Index Sample Index Original Filename Sample Name Sample ID Sample Comment Sample Type Acquisition Date & Time Rack Number Plate Number Vial Number Dilution Factor Injection Volume Operator Name Acq. Method Name IS Component Name Component Index Component Comment IS Comment Mass Info IS Mass Info IS Name Component Group Name Conc. Units Failed Query IS Failed Query Peak Comment IS Peak Comment Actual Concentration IS Actual Concentration Concentration Ratio Expected RT IS Expected RT Integration Type IS Integration Type Area IS Area Corrected Area IS Corrected Area Area Ratio Height IS Height Corrected Height IS Corrected Height Height Ratio Area / Height IS Area / Height Corrected Area/Height IS Corrected Area/Height Region Height IS Region Height Quality IS Quality Retention Time IS Retention Time Start Time IS Start Time End Time IS End Time Total Width IS Total Width Width at 50% IS Width at 50% Signal / Noise IS Signal / Noise Baseline Delta / Height IS Baseline Delta / Height Modified Relative RT Used Calculated Concentration Accuracy SF Peak Width Confidence SF Model Source SF Candidate Model Quality SF Asymmetry SF Saturated SF Integration Quality SF Group Confidence SF Num Peaks Score_IMPAQT MSSimScore_IMPAQT HeightScore_IMPAQT RTminScore_IMPAQT RankScore_IMPAQT MSSim_IMPAQT MSSimSita_IMPAQT RTminDiff_IMPAQT RankSum_IMPAQT CosSimilarity_IMPAQT CosSimilaritySita_IMPAQT Height_IMPAQT InterfereTrans_IMPAQT InterfereTransAll_IMPAQT LScore_IMPAQT LRTminScore_IMPAQT LSNScore_IMPAQT LSNAllScore_IMPAQT HLSimScore_IMPAQT HLSim_IMPAQT HLSimSita_IMPAQT BaseLine_IMPAQT BaseLineUnitNum_IMPAQT BaseLineMaxCount_IMPAQT Symbol Description 1 1 C20140716_OR021_01 C20140716_OR021_01 TB420053.[MT7]-EPPLGGLVDSR.2y8_1.heavy 642.357 / 816.457 606.0 34.69449996948242 33 12 10 3 8 2.085305365291895 47.95460735123668 0.050201416015625 4 0.897304728370788 3.8176706130856273 606.0 1.3 9.0 - - - - - - - 216.42857142857142 3 14 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 3 1 C20140716_OR021_01 C20140716_OR021_01 TB420053.[MT7]-EPPLGGLVDSR.2y9_1.heavy 642.357 / 913.51 2121.0 34.69449996948242 33 12 10 3 8 2.085305365291895 47.95460735123668 0.050201416015625 4 0.897304728370788 3.8176706130856273 2121.0 9.903 0.0 - - - - - - - 272.7 4 10 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 5 1 C20140716_OR021_01 C20140716_OR021_01 TB420053.[MT7]-EPPLGGLVDSR.2y10_1.heavy 642.357 / 1010.56 11513.0 34.69449996948242 33 12 10 3 8 2.085305365291895 47.95460735123668 0.050201416015625 4 0.897304728370788 3.8176706130856273 11513.0 27.45674558760224 0.0 - - - - - - - 363.6 23 5 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 7 1 C20140716_OR021_01 C20140716_OR021_01 TB420053.[MT7]-EPPLGGLVDSR.2y7_1.heavy 642.357 / 703.373 1212.0 34.69449996948242 33 12 10 3 8 2.085305365291895 47.95460735123668 0.050201416015625 4 0.897304728370788 3.8176706130856273 1212.0 0.9890109890109889 4.0 - - - - - - - 224.44444444444446 2 9 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 9 2 C20140716_OR021_01 C20140716_OR021_01 TB420051.[MT7]-EYIDPETK[MT7].2b3_1.heavy 641.842 / 550.299 22141.0 26.163000106811523 48 18 10 10 10 6.380002488198262 15.673975078376559 0.0 3 0.9823395745828853 9.273006359457305 22141.0 73.35549757281552 0.0 - - - - - - - 721.0 44 7 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 11 2 C20140716_OR021_01 C20140716_OR021_01 TB420051.[MT7]-EYIDPETK[MT7].2y4_1.heavy 641.842 / 618.358 139950.0 26.163000106811523 48 18 10 10 10 6.380002488198262 15.673975078376559 0.0 3 0.9823395745828853 9.273006359457305 139950.0 463.3296116504854 0.0 - - - - - - - 240.33333333333334 279 6 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 13 2 C20140716_OR021_01 C20140716_OR021_01 TB420051.[MT7]-EYIDPETK[MT7].2y5_1.heavy 641.842 / 733.385 16889.0 26.163000106811523 48 18 10 10 10 6.380002488198262 15.673975078376559 0.0 3 0.9823395745828853 9.273006359457305 16889.0 86.08470873786408 0.0 - - - - - - - 180.25 33 4 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 15 2 C20140716_OR021_01 C20140716_OR021_01 TB420051.[MT7]-EYIDPETK[MT7].2b4_1.heavy 641.842 / 665.326 102568.0 26.163000106811523 48 18 10 10 10 6.380002488198262 15.673975078376559 0.0 3 0.9823395745828853 9.273006359457305 102568.0 736.647359223301 0.0 - - - - - - - 206.0 205 9 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 17 3 C20140716_OR021_01 C20140716_OR021_01 TB442368.[MT7]-TAFTAQQLEALEK[MT7].3b4_1.heavy 579.992 / 565.31 28701.0 37.21364974975586 43 18 10 5 10 6.854581741121706 14.58878218638555 0.04290008544921875 3 0.9840510384900357 9.759268293169589 28701.0 60.08745119581965 0.0 - - - - - - - 227.4 57 5 DMBX1 diencephalon/mesencephalon homeobox 1 19 3 C20140716_OR021_01 C20140716_OR021_01 TB442368.[MT7]-TAFTAQQLEALEK[MT7].3b5_1.heavy 579.992 / 636.347 25034.0 37.21364974975586 43 18 10 5 10 6.854581741121706 14.58878218638555 0.04290008544921875 3 0.9840510384900357 9.759268293169589 25034.0 30.21803245408836 1.0 - - - - - - - 252.66666666666666 53 9 DMBX1 diencephalon/mesencephalon homeobox 1 21 3 C20140716_OR021_01 C20140716_OR021_01 TB442368.[MT7]-TAFTAQQLEALEK[MT7].3y4_1.heavy 579.992 / 604.379 41724.0 37.21364974975586 43 18 10 5 10 6.854581741121706 14.58878218638555 0.04290008544921875 3 0.9840510384900357 9.759268293169589 41724.0 67.44094814909568 0.0 - - - - - - - 231.66666666666666 83 6 DMBX1 diencephalon/mesencephalon homeobox 1 23 3 C20140716_OR021_01 C20140716_OR021_01 TB442368.[MT7]-TAFTAQQLEALEK[MT7].3y5_1.heavy 579.992 / 733.421 27563.0 37.21364974975586 43 18 10 5 10 6.854581741121706 14.58878218638555 0.04290008544921875 3 0.9840510384900357 9.759268293169589 27563.0 202.63707509881422 0.0 - - - - - - - 252.66666666666666 55 6 DMBX1 diencephalon/mesencephalon homeobox 1 25 4 C20140716_OR021_01 C20140716_OR021_01 TB436039.[MT7]-WMEWNPGFPLSIDAK[MT7].2b3_1.heavy 1040.03 / 591.272 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 27 4 C20140716_OR021_01 C20140716_OR021_01 TB436039.[MT7]-WMEWNPGFPLSIDAK[MT7].2y10_1.heavy 1040.03 / 1188.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 29 4 C20140716_OR021_01 C20140716_OR021_01 TB436039.[MT7]-WMEWNPGFPLSIDAK[MT7].2b5_1.heavy 1040.03 / 891.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 31 4 C20140716_OR021_01 C20140716_OR021_01 TB436039.[MT7]-WMEWNPGFPLSIDAK[MT7].2y7_1.heavy 1040.03 / 887.532 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 33 5 C20140716_OR021_01 C20140716_OR021_01 TB419951.[MT7]-RGAC[CAM]PDAR.2b7_1.heavy 523.768 / 872.417 321.0 13.392324924468994 44 20 10 6 8 10.264259821068016 9.742543714135522 0.03890037536621094 4 0.9946724965443811 16.900809335665304 321.0 0.0 1.0 - - - - - - - 0.0 0 0 ASB10 ankyrin repeat and SOCS box-containing 10 35 5 C20140716_OR021_01 C20140716_OR021_01 TB419951.[MT7]-RGAC[CAM]PDAR.2y5_1.heavy 523.768 / 618.266 98.0 13.392324924468994 44 20 10 6 8 10.264259821068016 9.742543714135522 0.03890037536621094 4 0.9946724965443811 16.900809335665304 98.0 1.6877777777777778 4.0 - - - - - - - 0.0 0 0 ASB10 ankyrin repeat and SOCS box-containing 10 37 5 C20140716_OR021_01 C20140716_OR021_01 TB419951.[MT7]-RGAC[CAM]PDAR.2b6_1.heavy 523.768 / 801.379 6946.0 13.392324924468994 44 20 10 6 8 10.264259821068016 9.742543714135522 0.03890037536621094 4 0.9946724965443811 16.900809335665304 6946.0 347.29999999999995 0.0 - - - - - - - 34.888888888888886 13 18 ASB10 ankyrin repeat and SOCS box-containing 10 39 5 C20140716_OR021_01 C20140716_OR021_01 TB419951.[MT7]-RGAC[CAM]PDAR.2y7_1.heavy 523.768 / 746.325 1080.0 13.392324924468994 44 20 10 6 8 10.264259821068016 9.742543714135522 0.03890037536621094 4 0.9946724965443811 16.900809335665304 1080.0 90.0 0.0 - - - - - - - 51.611111111111114 2 18 ASB10 ankyrin repeat and SOCS box-containing 10 41 6 C20140716_OR021_01 C20140716_OR021_01 TB419953.[MT7]-ISNTISER.2y5_1.heavy 532.297 / 605.325 2582.0 23.65559959411621 50 20 10 10 10 12.754500368800205 7.840369838760438 0.0 3 0.9994197608420866 51.23159191501953 2582.0 14.988001144850896 0.0 - - - - - - - 213.8 5 10 ALOX5 arachidonate 5-lipoxygenase 43 6 C20140716_OR021_01 C20140716_OR021_01 TB419953.[MT7]-ISNTISER.2b4_1.heavy 532.297 / 560.316 3467.0 23.65559959411621 50 20 10 10 10 12.754500368800205 7.840369838760438 0.0 3 0.9994197608420866 51.23159191501953 3467.0 6.060948081264108 1.0 - - - - - - - 205.64285714285714 6 14 ALOX5 arachidonate 5-lipoxygenase 45 6 C20140716_OR021_01 C20140716_OR021_01 TB419953.[MT7]-ISNTISER.2y6_1.heavy 532.297 / 719.368 3688.0 23.65559959411621 50 20 10 10 10 12.754500368800205 7.840369838760438 0.0 3 0.9994197608420866 51.23159191501953 3688.0 44.85405405405406 0.0 - - - - - - - 175.5 7 8 ALOX5 arachidonate 5-lipoxygenase 47 6 C20140716_OR021_01 C20140716_OR021_01 TB419953.[MT7]-ISNTISER.2y7_1.heavy 532.297 / 806.4 25006.0 23.65559959411621 50 20 10 10 10 12.754500368800205 7.840369838760438 0.0 3 0.9994197608420866 51.23159191501953 25006.0 365.3060685103708 0.0 - - - - - - - 221.57142857142858 50 7 ALOX5 arachidonate 5-lipoxygenase 49 7 C20140716_OR021_01 C20140716_OR021_01 TB420203.[MT7]-SLPGSAPPLTEK[MT7].2y6_1.heavy 742.932 / 828.495 10271.0 29.487175464630127 35 15 10 6 4 2.7717193748911235 36.078688523050104 0.03610038757324219 7 0.9520682743131367 5.614365496244395 10271.0 0.0 1.0 - - - - - - - 249.42857142857142 21 7 MRVI1 murine retrovirus integration site 1 homolog 51 7 C20140716_OR021_01 C20140716_OR021_01 TB420203.[MT7]-SLPGSAPPLTEK[MT7].2y10_1.heavy 742.932 / 1140.64 7806.0 29.487175464630127 35 15 10 6 4 2.7717193748911235 36.078688523050104 0.03610038757324219 7 0.9520682743131367 5.614365496244395 7806.0 5.819790252861362 1.0 - - - - - - - 190.85714285714286 19 7 MRVI1 murine retrovirus integration site 1 homolog 53 7 C20140716_OR021_01 C20140716_OR021_01 TB420203.[MT7]-SLPGSAPPLTEK[MT7].2y5_1.heavy 742.932 / 731.442 2362.0 29.487175464630127 35 15 10 6 4 2.7717193748911235 36.078688523050104 0.03610038757324219 7 0.9520682743131367 5.614365496244395 2362.0 2.9566063977746873 3.0 - - - - - - - 688.1 5 10 MRVI1 murine retrovirus integration site 1 homolog 55 7 C20140716_OR021_01 C20140716_OR021_01 TB420203.[MT7]-SLPGSAPPLTEK[MT7].2y3_1.heavy 742.932 / 521.305 1951.0 29.487175464630127 35 15 10 6 4 2.7717193748911235 36.078688523050104 0.03610038757324219 7 0.9520682743131367 5.614365496244395 1951.0 3.1957967475002875 2.0 - - - - - - - 239.77777777777777 5 9 MRVI1 murine retrovirus integration site 1 homolog 57 8 C20140716_OR021_01 C20140716_OR021_01 TB419955.