 1 1445 184 C20140711_OR018_04 C20140711_OR018_04 TB444052.[MT7]-TYQFDSFLESTR.2y9_1.heavy 819.4 / 1101.52 1903.0 40.057498931884766 46 16 10 10 10 7.572852819828607 13.205063188097622 0.0 3 0.9696581185421792 7.067028565753315 1903.0 9.355084033613446 0.0 - - - - - - - 252.875 3 8 BAI1 brain-specific angiogenesis inhibitor 1 1447 184 C20140711_OR018_04 C20140711_OR018_04 TB444052.[MT7]-TYQFDSFLESTR.2y10_1.heavy 819.4 / 1229.58 238.0 40.057498931884766 46 16 10 10 10 7.572852819828607 13.205063188097622 0.0 3 0.9696581185421792 7.067028565753315 238.0 -0.2133333333333333 28.0 - - - - - - - 183.9090909090909 2 11 BAI1 brain-specific angiogenesis inhibitor 1 1449 184 C20140711_OR018_04 C20140711_OR018_04 TB444052.[MT7]-TYQFDSFLESTR.2y7_1.heavy 819.4 / 839.426 4521.0 40.057498931884766 46 16 10 10 10 7.572852819828607 13.205063188097622 0.0 3 0.9696581185421792 7.067028565753315 4521.0 24.94781512605042 0.0 - - - - - - - 178.5 9 4 BAI1 brain-specific angiogenesis inhibitor 1 1451 185 C20140711_OR018_04 C20140711_OR018_04 TB432306.[MT7]-SVNALNSPLHQEY[MT7]EENLGDSIVGYK[MT7].4y4_1.heavy 802.918 / 610.368 884.0 34.22457504272461 33 14 10 3 6 1.7854639176661138 45.15362065301012 0.07450103759765625 5 0.9307635253838379 4.662906612341227 884.0 1.620366598778004 3.0 - - - - - - - 0.0 1 0 TSHR thyroid stimulating hormone receptor 1453 185 C20140711_OR018_04 C20140711_OR018_04 TB432306.[MT7]-SVNALNSPLHQEY[MT7]EENLGDSIVGYK[MT7].4b7_1.heavy 802.918 / 830.449 196.0 34.22457504272461 33 14 10 3 6 1.7854639176661138 45.15362065301012 0.07450103759765625 5 0.9307635253838379 4.662906612341227 196.0 1.9 16.0 - - - - - - - 0.0 1 0 TSHR thyroid stimulating hormone receptor 1455 185 C20140711_OR018_04 C20140711_OR018_04 TB432306.[MT7]-SVNALNSPLHQEY[MT7]EENLGDSIVGYK[MT7].4b4_1.heavy 802.918 / 516.29 589.0 34.22457504272461 33 14 10 3 6 1.7854639176661138 45.15362065301012 0.07450103759765625 5 0.9307635253838379 4.662906612341227 589.0 2.4040816326530616 3.0 - - - - - - - 0.0 1 0 TSHR thyroid stimulating hormone receptor 1457 185 C20140711_OR018_04 C20140711_OR018_04 TB432306.[MT7]-SVNALNSPLHQEY[MT7]EENLGDSIVGYK[MT7].4y3_1.heavy 802.918 / 511.3 1473.0 34.22457504272461 33 14 10 3 6 1.7854639176661138 45.15362065301012 0.07450103759765625 5 0.9307635253838379 4.662906612341227 1473.0 1.7505942275042443 1.0 - - - - - - - 207.22222222222223 2 9 TSHR thyroid stimulating hormone receptor 1459 186 C20140711_OR018_04 C20140711_OR018_04 TB431912.[MT7]-FLFGQK[MT7].2b3_1.heavy 514.313 / 552.33 1639.0 35.08654975891113 46 20 10 6 10 5.051409599598089 19.79645444074787 0.03980255126953125 3 0.9938326900471238 15.706919821960486 1639.0 8.4171095668969 2.0 - - - - - - - 218.14285714285714 3 7 AHRR aryl-hydrocarbon receptor repressor 1461 186 C20140711_OR018_04 C20140711_OR018_04 TB431912.[MT7]-FLFGQK[MT7].2y4_1.heavy 514.313 / 623.363 6009.0 35.08654975891113 46 20 10 6 10 5.051409599598089 19.79645444074787 0.03980255126953125 3 0.9938326900471238 15.706919821960486 6009.0 21.20105093256815 0.0 - - - - - - - 181.88888888888889 12 9 AHRR aryl-hydrocarbon receptor repressor 1463 186 C20140711_OR018_04 C20140711_OR018_04 TB431912.[MT7]-FLFGQK[MT7].2y5_1.heavy 514.313 / 736.447 3605.0 35.08654975891113 46 20 10 6 10 5.051409599598089 19.79645444074787 0.03980255126953125 3 0.9938326900471238 15.706919821960486 3605.0 22.456633195345713 0.0 - - - - - - - 284.0 7 5 AHRR aryl-hydrocarbon receptor repressor 1465 186 C20140711_OR018_04 C20140711_OR018_04 TB431912.[MT7]-FLFGQK[MT7].2b4_1.heavy 514.313 / 609.352 546.0 35.08654975891113 46 20 10 6 10 5.051409599598089 19.79645444074787 0.03980255126953125 3 0.9938326900471238 15.706919821960486 546.0 1.1494736842105264 13.0 - - - - - - - 0.0 1 0 AHRR aryl-hydrocarbon receptor repressor 1467 187 C20140711_OR018_04 C20140711_OR018_04 TB422786.[MT7]-GTINFVAILC[CAM]TDK[MT7]C[CAM]K[MT7].4b4_1.heavy 543.802 / 530.305 7477.0 40.302499771118164 38 13 10 5 10 1.6150976257127185 61.91576187592468 0.045200347900390625 3 0.906797139411611 4.01065643244441 7477.0 48.82938775510204 0.0 - - - - - - - 272.3333333333333 14 9 ULK4 unc-51-like kinase 4 (C. elegans) 1469 187 C20140711_OR018_04 C20140711_OR018_04 TB422786.[MT7]-GTINFVAILC[CAM]TDK[MT7]C[CAM]K[MT7].4y6_2.heavy 543.802 / 550.278 6619.0 40.302499771118164 38 13 10 5 10 1.6150976257127185 61.91576187592468 0.045200347900390625 3 0.906797139411611 4.01065643244441 6619.0 22.60446785631055 0.0 - - - - - - - 318.6 13 5 ULK4 unc-51-like kinase 4 (C. elegans) 1471 187 C20140711_OR018_04 C20140711_OR018_04 TB422786.[MT7]-GTINFVAILC[CAM]TDK[MT7]C[CAM]K[MT7].4b5_1.heavy 543.802 / 677.374 6987.0 40.302499771118164 38 13 10 5 10 1.6150976257127185 61.91576187592468 0.045200347900390625 3 0.906797139411611 4.01065643244441 6987.0 35.314728260869565 0.0 - - - - - - - 291.25 13 8 ULK4 unc-51-like kinase 4 (C. elegans) 1473 187 C20140711_OR018_04 C20140711_OR018_04 TB422786.[MT7]-GTINFVAILC[CAM]TDK[MT7]C[CAM]K[MT7].4y7_2.heavy 543.802 / 606.82 4168.0 40.302499771118164 38 13 10 5 10 1.6150976257127185 61.91576187592468 0.045200347900390625 3 0.906797139411611 4.01065643244441 4168.0 43.40469600565571 0.0 - - - - - - - 245.33333333333334 8 6 ULK4 unc-51-like kinase 4 (C. elegans) 1475 188 C20140711_OR018_04 C20140711_OR018_04 TB422641.[MT7]-LHRFWEGLPAQVR.4y5_1.heavy 439 / 570.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 1477 188 C20140711_OR018_04 C20140711_OR018_04 TB422641.[MT7]-LHRFWEGLPAQVR.4y4_1.heavy 439 / 473.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 1479 188 C20140711_OR018_04 C20140711_OR018_04 TB422641.[MT7]-LHRFWEGLPAQVR.4b7_1.heavy 439 / 1070.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 1481 188 C20140711_OR018_04 C20140711_OR018_04 TB422641.[MT7]-LHRFWEGLPAQVR.4b7_2.heavy 439 / 535.786 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 1483 189 C20140711_OR018_04 C20140711_OR018_04 TB431918.[MT7]-NIQMMTR.2b3_1.heavy 519.271 / 500.295 1622.0 26.292299270629883 46 16 10 10 10 5.042262620048448 19.83236644644248 0.0 3 0.9667989656864544 6.75425722411128 1622.0 17.74769247726646 0.0 - - - - - - - 286.27272727272725 3 11 BAI1 brain-specific angiogenesis inhibitor 1 1485 189 C20140711_OR018_04 C20140711_OR018_04 TB431918.[MT7]-NIQMMTR.2y5_1.heavy 519.271 / 666.306 1527.0 26.292299270629883 46 16 10 10 10 5.042262620048448 19.83236644644248 0.0 3 0.9667989656864544 6.75425722411128 1527.0 5.338229048438473 0.0 - - - - - - - 171.4 3 5 BAI1 brain-specific angiogenesis inhibitor 1 1487 189 C20140711_OR018_04 C20140711_OR018_04 TB431918.[MT7]-NIQMMTR.2b4_1.heavy 519.271 / 631.335 1431.0 26.292299270629883 46 16 10 10 10 5.042262620048448 19.83236644644248 0.0 3 0.9667989656864544 6.75425722411128 1431.0 2.0487546702911574 0.0 - - - - - - - 209.9 2 10 BAI1 brain-specific angiogenesis inhibitor 1 1489 189 C20140711_OR018_04 C20140711_OR018_04 TB431918.[MT7]-NIQMMTR.2y6_1.heavy 519.271 / 779.39 1240.0 26.292299270629883 46 16 10 10 10 5.042262620048448 19.83236644644248 0.0 3 0.9667989656864544 6.75425722411128 1240.0 2.4732286370654917 1.0 - - - - - - - 254.33333333333334 4 6 BAI1 brain-specific angiogenesis inhibitor 1 1491 190 C20140711_OR018_04 C20140711_OR018_04 TB444065.[MT7]-TYLGVESFDEVLR.2y4_1.heavy 836.439 / 516.314 2321.0 43.296749114990234 45 20 10 5 10 7.293335677834235 13.711147329186845 0.042999267578125 3 0.9900189334042138 12.3427520153191 2321.0 18.192656765676567 0.0 - - - - - - - 227.25 4 8 BAI1 brain-specific angiogenesis inhibitor 1 1493 190 C20140711_OR018_04 C20140711_OR018_04 TB444065.[MT7]-TYLGVESFDEVLR.2y8_1.heavy 836.439 / 994.484 1716.0 43.296749114990234 45 20 10 5 10 7.293335677834235 13.711147329186845 0.042999267578125 3 0.9900189334042138 12.3427520153191 1716.0 11.196475247524752 0.0 - - - - - - - 181.8 3 10 BAI1 brain-specific angiogenesis inhibitor 1 1495 190 C20140711_OR018_04 C20140711_OR018_04 TB444065.[MT7]-TYLGVESFDEVLR.2b4_1.heavy 836.439 / 579.326 1110.0 43.296749114990234 45 20 10 5 10 7.293335677834235 13.711147329186845 0.042999267578125 3 0.9900189334042138 12.3427520153191 1110.0 14.287128712871288 1.0 - - - - - - - 179.55555555555554 2 9 BAI1 brain-specific angiogenesis inhibitor 1 1497 190 C20140711_OR018_04 C20140711_OR018_04 TB444065.[MT7]-TYLGVESFDEVLR.2y10_1.heavy 836.439 / 1150.57 3431.0 43.296749114990234 45 20 10 5 10 7.293335677834235 13.711147329186845 0.042999267578125 3 0.9900189334042138 12.3427520153191 3431.0 45.85990099009901 0.0 - - - - - - - 185.16666666666666 6 6 BAI1 brain-specific angiogenesis inhibitor 1 1499 191 C20140711_OR018_04 C20140711_OR018_04 TB422645.[MT7]-AAPAEGAGEDEDDGASR.2y8_1.heavy 881.386 / 864.333 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1501 191 C20140711_OR018_04 C20140711_OR018_04 TB422645.[MT7]-AAPAEGAGEDEDDGASR.2y12_1.heavy 881.386 / 1178.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1503 191 C20140711_OR018_04 C20140711_OR018_04 TB422645.[MT7]-AAPAEGAGEDEDDGASR.2y10_1.heavy 881.386 / 1050.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1505 191 C20140711_OR018_04 C20140711_OR018_04 TB422645.[MT7]-AAPAEGAGEDEDDGASR.2y7_1.heavy 881.386 / 749.306 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1507 192 C20140711_OR018_04 C20140711_OR018_04 TB432191.[MT7]-DILC[CAM]DVTLIVERK[MT7].3y7_1.heavy 621.36 / 1002.64 6035.0 45.68464946746826 45 20 10 5 10 13.0638741813833 7.654697114467407 0.041400909423828125 3 0.9957945679546898 19.024127273791155 6035.0 67.70032051282051 0.0 - - - - - - - 182.0 12 8 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1509 192 C20140711_OR018_04 C20140711_OR018_04 TB432191.[MT7]-DILC[CAM]DVTLIVERK[MT7].3y6_1.heavy 621.36 / 901.595 3017.0 45.68464946746826 45 20 10 5 10 13.0638741813833 7.654697114467407 0.041400909423828125 3 0.9957945679546898 19.024127273791155 3017.0 33.50610576923077 0.0 - - - - - - - 104.0 6 4 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1511 192 C20140711_OR018_04 C20140711_OR018_04 TB432191.[MT7]-DILC[CAM]DVTLIVERK[MT7].3b5_1.heavy 621.36 / 761.362 7803.0 45.68464946746826 45 20 10 5 10 13.0638741813833 7.654697114467407 0.041400909423828125 3 0.9957945679546898 19.024127273791155 7803.0 23.17571936713436 0.0 - - - - - - - 273.0 15 8 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1513 192 C20140711_OR018_04 C20140711_OR018_04 TB432191.[MT7]-DILC[CAM]DVTLIVERK[MT7].3y4_1.heavy 621.36 / 675.427 4786.0 45.68464946746826 45 20 10 5 10 13.0638741813833 7.654697114467407 0.041400909423828125 3 0.9957945679546898 19.024127273791155 4786.0 13.345576923076923 0.0 - - - - - - - 264.0 9 13 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1515 193 C20140711_OR018_04 C20140711_OR018_04 TB431966.[MT7]-MVEFLLK[MT7].2y4_1.heavy 584.356 / 664.451 3687.0 42.16495132446289 39 17 8 6 8 2.902790379867985 29.07462303987745 0.03929901123046875 4 0.9794476940232858 8.593804305970453 3687.0 5.422058823529412 2.0 - - - - - - - 238.0 10 12 LOC100509882;LOC100510355;LOC100510377;ANKRD36;LOC400986;ANKRD20A3;ANKRD20A2;ANKRD36B;ANKRD20A4;ANKRD20A1 ankyrin repeat domain-containing protein 36C-like;ankyrin repeat domain-containing protein 36A-like;ankyrin repeat domain-containing protein 36B-like;ankyrin repeat domain 36;ankyrin repeat domain-containing protein 36C;ankyrin repeat domain 20 family, member A3;ankyrin repeat domain 20 family, member A2;ankyrin repeat domain 36B;ankyrin repeat domain 20 family, member A4;ankyrin repeat domain 20 family, member A1 1517 193 C20140711_OR018_04 C20140711_OR018_04 TB431966.[MT7]-MVEFLLK[MT7].2b3_1.heavy 584.356 / 504.261 3449.0 42.16495132446289 39 17 8 6 8 2.902790379867985 29.07462303987745 0.03929901123046875 4 0.9794476940232858 8.593804305970453 3449.0 12.462773109243695 0.0 - - - - - - - 275.1875 6 16 LOC100509882;LOC100510355;LOC100510377;ANKRD36;LOC400986;ANKRD20A3;ANKRD20A2;ANKRD36B;ANKRD20A4;ANKRD20A1 ankyrin repeat domain-containing protein 36C-like;ankyrin repeat domain-containing protein 36A-like;ankyrin repeat domain-containing protein 36B-like;ankyrin repeat domain 36;ankyrin repeat domain-containing protein 36C;ankyrin repeat domain 20 family, member A3;ankyrin repeat domain 20 family, member A2;ankyrin repeat domain 36B;ankyrin repeat domain 20 family, member A4;ankyrin repeat domain 20 family, member A1 1519 193 C20140711_OR018_04 C20140711_OR018_04 TB431966.[MT7]-MVEFLLK[MT7].2y3_1.heavy 584.356 / 517.383 2735.0 42.16495132446289 39 17 8 6 8 2.902790379867985 29.07462303987745 0.03929901123046875 4 0.9794476940232858 8.593804305970453 2735.0 12.257703081232492 0.0 - - - - - - - 261.8 5 10 LOC100509882;LOC100510355;LOC100510377;ANKRD36;LOC400986;ANKRD20A3;ANKRD20A2;ANKRD36B;ANKRD20A4;ANKRD20A1 ankyrin repeat domain-containing protein 36C-like;ankyrin repeat domain-containing protein 36A-like;ankyrin repeat domain-containing protein 36B-like;ankyrin repeat domain 36;ankyrin repeat domain-containing protein 36C;ankyrin repeat domain 20 family, member A3;ankyrin repeat domain 20 family, member A2;ankyrin repeat domain 36B;ankyrin repeat domain 20 family, member A4;ankyrin repeat domain 20 family, member A1 1521 193 C20140711_OR018_04 C20140711_OR018_04 TB431966.[MT7]-MVEFLLK[MT7].2y6_1.heavy 584.356 / 892.562 3330.0 42.16495132446289 39 17 8 6 8 2.902790379867985 29.07462303987745 0.03929901123046875 4 0.9794476940232858 8.593804305970453 3330.0 40.57563025210084 0.0 - - - - - - - 158.66666666666666 6 3 LOC100509882;LOC100510355;LOC100510377;ANKRD36;LOC400986;ANKRD20A3;ANKRD20A2;ANKRD36B;ANKRD20A4;ANKRD20A1 ankyrin repeat domain-containing protein 36C-like;ankyrin repeat domain-containing protein 36A-like;ankyrin repeat domain-containing protein 36B-like;ankyrin repeat domain 36;ankyrin repeat domain-containing protein 36C;ankyrin repeat domain 20 family, member A3;ankyrin repeat domain 20 family, member A2;ankyrin repeat domain 36B;ankyrin repeat domain 20 family, member A4;ankyrin repeat domain 20 family, member A1 1523 194 C20140711_OR018_04 C20140711_OR018_04 TB431961.[MT7]-GETFFFK[MT7].2y4_1.heavy 582.321 / 732.42 2368.0 37.25100135803223 39 16 10 5 8 2.467318749810891 33.81607989608175 0.04199981689453125 4 0.9609389217989012 6.223953721597809 2368.0 1.667370925057735 1.0 - - - - - - - 251.375 5 8 MMP25 matrix metallopeptidase 25 1525 194 C20140711_OR018_04 C20140711_OR018_04 TB431961.[MT7]-GETFFFK[MT7].2b4_1.heavy 582.321 / 579.289 4026.0 37.25100135803223 39 16 10 5 8 2.467318749810891 33.81607989608175 0.04199981689453125 4 0.9609389217989012 6.223953721597809 4026.0 10.194126753335613 0.0 - - - - - - - 249.88888888888889 8 9 MMP25 matrix metallopeptidase 25 1527 194 C20140711_OR018_04 C20140711_OR018_04 TB431961.[MT7]-GETFFFK[MT7].2y3_1.heavy 582.321 / 585.352 2723.0 37.25100135803223 39 16 10 5 8 2.467318749810891 33.81607989608175 0.04199981689453125 4 0.9609389217989012 6.223953721597809 2723.0 6.253325457102673 1.0 - - - - - - - 355.25 5 8 MMP25 matrix metallopeptidase 25 1529 194 C20140711_OR018_04 C20140711_OR018_04 TB431961.[MT7]-GETFFFK[MT7].2y6_1.heavy 582.321 / 962.51 2013.0 37.25100135803223 39 16 10 5 8 2.467318749810891 33.81607989608175 0.04199981689453125 4 0.9609389217989012 6.223953721597809 2013.0 9.632540559814585 0.0 - - - - - - - 236.71428571428572 4 7 MMP25 matrix metallopeptidase 25 1531 195 C20140711_OR018_04 C20140711_OR018_04 TB431865.[MT7]-TVDGTAR.2b3_1.heavy 432.239 / 460.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1533 195 C20140711_OR018_04 C20140711_OR018_04 TB431865.[MT7]-TVDGTAR.2y5_1.heavy 432.239 / 519.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1535 195 C20140711_OR018_04 C20140711_OR018_04 TB431865.[MT7]-TVDGTAR.2b4_1.heavy 432.239 / 517.274 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1537 195 C20140711_OR018_04 C20140711_OR018_04 TB431865.[MT7]-TVDGTAR.2b6_1.heavy 432.239 / 689.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1539 196 C20140711_OR018_04 C20140711_OR018_04 TB422690.[MT7]-YNYSEALTFDPQK[MT7].3b6_1.heavy 621.984 / 872.391 7057.0 36.21080017089844 44 14 10 10 10 1.6967799471301326 46.29667147362768 0.0 3 0.9432418874705821 5.15552072909746 7057.0 32.443255033557044 0.0 - - - - - - - 161.375 14 8 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1541 196 C20140711_OR018_04 C20140711_OR018_04 TB422690.[MT7]-YNYSEALTFDPQK[MT7].3y3_1.heavy 621.984 / 516.326 22264.0 36.21080017089844 44 14 10 10 10 1.6967799471301326 46.29667147362768 0.0 3 0.9432418874705821 5.15552072909746 22264.0 -1.243798882681567 0.0 - - - - - - - 99.0 44 2 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1543 196 C20140711_OR018_04 C20140711_OR018_04 TB422690.[MT7]-YNYSEALTFDPQK[MT7].3b5_1.heavy 621.984 / 801.354 3777.0 36.21080017089844 44 14 10 10 10 1.6967799471301326 46.29667147362768 0.0 3 0.9432418874705821 5.15552072909746 3777.0 -0.09489949748743598 0.0 - - - - - - - 173.875 7 8 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1545 196 C20140711_OR018_04 C20140711_OR018_04 TB422690.[MT7]-YNYSEALTFDPQK[MT7].3b3_1.heavy 621.984 / 585.279 3081.0 36.21080017089844 44 14 10 10 10 1.6967799471301326 46.29667147362768 0.0 3 0.9432418874705821 5.15552072909746 3081.0 -1.2398390342052314 0.0 - - - - - - - 357.8 6 5 NDST4 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4 1547 197 C20140711_OR018_04 C20140711_OR018_04 TB444178.[MT7]-ITYEELPAIITIEDAIK[MT7].3b6_1.heavy 740.759 / 893.474 5810.0 51.787601470947266 45 15 10 10 10 2.196158393828356 38.54404078388402 0.0 3 0.9579232307621502 5.995238744621476 5810.0 65.62492647058824 0.0 - - - - - - - 94.44444444444444 11 9 XDH xanthine dehydrogenase 1549 197 C20140711_OR018_04 C20140711_OR018_04 TB444178.[MT7]-ITYEELPAIITIEDAIK[MT7].3b4_1.heavy 740.759 / 651.347 1495.0 51.787601470947266 45 15 10 10 10 2.196158393828356 38.54404078388402 0.0 3 0.9579232307621502 5.995238744621476 1495.0 -0.02401412595644495 3.0 - - - - - - - 123.63636363636364 3 11 XDH xanthine dehydrogenase 1551 197 C20140711_OR018_04 C20140711_OR018_04 TB444178.[MT7]-ITYEELPAIITIEDAIK[MT7].3b5_1.heavy 740.759 / 780.39 4519.0 51.787601470947266 45 15 10 10 10 2.196158393828356 38.54404078388402 0.0 3 0.9579232307621502 5.995238744621476 4519.0 13.80638513282553 1.0 - - - - - - - 182.36363636363637 9 11 XDH xanthine dehydrogenase 1553 197 C20140711_OR018_04 C20140711_OR018_04 TB444178.[MT7]-ITYEELPAIITIEDAIK[MT7].3b8_1.heavy 740.759 / 1061.56 2752.0 51.787601470947266 45 15 10 10 10 2.196158393828356 38.54404078388402 0.0 3 0.9579232307621502 5.995238744621476 2752.0 39.09458823529411 0.0 - - - - - - - 132.6 5 10 XDH xanthine dehydrogenase 1555 198 C20140711_OR018_04 C20140711_OR018_04 TB431860.[MT7]-LVTSTR.2y4_1.heavy 410.754 / 464.246 2503.0 20.51729965209961 35 7 10 10 8 5.523156242794645 18.105589558589294 0.0 4 0.7227065799106551 2.2871987526627184 2503.0 20.85994066425214 0.0 - - - - - - - 197.2 5 10 XDH xanthine dehydrogenase 1557 198 C20140711_OR018_04 C20140711_OR018_04 TB431860.[MT7]-LVTSTR.2b3_1.heavy 410.754 / 458.31 910.0 20.51729965209961 35 7 10 10 8 5.523156242794645 18.105589558589294 0.0 4 0.7227065799106551 2.2871987526627184 910.0 3.592105263157895 3.0 - - - - - - - 199.8421052631579 4 19 XDH xanthine dehydrogenase 1559 198 C20140711_OR018_04 C20140711_OR018_04 TB431860.[MT7]-LVTSTR.2y5_1.heavy 410.754 / 563.315 8952.0 20.51729965209961 35 7 10 10 8 5.523156242794645 18.105589558589294 0.0 4 0.7227065799106551 2.2871987526627184 8952.0 70.03038953315492 0.0 - - - - - - - 163.53846153846155 17 13 XDH xanthine dehydrogenase 1561 198 C20140711_OR018_04 C20140711_OR018_04 TB431860.[MT7]-LVTSTR.2b4_1.heavy 410.754 / 545.341 1062.0 20.51729965209961 35 7 10 10 8 5.523156242794645 18.105589558589294 0.0 4 0.7227065799106551 2.2871987526627184 1062.0 6.4907894736842096 2.0 - - - - - - - 189.75 3 12 XDH xanthine dehydrogenase 1563 199 C20140711_OR018_04 C20140711_OR018_04 TB432289.[MT7]-LAPGSGSFADSAVAPLALEILQAVGH.3b9_1.heavy 879.145 / 932.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 1565 199 C20140711_OR018_04 C20140711_OR018_04 TB432289.[MT7]-LAPGSGSFADSAVAPLALEILQAVGH.3b10_2.heavy 879.145 / 524.265 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 1567 199 C20140711_OR018_04 C20140711_OR018_04 TB432289.[MT7]-LAPGSGSFADSAVAPLALEILQAVGH.3b8_1.heavy 879.145 / 861.459 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 1569 199 C20140711_OR018_04 C20140711_OR018_04 TB432289.[MT7]-LAPGSGSFADSAVAPLALEILQAVGH.3b7_1.heavy 879.145 / 714.39 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 1571 200 C20140711_OR018_04 C20140711_OR018_04 TB432182.[MT7]-AAAVLAAESMVVTLAK[MT7].3b6_1.heavy 611.697 / 641.41 50723.0 48.88934898376465 38 12 10 6 10 1.0437570745629545 55.179349691687605 0.03859710693359375 3 0.8830971456506282 3.5737588360351085 50723.0 129.80341721248132 0.0 - - - - - - - 773.25 101 8 PDIA2 protein disulfide isomerase family A, member 2 1573 200 C20140711_OR018_04 C20140711_OR018_04 TB432182.[MT7]-AAAVLAAESMVVTLAK[MT7].3b5_1.heavy 611.697 / 570.373 46269.0 48.88934898376465 38 12 10 6 10 1.0437570745629545 55.179349691687605 0.03859710693359375 3 0.8830971456506282 3.5737588360351085 46269.0 224.57944508123455 0.0 - - - - - - - 277.1818181818182 92 11 PDIA2 protein disulfide isomerase family A, member 2 1575 200 C20140711_OR018_04 C20140711_OR018_04 TB432182.[MT7]-AAAVLAAESMVVTLAK[MT7].3y4_1.heavy 611.697 / 576.384 71094.0 48.88934898376465 38 12 10 6 10 1.0437570745629545 55.179349691687605 0.03859710693359375 3 0.8830971456506282 3.5737588360351085 71094.0 181.47022539016027 0.0 - - - - - - - 804.0 142 8 PDIA2 protein disulfide isomerase family A, member 2 1577 200 C20140711_OR018_04 C20140711_OR018_04 TB432182.[MT7]-AAAVLAAESMVVTLAK[MT7].3y5_1.heavy 611.697 / 675.452 55589.0 48.88934898376465 38 12 10 6 10 1.0437570745629545 55.179349691687605 0.03859710693359375 3 0.8830971456506282 3.5737588360351085 55589.0 643.1147278472147 0.0 - - - - - - - 214.1 111 10 PDIA2 protein disulfide isomerase family A, member 2 1579 201 C20140711_OR018_04 C20140711_OR018_04 TB444035.[MT7]-DILC[CAM]DVTLIVER.2y8_1.heavy 795.438 / 944.541 809.0 48.4541015625 43 13 10 10 10 2.381004907030921 34.95148537609464 0.0 3 0.9257182846797939 4.49982561844044 809.0 14.59186475763326 0.0 - - - - - - - 0.0 1 0 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1581 201 C20140711_OR018_04 C20140711_OR018_04 TB444035.[MT7]-DILC[CAM]DVTLIVER.2y9_1.heavy 795.438 / 1104.57 1805.0 48.4541015625 43 13 10 10 10 2.381004907030921 34.95148537609464 0.0 3 0.9257182846797939 4.49982561844044 1805.0 33.15757288252544 0.0 - - - - - - - 141.27272727272728 3 11 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1583 201 C20140711_OR018_04 C20140711_OR018_04 TB444035.