[MT7]-ELENFK[MT7].2b3_1.heavy 534.302 / 516.279 N/A 28.73479970296224 45 20 9 6 10 8.169687276332407 12.240370606314407 0.03539848327636719 3 0.9951551604798018 17.723405548668595 3736.0 0.0 15.0 - - - - - - - 368.0 13 4 MRVI1 murine retrovirus integration site 1 homolog 59 8 C20140716_OR021_01 C20140716_OR021_01 TB419955.[MT7]-ELENFK[MT7].2y4_1.heavy 534.302 / 681.369 4302.0 28.73479970296224 45 20 9 6 10 8.169687276332407 12.240370606314407 0.03539848327636719 3 0.9951551604798018 17.723405548668595 4302.0 8.736953642384107 0.0 - - - - - - - 243.69230769230768 8 13 MRVI1 murine retrovirus integration site 1 homolog 61 8 C20140716_OR021_01 C20140716_OR021_01 TB419955.[MT7]-ELENFK[MT7].2y5_1.heavy 534.302 / 794.453 6113.0 28.73479970296224 45 20 9 6 10 8.169687276332407 12.240370606314407 0.03539848327636719 3 0.9951551604798018 17.723405548668595 6113.0 54.6297165327246 0.0 - - - - - - - 212.125 12 8 MRVI1 murine retrovirus integration site 1 homolog 63 8 C20140716_OR021_01 C20140716_OR021_01 TB419955.[MT7]-ELENFK[MT7].2y3_1.heavy 534.302 / 552.326 5321.0 28.73479970296224 45 20 9 6 10 8.169687276332407 12.240370606314407 0.03539848327636719 3 0.9951551604798018 17.723405548668595 5321.0 5.4855670103092775 1.0 - - - - - - - 301.8888888888889 10 9 MRVI1 murine retrovirus integration site 1 homolog 65 9 C20140716_OR021_01 C20140716_OR021_01 TB420206.[MT7]-LGHVELADLLLR.3y7_1.heavy 498.304 / 813.519 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 67 9 C20140716_OR021_01 C20140716_OR021_01 TB420206.[MT7]-LGHVELADLLLR.3y6_1.heavy 498.304 / 700.435 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 69 9 C20140716_OR021_01 C20140716_OR021_01 TB420206.[MT7]-LGHVELADLLLR.3y4_1.heavy 498.304 / 514.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 71 9 C20140716_OR021_01 C20140716_OR021_01 TB420206.[MT7]-LGHVELADLLLR.3y5_1.heavy 498.304 / 629.398 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 73 10 C20140716_OR021_01 C20140716_OR021_01 TB435899.[MT7]-GFQEGLK[MT7]K[MT7].3b4_1.heavy 446.942 / 606.3 3779.0 24.128799438476562 35 13 4 10 8 1.3117856216860482 50.82131223620174 0.0 4 0.9094127714587403 4.069064496074457 3779.0 26.393015873015873 0.0 - - - - - - - 220.25 7 12 MRVI1 murine retrovirus integration site 1 homolog 75 10 C20140716_OR021_01 C20140716_OR021_01 TB435899.[MT7]-GFQEGLK[MT7]K[MT7].3b5_1.heavy 446.942 / 663.322 4724.0 24.128799438476562 35 13 4 10 8 1.3117856216860482 50.82131223620174 0.0 4 0.9094127714587403 4.069064496074457 4724.0 33.34983080000748 1.0 - - - - - - - 214.54545454545453 9 11 MRVI1 murine retrovirus integration site 1 homolog 77 10 C20140716_OR021_01 C20140716_OR021_01 TB435899.[MT7]-GFQEGLK[MT7]K[MT7].3y4_1.heavy 446.942 / 733.517 1512.0 24.128799438476562 35 13 4 10 8 1.3117856216860482 50.82131223620174 0.0 4 0.9094127714587403 4.069064496074457 1512.0 7.474204946996466 0.0 - - - - - - - 188.625 3 8 MRVI1 murine retrovirus integration site 1 homolog 79 10 C20140716_OR021_01 C20140716_OR021_01 TB435899.[MT7]-GFQEGLK[MT7]K[MT7].3b3_1.heavy 446.942 / 477.258 3023.0 24.128799438476562 35 13 4 10 8 1.3117856216860482 50.82131223620174 0.0 4 0.9094127714587403 4.069064496074457 3023.0 1.5067043048694428 2.0 - - - - - - - 273.7 17 10 MRVI1 murine retrovirus integration site 1 homolog 81 11 C20140716_OR021_01 C20140716_OR021_01 TB420207.[MT7]-LGHVELADLLLR.2y4_1.heavy 746.952 / 514.371 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 83 11 C20140716_OR021_01 C20140716_OR021_01 TB420207.[MT7]-LGHVELADLLLR.2y8_1.heavy 746.952 / 942.562 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 85 11 C20140716_OR021_01 C20140716_OR021_01 TB420207.[MT7]-LGHVELADLLLR.2y9_1.heavy 746.952 / 1041.63 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 87 11 C20140716_OR021_01 C20140716_OR021_01 TB420207.[MT7]-LGHVELADLLLR.2y11_1.heavy 746.952 / 1235.71 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 89 12 C20140716_OR021_01 C20140716_OR021_01 TB420050.[MT7]-EYIDPETK[MT7].3y3_1.heavy 428.23 / 521.305 12415.0 26.163000106811523 46 18 10 10 8 2.9209100710198244 26.42293348923587 0.0 4 0.9898339363996866 12.229743509272778 12415.0 10.87129970029866 1.0 - - - - - - - 290.5 31 6 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 91 12 C20140716_OR021_01 C20140716_OR021_01 TB420050.[MT7]-EYIDPETK[MT7].3b4_1.heavy 428.23 / 665.326 38270.0 26.163000106811523 46 18 10 10 8 2.9209100710198244 26.42293348923587 0.0 4 0.9898339363996866 12.229743509272778 38270.0 705.9514563106795 0.0 - - - - - - - 132.28571428571428 76 7 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 93 12 C20140716_OR021_01 C20140716_OR021_01 TB420050.[MT7]-EYIDPETK[MT7].3y4_1.heavy 428.23 / 618.358 9337.0 26.163000106811523 46 18 10 10 8 2.9209100710198244 26.42293348923587 0.0 4 0.9898339363996866 12.229743509272778 9337.0 24.247722624031447 0.0 - - - - - - - 182.44444444444446 18 9 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 95 12 C20140716_OR021_01 C20140716_OR021_01 TB420050.[MT7]-EYIDPETK[MT7].3b3_1.heavy 428.23 / 550.299 15903.0 26.163000106811523 46 18 10 10 8 2.9209100710198244 26.42293348923587 0.0 4 0.9898339363996866 12.229743509272778 15903.0 121.7156279695914 0.0 - - - - - - - 234.42857142857142 31 7 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 97 13 C20140716_OR021_01 C20140716_OR021_01 TB442266.[MT7]-GVDFVLNYSK[MT7].2y4_1.heavy 715.4 / 655.353 13931.0 38.11370086669922 44 14 10 10 10 1.4254569163999697 41.16347060201707 0.0 3 0.9474242684172167 5.3585627063014165 13931.0 38.32730794538169 0.0 - - - - - - - 215.42857142857142 27 7 ALOX5 arachidonate 5-lipoxygenase 99 13 C20140716_OR021_01 C20140716_OR021_01 TB442266.[MT7]-GVDFVLNYSK[MT7].2y5_1.heavy 715.4 / 768.437 22173.0 38.11370086669922 44 14 10 10 10 1.4254569163999697 41.16347060201707 0.0 3 0.9474242684172167 5.3585627063014165 22173.0 220.296400862069 0.0 - - - - - - - 278.4 44 5 ALOX5 arachidonate 5-lipoxygenase 101 13 C20140716_OR021_01 C20140716_OR021_01 TB442266.[MT7]-GVDFVLNYSK[MT7].2b4_1.heavy 715.4 / 563.295 21593.0 38.11370086669922 44 14 10 10 10 1.4254569163999697 41.16347060201707 0.0 3 0.9474242684172167 5.3585627063014165 21593.0 88.37732626692392 0.0 - - - - - - - 232.0 43 5 ALOX5 arachidonate 5-lipoxygenase 103 13 C20140716_OR021_01 C20140716_OR021_01 TB442266.[MT7]-GVDFVLNYSK[MT7].2b5_1.heavy 715.4 / 662.363 21825.0 38.11370086669922 44 14 10 10 10 1.4254569163999697 41.16347060201707 0.0 3 0.9474242684172167 5.3585627063014165 21825.0 62.67412679958443 0.0 - - - - - - - 219.11111111111111 43 9 ALOX5 arachidonate 5-lipoxygenase 105 14 C20140716_OR021_01 C20140716_OR021_01 TB435891.[MT7]-SRTAFTAQQLEALEK[MT7].3y3_1.heavy 661.037 / 533.341 37384.0 33.893699645996094 46 16 10 10 10 6.523123241114365 15.330079825828445 0.0 3 0.9624174480401386 6.345993290733951 37384.0 69.49695498676081 0.0 - - - - - - - 675.2222222222222 74 9 DMBX1 diencephalon/mesencephalon homeobox 1 107 14 C20140716_OR021_01 C20140716_OR021_01 TB435891.[MT7]-SRTAFTAQQLEALEK[MT7].3y4_1.heavy 661.037 / 604.379 52729.0 33.893699645996094 46 16 10 10 10 6.523123241114365 15.330079825828445 0.0 3 0.9624174480401386 6.345993290733951 52729.0 142.42375930420712 0.0 - - - - - - - 772.5 105 8 DMBX1 diencephalon/mesencephalon homeobox 1 109 14 C20140716_OR021_01 C20140716_OR021_01 TB435891.[MT7]-SRTAFTAQQLEALEK[MT7].3b7_1.heavy 661.037 / 879.481 18950.0 33.893699645996094 46 16 10 10 10 6.523123241114365 15.330079825828445 0.0 3 0.9624174480401386 6.345993290733951 18950.0 94.68867313915857 0.0 - - - - - - - 191.28571428571428 37 7 DMBX1 diencephalon/mesencephalon homeobox 1 111 14 C20140716_OR021_01 C20140716_OR021_01 TB435891.[MT7]-SRTAFTAQQLEALEK[MT7].3y5_1.heavy 661.037 / 733.421 45417.0 33.893699645996094 46 16 10 10 10 6.523123241114365 15.330079825828445 0.0 3 0.9624174480401386 6.345993290733951 45417.0 250.96934466019417 0.0 - - - - - - - 271.54545454545456 90 11 DMBX1 diencephalon/mesencephalon homeobox 1 113 15 C20140716_OR021_01 C20140716_OR021_01 TB420201.[MT7]-SLPGSAPPLTEK[MT7].3b6_1.heavy 495.624 / 657.369 9017.0 29.40605068206787 42 16 10 6 10 1.9214517634553185 38.086055732724034 0.03610038757324219 3 0.9671454242108442 6.789974814593933 9017.0 98.42841788514517 0.0 - - - - - - - 133.57142857142858 18 7 MRVI1 murine retrovirus integration site 1 homolog 115 15 C20140716_OR021_01 C20140716_OR021_01 TB420201.[MT7]-SLPGSAPPLTEK[MT7].3y3_1.heavy 495.624 / 521.305 10468.0 29.40605068206787 42 16 10 6 10 1.9214517634553185 38.086055732724034 0.03610038757324219 3 0.9671454242108442 6.789974814593933 10468.0 0.4867705184840735 2.0 - - - - - - - 298.0 20 8 MRVI1 murine retrovirus integration site 1 homolog 117 15 C20140716_OR021_01 C20140716_OR021_01 TB420201.[MT7]-SLPGSAPPLTEK[MT7].3y4_1.heavy 495.624 / 634.389 4042.0 29.40605068206787 42 16 10 6 10 1.9214517634553185 38.086055732724034 0.03610038757324219 3 0.9671454242108442 6.789974814593933 4042.0 1.0498701298701298 2.0 - - - - - - - 181.25 8 4 MRVI1 murine retrovirus integration site 1 homolog 119 15 C20140716_OR021_01 C20140716_OR021_01 TB420201.[MT7]-SLPGSAPPLTEK[MT7].3y5_1.heavy 495.624 / 731.442 7981.0 29.40605068206787 42 16 10 6 10 1.9214517634553185 38.086055732724034 0.03610038757324219 3 0.9671454242108442 6.789974814593933 7981.0 8.143695520862991 1.0 - - - - - - - 266.57142857142856 15 7 MRVI1 murine retrovirus integration site 1 homolog 121 16 C20140716_OR021_01 C20140716_OR021_01 TB435893.[MT7]-LLEDIAVLHR.3b4_1.heavy 441.602 / 615.347 59855.0 40.80379867553711 45 15 10 10 10 2.5436745753811434 39.31320498614333 0.0 3 0.9500644280524742 5.499628456861557 59855.0 987.3517094017094 0.0 - - - - - - - 291.8333333333333 119 6 MRVI1 murine retrovirus integration site 1 homolog 123 16 C20140716_OR021_01 C20140716_OR021_01 TB435893.[MT7]-LLEDIAVLHR.3b3_1.heavy 441.602 / 500.32 10617.0 40.80379867553711 45 15 10 10 10 2.5436745753811434 39.31320498614333 0.0 3 0.9500644280524742 5.499628456861557 10617.0 76.09609442060086 0.0 - - - - - - - 320.75 21 4 MRVI1 murine retrovirus integration site 1 homolog 125 16 C20140716_OR021_01 C20140716_OR021_01 TB435893.[MT7]-LLEDIAVLHR.3y4_1.heavy 441.602 / 524.33 49587.0 40.80379867553711 45 15 10 10 10 2.5436745753811434 39.31320498614333 0.0 3 0.9500644280524742 5.499628456861557 49587.0 425.6394849785408 0.0 - - - - - - - 280.2 99 5 MRVI1 murine retrovirus integration site 1 homolog 127 16 C20140716_OR021_01 C20140716_OR021_01 TB435893.