[MT7]-DILC[CAM]DVTLIVER.2y10_1.heavy 795.438 / 1217.66 498.0 48.4541015625 43 13 10 10 10 2.381004907030921 34.95148537609464 0.0 3 0.9257182846797939 4.49982561844044 498.0 6.019354838709678 1.0 - - - - - - - 0.0 0 0 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1585 201 C20140711_OR018_04 C20140711_OR018_04 TB444035.[MT7]-DILC[CAM]DVTLIVER.2y7_1.heavy 795.438 / 829.514 560.0 48.4541015625 43 13 10 10 10 2.381004907030921 34.95148537609464 0.0 3 0.9257182846797939 4.49982561844044 560.0 8.651612903225807 2.0 - - - - - - - 0.0 1 0 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1587 202 C20140711_OR018_04 C20140711_OR018_04 TB432184.[MT7]-TVIAQDENLPEDVVR.2y9_1.heavy 921.49 / 1070.55 5038.0 34.10214900970459 40 14 10 6 10 8.662364743758133 11.544191794978078 0.037799835205078125 3 0.9359733990807088 4.851066817897567 5038.0 26.074755607393964 0.0 - - - - - - - 171.5 10 10 ULK4 unc-51-like kinase 4 (C. elegans) 1589 202 C20140711_OR018_04 C20140711_OR018_04 TB432184.[MT7]-TVIAQDENLPEDVVR.2y3_1.heavy 921.49 / 373.256 3829.0 34.10214900970459 40 14 10 6 10 8.662364743758133 11.544191794978078 0.037799835205078125 3 0.9359733990807088 4.851066817897567 3829.0 0.0 0.0 - - - - - - - 165.1818181818182 7 11 ULK4 unc-51-like kinase 4 (C. elegans) 1591 202 C20140711_OR018_04 C20140711_OR018_04 TB432184.[MT7]-TVIAQDENLPEDVVR.2y6_1.heavy 921.49 / 714.378 6750.0 34.10214900970459 40 14 10 6 10 8.662364743758133 11.544191794978078 0.037799835205078125 3 0.9359733990807088 4.851066817897567 6750.0 4.687499999999999 0.0 - - - - - - - 218.5 13 6 ULK4 unc-51-like kinase 4 (C. elegans) 1593 202 C20140711_OR018_04 C20140711_OR018_04 TB432184.[MT7]-TVIAQDENLPEDVVR.2y10_1.heavy 921.49 / 1185.57 5138.0 34.10214900970459 40 14 10 6 10 8.662364743758133 11.544191794978078 0.037799835205078125 3 0.9359733990807088 4.851066817897567 5138.0 74.22120792079208 0.0 - - - - - - - 168.22222222222223 10 9 ULK4 unc-51-like kinase 4 (C. elegans) 1595 203 C20140711_OR018_04 C20140711_OR018_04 TB432280.[MT7]-DLEQLVGIANYYALLHQQK[MT7].3b4_1.heavy 835.463 / 630.321 6851.0 46.103349685668945 46 20 10 6 10 19.708949547113924 5.073837129723815 0.039897918701171875 3 0.9981225664065734 28.478171920674317 6851.0 44.14235470212893 0.0 - - - - - - - 242.875 13 8 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1597 203 C20140711_OR018_04 C20140711_OR018_04 TB432280.[MT7]-DLEQLVGIANYYALLHQQK[MT7].3b5_1.heavy 835.463 / 743.406 4601.0 46.103349685668945 46 20 10 6 10 19.708949547113924 5.073837129723815 0.039897918701171875 3 0.9981225664065734 28.478171920674317 4601.0 5.476159217877094 1.0 - - - - - - - 175.28571428571428 9 7 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1599 203 C20140711_OR018_04 C20140711_OR018_04 TB432280.[MT7]-DLEQLVGIANYYALLHQQK[MT7].3b3_1.heavy 835.463 / 502.263 2659.0 46.103349685668945 46 20 10 6 10 19.708949547113924 5.073837129723815 0.039897918701171875 3 0.9981225664065734 28.478171920674317 2659.0 31.13766887194976 0.0 - - - - - - - 243.0 5 8 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1601 203 C20140711_OR018_04 C20140711_OR018_04 TB432280.[MT7]-DLEQLVGIANYYALLHQQK[MT7].3b7_1.heavy 835.463 / 899.495 2965.0 46.103349685668945 46 20 10 6 10 19.708949547113924 5.073837129723815 0.039897918701171875 3 0.9981225664065734 28.478171920674317 2965.0 5.785365853658536 0.0 - - - - - - - 225.0 5 5 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1603 204 C20140711_OR018_04 C20140711_OR018_04 TB422890.[MT7]-REPLDSPQWATHSQGMVPGMLPK[MT7].4b8_1.heavy 713.371 / 1067.56 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1605 204 C20140711_OR018_04 C20140711_OR018_04 TB422890.[MT7]-REPLDSPQWATHSQGMVPGMLPK[MT7].4y5_1.heavy 713.371 / 689.414 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1607 204 C20140711_OR018_04 C20140711_OR018_04 TB422890.[MT7]-REPLDSPQWATHSQGMVPGMLPK[MT7].4b5_1.heavy 713.371 / 755.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1609 204 C20140711_OR018_04 C20140711_OR018_04 TB422890.[MT7]-REPLDSPQWATHSQGMVPGMLPK[MT7].4y6_1.heavy 713.371 / 786.466 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1611 205 C20140711_OR018_04 C20140711_OR018_04 TB432282.[MT7]-NQPEPTMEEIENAFQGNLC[CAM]R.3b9_1.heavy 841.057 / 1200.53 2862.0 44.78639888763428 39 17 9 5 8 5.269198867580835 18.97821709012692 0.043598175048828125 4 0.9791314775730496 8.528219235762462 2862.0 32.69618181818182 0.0 - - - - - - - 183.33333333333334 5 9 XDH xanthine dehydrogenase 1613 205 C20140711_OR018_04 C20140711_OR018_04 TB432282.[MT7]-NQPEPTMEEIENAFQGNLC[CAM]R.3b6_1.heavy 841.057 / 811.407 1541.0 44.78639888763428 39 17 9 5 8 5.269198867580835 18.97821709012692 0.043598175048828125 4 0.9791314775730496 8.528219235762462 1541.0 -0.017331154542092164 2.0 - - - - - - - 220.0 4 7 XDH xanthine dehydrogenase 1615 205 C20140711_OR018_04 C20140711_OR018_04 TB432282.[MT7]-NQPEPTMEEIENAFQGNLC[CAM]R.3b4_1.heavy 841.057 / 613.306 6603.0 44.78639888763428 39 17 9 5 8 5.269198867580835 18.97821709012692 0.043598175048828125 4 0.9791314775730496 8.528219235762462 6603.0 48.20090687181005 1.0 - - - - - - - 201.66666666666666 14 6 XDH xanthine dehydrogenase 1617 205 C20140711_OR018_04 C20140711_OR018_04 TB432282.[MT7]-NQPEPTMEEIENAFQGNLC[CAM]R.3y5_1.heavy 841.057 / 619.298 4622.0 44.78639888763428 39 17 9 5 8 5.269198867580835 18.97821709012692 0.043598175048828125 4 0.9791314775730496 8.528219235762462 4622.0 6.523769836094082 1.0 - - - - - - - 238.33333333333334 9 6 XDH xanthine dehydrogenase 1619 206 C20140711_OR018_04 C20140711_OR018_04 TB422150.[MT7]-EAVAAAGAAGGK[MT7].3b4_1.heavy 420.91 / 515.295 2676.0 20.058000087738037 41 15 10 6 10 2.460382682946049 32.83872012351934 0.03280067443847656 3 0.9553598089731102 5.819295060023731 2676.0 11.700744100347245 0.0 - - - - - - - 163.0 5 8 TEX13B testis expressed 13B 1621 206 C20140711_OR018_04 C20140711_OR018_04 TB422150.[MT7]-EAVAAAGAAGGK[MT7].3b5_1.heavy 420.91 / 586.332 5009.0 20.058000087738037 41 15 10 6 10 2.460382682946049 32.83872012351934 0.03280067443847656 3 0.9553598089731102 5.819295060023731 5009.0 29.19638934164836 0.0 - - - - - - - 188.75 10 8 TEX13B testis expressed 13B 1623 206 C20140711_OR018_04 C20140711_OR018_04 TB422150.[MT7]-EAVAAAGAAGGK[MT7].3y4_1.heavy 420.91 / 476.295 2882.0 20.058000087738037 41 15 10 6 10 2.460382682946049 32.83872012351934 0.03280067443847656 3 0.9553598089731102 5.819295060023731 2882.0 43.15802096524553 0.0 - - - - - - - 122.85714285714286 5 14 TEX13B testis expressed 13B 1625 206 C20140711_OR018_04 C20140711_OR018_04 TB422150.[MT7]-EAVAAAGAAGGK[MT7].3b7_1.heavy 420.91 / 714.39 1372.0 20.058000087738037 41 15 10 6 10 2.460382682946049 32.83872012351934 0.03280067443847656 3 0.9553598089731102 5.819295060023731 1372.0 19.08869565217391 0.0 - - - - - - - 118.0 2 7 TEX13B testis expressed 13B 1627 207 C20140711_OR018_04 C20140711_OR018_04 TB422894.[MT7]-DAFGGVYSGPSLLDVSQTSVTALPSK[MT7].3b9_1.heavy 962.178 / 998.47 3249.0 43.76530075073242 46 16 10 10 10 3.4321533376014237 29.136227366194966 0.0 3 0.9685063845530091 6.9359296420064265 3249.0 -0.2737933240089983 2.0 - - - - - - - 240.6 9 5 TSHR thyroid stimulating hormone receptor 1629 207 C20140711_OR018_04 C20140711_OR018_04 TB422894.[MT7]-DAFGGVYSGPSLLDVSQTSVTALPSK[MT7].3b6_1.heavy 962.178 / 691.353 16004.0 43.76530075073242 46 16 10 10 10 3.4321533376014237 29.136227366194966 0.0 3 0.9685063845530091 6.9359296420064265 16004.0 139.3370062305296 0.0 - - - - - - - 320.8333333333333 32 6 TSHR thyroid stimulating hormone receptor 1631 207 C20140711_OR018_04 C20140711_OR018_04 TB422894.[MT7]-DAFGGVYSGPSLLDVSQTSVTALPSK[MT7].3b5_1.heavy 962.178 / 592.285 9025.0 43.76530075073242 46 16 10 10 10 3.4321533376014237 29.136227366194966 0.0 3 0.9685063845530091 6.9359296420064265 9025.0 -3.7604166666666714 0.0 - - - - - - - 240.5 18 4 TSHR thyroid stimulating hormone receptor 1633 207 C20140711_OR018_04 C20140711_OR018_04 TB422894.[MT7]-DAFGGVYSGPSLLDVSQTSVTALPSK[MT7].3b7_1.heavy 962.178 / 854.417 6498.0 43.76530075073242 46 16 10 10 10 3.4321533376014237 29.136227366194966 0.0 3 0.9685063845530091 6.9359296420064265 6498.0 -2.707500000000003 0.0 - - - - - - - 144.2 12 5 TSHR thyroid stimulating hormone receptor 1635 208 C20140711_OR018_04 C20140711_OR018_04 TB422295.[MT7]-YLTVIDK[MT7].2b3_1.heavy 570.349 / 522.304 8563.0 33.81769943237305 48 20 10 10 8 10.817281833967574 9.244466542970887 0.0 4 0.9967264426886164 21.564224785326903 8563.0 32.19107973073322 0.0 - - - - - - - 321.1666666666667 17 12 TSHR thyroid stimulating hormone receptor 1637 208 C20140711_OR018_04 C20140711_OR018_04 TB422295.[MT7]-YLTVIDK[MT7].2y5_1.heavy 570.349 / 719.442 13174.0 33.81769943237305 48 20 10 10 8 10.817281833967574 9.244466542970887 0.0 4 0.9967264426886164 21.564224785326903 13174.0 50.4536170212766 0.0 - - - - - - - 275.73333333333335 26 15 TSHR thyroid stimulating hormone receptor 1639 208 C20140711_OR018_04 C20140711_OR018_04 TB422295.[MT7]-YLTVIDK[MT7].2y3_1.heavy 570.349 / 519.326 17691.0 33.81769943237305 48 20 10 10 8 10.817281833967574 9.244466542970887 0.0 4 0.9967264426886164 21.564224785326903 17691.0 56.15021725862507 1.0 - - - - - - - 282.0 35 13 TSHR thyroid stimulating hormone receptor 1641 208 C20140711_OR018_04 C20140711_OR018_04 TB422295.[MT7]-YLTVIDK[MT7].2y6_1.heavy 570.349 / 832.526 9692.0 33.81769943237305 48 20 10 10 8 10.817281833967574 9.244466542970887 0.0 4 0.9967264426886164 21.564224785326903 9692.0 54.904148936170216 1.0 - - - - - - - 264.90909090909093 20 11 TSHR thyroid stimulating hormone receptor 1643 209 C20140711_OR018_04 C20140711_OR018_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 113627.0 44.22589874267578 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 113627.0 250.4838189252336 0.0 - - - - - - - 285.3333333333333 227 6 1645 209 C20140711_OR018_04 C20140711_OR018_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 164234.0 44.22589874267578 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 164234.0 206.67955536675163 0.0 - - - - - - - 214.0 328 3 1647 209 C20140711_OR018_04 C20140711_OR018_04 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 153321.0 44.22589874267578 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 153321.0 255.1876287170773 0.0 - - - - - - - 196.16666666666666 306 6 1649 210 C20140711_OR018_04 C20140711_OR018_04 TB431978.[MT7]-IK[MT7]EEEK[MT7].2y4_1.heavy 604.367 / 678.343 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZBTB7C;TRIM25;CALD1 zinc finger and BTB domain containing 7C;tripartite motif-containing 25;caldesmon 1 1651 210 C20140711_OR018_04 C20140711_OR018_04 TB431978.[MT7]-IK[MT7]EEEK[MT7].2y5_1.heavy 604.367 / 950.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZBTB7C;TRIM25;CALD1 zinc finger and BTB domain containing 7C;tripartite motif-containing 25;caldesmon 1 1653 210 C20140711_OR018_04 C20140711_OR018_04 TB431978.[MT7]-IK[MT7]EEEK[MT7].2b4_1.heavy 604.367 / 788.476 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZBTB7C;TRIM25;CALD1 zinc finger and BTB domain containing 7C;tripartite motif-containing 25;caldesmon 1 1655 210 C20140711_OR018_04 C20140711_OR018_04 TB431978.[MT7]-IK[MT7]EEEK[MT7].2b5_1.heavy 604.367 / 917.518 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZBTB7C;TRIM25;CALD1 zinc finger and BTB domain containing 7C;tripartite motif-containing 25;caldesmon 1 1657 211 C20140711_OR018_04 C20140711_OR018_04 TB431979.[MT7]-ELLQNSQSR.2b3_1.heavy 609.832 / 500.32 5028.0 22.514699935913086 50 20 10 10 10 7.651821605445478 13.068783507555146 0.0 3 0.9951885432836808 17.78483301622771 5028.0 22.255445719329213 0.0 - - - - - - - 183.11111111111111 10 9 ULK4 unc-51-like kinase 4 (C. elegans) 1659 211 C20140711_OR018_04 C20140711_OR018_04 TB431979.[MT7]-ELLQNSQSR.2y8_1.heavy 609.832 / 945.511 9808.0 22.514699935913086 50 20 10 10 10 7.651821605445478 13.068783507555146 0.0 3 0.9951885432836808 17.78483301622771 9808.0 17.6084093885782 0.0 - - - - - - - 170.5 19 14 ULK4 unc-51-like kinase 4 (C. elegans) 1661 211 C20140711_OR018_04 C20140711_OR018_04 TB431979.[MT7]-ELLQNSQSR.2y6_1.heavy 609.832 / 719.343 8324.0 22.514699935913086 50 20 10 10 10 7.651821605445478 13.068783507555146 0.0 3 0.9951885432836808 17.78483301622771 8324.0 98.44711816244376 0.0 - - - - - - - 206.0 16 10 ULK4 unc-51-like kinase 4 (C. elegans) 1663 211 C20140711_OR018_04 C20140711_OR018_04 TB431979.[MT7]-ELLQNSQSR.2y7_1.heavy 609.832 / 832.427 6511.0 22.514699935913086 50 20 10 10 10 7.651821605445478 13.068783507555146 0.0 3 0.9951885432836808 17.78483301622771 6511.0 129.4259756097561 0.0 - - - - - - - 164.66666666666666 13 6 ULK4 unc-51-like kinase 4 (C. elegans) 1665 212 C20140711_OR018_04 C20140711_OR018_04 TB432075.[MT7]-RYALSGSVWK[MT7].3y3_1.heavy 485.617 / 576.363 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 1667 212 C20140711_OR018_04 C20140711_OR018_04 TB432075.[MT7]-RYALSGSVWK[MT7].3b6_1.heavy 485.617 / 792.448 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 1669 212 C20140711_OR018_04 C20140711_OR018_04 TB432075.[MT7]-RYALSGSVWK[MT7].3b4_1.heavy 485.617 / 648.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 1671 212 C20140711_OR018_04 C20140711_OR018_04 TB432075.[MT7]-RYALSGSVWK[MT7].3b3_1.heavy 485.617 / 535.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 1673 213 C20140711_OR018_04 C20140711_OR018_04 TB431971.[MT7]-LTAEEEEAR.2y4_1.heavy 596.302 / 504.241 696.0 22.097999572753906 50 20 10 10 10 10.065307698661266 9.935116043526467 0.0 3 0.9952632610411608 17.92466578091125 696.0 0.0 5.0 - - - - - - - 0.0 1 0 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1675 213 C20140711_OR018_04 C20140711_OR018_04 TB431971.[MT7]-LTAEEEEAR.2y8_1.heavy 596.302 / 934.411 4720.0 22.097999572753906 50 20 10 10 10 10.065307698661266 9.935116043526467 0.0 3 0.9952632610411608 17.92466578091125 4720.0 61.82978056426332 0.0 - - - - - - - 217.9090909090909 9 11 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1677 213 C20140711_OR018_04 C20140711_OR018_04 TB431971.[MT7]-LTAEEEEAR.2y6_1.heavy 596.302 / 762.326 774.0 22.097999572753906 50 20 10 10 10 10.065307698661266 9.935116043526467 0.0 3 0.9952632610411608 17.92466578091125 774.0 6.278095661846496 2.0 - - - - - - - 0.0 1 0 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1679 213 C20140711_OR018_04 C20140711_OR018_04 TB431971.[MT7]-LTAEEEEAR.2y7_1.heavy 596.302 / 833.364 1238.0 22.097999572753906 50 20 10 10 10 10.065307698661266 9.935116043526467 0.0 3 0.9952632610411608 17.92466578091125 1238.0 31.351948051948053 0.0 - - - - - - - 210.14285714285714 2 7 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1681 214 C20140711_OR018_04 C20140711_OR018_04 TB422163.[MT7]-VDGPAQR.2y5_1.heavy 443.747 / 528.289 11577.0 16.44029998779297 46 20 10 6 10 8.88032049771564 11.26085483353037 0.035999298095703125 3 0.9984882523565312 31.73715496914402 11577.0 85.53817888885905 0.0 - - - - - - - 185.5 23 12 PDIA2 protein disulfide isomerase family A, member 2 1683 214 C20140711_OR018_04 C20140711_OR018_04 TB422163.[MT7]-VDGPAQR.2b4_1.heavy 443.747 / 513.279 111.0 16.44029998779297 46 20 10 6 10 8.88032049771564 11.26085483353037 0.035999298095703125 3 0.9984882523565312 31.73715496914402 111.0 0.2928571428571429 16.0 - - - - - - - 0.0 1 0 PDIA2 protein disulfide isomerase family A, member 2 1685 214 C20140711_OR018_04 C20140711_OR018_04 TB422163.[MT7]-VDGPAQR.2y6_1.heavy 443.747 / 643.316 4063.0 16.44029998779297 46 20 10 6 10 8.88032049771564 11.26085483353037 0.035999298095703125 3 0.9984882523565312 31.73715496914402 4063.0 48.29042322898438 0.0 - - - - - - - 133.6 8 10 PDIA2 protein disulfide isomerase family A, member 2 1687 214 C20140711_OR018_04 C20140711_OR018_04 TB422163.[MT7]-VDGPAQR.2b5_1.heavy 443.747 / 584.316 1837.0 16.44029998779297 46 20 10 6 10 8.88032049771564 11.26085483353037 0.035999298095703125 3 0.9984882523565312 31.73715496914402 1837.0 12.158561151079137 0.0 - - - - - - - 239.2 3 10 PDIA2 protein disulfide isomerase family A, member 2 1689 215 C20140711_OR018_04 C20140711_OR018_04 TB432277.[MT7]-TSTAVEVSPGEDMTHC[CAM]SPQK[MT7].4b4_1.heavy 613.045 / 505.274 10185.0 25.635400772094727 44 20 8 10 6 7.33245526314376 13.637996607036293 0.0 5 0.9917277679791342 13.559734280486165 10185.0 37.23201098901099 1.0 - - - - - - - 301.0 27 13 ULK4 unc-51-like kinase 4 (C. elegans) 1691 215 C20140711_OR018_04 C20140711_OR018_04 TB432277.[MT7]-TSTAVEVSPGEDMTHC[CAM]SPQK[MT7].4b5_1.heavy 613.045 / 604.342 8639.0 25.635400772094727 44 20 8 10 6 7.33245526314376 13.637996607036293 0.0 5 0.9917277679791342 13.559734280486165 8639.0 13.613415224583216 1.0 - - - - - - - 656.8888888888889 18 9 ULK4 unc-51-like kinase 4 (C. elegans) 1693 215 C20140711_OR018_04 C20140711_OR018_04 TB432277.[MT7]-TSTAVEVSPGEDMTHC[CAM]SPQK[MT7].4y3_1.heavy 613.045 / 516.326 6820.0 25.635400772094727 44 20 8 10 6 7.33245526314376 13.637996607036293 0.0 5 0.9917277679791342 13.559734280486165 6820.0 27.485961471291546 0.0 - - - - - - - 242.66666666666666 13 9 ULK4 unc-51-like kinase 4 (C. elegans) 1695 215 C20140711_OR018_04 C20140711_OR018_04 TB432277.[MT7]-TSTAVEVSPGEDMTHC[CAM]SPQK[MT7].4b6_1.heavy 613.045 / 733.385 7820.0 25.635400772094727 44 20 8 10 6 7.33245526314376 13.637996607036293 0.0 5 0.9917277679791342 13.559734280486165 7820.0 19.812683355508465 1.0 - - - - - - - 217.0 18 13 ULK4 unc-51-like kinase 4 (C. elegans) 1697 216 C20140711_OR018_04 C20140711_OR018_04 TB432274.[MT7]-ASSDFINLLDGLLQRDPQK[MT7].4b7_1.heavy 605.336 / 879.433 16494.0 50.75360107421875 43 13 10 10 10 1.2187446027828934 58.26948096681802 0.0 3 0.9120123417792557 4.129661553520436 16494.0 -3.7830275229357824 0.0 - - - - - - - 172.625 32 8 ULK4 unc-51-like kinase 4 (C. elegans) 1699 216 C20140711_OR018_04 C20140711_OR018_04 TB432274.[MT7]-ASSDFINLLDGLLQRDPQK[MT7].4b4_1.heavy 605.336 / 505.237 29864.0 50.75360107421875 43 13 10 10 10 1.2187446027828934 58.26948096681802 0.0 3 0.9120123417792557 4.129661553520436 29864.0 222.33332258217519 0.0 - - - - - - - 153.44444444444446 59 9 ULK4 unc-51-like kinase 4 (C. elegans) 1701 216 C20140711_OR018_04 C20140711_OR018_04 TB432274.[MT7]-ASSDFINLLDGLLQRDPQK[MT7].4b5_1.heavy 605.336 / 652.306 36622.0 50.75360107421875 43 13 10 10 10 1.2187446027828934 58.26948096681802 0.0 3 0.9120123417792557 4.129661553520436 36622.0 547.2086078719951 0.0 - - - - - - - 181.66666666666666 73 6 ULK4 unc-51-like kinase 4 (C. elegans) 1703 216 C20140711_OR018_04 C20140711_OR018_04 TB432274.[MT7]-ASSDFINLLDGLLQRDPQK[MT7].4y3_1.heavy 605.336 / 516.326 43234.0 50.75360107421875 43 13 10 10 10 1.2187446027828934 58.26948096681802 0.0 3 0.9120123417792557 4.129661553520436 43234.0 281.6159633027523 0.0 - - - - - - - 238.71428571428572 86 7 ULK4 unc-51-like kinase 4 (C. elegans) 1705 217 C20140711_OR018_04 C20140711_OR018_04 TB444018.[MT7]-RIHTGERPYK[MT7].3y6_1.heavy 515.635 / 893.496 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF716;ZFP62;ZNF735;ZNF559;ZNF479 zinc finger protein 716;zinc finger protein 62 homolog (mouse);zinc finger protein 735;zinc finger protein 559;zinc finger protein 479 1707 217 C20140711_OR018_04 C20140711_OR018_04 TB444018.[MT7]-RIHTGERPYK[MT7].3b6_1.heavy 515.635 / 838.465 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF716;ZFP62;ZNF735;ZNF559;ZNF479 zinc finger protein 716;zinc finger protein 62 homolog (mouse);zinc finger protein 735;zinc finger protein 559;zinc finger protein 479 1709 217 C20140711_OR018_04 C20140711_OR018_04 TB444018.[MT7]-RIHTGERPYK[MT7].3y8_2.heavy 515.635 / 566.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF716;ZFP62;ZNF735;ZNF559;ZNF479 zinc finger protein 716;zinc finger protein 62 homolog (mouse);zinc finger protein 735;zinc finger protein 559;zinc finger protein 479 1711 217 C20140711_OR018_04 C20140711_OR018_04 TB444018.[MT7]-RIHTGERPYK[MT7].3y9_2.heavy 515.635 / 622.847 N/A N/A - - - - - - - - - 0.0 - - - - - - - ZNF716;ZFP62;ZNF735;ZNF559;ZNF479 zinc finger protein 716;zinc finger protein 62 homolog (mouse);zinc finger protein 735;zinc finger protein 559;zinc finger protein 479 1713 218 C20140711_OR018_04 C20140711_OR018_04 TB422472.[MT7]-GSPVYTAPEVVR.2y8_1.heavy 709.892 / 934.499 4231.0 29.15809965133667 40 14 10 6 10 2.8104454150633864 28.158246460180287 0.03800010681152344 3 0.9466574470937951 5.319560812010006 4231.0 82.0295918367347 0.0 - - - - - - - 126.14285714285714 8 7 ULK4 unc-51-like kinase 4 (C. elegans) 1715 218 C20140711_OR018_04 C20140711_OR018_04 TB422472.[MT7]-GSPVYTAPEVVR.2y10_1.heavy 709.892 / 1130.62 2755.0 29.15809965133667 40 14 10 6 10 2.8104454150633864 28.158246460180287 0.03800010681152344 3 0.9466574470937951 5.319560812010006 2755.0 40.83410597741634 0.0 - - - - - - - 180.16666666666666 5 6 ULK4 unc-51-like kinase 4 (C. elegans) 1717 218 C20140711_OR018_04 C20140711_OR018_04 TB422472.[MT7]-GSPVYTAPEVVR.2y11_1.heavy 709.892 / 1217.65 295.0 29.15809965133667 40 14 10 6 10 2.8104454150633864 28.158246460180287 0.03800010681152344 3 0.9466574470937951 5.319560812010006 295.0 2.154081632653061 2.0 - - - - - - - 0.0 0 0 ULK4 unc-51-like kinase 4 (C. elegans) 1719 218 C20140711_OR018_04 C20140711_OR018_04 TB422472.[MT7]-GSPVYTAPEVVR.2y7_1.heavy 709.892 / 771.436 1968.0 29.15809965133667 40 14 10 6 10 2.8104454150633864 28.158246460180287 0.03800010681152344 3 0.9466574470937951 5.319560812010006 1968.0 -1.0 1.0 - - - - - - - 229.66666666666666 3 3 ULK4 unc-51-like kinase 4 (C. elegans) 1721 219 C20140711_OR018_04 C20140711_OR018_04 TB422878.[MT7]-LQGVPMPPGDLC[CAM]GPTLLLDVSIK[MT7].4y4_1.heavy 677.88 / 590.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1723 219 C20140711_OR018_04 C20140711_OR018_04 TB422878.[MT7]-LQGVPMPPGDLC[CAM]GPTLLLDVSIK[MT7].4b4_1.heavy 677.88 / 542.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1725 219 C20140711_OR018_04 C20140711_OR018_04 TB422878.[MT7]-LQGVPMPPGDLC[CAM]GPTLLLDVSIK[MT7].4y6_1.heavy 677.88 / 818.51 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1727 219 C20140711_OR018_04 C20140711_OR018_04 TB422878.[MT7]-LQGVPMPPGDLC[CAM]GPTLLLDVSIK[MT7].4b6_1.heavy 677.88 / 770.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1729 220 C20140711_OR018_04 C20140711_OR018_04 TB444191.[MT7]-LSLFC[CAM]IAAPVLLPSAAEMK[MT7].3y7_1.heavy 773.773 / 877.457 2508.0 52.31289863586426 42 18 10 6 8 3.1326122819460718 24.989217963726862 0.037799835205078125 4 0.9876117767159363 11.07665147774383 2508.0 103.59130434782608 0.0 - - - - - - - 71.0909090909091 5 22 AHRR aryl-hydrocarbon receptor repressor 1731 220 C20140711_OR018_04 C20140711_OR018_04 TB444191.[MT7]-LSLFC[CAM]IAAPVLLPSAAEMK[MT7].3b4_1.heavy 773.773 / 605.378 805.0 52.31289863586426 42 18 10 6 8 3.1326122819460718 24.989217963726862 0.037799835205078125 4 0.9876117767159363 11.07665147774383 805.0 7.75 1.0 - - - - - - - 0.0 1 0 AHRR aryl-hydrocarbon receptor repressor 1733 220 C20140711_OR018_04 C20140711_OR018_04 TB444191.