[MT7]-LLEDIAVLHR.3y5_1.heavy 441.602 / 595.367 28819.0 40.80379867553711 45 15 10 10 10 2.5436745753811434 39.31320498614333 0.0 3 0.9500644280524742 5.499628456861557 28819.0 203.96642832618028 0.0 - - - - - - - 233.2 57 5 MRVI1 murine retrovirus integration site 1 homolog 129 17 C20140716_OR021_01 C20140716_OR021_01 TB442364.[MT7]-GFTGPEGLPGPQGPK[MT7].3y7_1.heavy 576.317 / 824.475 16517.0 32.37537384033203 44 20 10 6 8 5.637261643218248 17.739109221638174 0.0345001220703125 4 0.9918671481069068 13.675592785748183 16517.0 74.01365402116113 0.0 - - - - - - - 261.875 33 8 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 131 17 C20140716_OR021_01 C20140716_OR021_01 TB442364.[MT7]-GFTGPEGLPGPQGPK[MT7].3y6_1.heavy 576.317 / 727.422 6903.0 32.37537384033203 44 20 10 6 8 5.637261643218248 17.739109221638174 0.0345001220703125 4 0.9918671481069068 13.675592785748183 6903.0 17.72391891891892 1.0 - - - - - - - 267.0833333333333 13 12 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 133 17 C20140716_OR021_01 C20140716_OR021_01 TB442364.[MT7]-GFTGPEGLPGPQGPK[MT7].3b4_1.heavy 576.317 / 507.268 14915.0 32.37537384033203 44 20 10 6 8 5.637261643218248 17.739109221638174 0.0345001220703125 4 0.9918671481069068 13.675592785748183 14915.0 47.88809851433584 0.0 - - - - - - - 301.3333333333333 29 9 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 135 17 C20140716_OR021_01 C20140716_OR021_01 TB442364.[MT7]-GFTGPEGLPGPQGPK[MT7].3b7_1.heavy 576.317 / 790.385 13805.0 32.37537384033203 44 20 10 6 8 5.637261643218248 17.739109221638174 0.0345001220703125 4 0.9918671481069068 13.675592785748183 13805.0 55.89068825910931 1.0 - - - - - - - 246.7 33 10 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 137 18 C20140716_OR021_01 C20140716_OR021_01 TB436047.[MT7]-LPQLIDAHQLQAHVDK[MT7].4y4_1.heavy 529.304 / 642.369 3636.0 35.79719924926758 48 18 10 10 10 5.816005381045873 17.19393182232877 0.0 3 0.9825775962953257 9.336320928274187 3636.0 13.632587484371916 1.0 - - - - - - - 208.0 7 5 IDO2 indoleamine 2,3-dioxygenase 2 139 18 C20140716_OR021_01 C20140716_OR021_01 TB436047.[MT7]-LPQLIDAHQLQAHVDK[MT7].4b4_1.heavy 529.304 / 596.389 7403.0 35.79719924926758 48 18 10 10 10 5.816005381045873 17.19393182232877 0.0 3 0.9825775962953257 9.336320928274187 7403.0 24.01624033280038 0.0 - - - - - - - 325.0 14 2 IDO2 indoleamine 2,3-dioxygenase 2 141 18 C20140716_OR021_01 C20140716_OR021_01 TB436047.[MT7]-LPQLIDAHQLQAHVDK[MT7].4y3_1.heavy 529.304 / 505.31 10260.0 35.79719924926758 48 18 10 10 10 5.816005381045873 17.19393182232877 0.0 3 0.9825775962953257 9.336320928274187 10260.0 0.9272493881933975 2.0 - - - - - - - 208.0 22 5 IDO2 indoleamine 2,3-dioxygenase 2 143 18 C20140716_OR021_01 C20140716_OR021_01 TB436047.[MT7]-LPQLIDAHQLQAHVDK[MT7].4b6_1.heavy 529.304 / 824.5 3247.0 35.79719924926758 48 18 10 10 10 5.816005381045873 17.19393182232877 0.0 3 0.9825775962953257 9.336320928274187 3247.0 1.9689220503050437 1.0 - - - - - - - 195.0 12 6 IDO2 indoleamine 2,3-dioxygenase 2 145 19 C20140716_OR021_01 C20140716_OR021_01 TB420065.[MT7]-TGEFAIVSGK[MT7].2y4_1.heavy 648.874 / 534.337 10949.0 32.29664993286133 38 18 6 6 8 3.0681586664672 26.039429512383737 0.034698486328125 4 0.9810091349588415 8.941292207390127 10949.0 43.848723916532904 1.0 - - - - - - - 253.30769230769232 32 13 PNLIPRP3 pancreatic lipase-related protein 3 147 19 C20140716_OR021_01 C20140716_OR021_01 TB420065.[MT7]-TGEFAIVSGK[MT7].2y5_1.heavy 648.874 / 647.421 4184.0 32.29664993286133 38 18 6 6 8 3.0681586664672 26.039429512383737 0.034698486328125 4 0.9810091349588415 8.941292207390127 4184.0 10.655880149812734 0.0 - - - - - - - 225.92307692307693 8 13 PNLIPRP3 pancreatic lipase-related protein 3 149 19 C20140716_OR021_01 C20140716_OR021_01 TB420065.[MT7]-TGEFAIVSGK[MT7].2b4_1.heavy 648.874 / 579.289 7122.0 32.29664993286133 38 18 6 6 8 3.0681586664672 26.039429512383737 0.034698486328125 4 0.9810091349588415 8.941292207390127 7122.0 10.174285714285714 0.0 - - - - - - - 189.86666666666667 14 15 PNLIPRP3 pancreatic lipase-related protein 3 151 19 C20140716_OR021_01 C20140716_OR021_01 TB420065.[MT7]-TGEFAIVSGK[MT7].2b6_1.heavy 648.874 / 763.411 7389.0 32.29664993286133 38 18 6 6 8 3.0681586664672 26.039429512383737 0.034698486328125 4 0.9810091349588415 8.941292207390127 7389.0 25.096507223113967 0.0 - - - - - - - 260.64285714285717 14 14 PNLIPRP3 pancreatic lipase-related protein 3 153 20 C20140716_OR021_01 C20140716_OR021_01 TB419940.[MT7]-ALETYEIIFK[MT7].3y3_1.heavy 505.628 / 551.367 4581.0 44.364601135253906 40 10 10 10 10 7.8424013705390445 12.751196384268525 0.0 3 0.8434804304386202 3.077821824357433 4581.0 -1.3674626865671637 0.0 - - - - - - - 245.8 9 5 DOPEY1;DOPEY2 dopey family member 1;dopey family member 2 155 20 C20140716_OR021_01 C20140716_OR021_01 TB419940.[MT7]-ALETYEIIFK[MT7].3b6_1.heavy 505.628 / 851.427 1229.0 44.364601135253906 40 10 10 10 10 7.8424013705390445 12.751196384268525 0.0 3 0.8434804304386202 3.077821824357433 1229.0 0.2397137745974955 1.0 - - - - - - - 391.0 2 2 DOPEY1;DOPEY2 dopey family member 1;dopey family member 2 157 20 C20140716_OR021_01 C20140716_OR021_01 TB419940.[MT7]-ALETYEIIFK[MT7].3b4_1.heavy 505.628 / 559.321 3017.0 44.364601135253906 40 10 10 10 10 7.8424013705390445 12.751196384268525 0.0 3 0.8434804304386202 3.077821824357433 3017.0 -0.2154999999999987 0.0 - - - - - - - 223.66666666666666 6 3 DOPEY1;DOPEY2 dopey family member 1;dopey family member 2 159 20 C20140716_OR021_01 C20140716_OR021_01 TB419940.[MT7]-ALETYEIIFK[MT7].3b5_1.heavy 505.628 / 722.384 1788.0 44.364601135253906 40 10 10 10 10 7.8424013705390445 12.751196384268525 0.0 3 0.8434804304386202 3.077821824357433 1788.0 0.0 2.0 - - - - - - - 223.0 3 2 DOPEY1;DOPEY2 dopey family member 1;dopey family member 2 161 21 C20140716_OR021_01 C20140716_OR021_01 TB419944.[MT7]-RLLISK[MT7].2b3_1.heavy 509.355 / 527.379 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4G2;DOPEY2 eukaryotic translation initiation factor 4 gamma, 2;dopey family member 2 163 21 C20140716_OR021_01 C20140716_OR021_01 TB419944.[MT7]-RLLISK[MT7].2y4_1.heavy 509.355 / 604.415 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4G2;DOPEY2 eukaryotic translation initiation factor 4 gamma, 2;dopey family member 2 165 21 C20140716_OR021_01 C20140716_OR021_01 TB419944.[MT7]-RLLISK[MT7].2y5_1.heavy 509.355 / 717.499 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4G2;DOPEY2 eukaryotic translation initiation factor 4 gamma, 2;dopey family member 2 167 21 C20140716_OR021_01 C20140716_OR021_01 TB419944.[MT7]-RLLISK[MT7].2y3_1.heavy 509.355 / 491.331 N/A N/A - - - - - - - - - 0.0 - - - - - - - EIF4G2;DOPEY2 eukaryotic translation initiation factor 4 gamma, 2;dopey family member 2 169 22 C20140716_OR021_01 C20140716_OR021_01 TB436042.[MT7]-VVGAEVAY[MT7]FIDVLMK[MT7].4b8_2.heavy 522.305 / 539.313 N/A N/A - - - - - - - - - 0.0 - - - - - - - PNLIPRP3 pancreatic lipase-related protein 3 171 22 C20140716_OR021_01 C20140716_OR021_01 TB436042.[MT7]-VVGAEVAY[MT7]FIDVLMK[MT7].4b5_1.heavy 522.305 / 600.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - PNLIPRP3 pancreatic lipase-related protein 3 173 22 C20140716_OR021_01 C20140716_OR021_01 TB436042.[MT7]-VVGAEVAY[MT7]FIDVLMK[MT7].4y3_1.heavy 522.305 / 535.339 N/A N/A - - - - - - - - - 0.0 - - - - - - - PNLIPRP3 pancreatic lipase-related protein 3 175 22 C20140716_OR021_01 C20140716_OR021_01 TB436042.[MT7]-VVGAEVAY[MT7]FIDVLMK[MT7].4b6_1.heavy 522.305 / 699.416 N/A N/A - - - - - - - - - 0.0 - - - - - - - PNLIPRP3 pancreatic lipase-related protein 3 177 23 C20140716_OR021_01 C20140716_OR021_01 TB442259.[MT7]-LAMC[CAM]TNLPEAR.2y8_1.heavy 710.364 / 960.457 34617.0 32.91490173339844 47 17 10 10 10 4.294995407754877 23.282911972255867 0.0 3 0.9734002297696448 7.550157651527527 34617.0 100.07485251942882 1.0 - - - - - - - 166.85714285714286 69 7 DMBX1 diencephalon/mesencephalon homeobox 1 179 23 C20140716_OR021_01 C20140716_OR021_01 TB442259.[MT7]-LAMC[CAM]TNLPEAR.2y9_1.heavy 710.364 / 1091.5 36951.0 32.91490173339844 47 17 10 10 10 4.294995407754877 23.282911972255867 0.0 3 0.9734002297696448 7.550157651527527 36951.0 304.7171849174668 0.0 - - - - - - - 237.83333333333334 73 6 DMBX1 diencephalon/mesencephalon homeobox 1 181 23 C20140716_OR021_01 C20140716_OR021_01 TB442259.[MT7]-LAMC[CAM]TNLPEAR.2b6_1.heavy 710.364 / 835.392 19318.0 32.91490173339844 47 17 10 10 10 4.294995407754877 23.282911972255867 0.0 3 0.9734002297696448 7.550157651527527 19318.0 70.0762883803678 0.0 - - - - - - - 207.6 38 5 DMBX1 diencephalon/mesencephalon homeobox 1 183 23 C20140716_OR021_01 C20140716_OR021_01 TB442259.[MT7]-LAMC[CAM]TNLPEAR.2y10_1.heavy 710.364 / 1162.53 49787.0 32.91490173339844 47 17 10 10 10 4.294995407754877 23.282911972255867 0.0 3 0.9734002297696448 7.550157651527527 49787.0 158.70406169665807 0.0 - - - - - - - 259.42857142857144 99 7 DMBX1 diencephalon/mesencephalon homeobox 1 185 24 C20140716_OR021_01 C20140716_OR021_01 TB435886.[MT7]-TGEFAIVSGK[MT7].3b6_1.heavy 432.918 / 763.411 9147.0 32.30532455444336 42 16 10 6 10 2.276769210827053 43.92188699867136 0.034698486328125 3 0.9642430159703556 6.506977022788104 9147.0 27.978510762593807 0.0 - - - - - - - 240.75 18 8 PNLIPRP3 pancreatic lipase-related protein 3 187 24 C20140716_OR021_01 C20140716_OR021_01 TB435886.[MT7]-TGEFAIVSGK[MT7].3b4_1.heavy 432.918 / 579.289 28692.0 32.30532455444336 42 16 10 6 10 2.276769210827053 43.92188699867136 0.034698486328125 3 0.9642430159703556 6.506977022788104 28692.0 84.4780883636401 0.0 - - - - - - - 301.0 57 8 PNLIPRP3 pancreatic lipase-related protein 3 189 24 C20140716_OR021_01 C20140716_OR021_01 TB435886.[MT7]-TGEFAIVSGK[MT7].3b5_1.heavy 432.918 / 650.327 42365.0 32.30532455444336 42 16 10 6 10 2.276769210827053 43.92188699867136 0.034698486328125 3 0.9642430159703556 6.506977022788104 42365.0 149.27819179781795 0.0 - - - - - - - 216.66666666666666 84 12 PNLIPRP3 pancreatic lipase-related protein 3 191 24 C20140716_OR021_01 C20140716_OR021_01 TB435886.[MT7]-TGEFAIVSGK[MT7].3y4_1.heavy 432.918 / 534.337 27826.0 32.30532455444336 42 16 10 6 10 2.276769210827053 43.92188699867136 0.034698486328125 3 0.9642430159703556 6.506977022788104 27826.0 99.5492290082351 1.0 - - - - - - - 325.84615384615387 55 13 PNLIPRP3 pancreatic lipase-related protein 3 193 25 C20140716_OR021_01 C20140716_OR021_01 TB442256.[MT7]-GFPGLPGLTGSK[MT7].3y6_1.heavy 473.613 / 706.422 1469.0 40.02242660522461 42 17 10 5 10 3.174444592331084 31.50157361120207 0.0420989990234375 3 0.976542644874393 8.042113973619708 1469.0 12.593652812476343 0.0 - - - - - - - 210.0 2 3 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 195 25 C20140716_OR021_01 C20140716_OR021_01 TB442256.