[MT7]-LSLFC[CAM]IAAPVLLPSAAEMK[MT7].3b5_1.heavy 773.773 / 765.409 1150.0 52.31289863586426 42 18 10 6 8 3.1326122819460718 24.989217963726862 0.037799835205078125 4 0.9876117767159363 11.07665147774383 1150.0 25.96153846153846 1.0 - - - - - - - 65.55 2 20 AHRR aryl-hydrocarbon receptor repressor 1735 220 C20140711_OR018_04 C20140711_OR018_04 TB444191.[MT7]-LSLFC[CAM]IAAPVLLPSAAEMK[MT7].3b8_1.heavy 773.773 / 1020.57 1334.0 52.31289863586426 42 18 10 6 8 3.1326122819460718 24.989217963726862 0.037799835205078125 4 0.9876117767159363 11.07665147774383 1334.0 39.63333333333333 0.0 - - - - - - - 92.0 2 16 AHRR aryl-hydrocarbon receptor repressor 1737 221 C20140711_OR018_04 C20140711_OR018_04 TB422875.[MT7]-SVFSTGLTEADEASVFVVGTVLYR.3y7_1.heavy 897.805 / 807.472 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAI1 brain-specific angiogenesis inhibitor 1 1739 221 C20140711_OR018_04 C20140711_OR018_04 TB422875.[MT7]-SVFSTGLTEADEASVFVVGTVLYR.3b6_1.heavy 897.805 / 723.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAI1 brain-specific angiogenesis inhibitor 1 1741 221 C20140711_OR018_04 C20140711_OR018_04 TB422875.[MT7]-SVFSTGLTEADEASVFVVGTVLYR.3b7_1.heavy 897.805 / 836.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAI1 brain-specific angiogenesis inhibitor 1 1743 221 C20140711_OR018_04 C20140711_OR018_04 TB422875.[MT7]-SVFSTGLTEADEASVFVVGTVLYR.3y9_1.heavy 897.805 / 1053.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - BAI1 brain-specific angiogenesis inhibitor 1 1745 222 C20140711_OR018_04 C20140711_OR018_04 TB444197.[MT7]-TLLSPEEILLSIEIPY[MT7]SR.4y4_1.heavy 591.093 / 666.369 917.0 50.763075828552246 41 15 10 6 10 5.878116283328588 17.01225276601252 0.037899017333984375 3 0.9543402999628124 5.753463384442659 917.0 24.918478260869563 0.0 - - - - - - - 0.0 1 0 XDH xanthine dehydrogenase 1747 222 C20140711_OR018_04 C20140711_OR018_04 TB444197.[MT7]-TLLSPEEILLSIEIPY[MT7]SR.4b7_1.heavy 591.093 / 914.495 1559.0 50.763075828552246 41 15 10 6 10 5.878116283328588 17.01225276601252 0.037899017333984375 3 0.9543402999628124 5.753463384442659 1559.0 64.39347826086956 0.0 - - - - - - - 57.5 3 4 XDH xanthine dehydrogenase 1749 222 C20140711_OR018_04 C20140711_OR018_04 TB444197.[MT7]-TLLSPEEILLSIEIPY[MT7]SR.4b4_1.heavy 591.093 / 559.357 1972.0 50.763075828552246 41 15 10 6 10 5.878116283328588 17.01225276601252 0.037899017333984375 3 0.9543402999628124 5.753463384442659 1972.0 8.331541243497647 0.0 - - - - - - - 197.3 3 10 XDH xanthine dehydrogenase 1751 222 C20140711_OR018_04 C20140711_OR018_04 TB444197.[MT7]-TLLSPEEILLSIEIPY[MT7]SR.4y6_1.heavy 591.093 / 908.496 1101.0 50.763075828552246 41 15 10 6 10 5.878116283328588 17.01225276601252 0.037899017333984375 3 0.9543402999628124 5.753463384442659 1101.0 32.12047826086956 0.0 - - - - - - - 114.66666666666667 2 6 XDH xanthine dehydrogenase 1753 223 C20140711_OR018_04 C20140711_OR018_04 TB422375.[MT7]-K[MT7]AEATGEK[MT7].2y4_1.heavy 633.375 / 578.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - HMGA2 high mobility group AT-hook 2 1755 223 C20140711_OR018_04 C20140711_OR018_04 TB422375.[MT7]-K[MT7]AEATGEK[MT7].2b3_1.heavy 633.375 / 617.386 N/A N/A - - - - - - - - - 0.0 - - - - - - - HMGA2 high mobility group AT-hook 2 1757 223 C20140711_OR018_04 C20140711_OR018_04 TB422375.[MT7]-K[MT7]AEATGEK[MT7].2y5_1.heavy 633.375 / 649.364 N/A N/A - - - - - - - - - 0.0 - - - - - - - HMGA2 high mobility group AT-hook 2 1759 223 C20140711_OR018_04 C20140711_OR018_04 TB422375.[MT7]-K[MT7]AEATGEK[MT7].2y7_1.heavy 633.375 / 849.443 N/A N/A - - - - - - - - - 0.0 - - - - - - - HMGA2 high mobility group AT-hook 2 1761 224 C20140711_OR018_04 C20140711_OR018_04 TB432160.[MT7]-YDEAAARPDPGYPR.3b9_2.heavy 574.617 / 567.271 16208.0 24.346250534057617 32 13 10 3 6 1.9084745020951104 52.39787059781028 0.07960128784179688 5 0.9046273825916888 3.9640295126066913 16208.0 64.46066171081227 0.0 - - - - - - - 234.44444444444446 32 9 MMP25 matrix metallopeptidase 25 1763 224 C20140711_OR018_04 C20140711_OR018_04 TB432160.[MT7]-YDEAAARPDPGYPR.3b4_1.heavy 574.617 / 623.279 1182.0 24.346250534057617 32 13 10 3 6 1.9084745020951104 52.39787059781028 0.07960128784179688 5 0.9046273825916888 3.9640295126066913 1182.0 0.4 3.0 - - - - - - - 215.66666666666666 2 9 MMP25 matrix metallopeptidase 25 1765 224 C20140711_OR018_04 C20140711_OR018_04 TB432160.[MT7]-YDEAAARPDPGYPR.3b5_1.heavy 574.617 / 694.316 1604.0 24.346250534057617 32 13 10 3 6 1.9084745020951104 52.39787059781028 0.07960128784179688 5 0.9046273825916888 3.9640295126066913 1604.0 0.8442105263157895 2.0 - - - - - - - 261.6 5 10 MMP25 matrix metallopeptidase 25 1767 224 C20140711_OR018_04 C20140711_OR018_04 TB432160.[MT7]-YDEAAARPDPGYPR.3y5_1.heavy 574.617 / 589.309 22286.0 24.346250534057617 32 13 10 3 6 1.9084745020951104 52.39787059781028 0.07960128784179688 5 0.9046273825916888 3.9640295126066913 22286.0 93.00998658649398 0.0 - - - - - - - 197.0 44 6 MMP25 matrix metallopeptidase 25 1769 225 C20140711_OR018_04 C20140711_OR018_04 TB422175.[MT7]-ILAALPSA.2y5_1.heavy 450.288 / 458.261 N/A 40.27989959716797 26 -2 10 10 8 0.16397976078158788 212.9147570420598 0.0 4 0.11744653102047835 1.201125561681591 0.0 0.0 17.0 - - - - - - - 246.0 7 2 IRX1 iroquois homeobox 1 1771 225 C20140711_OR018_04 C20140711_OR018_04 TB422175.[MT7]-ILAALPSA.2b4_1.heavy 450.288 / 513.352 3561.0 40.27989959716797 26 -2 10 10 8 0.16397976078158788 212.9147570420598 0.0 4 0.11744653102047835 1.201125561681591 3561.0 28.822314534819558 3.0 - - - - - - - 164.0 19 3 IRX1 iroquois homeobox 1 1773 225 C20140711_OR018_04 C20140711_OR018_04 TB422175.[MT7]-ILAALPSA.2b5_1.heavy 450.288 / 626.436 7613.0 40.27989959716797 26 -2 10 10 8 0.16397976078158788 212.9147570420598 0.0 4 0.11744653102047835 1.201125561681591 7613.0 92.84146341463415 0.0 - - - - - - - 245.66666666666666 15 3 IRX1 iroquois homeobox 1 1775 225 C20140711_OR018_04 C20140711_OR018_04 TB422175.[MT7]-ILAALPSA.2y7_1.heavy 450.288 / 642.382 45554.0 40.27989959716797 26 -2 10 10 8 0.16397976078158788 212.9147570420598 0.0 4 0.11744653102047835 1.201125561681591 45554.0 729.6047154471545 0.0 - - - - - - - 368.25 91 4 IRX1 iroquois homeobox 1 1777 226 C20140711_OR018_04 C20140711_OR018_04 TB432167.[MT7]-LHRFWEGLPAQVR.3y12_2.heavy 584.997 / 748.399 4307.0 34.42273203531901 44 20 10 6 8 5.296435114899566 18.88062401041918 0.037601470947265625 4 0.993595828804021 15.413414440153414 4307.0 17.89454563545807 1.0 - - - - - - - 186.07142857142858 12 14 MMP25 matrix metallopeptidase 25 1779 226 C20140711_OR018_04 C20140711_OR018_04 TB432167.[MT7]-LHRFWEGLPAQVR.3y5_1.heavy 584.997 / 570.336 15025.0 34.42273203531901 44 20 10 6 8 5.296435114899566 18.88062401041918 0.037601470947265625 4 0.993595828804021 15.413414440153414 15025.0 27.368256561287254 0.0 - - - - - - - 282.45454545454544 30 11 MMP25 matrix metallopeptidase 25 1781 226 C20140711_OR018_04 C20140711_OR018_04 TB432167.[MT7]-LHRFWEGLPAQVR.3b7_2.heavy 584.997 / 535.786 9316.0 34.42273203531901 44 20 10 6 8 5.296435114899566 18.88062401041918 0.037601470947265625 4 0.993595828804021 15.413414440153414 9316.0 38.03129118136439 0.0 - - - - - - - 244.88888888888889 18 9 MMP25 matrix metallopeptidase 25 1783 226 C20140711_OR018_04 C20140711_OR018_04 TB432167.[MT7]-LHRFWEGLPAQVR.3y10_1.heavy 584.997 / 1202.63 N/A 34.42273203531901 44 20 10 6 8 5.296435114899566 18.88062401041918 0.037601470947265625 4 0.993595828804021 15.413414440153414 100.0 0.5 17.0 - - - - - - - 0.0 1 0 MMP25 matrix metallopeptidase 25 1785 227 C20140711_OR018_04 C20140711_OR018_04 TB422275.[MT7]-FAGLPETGR.2y8_1.heavy 546.302 / 800.426 18962.0 29.99679946899414 47 17 10 10 10 2.38329059987195 33.589400433250375 0.0 3 0.9757604979939836 7.91078063351647 18962.0 231.5870997559329 0.0 - - - - - - - 294.6363636363636 37 11 MMP25 matrix metallopeptidase 25 1787 227 C20140711_OR018_04 C20140711_OR018_04 TB422275.[MT7]-FAGLPETGR.2y5_1.heavy 546.302 / 559.284 19944.0 29.99679946899414 47 17 10 10 10 2.38329059987195 33.589400433250375 0.0 3 0.9757604979939836 7.91078063351647 19944.0 101.5492615672223 0.0 - - - - - - - 327.3333333333333 39 6 MMP25 matrix metallopeptidase 25 1789 227 C20140711_OR018_04 C20140711_OR018_04 TB422275.[MT7]-FAGLPETGR.2b4_1.heavy 546.302 / 533.32 12085.0 29.99679946899414 47 17 10 10 10 2.38329059987195 33.589400433250375 0.0 3 0.9757604979939836 7.91078063351647 12085.0 16.387868540147803 0.0 - - - - - - - 294.6 24 5 MMP25 matrix metallopeptidase 25 1791 227 C20140711_OR018_04 C20140711_OR018_04 TB422275.[MT7]-FAGLPETGR.2y7_1.heavy 546.302 / 729.389 10906.0 29.99679946899414 47 17 10 10 10 2.38329059987195 33.589400433250375 0.0 3 0.9757604979939836 7.91078063351647 10906.0 163.14485714285715 0.0 - - - - - - - 147.0 21 8 MMP25 matrix metallopeptidase 25 1793 228 C20140711_OR018_04 C20140711_OR018_04 TB422274.[MT7]-SLFSITK[MT7].2y4_1.heavy 542.336 / 592.379 4787.0 35.78010177612305 50 20 10 10 10 5.9291481879202035 16.865829092235508 0.0 3 0.9908817544479157 12.914457716077157 4787.0 81.66058823529411 0.0 - - - - - - - 254.875 9 8 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1795 228 C20140711_OR018_04 C20140711_OR018_04 TB422274.[MT7]-SLFSITK[MT7].2y5_1.heavy 542.336 / 739.447 3463.0 35.78010177612305 50 20 10 10 10 5.9291481879202035 16.865829092235508 0.0 3 0.9908817544479157 12.914457716077157 3463.0 36.67773103740514 0.0 - - - - - - - 215.11111111111111 6 9 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1797 228 C20140711_OR018_04 C20140711_OR018_04 TB422274.[MT7]-SLFSITK[MT7].2y3_1.heavy 542.336 / 505.347 1120.0 35.78010177612305 50 20 10 10 10 5.9291481879202035 16.865829092235508 0.0 3 0.9908817544479157 12.914457716077157 1120.0 2.2992081188906432 11.0 - - - - - - - 264.9 3 10 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1799 228 C20140711_OR018_04 C20140711_OR018_04 TB422274.[MT7]-SLFSITK[MT7].2y6_1.heavy 542.336 / 852.531 1630.0 35.78010177612305 50 20 10 10 10 5.9291481879202035 16.865829092235508 0.0 3 0.9908817544479157 12.914457716077157 1630.0 15.187262128438599 0.0 - - - - - - - 203.8 3 5 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1801 229 C20140711_OR018_04 C20140711_OR018_04 TB432164.[MT7]-SFPQSSQLSQETVR.2y9_1.heavy 869.448 / 1047.54 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 1803 229 C20140711_OR018_04 C20140711_OR018_04 TB432164.[MT7]-SFPQSSQLSQETVR.2y6_1.heavy 869.448 / 719.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 1805 229 C20140711_OR018_04 C20140711_OR018_04 TB432164.[MT7]-SFPQSSQLSQETVR.2y10_1.heavy 869.448 / 1134.57 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 1807 229 C20140711_OR018_04 C20140711_OR018_04 TB432164.[MT7]-SFPQSSQLSQETVR.2y7_1.heavy 869.448 / 832.452 N/A N/A - - - - - - - - - 0.0 - - - - - - - MMP25 matrix metallopeptidase 25 1809 230 C20140711_OR018_04 C20140711_OR018_04 TB422677.[MT7]-ADLSYPSHC[CAM]C[CAM]AFK[MT7].3b4_1.heavy 615.295 / 531.289 5661.0 28.1395001411438 38 15 10 3 10 1.6886858854963536 40.34788313066157 0.07579994201660156 3 0.9540577532530703 5.735606718934428 5661.0 -0.3933981931897148 0.0 - - - - - - - 288.0 11 6 TSHR thyroid stimulating hormone receptor 1811 230 C20140711_OR018_04 C20140711_OR018_04 TB422677.[MT7]-ADLSYPSHC[CAM]C[CAM]AFK[MT7].3b5_1.heavy 615.295 / 694.353 3454.0 28.1395001411438 38 15 10 3 10 1.6886858854963536 40.34788313066157 0.07579994201660156 3 0.9540577532530703 5.735606718934428 3454.0 -3.597916666666663 0.0 - - - - - - - 144.0 6 4 TSHR thyroid stimulating hormone receptor 1813 230 C20140711_OR018_04 C20140711_OR018_04 TB422677.