[MT7]-GFPGLPGLTGSK[MT7].3b4_1.heavy 473.613 / 503.273 8078.0 40.02242660522461 42 17 10 5 10 3.174444592331084 31.50157361120207 0.0420989990234375 3 0.976542644874393 8.042113973619708 8078.0 35.774 0.0 - - - - - - - 210.0 16 4 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 197 25 C20140716_OR021_01 C20140716_OR021_01 TB442256.[MT7]-GFPGLPGLTGSK[MT7].3b5_1.heavy 473.613 / 616.357 3987.0 40.02242660522461 42 17 10 5 10 3.174444592331084 31.50157361120207 0.0420989990234375 3 0.976542644874393 8.042113973619708 3987.0 -0.3451441420576538 2.0 - - - - - - - 140.0 10 3 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 199 25 C20140716_OR021_01 C20140716_OR021_01 TB442256.[MT7]-GFPGLPGLTGSK[MT7].3y4_1.heavy 473.613 / 536.316 7868.0 40.02242660522461 42 17 10 5 10 3.174444592331084 31.50157361120207 0.0420989990234375 3 0.976542644874393 8.042113973619708 7868.0 20.060315655690353 0.0 - - - - - - - 288.75 15 4 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 201 26 C20140716_OR021_01 C20140716_OR021_01 TB435884.[MT7]-EAEGSHGEGK[MT7].2y4_1.heavy 644.822 / 534.3 N/A 13.356733004252115 31 13 2 6 10 2.600303124769248 38.4570548900425 0.03880023956298828 3 0.9268282950264815 4.534259288851207 1742.0 10.072718310279926 4.0 - - - - - - - 244.95238095238096 10 21 DMBX1 diencephalon/mesencephalon homeobox 1 203 26 C20140716_OR021_01 C20140716_OR021_01 TB435884.[MT7]-EAEGSHGEGK[MT7].2y5_1.heavy 644.822 / 671.359 716.0 13.356733004252115 31 13 2 6 10 2.600303124769248 38.4570548900425 0.03880023956298828 3 0.9268282950264815 4.534259288851207 716.0 81.8925 0.0 - - - - - - - 0.0 1 0 DMBX1 diencephalon/mesencephalon homeobox 1 205 26 C20140716_OR021_01 C20140716_OR021_01 TB435884.[MT7]-EAEGSHGEGK[MT7].2y9_1.heavy 644.822 / 1015.49 2181.0 13.356733004252115 31 13 2 6 10 2.600303124769248 38.4570548900425 0.03880023956298828 3 0.9268282950264815 4.534259288851207 2181.0 182.16306818181818 0.0 - - - - - - - 47.111111111111114 4 9 DMBX1 diencephalon/mesencephalon homeobox 1 207 26 C20140716_OR021_01 C20140716_OR021_01 TB435884.[MT7]-EAEGSHGEGK[MT7].2y7_1.heavy 644.822 / 815.413 798.0 13.356733004252115 31 13 2 6 10 2.600303124769248 38.4570548900425 0.03880023956298828 3 0.9268282950264815 4.534259288851207 798.0 83.29124999999999 0.0 - - - - - - - 0.0 1 0 DMBX1 diencephalon/mesencephalon homeobox 1 209 27 C20140716_OR021_01 C20140716_OR021_01 TB442099.[MT7]-GPLPNTK[MT7].2y4_1.heavy 507.813 / 603.358 13634.0 21.97107458114624 37 18 10 3 6 1.0353151292275784 54.36835673475595 0.06589889526367188 5 0.9884329823741083 11.463893852923979 13634.0 73.17176143356893 0.0 - - - - - - - 257.8333333333333 27 12 COL10A1 collagen, type X, alpha 1 211 27 C20140716_OR021_01 C20140716_OR021_01 TB442099.[MT7]-GPLPNTK[MT7].2y3_1.heavy 507.813 / 506.306 967.0 21.97107458114624 37 18 10 3 6 1.0353151292275784 54.36835673475595 0.06589889526367188 5 0.9884329823741083 11.463893852923979 967.0 2.762646055111292 8.0 - - - - - - - 271.75 2 16 COL10A1 collagen, type X, alpha 1 213 27 C20140716_OR021_01 C20140716_OR021_01 TB442099.[MT7]-GPLPNTK[MT7].2y6_1.heavy 507.813 / 813.495 2997.0 21.97107458114624 37 18 10 3 6 1.0353151292275784 54.36835673475595 0.06589889526367188 5 0.9884329823741083 11.463893852923979 2997.0 3.985721489329191 0.0 - - - - - - - 204.22222222222223 5 9 COL10A1 collagen, type X, alpha 1 215 27 C20140716_OR021_01 C20140716_OR021_01 TB442099.[MT7]-GPLPNTK[MT7].2b5_1.heavy 507.813 / 623.363 774.0 21.97107458114624 37 18 10 3 6 1.0353151292275784 54.36835673475595 0.06589889526367188 5 0.9884329823741083 11.463893852923979 774.0 0.17793103448275857 23.0 - - - - - - - 718.4285714285714 17 7 COL10A1 collagen, type X, alpha 1 217 28 C20140716_OR021_01 C20140716_OR021_01 TB420483.[MT7]-RRIYDITNVLEGIHLIK[MT7].4b8_2.heavy 586.104 / 588.834 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F3 E2F transcription factor 3 219 28 C20140716_OR021_01 C20140716_OR021_01 TB420483.[MT7]-RRIYDITNVLEGIHLIK[MT7].4b12_2.heavy 586.104 / 787.942 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F3 E2F transcription factor 3 221 28 C20140716_OR021_01 C20140716_OR021_01 TB420483.[MT7]-RRIYDITNVLEGIHLIK[MT7].4y3_1.heavy 586.104 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F3 E2F transcription factor 3 223 28 C20140716_OR021_01 C20140716_OR021_01 TB420483.[MT7]-RRIYDITNVLEGIHLIK[MT7].4b9_2.heavy 586.104 / 638.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F3 E2F transcription factor 3 225 29 C20140716_OR021_01 C20140716_OR021_01 TB420482.[MT7]-WESLVALSLARLPVAAQPK[MT7].4b5_1.heavy 585.103 / 759.416 242.0 46.31695079803467 23 5 10 6 2 0.5654571383726819 100.6173365315602 0.033000946044921875 12 0.66362447493703 2.065129441081474 242.0 1.392 20.0 - - - - - - - 0.0 0 0 FGF4 fibroblast growth factor 4 227 29 C20140716_OR021_01 C20140716_OR021_01 TB420482.[MT7]-WESLVALSLARLPVAAQPK[MT7].4b3_1.heavy 585.103 / 547.263 5027.0 46.31695079803467 23 5 10 6 2 0.5654571383726819 100.6173365315602 0.033000946044921875 12 0.66362447493703 2.065129441081474 5027.0 5.028602886622618 0.0 - - - - - - - 315.1333333333333 10 15 FGF4 fibroblast growth factor 4 229 29 C20140716_OR021_01 C20140716_OR021_01 TB420482.[MT7]-WESLVALSLARLPVAAQPK[MT7].4b6_1.heavy 585.103 / 830.453 7935.0 46.31695079803467 23 5 10 6 2 0.5654571383726819 100.6173365315602 0.033000946044921875 12 0.66362447493703 2.065129441081474 7935.0 141.30556835117193 0.0 - - - - - - - 130.6153846153846 15 13 FGF4 fibroblast growth factor 4 231 29 C20140716_OR021_01 C20140716_OR021_01 TB420482.[MT7]-WESLVALSLARLPVAAQPK[MT7].4b4_1.heavy 585.103 / 660.347 121.0 46.31695079803467 23 5 10 6 2 0.5654571383726819 100.6173365315602 0.033000946044921875 12 0.66362447493703 2.065129441081474 121.0 0.22830188679245286 38.0 - - - - - - - 160.7826086956522 3 23 FGF4 fibroblast growth factor 4 233 30 C20140716_OR021_01 C20140716_OR021_01 TPX_ECO57.AQTFTLVAK.2y7.peptide 489.78 / 779.47 318429.0 31.181699752807617 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 318429.0 4768.102007623165 0.0 - - - - - - - 207.5 636 14 235 30 C20140716_OR021_01 C20140716_OR021_01 TPX_ECO57.AQTFTLVAK.2y6.peptide 489.78 / 678.42 113384.0 31.181699752807617 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 113384.0 908.8499971454128 0.0 - - - - - - - 194.07142857142858 226 14 237 30 C20140716_OR021_01 C20140716_OR021_01 TPX_ECO57.AQTFTLVAK.2y5.peptide 489.78 / 531.35 144187.0 31.181699752807617 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 144187.0 1341.6330481283421 0.0 - - - - - - - 280.88235294117646 288 17 239 31 C20140716_OR021_01 C20140716_OR021_01 TB420486.[MT7]-LALTQPC[CAM]ALTALDQGPSPSLR.3y6_1.heavy 785.094 / 656.373 16161.0 42.26254844665527 42 16 10 6 10 2.0798462896645136 37.69228873461064 0.036899566650390625 3 0.9668297431394703 6.7574075552794985 16161.0 86.29967319546267 0.0 - - - - - - - 753.1428571428571 32 7 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 241 31 C20140716_OR021_01 C20140716_OR021_01 TB420486.[MT7]-LALTQPC[CAM]ALTALDQGPSPSLR.3b5_1.heavy 785.094 / 671.421 24007.0 42.26254844665527 42 16 10 6 10 2.0798462896645136 37.69228873461064 0.036899566650390625 3 0.9668297431394703 6.7574075552794985 24007.0 81.23763997459984 0.0 - - - - - - - 319.09090909090907 48 11 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 243 31 C20140716_OR021_01 C20140716_OR021_01 TB420486.[MT7]-LALTQPC[CAM]ALTALDQGPSPSLR.3y12_1.heavy 785.094 / 1241.65 3865.0 42.26254844665527 42 16 10 6 10 2.0798462896645136 37.69228873461064 0.036899566650390625 3 0.9668297431394703 6.7574075552794985 3865.0 20.646367521367523 0.0 - - - - - - - 257.4 7 10 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 245 31 C20140716_OR021_01 C20140716_OR021_01 TB420486.[MT7]-LALTQPC[CAM]ALTALDQGPSPSLR.3y8_1.heavy 785.094 / 841.453 10774.0 42.26254844665527 42 16 10 6 10 2.0798462896645136 37.69228873461064 0.036899566650390625 3 0.9668297431394703 6.7574075552794985 10774.0 47.48687407018465 0.0 - - - - - - - 191.45454545454547 21 11 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 247 32 C20140716_OR021_01 C20140716_OR021_01 TB420323.[MT7]-EAINRLHEAVPGVR.4y4_1.heavy 426.996 / 428.262 75983.0 28.006200790405273 50 20 10 10 10 7.965831279034632 12.553617632247775 0.0 3 0.9949343813029451 17.33255633084467 75983.0 110.56171842992651 0.0 - - - - - - - 458.0 151 2 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 249 32 C20140716_OR021_01 C20140716_OR021_01 TB420323.[MT7]-EAINRLHEAVPGVR.4b8_2.heavy 426.996 / 554.305 28494.0 28.006200790405273 50 20 10 10 10 7.965831279034632 12.553617632247775 0.0 3 0.9949343813029451 17.33255633084467 28494.0 74.54767657342657 0.0 - - - - - - - 343.25 56 8 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 251 32 C20140716_OR021_01 C20140716_OR021_01 TB420323.[MT7]-EAINRLHEAVPGVR.4b7_2.heavy 426.996 / 489.784 23687.0 28.006200790405273 50 20 10 10 10 7.965831279034632 12.553617632247775 0.0 3 0.9949343813029451 17.33255633084467 23687.0 29.247762427153475 1.0 - - - - - - - 300.125 53 8 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 253 32 C20140716_OR021_01 C20140716_OR021_01 TB420323.[MT7]-EAINRLHEAVPGVR.4b9_2.heavy 426.996 / 589.824 25061.0 28.006200790405273 50 20 10 10 10 7.965831279034632 12.553617632247775 0.0 3 0.9949343813029451 17.33255633084467 25061.0 146.6396044752191 0.0 - - - - - - - 228.83333333333334 50 6 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 255 33 C20140716_OR021_01 C20140716_OR021_01 TB420459.[MT7]-ELPDHYRPWMEIANK[MT7].4b11_2.heavy 547.537 / 799.881 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDO2 indoleamine 2,3-dioxygenase 2 257 33 C20140716_OR021_01 C20140716_OR021_01 TB420459.[MT7]-ELPDHYRPWMEIANK[MT7].4b4_1.heavy 547.537 / 599.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDO2 indoleamine 2,3-dioxygenase 2 259 33 C20140716_OR021_01 C20140716_OR021_01 TB420459.[MT7]-ELPDHYRPWMEIANK[MT7].4b10_2.heavy 547.537 / 735.359 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDO2 indoleamine 2,3-dioxygenase 2 261 33 C20140716_OR021_01 C20140716_OR021_01 TB420459.[MT7]-ELPDHYRPWMEIANK[MT7].4b9_2.heavy 547.537 / 669.839 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDO2 indoleamine 2,3-dioxygenase 2 263 34 C20140716_OR021_01 C20140716_OR021_01 TB420327.