[MT7]-ADLSYPSHC[CAM]C[CAM]AFK[MT7].3y4_1.heavy 615.295 / 669.351 9211.0 28.1395001411438 38 15 10 3 10 1.6886858854963536 40.34788313066157 0.07579994201660156 3 0.9540577532530703 5.735606718934428 9211.0 -4.797395833333333 0.0 - - - - - - - 240.0 18 6 TSHR thyroid stimulating hormone receptor 1815 230 C20140711_OR018_04 C20140711_OR018_04 TB422677.[MT7]-ADLSYPSHC[CAM]C[CAM]AFK[MT7].3y5_1.heavy 615.295 / 829.382 7484.0 28.1395001411438 38 15 10 3 10 1.6886858854963536 40.34788313066157 0.07579994201660156 3 0.9540577532530703 5.735606718934428 7484.0 -1.9489583333333371 0.0 - - - - - - - 120.0 14 4 TSHR thyroid stimulating hormone receptor 1817 231 C20140711_OR018_04 C20140711_OR018_04 TB432165.[MT7]-GTINFVAILC[CAM]TDK[MT7].3b6_1.heavy 580.658 / 776.442 6334.0 44.27000045776367 48 18 10 10 10 5.804563363474626 17.227824685186956 0.0 3 0.9879417121041161 11.227476985502205 6334.0 83.92377917843947 0.0 - - - - - - - 179.0 12 6 ULK4 unc-51-like kinase 4 (C. elegans) 1819 231 C20140711_OR018_04 C20140711_OR018_04 TB432165.[MT7]-GTINFVAILC[CAM]TDK[MT7].3b4_1.heavy 580.658 / 530.305 16854.0 44.27000045776367 48 18 10 10 10 5.804563363474626 17.227824685186956 0.0 3 0.9879417121041161 11.227476985502205 16854.0 170.28083402814937 0.0 - - - - - - - 178.77777777777777 33 9 ULK4 unc-51-like kinase 4 (C. elegans) 1821 231 C20140711_OR018_04 C20140711_OR018_04 TB432165.[MT7]-GTINFVAILC[CAM]TDK[MT7].3b5_1.heavy 580.658 / 677.374 19752.0 44.27000045776367 48 18 10 10 10 5.804563363474626 17.227824685186956 0.0 3 0.9879417121041161 11.227476985502205 19752.0 47.82104174660675 0.0 - - - - - - - 201.25 39 8 ULK4 unc-51-like kinase 4 (C. elegans) 1823 231 C20140711_OR018_04 C20140711_OR018_04 TB432165.[MT7]-GTINFVAILC[CAM]TDK[MT7].3b7_1.heavy 580.658 / 847.479 9232.0 44.27000045776367 48 18 10 10 10 5.804563363474626 17.227824685186956 0.0 3 0.9879417121041161 11.227476985502205 9232.0 58.069124074314665 0.0 - - - - - - - 184.0 18 7 ULK4 unc-51-like kinase 4 (C. elegans) 1825 232 C20140711_OR018_04 C20140711_OR018_04 TB422483.[MT7]-LGILFC[CAM]DISPR.3y6_1.heavy 478.935 / 747.345 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 1827 232 C20140711_OR018_04 C20140711_OR018_04 TB422483.[MT7]-LGILFC[CAM]DISPR.3b4_1.heavy 478.935 / 541.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 1829 232 C20140711_OR018_04 C20140711_OR018_04 TB422483.[MT7]-LGILFC[CAM]DISPR.3b3_1.heavy 478.935 / 428.299 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 1831 232 C20140711_OR018_04 C20140711_OR018_04 TB422483.[MT7]-LGILFC[CAM]DISPR.3y5_1.heavy 478.935 / 587.315 N/A N/A - - - - - - - - - 0.0 - - - - - - - ULK4 unc-51-like kinase 4 (C. elegans) 1833 233 C20140711_OR018_04 C20140711_OR018_04 TB422484.[MT7]-VTWIQASTLK[MT7].3b4_1.heavy 478.957 / 644.389 2904.0 36.6057014465332 37 15 6 10 6 2.143491734806447 37.198867127902616 0.0 5 0.9578484183542851 5.98987815025361 2904.0 -0.42086956521739083 0.0 - - - - - - - 186.6 5 5 XDH xanthine dehydrogenase 1835 233 C20140711_OR018_04 C20140711_OR018_04 TB422484.[MT7]-VTWIQASTLK[MT7].3y4_1.heavy 478.957 / 592.379 1867.0 36.6057014465332 37 15 6 10 6 2.143491734806447 37.198867127902616 0.0 5 0.9578484183542851 5.98987815025361 1867.0 25.443165180230395 0.0 - - - - - - - 165.8 3 5 XDH xanthine dehydrogenase 1837 233 C20140711_OR018_04 C20140711_OR018_04 TB422484.[MT7]-VTWIQASTLK[MT7].3b3_1.heavy 478.957 / 531.305 2801.0 36.6057014465332 37 15 6 10 6 2.143491734806447 37.198867127902616 0.0 5 0.9578484183542851 5.98987815025361 2801.0 7.030953152245204 4.0 - - - - - - - 265.0 9 9 XDH xanthine dehydrogenase 1839 233 C20140711_OR018_04 C20140711_OR018_04 TB422484.[MT7]-VTWIQASTLK[MT7].3y5_1.heavy 478.957 / 663.416 1763.0 36.6057014465332 37 15 6 10 6 2.143491734806447 37.198867127902616 0.0 5 0.9578484183542851 5.98987815025361 1763.0 14.14036801963434 0.0 - - - - - - - 172.83333333333334 3 6 XDH xanthine dehydrogenase 1841 234 C20140711_OR018_04 C20140711_OR018_04 TB422382.[MT7]-FSNFC[CAM]LAK[MT7].2y4_1.heavy 637.844 / 635.367 4761.0 34.49377632141113 39 13 10 6 10 2.4034641562911503 41.60661174756717 0.03749847412109375 3 0.9231595280444969 4.4232998536160775 4761.0 20.605396178624524 0.0 - - - - - - - 259.6363636363636 9 11 ULK4 unc-51-like kinase 4 (C. elegans) 1843 234 C20140711_OR018_04 C20140711_OR018_04 TB422382.[MT7]-FSNFC[CAM]LAK[MT7].2y5_1.heavy 637.844 / 782.435 2000.0 34.49377632141113 39 13 10 6 10 2.4034641562911503 41.60661174756717 0.03749847412109375 3 0.9231595280444969 4.4232998536160775 2000.0 7.885066998204172 0.0 - - - - - - - 250.9090909090909 4 11 ULK4 unc-51-like kinase 4 (C. elegans) 1845 234 C20140711_OR018_04 C20140711_OR018_04 TB422382.[MT7]-FSNFC[CAM]LAK[MT7].2b4_1.heavy 637.844 / 640.321 2666.0 34.49377632141113 39 13 10 6 10 2.4034641562911503 41.60661174756717 0.03749847412109375 3 0.9231595280444969 4.4232998536160775 2666.0 19.556927476170742 0.0 - - - - - - - 190.21428571428572 5 14 ULK4 unc-51-like kinase 4 (C. elegans) 1847 234 C20140711_OR018_04 C20140711_OR018_04 TB422382.[MT7]-FSNFC[CAM]LAK[MT7].2y7_1.heavy 637.844 / 983.51 10760.0 34.49377632141113 39 13 10 6 10 2.4034641562911503 41.60661174756717 0.03749847412109375 3 0.9231595280444969 4.4232998536160775 10760.0 106.0476348464284 0.0 - - - - - - - 199.7 21 10 ULK4 unc-51-like kinase 4 (C. elegans) 1849 235 C20140711_OR018_04 C20140711_OR018_04 TB431959.[MT7]-SHPATFPTR.2y4_1.heavy 579.313 / 520.288 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1851 235 C20140711_OR018_04 C20140711_OR018_04 TB431959.[MT7]-SHPATFPTR.2y8_1.heavy 579.313 / 926.484 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1853 235 C20140711_OR018_04 C20140711_OR018_04 TB431959.[MT7]-SHPATFPTR.2y6_1.heavy 579.313 / 692.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1855 235 C20140711_OR018_04 C20140711_OR018_04 TB431959.[MT7]-SHPATFPTR.2y7_1.heavy 579.313 / 789.425 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1857 236 C20140711_OR018_04 C20140711_OR018_04 TB431896.[MT7]-LGLSGTK[MT7].2y4_1.heavy 482.307 / 536.316 7232.0 25.308700561523438 44 16 10 10 8 3.060562594083368 32.6737313568814 0.0 4 0.9631448485622871 6.408705756673031 7232.0 27.0784287055928 0.0 - - - - - - - 250.66666666666666 14 9 XDH xanthine dehydrogenase 1859 236 C20140711_OR018_04 C20140711_OR018_04 TB431896.[MT7]-LGLSGTK[MT7].2y5_1.heavy 482.307 / 649.4 1878.0 25.308700561523438 44 16 10 10 8 3.060562594083368 32.6737313568814 0.0 4 0.9631448485622871 6.408705756673031 1878.0 24.37404255319149 0.0 - - - - - - - 141.0 3 6 XDH xanthine dehydrogenase 1861 236 C20140711_OR018_04 C20140711_OR018_04 TB431896.[MT7]-LGLSGTK[MT7].2y3_1.heavy 482.307 / 449.284 3381.0 25.308700561523438 44 16 10 10 8 3.060562594083368 32.6737313568814 0.0 4 0.9631448485622871 6.408705756673031 3381.0 8.416531914893616 0.0 - - - - - - - 270.25 6 8 XDH xanthine dehydrogenase 1863 236 C20140711_OR018_04 C20140711_OR018_04 TB431896.[MT7]-LGLSGTK[MT7].2y6_1.heavy 482.307 / 706.422 3569.0 25.308700561523438 44 16 10 10 8 3.060562594083368 32.6737313568814 0.0 4 0.9631448485622871 6.408705756673031 3569.0 6.876709376398503 3.0 - - - - - - - 208.88888888888889 8 9 XDH xanthine dehydrogenase 1865 237 C20140711_OR018_04 C20140711_OR018_04 TB431897.[MT7]-QFLQMR.2y4_1.heavy 483.769 / 547.302 1027.0 30.914750576019287 40 18 10 6 6 6.485962226812761 15.417912794281039 0.03899955749511719 5 0.9832878157148651 9.5332079376632 1027.0 3.3010714285714284 1.0 - - - - - - - 214.6 4 10 BAI1 brain-specific angiogenesis inhibitor 1 1867 237 C20140711_OR018_04 C20140711_OR018_04 TB431897.[MT7]-QFLQMR.2b3_1.heavy 483.769 / 533.32 1120.0 30.914750576019287 40 18 10 6 6 6.485962226812761 15.417912794281039 0.03899955749511719 5 0.9832878157148651 9.5332079376632 1120.0 5.8218766756032165 1.0 - - - - - - - 263.0 9 11 BAI1 brain-specific angiogenesis inhibitor 1 1869 237 C20140711_OR018_04 C20140711_OR018_04 TB431897.[MT7]-QFLQMR.2y5_1.heavy 483.769 / 694.37 4760.0 30.914750576019287 40 18 10 6 6 6.485962226812761 15.417912794281039 0.03899955749511719 5 0.9832878157148651 9.5332079376632 4760.0 48.159989442129664 1.0 - - - - - - - 196.0 10 10 BAI1 brain-specific angiogenesis inhibitor 1 1871 237 C20140711_OR018_04 C20140711_OR018_04 TB431897.[MT7]-QFLQMR.2b4_1.heavy 483.769 / 661.379 560.0 30.914750576019287 40 18 10 6 6 6.485962226812761 15.417912794281039 0.03899955749511719 5 0.9832878157148651 9.5332079376632 560.0 2.3363424294008746 3.0 - - - - - - - 0.0 1 0 BAI1 brain-specific angiogenesis inhibitor 1 1873 238 C20140711_OR018_04 C20140711_OR018_04 TB431950.[MT7]-REDDIAK[MT7].2b3_1.heavy 567.821 / 545.28 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 1875 238 C20140711_OR018_04 C20140711_OR018_04 TB431950.[MT7]-REDDIAK[MT7].2b4_1.heavy 567.821 / 660.307 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 1877 238 C20140711_OR018_04 C20140711_OR018_04 TB431950.[MT7]-REDDIAK[MT7].2b6_1.heavy 567.821 / 844.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 1879 238 C20140711_OR018_04 C20140711_OR018_04 TB431950.[MT7]-REDDIAK[MT7].2b5_1.heavy 567.821 / 773.391 N/A N/A - - - - - - - - - 0.0 - - - - - - - XDH xanthine dehydrogenase 1881 239 C20140711_OR018_04 C20140711_OR018_04 TB431957.[MT7]-TGTLTENK[MT7].2y4_1.heavy 576.329 / 635.348 1625.0 19.617399215698242 28 14 2 6 6 1.3770870256795902 57.8412976948238 0.033599853515625 5 0.9328730406099015 4.736461515448849 1625.0 14.882158517140578 1.0 - - - - - - - 133.55555555555554 3 9 ATP10B;ATP10A;ATP10D ATPase, class V, type 10B;ATPase, class V, type 10A;ATPase, class V, type 10D 1883 239 C20140711_OR018_04 C20140711_OR018_04 TB431957.[MT7]-TGTLTENK[MT7].2y5_1.heavy 576.329 / 748.432 1413.0 19.617399215698242 28 14 2 6 6 1.3770870256795902 57.8412976948238 0.033599853515625 5 0.9328730406099015 4.736461515448849 1413.0 6.8655506708001495 1.0 - - - - - - - 185.75 2 8 ATP10B;ATP10A;ATP10D ATPase, class V, type 10B;ATPase, class V, type 10A;ATPase, class V, type 10D 1885 239 C20140711_OR018_04 C20140711_OR018_04 TB431957.[MT7]-TGTLTENK[MT7].2y3_1.heavy 576.329 / 534.3 N/A 19.617399215698242 28 14 2 6 6 1.3770870256795902 57.8412976948238 0.033599853515625 5 0.9328730406099015 4.736461515448849 0.0 0.0 52.0 - - - - - - - 172.77777777777777 6 9 ATP10B;ATP10A;ATP10D ATPase, class V, type 10B;ATPase, class V, type 10A;ATPase, class V, type 10D 1887 239 C20140711_OR018_04 C20140711_OR018_04 TB431957.[MT7]-TGTLTENK[MT7].2y7_1.heavy 576.329 / 906.501 706.0 19.617399215698242 28 14 2 6 6 1.3770870256795902 57.8412976948238 0.033599853515625 5 0.9328730406099015 4.736461515448849 706.0 3.3035471698113206 2.0 - - - - - - - 114.875 7 8 ATP10B;ATP10A;ATP10D ATPase, class V, type 10B;ATPase, class V, type 10A;ATPase, class V, type 10D 1889 240 C20140711_OR018_04 C20140711_OR018_04 TB422385.[MT7]-TRLHPVQER.3y3_1.heavy 427.25 / 432.22 5898.0 16.674400329589844 46 16 10 10 10 2.016983889896614 39.17705668315358 0.0 3 0.9620268609796089 6.313063497590244 5898.0 116.83373806521348 0.0 - - - - - - - 126.75 11 12 XDH xanthine dehydrogenase 1891 240 C20140711_OR018_04 C20140711_OR018_04 TB422385.