[MT7]-IVGFRPELGDPVK[MT7].3y11_2.heavy 572.341 / 679.881 13128.0 36.052799224853516 42 17 10 5 10 5.445805116895144 18.362757728835827 0.04740142822265625 3 0.9759682065820906 7.945032564824753 13128.0 76.28089907287664 0.0 - - - - - - - 216.83333333333334 26 6 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 265 34 C20140716_OR021_01 C20140716_OR021_01 TB420327.[MT7]-IVGFRPELGDPVK[MT7].3b10_1.heavy 572.341 / 1228.68 N/A 36.052799224853516 42 17 10 5 10 5.445805116895144 18.362757728835827 0.04740142822265625 3 0.9759682065820906 7.945032564824753 0.0 0.0 1.0 - - - - - - - 0.0 0 0 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 267 34 C20140716_OR021_01 C20140716_OR021_01 TB420327.[MT7]-IVGFRPELGDPVK[MT7].3b10_2.heavy 572.341 / 614.844 96998.0 36.052799224853516 42 17 10 5 10 5.445805116895144 18.362757728835827 0.04740142822265625 3 0.9759682065820906 7.945032564824753 96998.0 623.5585714285713 0.0 - - - - - - - 252.91666666666666 193 12 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 269 34 C20140716_OR021_01 C20140716_OR021_01 TB420327.[MT7]-IVGFRPELGDPVK[MT7].3y12_2.heavy 572.341 / 729.415 35805.0 36.052799224853516 42 17 10 5 10 5.445805116895144 18.362757728835827 0.04740142822265625 3 0.9759682065820906 7.945032564824753 35805.0 363.90739852398525 0.0 - - - - - - - 253.0 71 6 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 271 35 C20140716_OR021_01 C20140716_OR021_01 TB436056.[MT7]-HLAEEMSAVFHPANSTGIR.4y8_1.heavy 553.533 / 815.437 14877.0 36.97800064086914 48 18 10 10 10 3.6380907036697727 22.901906472072568 0.0 3 0.9846502616596103 9.948435439009746 14877.0 109.71570330092686 1.0 - - - - - - - 268.0 30 6 KAZ kazrin 273 35 C20140716_OR021_01 C20140716_OR021_01 TB436056.[MT7]-HLAEEMSAVFHPANSTGIR.4y9_1.heavy 553.533 / 952.496 3083.0 36.97800064086914 48 18 10 10 10 3.6380907036697727 22.901906472072568 0.0 3 0.9846502616596103 9.948435439009746 3083.0 32.4405223880597 0.0 - - - - - - - 223.33333333333334 6 6 KAZ kazrin 275 35 C20140716_OR021_01 C20140716_OR021_01 TB436056.[MT7]-HLAEEMSAVFHPANSTGIR.4b4_1.heavy 553.533 / 595.332 4289.0 36.97800064086914 48 18 10 10 10 3.6380907036697727 22.901906472072568 0.0 3 0.9846502616596103 9.948435439009746 4289.0 17.668119402985077 1.0 - - - - - - - 227.8 8 10 KAZ kazrin 277 35 C20140716_OR021_01 C20140716_OR021_01 TB436056.[MT7]-HLAEEMSAVFHPANSTGIR.4b5_1.heavy 553.533 / 724.375 5495.0 36.97800064086914 48 18 10 10 10 3.6380907036697727 22.901906472072568 0.0 3 0.9846502616596103 9.948435439009746 5495.0 28.04910447761194 0.0 - - - - - - - 282.8888888888889 10 9 KAZ kazrin 279 36 C20140716_OR021_01 C20140716_OR021_01 TB420457.[MT7]-FIQLLSQSPDGVLDLNK[MT7].4y5_1.heavy 544.562 / 746.453 1529.0 47.85200119018555 31 13 6 6 6 2.301190677788491 43.45576442891851 0.03179931640625 5 0.9101461958358238 4.085895748480831 1529.0 9.693660130718953 0.0 - - - - - - - 203.77777777777777 3 9 E2F3 E2F transcription factor 3 281 36 C20140716_OR021_01 C20140716_OR021_01 TB420457.[MT7]-FIQLLSQSPDGVLDLNK[MT7].4y4_1.heavy 544.562 / 633.369 1988.0 47.85200119018555 31 13 6 6 6 2.301190677788491 43.45576442891851 0.03179931640625 5 0.9101461958358238 4.085895748480831 1988.0 24.61235638114895 0.0 - - - - - - - 120.83333333333333 3 12 E2F3 E2F transcription factor 3 283 36 C20140716_OR021_01 C20140716_OR021_01 TB420457.[MT7]-FIQLLSQSPDGVLDLNK[MT7].4b4_1.heavy 544.562 / 646.404 2447.0 47.85200119018555 31 13 6 6 6 2.301190677788491 43.45576442891851 0.03179931640625 5 0.9101461958358238 4.085895748480831 2447.0 4.4840314136125645 0.0 - - - - - - - 237.66666666666666 4 9 E2F3 E2F transcription factor 3 285 36 C20140716_OR021_01 C20140716_OR021_01 TB420457.[MT7]-FIQLLSQSPDGVLDLNK[MT7].4y3_1.heavy 544.562 / 518.342 2218.0 47.85200119018555 31 13 6 6 6 2.301190677788491 43.45576442891851 0.03179931640625 5 0.9101461958358238 4.085895748480831 2218.0 10.963486835954924 2.0 - - - - - - - 188.53333333333333 7 15 E2F3 E2F transcription factor 3 287 37 C20140716_OR021_01 C20140716_OR021_01 ODP2_ECOLI.AEAPAAAPAAK.2y7.peptide 484.26 / 599.35 163621.0 16.381900787353516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 163621.0 38.47457552041969 0.0 - - - - - - - 172.375 327 8 289 37 C20140716_OR021_01 C20140716_OR021_01 ODP2_ECOLI.AEAPAAAPAAK.2y8.peptide 484.26 / 696.4 225862.0 16.381900787353516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 225862.0 629.13792580679 0.0 - - - - - - - 129.23076923076923 451 13 291 37 C20140716_OR021_01 C20140716_OR021_01 ODP2_ECOLI.AEAPAAAPAAK.2y6.peptide 484.26 / 528.31 137241.0 16.381900787353516 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 137241.0 180.69223880597013 0.0 - - - - - - - 219.45454545454547 274 11 293 38 C20140716_OR021_01 C20140716_OR021_01 TB420458.[MT7]-FIQLLSQSPDGVLDLNK[MT7].3y3_1.heavy 725.747 / 518.342 33486.0 47.86790084838867 50 20 10 10 10 13.342723868272982 7.494721541662507 0.0 3 0.9960325652019439 19.58681312798371 33486.0 97.58495159516428 0.0 - - - - - - - 802.0 66 9 E2F3 E2F transcription factor 3 295 38 C20140716_OR021_01 C20140716_OR021_01 TB420458.[MT7]-FIQLLSQSPDGVLDLNK[MT7].3b4_1.heavy 725.747 / 646.404 58908.0 47.86790084838867 50 20 10 10 10 13.342723868272982 7.494721541662507 0.0 3 0.9960325652019439 19.58681312798371 58908.0 262.78390794468544 0.0 - - - - - - - 230.4 117 15 E2F3 E2F transcription factor 3 297 38 C20140716_OR021_01 C20140716_OR021_01 TB420458.[MT7]-FIQLLSQSPDGVLDLNK[MT7].3y4_1.heavy 725.747 / 633.369 28801.0 47.86790084838867 50 20 10 10 10 13.342723868272982 7.494721541662507 0.0 3 0.9960325652019439 19.58681312798371 28801.0 132.61301054696486 0.0 - - - - - - - 225.0 57 14 E2F3 E2F transcription factor 3 299 38 C20140716_OR021_01 C20140716_OR021_01 TB420458.[MT7]-FIQLLSQSPDGVLDLNK[MT7].3y5_1.heavy 725.747 / 746.453 27265.0 47.86790084838867 50 20 10 10 10 13.342723868272982 7.494721541662507 0.0 3 0.9960325652019439 19.58681312798371 27265.0 101.50732893819702 0.0 - - - - - - - 234.77777777777777 54 18 E2F3 E2F transcription factor 3 301 39 C20140716_OR021_01 C20140716_OR021_01 TB435877.[MT7]-DIQFDSEK[MT7].2b3_1.heavy 635.332 / 501.279 23622.0 27.47089958190918 50 20 10 10 10 6.480464515033741 15.430992603695993 0.0 3 0.9929822119502634 14.723394078843103 23622.0 46.43588385485701 1.0 - - - - - - - 259.09090909090907 50 11 ALOX5 arachidonate 5-lipoxygenase 303 39 C20140716_OR021_01 C20140716_OR021_01 TB435877.[MT7]-DIQFDSEK[MT7].2y4_1.heavy 635.332 / 622.316 16091.0 27.47089958190918 50 20 10 10 10 6.480464515033741 15.430992603695993 0.0 3 0.9929822119502634 14.723394078843103 16091.0 87.950327506723 0.0 - - - - - - - 240.66666666666666 32 9 ALOX5 arachidonate 5-lipoxygenase 305 39 C20140716_OR021_01 C20140716_OR021_01 TB435877.[MT7]-DIQFDSEK[MT7].2y5_1.heavy 635.332 / 769.385 19286.0 27.47089958190918 50 20 10 10 10 6.480464515033741 15.430992603695993 0.0 3 0.9929822119502634 14.723394078843103 19286.0 90.08592105263158 0.0 - - - - - - - 253.33333333333334 38 9 ALOX5 arachidonate 5-lipoxygenase 307 39 C20140716_OR021_01 C20140716_OR021_01 TB435877.[MT7]-DIQFDSEK[MT7].2y3_1.heavy 635.332 / 507.289 37317.0 27.47089958190918 50 20 10 10 10 6.480464515033741 15.430992603695993 0.0 3 0.9929822119502634 14.723394078843103 37317.0 78.56532108313812 0.0 - - - - - - - 285.0 74 12 ALOX5 arachidonate 5-lipoxygenase 309 40 C20140716_OR021_01 C20140716_OR021_01 TB420071.[MT7]-LAQAIGIPEPR.3y6_1.heavy 436.93 / 668.373 6529.0 36.26940155029297 46 16 10 10 10 1.9393412421792249 36.0982819175671 0.0 3 0.9679586557561242 6.876073625107373 6529.0 64.68566280991736 0.0 - - - - - - - 322.6666666666667 13 6 LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 311 40 C20140716_OR021_01 C20140716_OR021_01 TB420071.[MT7]-LAQAIGIPEPR.3b4_1.heavy 436.93 / 528.326 14872.0 36.26940155029297 46 16 10 10 10 1.9393412421792249 36.0982819175671 0.0 3 0.9679586557561242 6.876073625107373 14872.0 100.53963636363636 0.0 - - - - - - - 259.2857142857143 29 7 LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 313 40 C20140716_OR021_01 C20140716_OR021_01 TB420071.[MT7]-LAQAIGIPEPR.3y4_1.heavy 436.93 / 498.267 20434.0 36.26940155029297 46 16 10 10 10 1.9393412421792249 36.0982819175671 0.0 3 0.9679586557561242 6.876073625107373 20434.0 332.6857851239669 0.0 - - - - - - - 201.66666666666666 40 3 LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 315 40 C20140716_OR021_01 C20140716_OR021_01 TB420071.[MT7]-LAQAIGIPEPR.3b3_1.heavy 436.93 / 457.289 10761.0 36.26940155029297 46 16 10 10 10 1.9393412421792249 36.0982819175671 0.0 3 0.9679586557561242 6.876073625107373 10761.0 88.73828309784784 1.0 - - - - - - - 211.75 22 8 LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 317 41 C20140716_OR021_01 C20140716_OR021_01 TB442241.[MT7]-YRTNTGFLQR.2b8_1.heavy 700.382 / 1097.59 1131.0 27.265950202941895 34 15 10 5 4 2.1393555220027025 31.175367317295574 0.04590034484863281 7 0.9523141441419516 5.628938206548591 1131.0 8.007079646017699 2.0 - - - - - - - 169.5 3 6 ITLN2 intelectin 2 319 41 C20140716_OR021_01 C20140716_OR021_01 TB442241.[MT7]-YRTNTGFLQR.2y8_1.heavy 700.382 / 936.49 1583.0 27.265950202941895 34 15 10 5 4 2.1393555220027025 31.175367317295574 0.04590034484863281 7 0.9523141441419516 5.628938206548591 1583.0 14.429115044247787 0.0 - - - - - - - 197.75 3 4 ITLN2 intelectin 2 321 41 C20140716_OR021_01 C20140716_OR021_01 TB442241.[MT7]-YRTNTGFLQR.2y5_1.heavy 700.382 / 620.352 905.0 27.265950202941895 34 15 10 5 4 2.1393555220027025 31.175367317295574 0.04590034484863281 7 0.9523141441419516 5.628938206548591 905.0 2.60287610619469 8.0 - - - - - - - 320.1666666666667 2 12 ITLN2 intelectin 2 323 41 C20140716_OR021_01 C20140716_OR021_01 TB442241.[MT7]-YRTNTGFLQR.2b7_1.heavy 700.382 / 984.502 565.0 27.265950202941895 34 15 10 5 4 2.1393555220027025 31.175367317295574 0.04590034484863281 7 0.9523141441419516 5.628938206548591 565.0 3.166666666666667 4.0 - - - - - - - 0.0 1 0 ITLN2 intelectin 2 325 42 C20140716_OR021_01 C20140716_OR021_01 TB435871.[MT7]-YYPYYGK[MT7].2y4_1.heavy 621.326 / 674.363 6273.0 30.10134983062744 38 12 10 6 10 0.8530182166228186 76.55968075330642 0.033000946044921875 3 0.8815089478308923 3.5492364683299193 6273.0 13.806602870813398 1.0 - - - - - - - 230.3 12 10 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 327 42 C20140716_OR021_01 C20140716_OR021_01 TB435871.[MT7]-YYPYYGK[MT7].2y5_1.heavy 621.326 / 771.416 41507.0 30.10134983062744 38 12 10 6 10 0.8530182166228186 76.55968075330642 0.033000946044921875 3 0.8815089478308923 3.5492364683299193 41507.0 220.90558452442627 0.0 - - - - - - - 241.3846153846154 83 13 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 329 42 C20140716_OR021_01 C20140716_OR021_01 TB435871.[MT7]-YYPYYGK[MT7].2y3_1.heavy 621.326 / 511.3 12755.0 30.10134983062744 38 12 10 6 10 0.8530182166228186 76.55968075330642 0.033000946044921875 3 0.8815089478308923 3.5492364683299193 12755.0 38.44808612440192 0.0 - - - - - - - 281.61538461538464 25 13 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 331 42 C20140716_OR021_01 C20140716_OR021_01 TB435871.[MT7]-YYPYYGK[MT7].2y6_1.heavy 621.326 / 934.479 18192.0 30.10134983062744 38 12 10 6 10 0.8530182166228186 76.55968075330642 0.033000946044921875 3 0.8815089478308923 3.5492364683299193 18192.0 205.7456160145587 0.0 - - - - - - - 239.14285714285714 36 14 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 333 43 C20140716_OR021_01 C20140716_OR021_01 TB442242.[MT7]-DSLLELSPVER.2y8_1.heavy 701.389 / 942.526 28156.0 39.481201171875 46 16 10 10 10 2.189604476426188 36.56276291210294 0.0 3 0.9612373260662577 6.248022149566142 28156.0 132.08603482497293 0.0 - - - - - - - 253.77777777777777 56 9 FGF4 fibroblast growth factor 4 335 43 C20140716_OR021_01 C20140716_OR021_01 TB442242.[MT7]-DSLLELSPVER.2y6_1.heavy 701.389 / 700.399 14784.0 39.481201171875 46 16 10 10 10 2.189604476426188 36.56276291210294 0.0 3 0.9612373260662577 6.248022149566142 14784.0 62.355828220858896 0.0 - - - - - - - 258.0 29 8 FGF4 fibroblast growth factor 4 337 43 C20140716_OR021_01 C20140716_OR021_01 TB442242.[MT7]-DSLLELSPVER.2y10_1.heavy 701.389 / 1142.64 11958.0 39.481201171875 46 16 10 10 10 2.189604476426188 36.56276291210294 0.0 3 0.9612373260662577 6.248022149566142 11958.0 42.842172794117644 0.0 - - - - - - - 205.22222222222223 23 9 FGF4 fibroblast growth factor 4 339 43 C20140716_OR021_01 C20140716_OR021_01 TB442242.[MT7]-DSLLELSPVER.2y7_1.heavy 701.389 / 829.441 27395.0 39.481201171875 46 16 10 10 10 2.189604476426188 36.56276291210294 0.0 3 0.9612373260662577 6.248022149566142 27395.0 83.3336492473139 0.0 - - - - - - - 308.0 54 6 FGF4 fibroblast growth factor 4 341 44 C20140716_OR021_01 C20140716_OR021_01 TB420452.[MT7]-VDGRSEEEEETPLHVAAR.4y5_1.heavy 542.773 / 553.32 8928.0 25.888599395751953 48 18 10 10 10 5.98952364956782 16.695818540964538 0.0 3 0.9833518171683211 9.551566113767615 8928.0 50.816 0.0 - - - - - - - 288.3 17 10 ASB10 ankyrin repeat and SOCS box-containing 10 343 44 C20140716_OR021_01 C20140716_OR021_01 TB420452.[MT7]-VDGRSEEEEETPLHVAAR.4b11_2.heavy 542.773 / 703.314 6231.0 25.888599395751953 48 18 10 10 10 5.98952364956782 16.695818540964538 0.0 3 0.9833518171683211 9.551566113767615 6231.0 49.044000000000004 0.0 - - - - - - - 217.0 12 6 ASB10 ankyrin repeat and SOCS box-containing 10 345 44 C20140716_OR021_01 C20140716_OR021_01 TB420452.[MT7]-VDGRSEEEEETPLHVAAR.4b9_2.heavy 542.773 / 588.268 4185.0 25.888599395751953 48 18 10 10 10 5.98952364956782 16.695818540964538 0.0 3 0.9833518171683211 9.551566113767615 4185.0 24.1875 0.0 - - - - - - - 243.23076923076923 8 13 ASB10 ankyrin repeat and SOCS box-containing 10 347 44 C20140716_OR021_01 C20140716_OR021_01 TB420452.[MT7]-VDGRSEEEEETPLHVAAR.4b10_2.heavy 542.773 / 652.79 6975.0 25.888599395751953 48 18 10 10 10 5.98952364956782 16.695818540964538 0.0 3 0.9833518171683211 9.551566113767615 6975.0 37.25 0.0 - - - - - - - 292.2857142857143 13 7 ASB10 ankyrin repeat and SOCS box-containing 10 349 45 C20140716_OR021_01 C20140716_OR021_01 TB420320.[MT7]-YWLNDDWYLK[MT7].3b6_1.heavy 568.627 / 951.433 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 351 45 C20140716_OR021_01 C20140716_OR021_01 TB420320.[MT7]-YWLNDDWYLK[MT7].3y3_1.heavy 568.627 / 567.362 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 353 45 C20140716_OR021_01 C20140716_OR021_01 TB420320.[MT7]-YWLNDDWYLK[MT7].3b5_1.heavy 568.627 / 836.406 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 355 45 C20140716_OR021_01 C20140716_OR021_01 TB420320.[MT7]-YWLNDDWYLK[MT7].3b3_1.heavy 568.627 / 607.336 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 357 46 C20140716_OR021_01 C20140716_OR021_01 TB420450.[MT7]-RDDLEALGHMFMYFLR.3y7_1.heavy 720.028 / 1007.48 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 359 46 C20140716_OR021_01 C20140716_OR021_01 TB420450.[MT7]-RDDLEALGHMFMYFLR.3b6_1.heavy 720.028 / 844.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 361 46 C20140716_OR021_01 C20140716_OR021_01 TB420450.[MT7]-RDDLEALGHMFMYFLR.3y6_1.heavy 720.028 / 876.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 363 46 C20140716_OR021_01 C20140716_OR021_01 TB420450.[MT7]-RDDLEALGHMFMYFLR.3b8_1.heavy 720.028 / 1014.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 365 47 C20140716_OR021_01 C20140716_OR021_01 TB442381.[MT7]-TPHGDYIEFPC[CAM]YR.3y6_1.heavy 600.283 / 871.377 26559.0 34.866798400878906 44 14 10 10 10 3.7703209497111887 26.52294097340974 0.0 3 0.9474846709093074 5.361671017127209 26559.0 118.91114391143911 0.0 - - - - - - - 232.71428571428572 53 7 ALOX5 arachidonate 5-lipoxygenase 367 47 C20140716_OR021_01 C20140716_OR021_01 TB442381.[MT7]-TPHGDYIEFPC[CAM]YR.3b5_1.heavy 600.283 / 652.317 12467.0 34.866798400878906 44 14 10 10 10 3.7703209497111887 26.52294097340974 0.0 3 0.9474846709093074 5.361671017127209 12467.0 13.909940795043564 1.0 - - - - - - - 254.5 25 8 ALOX5 arachidonate 5-lipoxygenase 369 47 C20140716_OR021_01 C20140716_OR021_01 TB442381.[MT7]-TPHGDYIEFPC[CAM]YR.3y4_1.heavy 600.283 / 595.266 61113.0 34.866798400878906 44 14 10 10 10 3.7703209497111887 26.52294097340974 0.0 3 0.9474846709093074 5.361671017127209 61113.0 95.86320325532023 0.0 - - - - - - - 692.6666666666666 122 9 ALOX5 arachidonate 5-lipoxygenase 371 47 C20140716_OR021_01 C20140716_OR021_01 TB442381.[MT7]-TPHGDYIEFPC[CAM]YR.3y5_1.heavy 600.283 / 742.334 23172.0 34.866798400878906 44 14 10 10 10 3.7703209497111887 26.52294097340974 0.0 3 0.9474846709093074 5.361671017127209 23172.0 63.68909679565929 0.0 - - - - - - - 339.1666666666667 46 6 ALOX5 arachidonate 5-lipoxygenase 373 48 C20140716_OR021_01 C20140716_OR021_01 TB420321.[MT7]-YWLNDDWYLK[MT7].2y4_1.heavy 852.437 / 753.442 N/A 45.375099182128906 30 12 6 10 2 1.4752978343997751 67.78292333133193 0.0 12 0.8940719597824685 3.7579113892565172 0.0 0.0 45.0 - - - - - - - 679.5 12 8 ALOX5 arachidonate 5-lipoxygenase 375 48 C20140716_OR021_01 C20140716_OR021_01 TB420321.[MT7]-YWLNDDWYLK[MT7].2y5_1.heavy 852.437 / 868.469 503.0 45.375099182128906 30 12 6 10 2 1.4752978343997751 67.78292333133193 0.0 12 0.8940719597824685 3.7579113892565172 503.0 4.1540128516162875 11.0 - - - - - - - 241.6 5 10 ALOX5 arachidonate 5-lipoxygenase 377 48 C20140716_OR021_01 C20140716_OR021_01 TB420321.[MT7]-YWLNDDWYLK[MT7].2y3_1.heavy 852.437 / 567.362 4127.0 45.375099182128906 30 12 6 10 2 1.4752978343997751 67.78292333133193 0.0 12 0.8940719597824685 3.7579113892565172 4127.0 11.834892245467858 0.0 - - - - - - - 776.5714285714286 8 7 ALOX5 arachidonate 5-lipoxygenase 379 48 C20140716_OR021_01 C20140716_OR021_01 TB420321.[MT7]-YWLNDDWYLK[MT7].2y7_1.heavy 852.437 / 1097.54 1510.0 45.375099182128906 30 12 6 10 2 1.4752978343997751 67.78292333133193 0.0 12 0.8940719597824685 3.7579113892565172 1510.0 0.6003976143141152 6.0 - - - - - - - 682.2222222222222 13 9 ALOX5 arachidonate 5-lipoxygenase 381 49 C20140716_OR021_01 C20140716_OR021_01 TB419962.[MT7]-TNTGFLQR.2y5_1.heavy 540.8 / 620.352 3552.0 27.44824981689453 42 17 10 5 10 5.267250837408683 18.985235958346113 0.045299530029296875 3 0.9768407263706425 8.09390605135683 3552.0 15.79813953488372 0.0 - - - - - - - 263.7 7 10 ITLN2 intelectin 2 383 49 C20140716_OR021_01 C20140716_OR021_01 TB419962.[MT7]-TNTGFLQR.2b4_1.heavy 540.8 / 518.269 2750.0 27.44824981689453 42 17 10 5 10 5.267250837408683 18.985235958346113 0.045299530029296875 3 0.9768407263706425 8.09390605135683 2750.0 6.883273284811228 0.0 - - - - - - - 655.0 5 7 ITLN2 intelectin 2 385 49 C20140716_OR021_01 C20140716_OR021_01 TB419962.[MT7]-TNTGFLQR.2b5_1.heavy 540.8 / 665.338 4240.0 27.44824981689453 42 17 10 5 10 5.267250837408683 18.985235958346113 0.045299530029296875 3 0.9768407263706425 8.09390605135683 4240.0 41.68577282039608 0.0 - - - - - - - 245.71428571428572 8 7 ITLN2 intelectin 2 387 49 C20140716_OR021_01 C20140716_OR021_01 TB419962.[MT7]-TNTGFLQR.2y7_1.heavy 540.8 / 835.442 8136.0 27.44824981689453 42 17 10 5 10 5.267250837408683 18.985235958346113 0.045299530029296875 3 0.9768407263706425 8.09390605135683 8136.0 23.015560944386916 0.0 - - - - - - - 286.5 16 8 ITLN2 intelectin 2 389 50 C20140716_OR021_01 C20140716_OR021_01 TB420089.[MT7]-ITGLDPAGPFFHNTPK[MT7].3b5_1.heavy 667.366 / 644.374 46433.0 39.09710121154785 40 17 10 5 8 2.2573960039075325 33.664231504047585 0.04399871826171875 4 0.9765992631430112 8.051875394931729 46433.0 49.03089878055753 1.0 - - - - - - - 137.0 92 1 PNLIPRP3 pancreatic lipase-related protein 3 391 50 C20140716_OR021_01 C20140716_OR021_01 TB420089.[MT7]-ITGLDPAGPFFHNTPK[MT7].3y4_1.heavy 667.366 / 603.358 19645.0 39.09710121154785 40 17 10 5 8 2.2573960039075325 33.664231504047585 0.04399871826171875 4 0.9765992631430112 8.051875394931729 19645.0 0.0 0.0 - - - - - - - 274.6666666666667 39 3 PNLIPRP3 pancreatic lipase-related protein 3 393 50 C20140716_OR021_01 C20140716_OR021_01 TB420089.[MT7]-ITGLDPAGPFFHNTPK[MT7].3b8_1.heavy 667.366 / 869.485 6594.0 39.09710121154785 40 17 10 5 8 2.2573960039075325 33.664231504047585 0.04399871826171875 4 0.9765992631430112 8.051875394931729 6594.0 -0.05517068273092368 2.0 - - - - - - - 247.2 23 5 PNLIPRP3 pancreatic lipase-related protein 3 395 50 C20140716_OR021_01 C20140716_OR021_01 TB420089.[MT7]-ITGLDPAGPFFHNTPK[MT7].3y5_1.heavy 667.366 / 740.417 8655.0 39.09710121154785 40 17 10 5 8 2.2573960039075325 33.664231504047585 0.04399871826171875 4 0.9765992631430112 8.051875394931729 8655.0 0.8894619400476685 2.0 - - - - - - - 275.0 23 1 PNLIPRP3 pancreatic lipase-related protein 3 397 51 C20140716_OR021_01 C20140716_OR021_01 TB420466.[MT7]-ARC[CAM]ETQNIDPVVWTNQR.3y6_1.heavy 744.375 / 803.416 8420.0 32.68579864501953 47 17 10 10 10 4.686319493988646 21.338707300745185 0.0 3 0.9730525630548228 7.501075263454415 8420.0 76.30477456335278 0.0 - - - - - - - 236.1818181818182 16 11 KAZ kazrin 399 51 C20140716_OR021_01 C20140716_OR021_01 TB420466.[MT7]-ARC[CAM]ETQNIDPVVWTNQR.3y8_1.heavy 744.375 / 999.537 28307.0 32.68579864501953 47 17 10 10 10 4.686319493988646 21.338707300745185 0.0 3 0.9730525630548228 7.501075263454415 28307.0 358.8188994413408 0.0 - - - - - - - 197.2 56 10 KAZ kazrin 401 51 C20140716_OR021_01 C20140716_OR021_01 TB420466.