[MT7]-TRLHPVQER.3b4_1.heavy 427.25 / 652.401 2128.0 16.674400329589844 46 16 10 10 10 2.016983889896614 39.17705668315358 0.0 3 0.9620268609796089 6.313063497590244 2128.0 46.240010088272385 0.0 - - - - - - - 130.14285714285714 4 7 XDH xanthine dehydrogenase 1893 240 C20140711_OR018_04 C20140711_OR018_04 TB422385.[MT7]-TRLHPVQER.3y4_1.heavy 427.25 / 531.289 3891.0 16.674400329589844 46 16 10 10 10 2.016983889896614 39.17705668315358 0.0 3 0.9620268609796089 6.313063497590244 3891.0 60.59754098360655 0.0 - - - - - - - 144.625 7 8 XDH xanthine dehydrogenase 1895 240 C20140711_OR018_04 C20140711_OR018_04 TB422385.[MT7]-TRLHPVQER.3y5_1.heavy 427.25 / 628.341 8087.0 16.674400329589844 46 16 10 10 10 2.016983889896614 39.17705668315358 0.0 3 0.9620268609796089 6.313063497590244 8087.0 194.2205737704918 0.0 - - - - - - - 104.42857142857143 16 7 XDH xanthine dehydrogenase 1897 241 C20140711_OR018_04 C20140711_OR018_04 TB422386.[MT7]-YFPAGPGRK[MT7].3y7_1.heavy 427.583 / 826.502 1386.0 25.445600509643555 41 11 10 10 10 1.3479150646794442 64.24759894914902 0.0 3 0.8686386612496261 3.36709706540951 1386.0 15.742847110049864 1.0 - - - - - - - 202.33333333333334 2 3 PDIA2 protein disulfide isomerase family A, member 2 1899 241 C20140711_OR018_04 C20140711_OR018_04 TB422386.[MT7]-YFPAGPGRK[MT7].3y6_1.heavy 427.583 / 729.449 1646.0 25.445600509643555 41 11 10 10 10 1.3479150646794442 64.24759894914902 0.0 3 0.8686386612496261 3.36709706540951 1646.0 18.933757225433524 0.0 - - - - - - - 173.33333333333334 3 6 PDIA2 protein disulfide isomerase family A, member 2 1901 241 C20140711_OR018_04 C20140711_OR018_04 TB422386.[MT7]-YFPAGPGRK[MT7].3y8_2.heavy 427.583 / 487.289 6323.0 25.445600509643555 41 11 10 10 10 1.3479150646794442 64.24759894914902 0.0 3 0.8686386612496261 3.36709706540951 6323.0 48.20127767896843 0.0 - - - - - - - 242.4 12 5 PDIA2 protein disulfide isomerase family A, member 2 1903 241 C20140711_OR018_04 C20140711_OR018_04 TB422386.[MT7]-YFPAGPGRK[MT7].3y5_1.heavy 427.583 / 658.412 1126.0 25.445600509643555 41 11 10 10 10 1.3479150646794442 64.24759894914902 0.0 3 0.8686386612496261 3.36709706540951 1126.0 11.83655172413793 1.0 - - - - - - - 173.33333333333334 2 6 PDIA2 protein disulfide isomerase family A, member 2 1905 242 C20140711_OR018_04 C20140711_OR018_04 TB432150.[MT7]-NDLVVSLPEEVTAR.2y9_1.heavy 843.463 / 1001.53 5675.0 38.38639831542969 47 17 10 10 10 4.566137423297664 17.482083015371416 0.0 3 0.9784616939587608 8.39409740131399 5675.0 9.060539539432563 1.0 - - - - - - - 259.0 15 10 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1907 242 C20140711_OR018_04 C20140711_OR018_04 TB432150.[MT7]-NDLVVSLPEEVTAR.2b4_1.heavy 843.463 / 586.332 10857.0 38.38639831542969 47 17 10 10 10 4.566137423297664 17.482083015371416 0.0 3 0.9784616939587608 8.39409740131399 10857.0 40.493675675675675 0.0 - - - - - - - 246.5 21 4 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1909 242 C20140711_OR018_04 C20140711_OR018_04 TB432150.[MT7]-NDLVVSLPEEVTAR.2y10_1.heavy 843.463 / 1100.59 8636.0 38.38639831542969 47 17 10 10 10 4.566137423297664 17.482083015371416 0.0 3 0.9784616939587608 8.39409740131399 8636.0 72.22284333113602 0.0 - - - - - - - 231.25 17 8 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1911 242 C20140711_OR018_04 C20140711_OR018_04 TB432150.[MT7]-NDLVVSLPEEVTAR.2y7_1.heavy 843.463 / 801.41 7526.0 38.38639831542969 47 17 10 10 10 4.566137423297664 17.482083015371416 0.0 3 0.9784616939587608 8.39409740131399 7526.0 87.3809696850005 0.0 - - - - - - - 176.14285714285714 15 7 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1913 243 C20140711_OR018_04 C20140711_OR018_04 TB432294.[MT7]-DQDWNDFLQQVC[CAM]SQIDSTEK[MT7].3b6_1.heavy 915.429 / 918.371 4154.0 48.13202476501465 41 15 10 6 10 1.5015597160318788 44.81250974527215 0.03890228271484375 3 0.9530885880562566 5.675583840139449 4154.0 76.00936170212765 0.0 - - - - - - - 242.57142857142858 8 7 ULK4 unc-51-like kinase 4 (C. elegans) 1915 243 C20140711_OR018_04 C20140711_OR018_04 TB432294.[MT7]-DQDWNDFLQQVC[CAM]SQIDSTEK[MT7].3b3_1.heavy 915.429 / 503.222 4248.0 48.13202476501465 41 15 10 6 10 1.5015597160318788 44.81250974527215 0.03890228271484375 3 0.9530885880562566 5.675583840139449 4248.0 14.78668907563025 0.0 - - - - - - - 310.14285714285717 8 7 ULK4 unc-51-like kinase 4 (C. elegans) 1917 243 C20140711_OR018_04 C20140711_OR018_04 TB432294.[MT7]-DQDWNDFLQQVC[CAM]SQIDSTEK[MT7].3y5_1.heavy 915.429 / 723.364 2832.0 48.13202476501465 41 15 10 6 10 1.5015597160318788 44.81250974527215 0.03890228271484375 3 0.9530885880562566 5.675583840139449 2832.0 13.006643109540635 0.0 - - - - - - - 199.11111111111111 5 9 ULK4 unc-51-like kinase 4 (C. elegans) 1919 243 C20140711_OR018_04 C20140711_OR018_04 TB432294.[MT7]-DQDWNDFLQQVC[CAM]SQIDSTEK[MT7].3b7_1.heavy 915.429 / 1065.44 4248.0 48.13202476501465 41 15 10 6 10 1.5015597160318788 44.81250974527215 0.03890228271484375 3 0.9530885880562566 5.675583840139449 4248.0 20.55260979303382 0.0 - - - - - - - 228.08333333333334 8 12 ULK4 unc-51-like kinase 4 (C. elegans) 1921 244 C20140711_OR018_04 C20140711_OR018_04 TB422186.[MT7]-EQTDAGR.2y5_1.heavy 460.731 / 519.252 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1923 244 C20140711_OR018_04 C20140711_OR018_04 TB422186.[MT7]-EQTDAGR.2b4_1.heavy 460.731 / 618.285 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1925 244 C20140711_OR018_04 C20140711_OR018_04 TB422186.[MT7]-EQTDAGR.2y6_1.heavy 460.731 / 647.311 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1927 244 C20140711_OR018_04 C20140711_OR018_04 TB422186.[MT7]-EQTDAGR.2b5_1.heavy 460.731 / 689.322 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 1929 245 C20140711_OR018_04 C20140711_OR018_04 TB431892.[MT7]-GVLEQLR.2y5_1.heavy 479.794 / 658.388 2710.0 30.944000244140625 48 18 10 10 10 3.092179718222772 26.62914464584869 0.0 3 0.9805862100025761 8.843050056135656 2710.0 15.969642857142855 0.0 - - - - - - - 172.23076923076923 5 13 XDH xanthine dehydrogenase 1931 245 C20140711_OR018_04 C20140711_OR018_04 TB431892.[MT7]-GVLEQLR.2b4_1.heavy 479.794 / 543.326 1962.0 30.944000244140625 48 18 10 10 10 3.092179718222772 26.62914464584869 0.0 3 0.9805862100025761 8.843050056135656 1962.0 10.462488655462185 0.0 - - - - - - - 317.6 3 5 XDH xanthine dehydrogenase 1933 245 C20140711_OR018_04 C20140711_OR018_04 TB431892.[MT7]-GVLEQLR.2y6_1.heavy 479.794 / 757.457 1308.0 30.944000244140625 48 18 10 10 10 3.092179718222772 26.62914464584869 0.0 3 0.9805862100025761 8.843050056135656 1308.0 12.130833189580818 0.0 - - - - - - - 198.375 2 8 XDH xanthine dehydrogenase 1935 245 C20140711_OR018_04 C20140711_OR018_04 TB431892.[MT7]-GVLEQLR.2b5_1.heavy 479.794 / 671.385 1962.0 30.944000244140625 48 18 10 10 10 3.092179718222772 26.62914464584869 0.0 3 0.9805862100025761 8.843050056135656 1962.0 6.285159169101436 2.0 - - - - - - - 197.11111111111111 3 9 XDH xanthine dehydrogenase 1937 246 C20140711_OR018_04 C20140711_OR018_04 TB422280.[MT7]-DTVVLFK[MT7].2y4_1.heavy 555.344 / 650.436 12765.0 34.78657627105713 46 20 10 6 10 8.740482593520534 11.441015862686081 0.039699554443359375 3 0.9940813989761786 16.03387166469766 12765.0 34.49128787878788 0.0 - - - - - - - 252.0 25 11 PDIA2 protein disulfide isomerase family A, member 2 1939 246 C20140711_OR018_04 C20140711_OR018_04 TB422280.[MT7]-DTVVLFK[MT7].2b4_1.heavy 555.344 / 559.321 10884.0 34.78657627105713 46 20 10 6 10 8.740482593520534 11.441015862686081 0.039699554443359375 3 0.9940813989761786 16.03387166469766 10884.0 4.807656686441423 1.0 - - - - - - - 247.5 21 6 PDIA2 protein disulfide isomerase family A, member 2 1941 246 C20140711_OR018_04 C20140711_OR018_04 TB422280.[MT7]-DTVVLFK[MT7].2y3_1.heavy 555.344 / 551.367 16327.0 34.78657627105713 46 20 10 6 10 8.740482593520534 11.441015862686081 0.039699554443359375 3 0.9940813989761786 16.03387166469766 16327.0 15.112537624173566 0.0 - - - - - - - 791.6666666666666 32 9 PDIA2 protein disulfide isomerase family A, member 2 1943 246 C20140711_OR018_04 C20140711_OR018_04 TB422280.[MT7]-DTVVLFK[MT7].2y6_1.heavy 555.344 / 850.552 3364.0 34.78657627105713 46 20 10 6 10 8.740482593520534 11.441015862686081 0.039699554443359375 3 0.9940813989761786 16.03387166469766 3364.0 44.47955555555556 0.0 - - - - - - - 277.2 6 10 PDIA2 protein disulfide isomerase family A, member 2 1945 247 C20140711_OR018_04 C20140711_OR018_04 TB422187.[MT7]-TISALK[MT7].2y4_1.heavy 460.805 / 562.368 4057.0 26.27853266398112 38 18 10 2 8 4.341173417307629 23.03524655368857 0.08259963989257812 4 0.9898581688021374 12.244370190252706 4057.0 5.732336173335846 0.0 - - - - - - - 212.0 8 4 XDH xanthine dehydrogenase 1947 247 C20140711_OR018_04 C20140711_OR018_04 TB422187.[MT7]-TISALK[MT7].2y5_1.heavy 460.805 / 675.452 N/A 26.27853266398112 38 18 10 2 8 4.341173417307629 23.03524655368857 0.08259963989257812 4 0.9898581688021374 12.244370190252706 3302.0 42.1531914893617 0.0 - - - - - - - 172.83333333333334 6 6 XDH xanthine dehydrogenase 1949 247 C20140711_OR018_04 C20140711_OR018_04 TB422187.[MT7]-TISALK[MT7].2b4_1.heavy 460.805 / 517.31 1132.0 26.27853266398112 38 18 10 2 8 4.341173417307629 23.03524655368857 0.08259963989257812 4 0.9898581688021374 12.244370190252706 1132.0 0.5828608115048792 3.0 - - - - - - - 297.61538461538464 4 13 XDH xanthine dehydrogenase 1951 247 C20140711_OR018_04 C20140711_OR018_04 TB422187.[MT7]-TISALK[MT7].2y3_1.heavy 460.805 / 475.336 1793.0 26.27853266398112 38 18 10 2 8 4.341173417307629 23.03524655368857 0.08259963989257812 4 0.9898581688021374 12.244370190252706 1793.0 13.197937490351283 0.0 - - - - - - - 254.07692307692307 3 13 XDH xanthine dehydrogenase 1953 248 C20140711_OR018_04 C20140711_OR018_04 TB444022.[MT7]-LVEDFVDVIGFR.2y8_1.heavy 776.928 / 952.525 2994.0 51.584999084472656 33 3 10 10 10 0.3717146529058283 123.94136200189979 0.0 3 0.5473722791372775 1.760158247610417 2994.0 54.23094339622641 0.0 - - - - - - - 93.86666666666666 5 15 BAI1 brain-specific angiogenesis inhibitor 1 1955 248 C20140711_OR018_04 C20140711_OR018_04 TB444022.[MT7]-LVEDFVDVIGFR.2y5_1.heavy 776.928 / 591.361 2290.0 51.584999084472656 33 3 10 10 10 0.3717146529058283 123.94136200189979 0.0 3 0.5473722791372775 1.760158247610417 2290.0 26.520296582849774 0.0 - - - - - - - 156.8181818181818 4 11 BAI1 brain-specific angiogenesis inhibitor 1 1957 248 C20140711_OR018_04 C20140711_OR018_04 TB444022.[MT7]-LVEDFVDVIGFR.2y6_1.heavy 776.928 / 706.388 1268.0 51.584999084472656 33 3 10 10 10 0.3717146529058283 123.94136200189979 0.0 3 0.5473722791372775 1.760158247610417 1268.0 39.98814016172507 0.0 - - - - - - - 92.0 2 13 BAI1 brain-specific angiogenesis inhibitor 1 1959 248 C20140711_OR018_04 C20140711_OR018_04 TB444022.[MT7]-LVEDFVDVIGFR.2y10_1.heavy 776.928 / 1196.59 916.0 51.584999084472656 33 3 10 10 10 0.3717146529058283 123.94136200189979 0.0 3 0.5473722791372775 1.760158247610417 916.0 6.088015047195044 1.0 - - - - - - - 99.0 2 11 BAI1 brain-specific angiogenesis inhibitor 1 1961 249 C20140711_OR018_04 C20140711_OR018_04 TB422285.[MT7]-GITQGDLK[MT7].2y4_1.heavy 560.334 / 576.347 4963.0 24.612775325775146 42 16 10 6 10 3.319531947419956 30.124728902736763 0.03849983215332031 3 0.9639980850239729 6.484670741960706 4963.0 27.43894259818731 0.0 - - - - - - - 206.9 9 10 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1963 249 C20140711_OR018_04 C20140711_OR018_04 TB422285.