[MT7]-ARC[CAM]ETQNIDPVVWTNQR.3y5_1.heavy 744.375 / 704.347 14422.0 32.68579864501953 47 17 10 10 10 4.686319493988646 21.338707300745185 0.0 3 0.9730525630548228 7.501075263454415 14422.0 101.48561701915403 0.0 - - - - - - - 250.9 28 10 KAZ kazrin 403 51 C20140716_OR021_01 C20140716_OR021_01 TB420466.[MT7]-ARC[CAM]ETQNIDPVVWTNQR.3b7_2.heavy 744.375 / 502.739 20334.0 32.68579864501953 47 17 10 10 10 4.686319493988646 21.338707300745185 0.0 3 0.9730525630548228 7.501075263454415 20334.0 105.64425819533625 0.0 - - - - - - - 268.875 40 8 KAZ kazrin 405 52 C20140716_OR021_01 C20140716_OR021_01 TB420082.[MT7]-LLEDIAVLHR.2b4_1.heavy 661.899 / 615.347 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRVI1 murine retrovirus integration site 1 homolog 407 52 C20140716_OR021_01 C20140716_OR021_01 TB420082.[MT7]-LLEDIAVLHR.2y9_1.heavy 661.899 / 1065.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRVI1 murine retrovirus integration site 1 homolog 409 52 C20140716_OR021_01 C20140716_OR021_01 TB420082.[MT7]-LLEDIAVLHR.2y6_1.heavy 661.899 / 708.451 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRVI1 murine retrovirus integration site 1 homolog 411 52 C20140716_OR021_01 C20140716_OR021_01 TB420082.[MT7]-LLEDIAVLHR.2y7_1.heavy 661.899 / 823.479 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRVI1 murine retrovirus integration site 1 homolog 413 53 C20140716_OR021_01 C20140716_OR021_01 TB419967.[MT7]-GSEEHLK[MT7].2y4_1.heavy 544.303 / 670.4 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 415 53 C20140716_OR021_01 C20140716_OR021_01 TB419967.[MT7]-GSEEHLK[MT7].2b4_1.heavy 544.303 / 547.248 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 417 53 C20140716_OR021_01 C20140716_OR021_01 TB419967.[MT7]-GSEEHLK[MT7].2y3_1.heavy 544.303 / 541.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 419 53 C20140716_OR021_01 C20140716_OR021_01 TB419967.[MT7]-GSEEHLK[MT7].2b5_1.heavy 544.303 / 684.307 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 421 54 C20140716_OR021_01 C20140716_OR021_01 TB435867.[MT7]-LPLAEEEK[MT7].2y4_1.heavy 608.855 / 678.343 11325.0 30.392099380493164 45 15 10 10 10 3.899834864082992 25.64211139322537 0.0 3 0.958890376567968 6.065847275296955 11325.0 139.93015203974107 0.0 - - - - - - - 228.25 22 12 MRVI1 murine retrovirus integration site 1 homolog 423 54 C20140716_OR021_01 C20140716_OR021_01 TB435867.[MT7]-LPLAEEEK[MT7].2y5_1.heavy 608.855 / 749.38 15526.0 30.392099380493164 45 15 10 10 10 3.899834864082992 25.64211139322537 0.0 3 0.958890376567968 6.065847275296955 15526.0 28.6673136629999 0.0 - - - - - - - 313.07142857142856 31 14 MRVI1 murine retrovirus integration site 1 homolog 425 54 C20140716_OR021_01 C20140716_OR021_01 TB435867.[MT7]-LPLAEEEK[MT7].2y3_1.heavy 608.855 / 549.3 9773.0 30.392099380493164 45 15 10 10 10 3.899834864082992 25.64211139322537 0.0 3 0.958890376567968 6.065847275296955 9773.0 32.07768052516411 1.0 - - - - - - - 243.61904761904762 108 21 MRVI1 murine retrovirus integration site 1 homolog 427 54 C20140716_OR021_01 C20140716_OR021_01 TB435867.[MT7]-LPLAEEEK[MT7].2y7_1.heavy 608.855 / 959.517 126039.0 30.392099380493164 45 15 10 10 10 3.899834864082992 25.64211139322537 0.0 3 0.958890376567968 6.065847275296955 126039.0 228.1984630593028 0.0 - - - - - - - 296.75 252 8 MRVI1 murine retrovirus integration site 1 homolog 429 55 C20140716_OR021_01 C20140716_OR021_01 TB436063.[MT7]-DSVTNPGQYVLTGMHAGQPK[MT7].3y6_1.heavy 796.746 / 781.444 5934.0 35.119998931884766 44 14 10 10 10 2.4240802652388855 41.25275942137391 0.0 3 0.9380638938705409 4.9331347915933135 5934.0 18.946180021236625 0.0 - - - - - - - 350.6666666666667 11 6 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 431 55 C20140716_OR021_01 C20140716_OR021_01 TB436063.[MT7]-DSVTNPGQYVLTGMHAGQPK[MT7].3b5_1.heavy 796.746 / 661.327 16320.0 35.119998931884766 44 14 10 10 10 2.4240802652388855 41.25275942137391 0.0 3 0.9380638938705409 4.9331347915933135 16320.0 91.68840847450966 0.0 - - - - - - - 206.16666666666666 32 6 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 433 55 C20140716_OR021_01 C20140716_OR021_01 TB436063.[MT7]-DSVTNPGQYVLTGMHAGQPK[MT7].3y5_1.heavy 796.746 / 644.385 11992.0 35.119998931884766 44 14 10 10 10 2.4240802652388855 41.25275942137391 0.0 3 0.9380638938705409 4.9331347915933135 11992.0 47.1922371967655 0.0 - - - - - - - 321.4 23 10 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 435 55 C20140716_OR021_01 C20140716_OR021_01 TB436063.[MT7]-DSVTNPGQYVLTGMHAGQPK[MT7].3y9_1.heavy 796.746 / 1070.55 11622.0 35.119998931884766 44 14 10 10 10 2.4240802652388855 41.25275942137391 0.0 3 0.9380638938705409 4.9331347915933135 11622.0 46.00372797161443 0.0 - - - - - - - 197.8 23 5 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 437 56 C20140716_OR021_01 C20140716_OR021_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y7.peptide 590.82 / 599.35 280536.0 19.353099822998047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 280536.0 1953.9399025353155 0.0 - - - - - - - 200.72727272727272 561 11 439 56 C20140716_OR021_01 C20140716_OR021_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y9.peptide 590.82 / 741.43 147594.0 19.353099822998047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 147594.0 1506.323260981912 0.0 - - - - - - - 200.07142857142858 295 14 441 56 C20140716_OR021_01 C20140716_OR021_01 ODP2_ECOLI.EAAPAAAPAAAAAK.2y11.peptide 590.82 / 909.52 161060.0 19.353099822998047 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 161060.0 1856.683667354357 0.0 - - - - - - - 230.92857142857142 322 14 443 57 C20140716_OR021_01 C20140716_OR021_01 TB442233.[MT7]-YYPY[MT7]YGK[MT7].3y6_2.heavy 462.587 / 539.794 5260.0 26.650650024414062 24 13 0 5 6 0.8888406833305683 69.10347209622239 0.04669952392578125 6 0.9091569675446871 4.063241829300515 5260.0 58.863249961638786 0.0 - - - - - - - 266.6666666666667 10 6 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 445 57 C20140716_OR021_01 C20140716_OR021_01 TB442233.[MT7]-YYPY[MT7]YGK[MT7].3y3_1.heavy 462.587 / 511.3 9948.0 26.650650024414062 24 13 0 5 6 0.8888406833305683 69.10347209622239 0.04669952392578125 6 0.9091569675446871 4.063241829300515 9948.0 19.718256521074103 2.0 - - - - - - - 310.2857142857143 82 7 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 447 57 C20140716_OR021_01 C20140716_OR021_01 TB442233.[MT7]-YYPY[MT7]YGK[MT7].3y4_1.heavy 462.587 / 818.465 1029.0 26.650650024414062 24 13 0 5 6 0.8888406833305683 69.10347209622239 0.04669952392578125 6 0.9091569675446871 4.063241829300515 1029.0 4.793777292576419 1.0 - - - - - - - 257.25 2 4 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 449 57 C20140716_OR021_01 C20140716_OR021_01 TB442233.[MT7]-YYPY[MT7]YGK[MT7].3y5_1.heavy 462.587 / 915.518 114.0 26.650650024414062 24 13 0 5 6 0.8888406833305683 69.10347209622239 0.04669952392578125 6 0.9091569675446871 4.063241829300515 114.0 0.8 12.0 - - - - - - - 0.0 0 0 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 451 58 C20140716_OR021_01 C20140716_OR021_01 TB435862.[MT7]-FFVAMSSK[MT7].2y4_1.heavy 602.836 / 596.319 9806.0 37.19219970703125 47 17 10 10 10 7.322491730782832 13.656553489792636 0.0 3 0.9734818266687418 7.5618166399537445 9806.0 12.920508777570678 1.0 - - - - - - - 798.2222222222222 29 9 FGF4 fibroblast growth factor 4 453 58 C20140716_OR021_01 C20140716_OR021_01 TB435862.[MT7]-FFVAMSSK[MT7].2y5_1.heavy 602.836 / 667.357 16436.0 37.19219970703125 47 17 10 10 10 7.322491730782832 13.656553489792636 0.0 3 0.9734818266687418 7.5618166399537445 16436.0 94.48714975845411 0.0 - - - - - - - 276.0 32 7 FGF4 fibroblast growth factor 4 455 58 C20140716_OR021_01 C20140716_OR021_01 TB435862.[MT7]-FFVAMSSK[MT7].2y6_1.heavy 602.836 / 766.425 6353.0 37.19219970703125 47 17 10 10 10 7.322491730782832 13.656553489792636 0.0 3 0.9734818266687418 7.5618166399537445 6353.0 22.943942756070108 0.0 - - - - - - - 193.2 12 5 FGF4 fibroblast growth factor 4 457 58 C20140716_OR021_01 C20140716_OR021_01 TB435862.[MT7]-FFVAMSSK[MT7].2b7_1.heavy 602.836 / 914.456 1381.0 37.19219970703125 47 17 10 10 10 7.322491730782832 13.656553489792636 0.0 3 0.9734818266687418 7.5618166399537445 1381.0 5.936023321270607 1.0 - - - - - - - 276.0 2 6 FGF4 fibroblast growth factor 4 459 59 C20140716_OR021_01 C20140716_OR021_01 TB420462.[MT7]-EGC[CAM]PTMGHFADRFHFK[MT7].4y8_2.heavy 557.021 / 606.326 N/A N/A - - - - - - - - - 0.0 - - - - - - - PNLIPRP3 pancreatic lipase-related protein 3 461 59 C20140716_OR021_01 C20140716_OR021_01 TB420462.[MT7]-EGC[CAM]PTMGHFADRFHFK[MT7].4b5_1.heavy 557.021 / 689.305 N/A N/A - - - - - - - - - 0.0 - - - - - - - PNLIPRP3 pancreatic lipase-related protein 3 463 59 C20140716_OR021_01 C20140716_OR021_01 TB420462.[MT7]-EGC[CAM]PTMGHFADRFHFK[MT7].4y7_2.heavy 557.021 / 532.792 N/A N/A - - - - - - - - - 0.0 - - - - - - - PNLIPRP3 pancreatic lipase-related protein 3 465 59 C20140716_OR021_01 C20140716_OR021_01 TB420462.[MT7]-EGC[CAM]PTMGHFADRFHFK[MT7].4y3_1.heavy 557.021 / 575.342 N/A N/A - - - - - - - - - 0.0 - - - - - - - PNLIPRP3 pancreatic lipase-related protein 3 467 60 C20140716_OR021_01 C20140716_OR021_01 TB435859.[MT7]-DQTVIVVK[MT7].2y4_1.heavy 595.373 / 602.436 29844.0 28.21660041809082 48 18 10 10 10 4.330951052382781 19.35946760549844 0.0 3 0.9880030294222939 11.256190380867176 29844.0 136.89908256880733 0.0 - - - - - - - 169.55555555555554 59 9 E2F3 E2F transcription factor 3 469 60 C20140716_OR021_01 C20140716_OR021_01 TB435859.[MT7]-DQTVIVVK[MT7].2b4_1.heavy 595.373 / 588.311 30606.0 28.21660041809082 48 18 10 10 10 4.330951052382781 19.35946760549844 0.0 3 0.9880030294222939 11.256190380867176 30606.0 87.7671869234463 0.0 - - - - - - - 638.1428571428571 61 7 E2F3 E2F transcription factor 3 471 60 C20140716_OR021_01 C20140716_OR021_01 TB435859.[MT7]-DQTVIVVK[MT7].2y6_1.heavy 595.373 / 802.552 6099.0 28.21660041809082 48 18 10 10 10 4.330951052382781 19.35946760549844 0.0 3 0.9880030294222939 11.256190380867176 6099.0 64.57106422018349 0.0 - - - - - - - 218.0 12 9 E2F3 E2F transcription factor 3 473 60 C20140716_OR021_01 C20140716_OR021_01 TB435859.[MT7]-DQTVIVVK[MT7].2y7_1.heavy 595.373 / 930.61 8714.0 28.21660041809082 48 18 10 10 10 4.330951052382781 19.35946760549844 0.0 3 0.9880030294222939 11.256190380867176 8714.0 36.77467889908257 0.0 - - - - - - - 218.0 17 13 E2F3 E2F transcription factor 3 475 61 C20140716_OR021_01 C20140716_OR021_01 TB420094.