[MT7]-GITQGDLK[MT7].2b4_1.heavy 560.334 / 544.321 1737.0 24.612775325775146 42 16 10 6 10 3.319531947419956 30.124728902736763 0.03849983215332031 3 0.9639980850239729 6.484670741960706 1737.0 12.731420454545454 1.0 - - - - - - - 217.0 3 8 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1965 249 C20140711_OR018_04 C20140711_OR018_04 TB422285.[MT7]-GITQGDLK[MT7].2b6_1.heavy 560.334 / 716.37 12158.0 24.612775325775146 42 16 10 6 10 3.319531947419956 30.124728902736763 0.03849983215332031 3 0.9639980850239729 6.484670741960706 12158.0 201.8343410003651 0.0 - - - - - - - 186.125 24 8 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1967 249 C20140711_OR018_04 C20140711_OR018_04 TB422285.[MT7]-GITQGDLK[MT7].2y6_1.heavy 560.334 / 805.454 5376.0 24.612775325775146 42 16 10 6 10 3.319531947419956 30.124728902736763 0.03849983215332031 3 0.9639980850239729 6.484670741960706 5376.0 45.078077451249655 0.0 - - - - - - - 237.75 10 8 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 1969 250 C20140711_OR018_04 C20140711_OR018_04 TB444023.[MT7]-EAC[CAM]TWGSLALGVR.2b3_1.heavy 782.407 / 505.22 5620.0 39.256500244140625 44 14 10 10 10 3.5469530892705357 22.521283433827556 0.0 3 0.94480710905302 5.228808974909789 5620.0 21.37597403630463 0.0 - - - - - - - 328.875 11 8 TEX13B;TEX13A testis expressed 13B;testis expressed 13A 1971 250 C20140711_OR018_04 C20140711_OR018_04 TB444023.[MT7]-EAC[CAM]TWGSLALGVR.2y8_1.heavy 782.407 / 772.468 2630.0 39.256500244140625 44 14 10 10 10 3.5469530892705357 22.521283433827556 0.0 3 0.94480710905302 5.228808974909789 2630.0 1.4489028213166144 1.0 - - - - - - - 120.0 5 6 TEX13B;TEX13A testis expressed 13B;testis expressed 13A 1973 250 C20140711_OR018_04 C20140711_OR018_04 TB444023.[MT7]-EAC[CAM]TWGSLALGVR.2y9_1.heavy 782.407 / 958.547 4663.0 39.256500244140625 44 14 10 10 10 3.5469530892705357 22.521283433827556 0.0 3 0.94480710905302 5.228808974909789 4663.0 45.59919735006973 0.0 - - - - - - - 209.5 9 4 TEX13B;TEX13A testis expressed 13B;testis expressed 13A 1975 250 C20140711_OR018_04 C20140711_OR018_04 TB444023.[MT7]-EAC[CAM]TWGSLALGVR.2y10_1.heavy 782.407 / 1059.59 7413.0 39.256500244140625 44 14 10 10 10 3.5469530892705357 22.521283433827556 0.0 3 0.94480710905302 5.228808974909789 7413.0 23.57271966527197 0.0 - - - - - - - 314.0 14 8 TEX13B;TEX13A testis expressed 13B;testis expressed 13A 1977 251 C20140711_OR018_04 C20140711_OR018_04 TB422885.[MT7]-SIELDGTFVGAEAPGELGGLGPGPAEAR.3y11_1.heavy 937.814 / 981.511 16391.0 42.05782508850098 41 15 10 6 10 1.7904918723381595 38.370575600504324 0.03910064697265625 3 0.9516229796792376 5.588255454299884 16391.0 0.0 0.0 - - - - - - - 305.75 32 4 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1979 251 C20140711_OR018_04 C20140711_OR018_04 TB422885.[MT7]-SIELDGTFVGAEAPGELGGLGPGPAEAR.3b5_1.heavy 937.814 / 702.379 11376.0 42.05782508850098 41 15 10 6 10 1.7904918723381595 38.370575600504324 0.03910064697265625 3 0.9516229796792376 5.588255454299884 11376.0 -3.099727520435966 0.0 - - - - - - - 258.1111111111111 22 9 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1981 251 C20140711_OR018_04 C20140711_OR018_04 TB422885.[MT7]-SIELDGTFVGAEAPGELGGLGPGPAEAR.3y8_1.heavy 937.814 / 754.384 19449.0 42.05782508850098 41 15 10 6 10 1.7904918723381595 38.370575600504324 0.03910064697265625 3 0.9516229796792376 5.588255454299884 19449.0 -1.5898365122615843 0.0 - - - - - - - 203.66666666666666 38 6 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1983 251 C20140711_OR018_04 C20140711_OR018_04 TB422885.[MT7]-SIELDGTFVGAEAPGELGGLGPGPAEAR.3b7_1.heavy 937.814 / 860.448 7829.0 42.05782508850098 41 15 10 6 10 1.7904918723381595 38.370575600504324 0.03910064697265625 3 0.9516229796792376 5.588255454299884 7829.0 -0.9586530612244921 0.0 - - - - - - - 245.0 15 4 SLC8A2 solute carrier family 8 (sodium/calcium exchanger), member 2 1985 252 C20140711_OR018_04 C20140711_OR018_04 TB432155.[MT7]-LGILFC[CAM]DISPRK[MT7].3y7_1.heavy 569.667 / 1019.54 3027.0 40.459800720214844 37 7 10 10 10 0.685712681948696 73.74808344170594 0.0 3 0.7231468815334188 2.289110422461896 3027.0 13.757154645242176 0.0 - - - - - - - 282.3333333333333 6 3 ULK4 unc-51-like kinase 4 (C. elegans) 1987 252 C20140711_OR018_04 C20140711_OR018_04 TB432155.[MT7]-LGILFC[CAM]DISPRK[MT7].3y6_1.heavy 569.667 / 859.512 969.0 40.459800720214844 37 7 10 10 10 0.685712681948696 73.74808344170594 0.0 3 0.7231468815334188 2.289110422461896 969.0 4.137511446821338 1.0 - - - - - - - 242.0 2 7 ULK4 unc-51-like kinase 4 (C. elegans) 1989 252 C20140711_OR018_04 C20140711_OR018_04 TB432155.[MT7]-LGILFC[CAM]DISPRK[MT7].3b4_1.heavy 569.667 / 541.383 10292.0 40.459800720214844 37 7 10 10 10 0.685712681948696 73.74808344170594 0.0 3 0.7231468815334188 2.289110422461896 10292.0 44.04566517955094 0.0 - - - - - - - 242.0 20 7 ULK4 unc-51-like kinase 4 (C. elegans) 1991 252 C20140711_OR018_04 C20140711_OR018_04 TB432155.[MT7]-LGILFC[CAM]DISPRK[MT7].3y5_1.heavy 569.667 / 744.485 3269.0 40.459800720214844 37 7 10 10 10 0.685712681948696 73.74808344170594 0.0 3 0.7231468815334188 2.289110422461896 3269.0 5.94319017818755 0.0 - - - - - - - 221.83333333333334 6 6 ULK4 unc-51-like kinase 4 (C. elegans) 1993 253 C20140711_OR018_04 C20140711_OR018_04 TB444021.[MT7]-NLTYIDPDALK[MT7].2y5_1.heavy 775.937 / 687.416 5806.0 36.37662410736084 36 13 10 5 8 2.253308887553188 44.37917968210187 0.044300079345703125 4 0.9280385220456999 4.572702031403314 5806.0 32.872324214018356 0.0 - - - - - - - 247.25 11 8 TSHR thyroid stimulating hormone receptor 1995 253 C20140711_OR018_04 C20140711_OR018_04 TB444021.[MT7]-NLTYIDPDALK[MT7].2y9_1.heavy 775.937 / 1179.64 247.0 36.37662410736084 36 13 10 5 8 2.253308887553188 44.37917968210187 0.044300079345703125 4 0.9280385220456999 4.572702031403314 247.0 2.3913964003130164 20.0 - - - - - - - 0.0 1 0 TSHR thyroid stimulating hormone receptor 1997 253 C20140711_OR018_04 C20140711_OR018_04 TB444021.[MT7]-NLTYIDPDALK[MT7].2b6_1.heavy 775.937 / 864.458 3829.0 36.37662410736084 36 13 10 5 8 2.253308887553188 44.37917968210187 0.044300079345703125 4 0.9280385220456999 4.572702031403314 3829.0 19.141989898195828 1.0 - - - - - - - 206.0 11 6 TSHR thyroid stimulating hormone receptor 1999 253 C20140711_OR018_04 C20140711_OR018_04 TB444021.[MT7]-NLTYIDPDALK[MT7].2y6_1.heavy 775.937 / 802.443 1482.0 36.37662410736084 36 13 10 5 8 2.253308887553188 44.37917968210187 0.044300079345703125 4 0.9280385220456999 4.572702031403314 1482.0 11.935723475666602 0.0 - - - - - - - 165.16666666666666 2 6 TSHR thyroid stimulating hormone receptor 2001 254 C20140711_OR018_04 C20140711_OR018_04 TB432154.[MT7]-AILEDSEVPSEVK[MT7].3b5_1.heavy 568.648 / 686.384 34021.0 32.21419906616211 46 16 10 10 10 4.6537961725703445 21.487834080358716 0.0 3 0.9631664565605599 6.410596981578882 34021.0 80.70871673140556 0.0 - - - - - - - 247.53846153846155 68 13 TEX13B;TEX13A testis expressed 13B;testis expressed 13A 2003 254 C20140711_OR018_04 C20140711_OR018_04 TB432154.[MT7]-AILEDSEVPSEVK[MT7].3y4_1.heavy 568.648 / 606.358 48386.0 32.21419906616211 46 16 10 10 10 4.6537961725703445 21.487834080358716 0.0 3 0.9631664565605599 6.410596981578882 48386.0 69.51582090698871 0.0 - - - - - - - 264.9 96 10 TEX13B;TEX13A testis expressed 13B;testis expressed 13A 2005 254 C20140711_OR018_04 C20140711_OR018_04 TB432154.[MT7]-AILEDSEVPSEVK[MT7].3b7_1.heavy 568.648 / 902.459 39030.0 32.21419906616211 46 16 10 10 10 4.6537961725703445 21.487834080358716 0.0 3 0.9631664565605599 6.410596981578882 39030.0 238.21881868131868 0.0 - - - - - - - 685.5 78 8 TEX13B;TEX13A testis expressed 13B;testis expressed 13A 2007 254 C20140711_OR018_04 C20140711_OR018_04 TB432154.[MT7]-AILEDSEVPSEVK[MT7].3y5_1.heavy 568.648 / 703.411 98757.0 32.21419906616211 46 16 10 10 10 4.6537961725703445 21.487834080358716 0.0 3 0.9631664565605599 6.410596981578882 98757.0 316.44174468941907 0.0 - - - - - - - 779.875 197 8 TEX13B;TEX13A testis expressed 13B;testis expressed 13A 2009 255 C20140711_OR018_04 C20140711_OR018_04 TB432293.[MT7]-DQGSPLAAADVLK[MT7]PQDSPLGLAK[MT7].4b8_1.heavy 681.638 / 884.459 3707.0 38.82794952392578 44 20 10 6 8 6.745614212429752 14.824446944465901 0.03949737548828125 4 0.993647570229847 15.476126226463828 3707.0 15.430489763518523 0.0 - - - - - - - 269.8181818181818 7 11 IRX1 iroquois homeobox 1 2011 255 C20140711_OR018_04 C20140711_OR018_04 TB432293.[MT7]-DQGSPLAAADVLK[MT7]PQDSPLGLAK[MT7].4b7_1.heavy 681.638 / 813.422 9143.0 38.82794952392578 44 20 10 6 8 6.745614212429752 14.824446944465901 0.03949737548828125 4 0.993647570229847 15.476126226463828 9143.0 36.49796761133603 0.0 - - - - - - - 346.0 18 5 IRX1 iroquois homeobox 1 2013 255 C20140711_OR018_04 C20140711_OR018_04 TB432293.[MT7]-DQGSPLAAADVLK[MT7]PQDSPLGLAK[MT7].4b10_1.heavy 681.638 / 1070.52 3212.0 38.82794952392578 44 20 10 6 8 6.745614212429752 14.824446944465901 0.03949737548828125 4 0.993647570229847 15.476126226463828 3212.0 0.8665467625899279 0.0 - - - - - - - 201.0 6 8 IRX1 iroquois homeobox 1 2015 255 C20140711_OR018_04 C20140711_OR018_04 TB432293.[MT7]-DQGSPLAAADVLK[MT7]PQDSPLGLAK[MT7].4b3_1.heavy 681.638 / 445.216 4201.0 38.82794952392578 44 20 10 6 8 6.745614212429752 14.824446944465901 0.03949737548828125 4 0.993647570229847 15.476126226463828 4201.0 4.157315329240247 3.0 - - - - - - - 265.0 18 7 IRX1 iroquois homeobox 1 2017 256 C20140711_OR018_04 C20140711_OR018_04 TB432152.[MT7]-GFGPLLQFAYTAK[MT7].3b6_1.heavy 567.659 / 729.442 6617.0 46.39310073852539 50 20 10 10 10 13.922459361288496 7.18263902985781 0.0 3 0.9980178343526169 27.715367021425052 6617.0 15.350259491576175 0.0 - - - - - - - 329.1666666666667 13 6 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 2019 256 C20140711_OR018_04 C20140711_OR018_04 TB432152.[MT7]-GFGPLLQFAYTAK[MT7].3b5_1.heavy 567.659 / 616.357 30616.0 46.39310073852539 50 20 10 10 10 13.922459361288496 7.18263902985781 0.0 3 0.9980178343526169 27.715367021425052 30616.0 45.06249493487699 0.0 - - - - - - - 276.6 61 5 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 2021 256 C20140711_OR018_04 C20140711_OR018_04 TB432152.[MT7]-GFGPLLQFAYTAK[MT7].3y4_1.heavy 567.659 / 626.363 12444.0 46.39310073852539 50 20 10 10 10 13.922459361288496 7.18263902985781 0.0 3 0.9980178343526169 27.715367021425052 12444.0 2.1753041410488265 1.0 - - - - - - - 185.375 24 8 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 2023 256 C20140711_OR018_04 C20140711_OR018_04 TB432152.[MT7]-GFGPLLQFAYTAK[MT7].3b7_1.heavy 567.659 / 857.5 7308.0 46.39310073852539 50 20 10 10 10 13.922459361288496 7.18263902985781 0.0 3 0.9980178343526169 27.715367021425052 7308.0 25.217701212331477 1.0 - - - - - - - 214.0 14 6 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 2025 257 C20140711_OR018_04 C20140711_OR018_04 TB432291.[MT7]-LQGVPMPPGDLC[CAM]GPTLLLDVSIK[MT7].3y7_1.heavy 903.504 / 931.594 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 2027 257 C20140711_OR018_04 C20140711_OR018_04 TB432291.[MT7]-LQGVPMPPGDLC[CAM]GPTLLLDVSIK[MT7].3b6_1.heavy 903.504 / 770.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 2029 257 C20140711_OR018_04 C20140711_OR018_04 TB432291.[MT7]-LQGVPMPPGDLC[CAM]GPTLLLDVSIK[MT7].3b4_1.heavy 903.504 / 542.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor 2031 257 C20140711_OR018_04 C20140711_OR018_04 TB432291.[MT7]-LQGVPMPPGDLC[CAM]GPTLLLDVSIK[MT7].3y4_1.heavy 903.504 / 590.399 N/A N/A - - - - - - - - - 0.0 - - - - - - - AHRR aryl-hydrocarbon receptor repressor