[MT7]-EFVAGFVQFR.3y3_1.heavy 448.579 / 450.246 6796.0 43.322200775146484 47 17 10 10 10 5.986570917573227 16.704053351553206 0.0 3 0.9723929619962276 7.41051235128434 6796.0 30.06393214016077 0.0 - - - - - - - 230.2 13 5 ITLN2 intelectin 2 477 61 C20140716_OR021_01 C20140716_OR021_01 TB420094.[MT7]-EFVAGFVQFR.3b5_1.heavy 448.579 / 648.347 3456.0 43.322200775146484 47 17 10 10 10 5.986570917573227 16.704053351553206 0.0 3 0.9723929619962276 7.41051235128434 3456.0 14.811060869565218 1.0 - - - - - - - 211.0 6 6 ITLN2 intelectin 2 479 61 C20140716_OR021_01 C20140716_OR021_01 TB420094.[MT7]-EFVAGFVQFR.3y4_1.heavy 448.579 / 549.314 5414.0 43.322200775146484 47 17 10 10 10 5.986570917573227 16.704053351553206 0.0 3 0.9723929619962276 7.41051235128434 5414.0 13.983182847550054 1.0 - - - - - - - 230.2 15 5 ITLN2 intelectin 2 481 61 C20140716_OR021_01 C20140716_OR021_01 TB420094.[MT7]-EFVAGFVQFR.3b3_1.heavy 448.579 / 520.289 3110.0 43.322200775146484 47 17 10 10 10 5.986570917573227 16.704053351553206 0.0 3 0.9723929619962276 7.41051235128434 3110.0 40.56521739130435 0.0 - - - - - - - 230.33333333333334 6 3 ITLN2 intelectin 2 483 62 C20140716_OR021_01 C20140716_OR021_01 OPPA_ECOLI.LAIAASSLWK.2y7.peptide 530.31 / 762.41 236264.0 39.61750030517578 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 236264.0 271.9783255813954 0.0 - - - - - - - 322.6 472 5 485 62 C20140716_OR021_01 C20140716_OR021_01 OPPA_ECOLI.LAIAASSLWK.2y8.peptide 530.31 / 875.5 95602.0 39.61750030517578 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 95602.0 491.34981395348836 0.0 - - - - - - - 188.375 191 8 487 62 C20140716_OR021_01 C20140716_OR021_01 OPPA_ECOLI.LAIAASSLWK.2y6.peptide 530.31 / 691.38 149050.0 39.61750030517578 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 149050.0 585.5693620851033 0.0 - - - - - - - 251.16666666666666 298 6 489 63 C20140716_OR021_01 C20140716_OR021_01 TB420098.[MT7]-VQRGDENDIR.2b8_1.heavy 673.351 / 1058.5 36329.0 17.82415008544922 44 18 10 6 10 2.442034318413344 29.829914731884354 0.034099578857421875 3 0.9877495703004275 11.138901193643637 36329.0 555.877469879518 0.0 - - - - - - - 145.5 72 16 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 491 63 C20140716_OR021_01 C20140716_OR021_01 TB420098.[MT7]-VQRGDENDIR.2b8_2.heavy 673.351 / 529.753 1330.0 17.82415008544922 44 18 10 6 10 2.442034318413344 29.829914731884354 0.034099578857421875 3 0.9877495703004275 11.138901193643637 1330.0 13.780722891566267 0.0 - - - - - - - 148.57142857142858 2 14 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 493 63 C20140716_OR021_01 C20140716_OR021_01 TB420098.[MT7]-VQRGDENDIR.2y5_1.heavy 673.351 / 646.315 3741.0 17.82415008544922 44 18 10 6 10 2.442034318413344 29.829914731884354 0.034099578857421875 3 0.9877495703004275 11.138901193643637 3741.0 89.50068846815834 0.0 - - - - - - - 124.72727272727273 7 11 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 495 63 C20140716_OR021_01 C20140716_OR021_01 TB420098.[MT7]-VQRGDENDIR.2b5_1.heavy 673.351 / 700.386 2743.0 17.82415008544922 44 18 10 6 10 2.442034318413344 29.829914731884354 0.034099578857421875 3 0.9877495703004275 11.138901193643637 2743.0 28.00025500198994 0.0 - - - - - - - 130.0 5 8 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 497 64 C20140716_OR021_01 C20140716_OR021_01 TB420097.[MT7]-VQRGDENDIR.3y7_1.heavy 449.236 / 818.364 4640.0 17.84119987487793 48 18 10 10 10 4.784377875505963 20.90135909037592 0.0 3 0.9894372764717926 11.997517533907544 4640.0 72.38154569497502 0.0 - - - - - - - 70.3 9 10 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 499 64 C20140716_OR021_01 C20140716_OR021_01 TB420097.[MT7]-VQRGDENDIR.3y5_1.heavy 449.236 / 646.315 13670.0 17.84119987487793 48 18 10 10 10 4.784377875505963 20.90135909037592 0.0 3 0.9894372764717926 11.997517533907544 13670.0 104.67523427041499 0.0 - - - - - - - 181.77777777777777 27 18 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 501 64 C20140716_OR021_01 C20140716_OR021_01 TB420097.[MT7]-VQRGDENDIR.3b7_2.heavy 449.236 / 472.239 41134.0 17.84119987487793 48 18 10 10 10 4.784377875505963 20.90135909037592 0.0 3 0.9894372764717926 11.997517533907544 41134.0 176.43008187749024 0.0 - - - - - - - 236.71428571428572 82 21 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 503 64 C20140716_OR021_01 C20140716_OR021_01 TB420097.[MT7]-VQRGDENDIR.3b8_2.heavy 449.236 / 529.753 263790.0 17.84119987487793 48 18 10 10 10 4.784377875505963 20.90135909037592 0.0 3 0.9894372764717926 11.997517533907544 263790.0 738.9741312741313 0.0 - - - - - - - 309.0 527 13 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 505 65 C20140716_OR021_01 C20140716_OR021_01 TB420095.[MT7]-EFVAGFVQFR.2y8_1.heavy 672.365 / 923.51 17967.0 43.322200775146484 50 20 10 10 10 6.816830785699658 14.669573463636493 0.0 3 0.9910948406039849 13.068288246271521 17967.0 35.21591960258597 0.0 - - - - - - - 281.6666666666667 35 9 ITLN2 intelectin 2 507 65 C20140716_OR021_01 C20140716_OR021_01 TB420095.[MT7]-EFVAGFVQFR.2y9_1.heavy 672.365 / 1070.58 45839.0 43.322200775146484 50 20 10 10 10 6.816830785699658 14.669573463636493 0.0 3 0.9910948406039849 13.068288246271521 45839.0 270.52206944444447 0.0 - - - - - - - 279.85714285714283 91 7 ITLN2 intelectin 2 509 65 C20140716_OR021_01 C20140716_OR021_01 TB420095.[MT7]-EFVAGFVQFR.2y6_1.heavy 672.365 / 753.404 21077.0 43.322200775146484 50 20 10 10 10 6.816830785699658 14.669573463636493 0.0 3 0.9910948406039849 13.068288246271521 21077.0 19.550356465048523 1.0 - - - - - - - 197.28571428571428 51 7 ITLN2 intelectin 2 511 65 C20140716_OR021_01 C20140716_OR021_01 TB420095.[MT7]-EFVAGFVQFR.2y7_1.heavy 672.365 / 824.441 31442.0 43.322200775146484 50 20 10 10 10 6.816830785699658 14.669573463636493 0.0 3 0.9910948406039849 13.068288246271521 31442.0 280.74160088292524 0.0 - - - - - - - 230.25 62 12 ITLN2 intelectin 2 513 66 C20140716_OR021_01 C20140716_OR021_01 TB420099.[MT7]-LLTEDSENQR.3y6_1.heavy 450.232 / 748.322 2343.0 26.34589958190918 34 18 0 10 6 4.630989047592948 21.5936593613792 0.0 6 0.9812740806209156 9.004523643734002 2343.0 31.379464285714285 0.0 - - - - - - - 167.5 4 4 E2F3 E2F transcription factor 3 515 66 C20140716_OR021_01 C20140716_OR021_01 TB420099.[MT7]-LLTEDSENQR.3b4_1.heavy 450.232 / 601.368 4687.0 26.34589958190918 34 18 0 10 6 4.630989047592948 21.5936593613792 0.0 6 0.9812740806209156 9.004523643734002 4687.0 7.282589641434262 3.0 - - - - - - - 334.6363636363636 141 11 E2F3 E2F transcription factor 3 517 66 C20140716_OR021_01 C20140716_OR021_01 TB420099.[MT7]-LLTEDSENQR.3b5_1.heavy 450.232 / 716.395 4241.0 26.34589958190918 34 18 0 10 6 4.630989047592948 21.5936593613792 0.0 6 0.9812740806209156 9.004523643734002 4241.0 22.787462686567167 2.0 - - - - - - - 223.375 8 8 E2F3 E2F transcription factor 3 519 66 C20140716_OR021_01 C20140716_OR021_01 TB420099.[MT7]-LLTEDSENQR.3y5_1.heavy 450.232 / 633.295 5245.0 26.34589958190918 34 18 0 10 6 4.630989047592948 21.5936593613792 0.0 6 0.9812740806209156 9.004523643734002 5245.0 43.04192825112107 0.0 - - - - - - - 223.0 10 7 E2F3 E2F transcription factor 3 521 67 C20140716_OR021_01 C20140716_OR021_01 TB420293.[MT7]-LAYVTYQDIRK[MT7].3y10_2.heavy 553.322 / 700.886 12441.0 33.062275886535645 39 13 10 6 10 1.2333409308747778 54.34736054430286 0.039699554443359375 3 0.9155448163203399 4.216423456214538 12441.0 -2.0850837988826783 0.0 - - - - - - - 166.57142857142858 24 7 E2F3 E2F transcription factor 3 523 67 C20140716_OR021_01 C20140716_OR021_01 TB420293.[MT7]-LAYVTYQDIRK[MT7].3y7_1.heavy 553.322 / 1067.6 9308.0 33.062275886535645 39 13 10 6 10 1.2333409308747778 54.34736054430286 0.039699554443359375 3 0.9155448163203399 4.216423456214538 9308.0 0.0 0.0 - - - - - - - 313.5 18 2 E2F3 E2F transcription factor 3 525 67 C20140716_OR021_01 C20140716_OR021_01 TB420293.[MT7]-LAYVTYQDIRK[MT7].3y3_1.heavy 553.322 / 560.4 9219.0 33.062275886535645 39 13 10 6 10 1.2333409308747778 54.34736054430286 0.039699554443359375 3 0.9155448163203399 4.216423456214538 9219.0 -0.7210391061452519 0.0 - - - - - - - 239.0 18 9 E2F3 E2F transcription factor 3 527 67 C20140716_OR021_01 C20140716_OR021_01 TB420293.[MT7]-LAYVTYQDIRK[MT7].3b4_1.heavy 553.322 / 591.362 4207.0 33.062275886535645 39 13 10 6 10 1.2333409308747778 54.34736054430286 0.039699554443359375 3 0.9155448163203399 4.216423456214538 4207.0 -2.350279329608938 1.0 - - - - - - - 298.5 8 6 E2F3 E2F transcription factor 3 529 68 C20140716_OR021_01 C20140716_OR021_01 TB420191.[MT7]-AEVVGAVRQEK[MT7].3y10_2.heavy 491.959 / 629.865 7268.0 23.006924629211426 35 10 10 5 10 0.9919399278755591 61.716854424547805 0.040500640869140625 3 0.8367256512169712 3.011681229256828 7268.0 40.011184883149575 0.0 - - - - - - - 210.15384615384616 14 13 MRVI1 murine retrovirus integration site 1 homolog 531 68 C20140716_OR021_01 C20140716_OR021_01 TB420191.[MT7]-AEVVGAVRQEK[MT7].3y7_1.heavy 491.959 / 931.544 3044.0 23.006924629211426 35 10 10 5 10 0.9919399278755591 61.716854424547805 0.040500640869140625 3 0.8367256512169712 3.011681229256828 3044.0 58.916129032258056 0.0 - - - - - - - 116.375 6 8 MRVI1 murine retrovirus integration site 1 homolog 533 68 C20140716_OR021_01 C20140716_OR021_01 TB420191.[MT7]-AEVVGAVRQEK[MT7].3b5_1.heavy 491.959 / 600.347 5404.0 23.006924629211426 35 10 10 5 10 0.9919399278755591 61.716854424547805 0.040500640869140625 3 0.8367256512169712 3.011681229256828 5404.0 68.1310752688172 0.0 - - - - - - - 199.31578947368422 10 19 MRVI1 murine retrovirus integration site 1 homolog 535 68 C20140716_OR021_01 C20140716_OR021_01 TB420191.[MT7]-AEVVGAVRQEK[MT7].3y8_1.heavy 491.959 / 1030.61 62.0 23.006924629211426 35 10 10 5 10 0.9919399278755591 61.716854424547805 0.040500640869140625 3 0.8367256512169712 3.011681229256828 62.0 -0.0 0.0 - - - - - - - 0.0 0 0 MRVI1 murine retrovirus integration site 1 homolog 537 69 C20140716_OR021_01 C20140716_OR021_01 TB420196.[MT7]-EVTELSQEEK[MT7].2y5_1.heavy 740.393 / 764.391 12141.0 25.614299774169922 38 8 10 10 10 0.7409747370853187 78.19491619370578 0.0 3 0.7899060187661961 2.6438750305673744 12141.0 149.30686389511817 0.0 - - - - - - - 256.75 24 8 E2F3 E2F transcription factor 3 539 69 C20140716_OR021_01 C20140716_OR021_01 TB420196.[MT7]-EVTELSQEEK[MT7].2y9_1.heavy 740.393 / 1206.63 36608.0 25.614299774169922 38 8 10 10 10 0.7409747370853187 78.19491619370578 0.0 3 0.7899060187661961 2.6438750305673744 36608.0 87.90833738824126 1.0 - - - - - - - 261.6 78 5 E2F3 E2F transcription factor 3 541 69 C20140716_OR021_01 C20140716_OR021_01 TB420196.[MT7]-EVTELSQEEK[MT7].2b4_1.heavy 740.393 / 603.311 15316.0 25.614299774169922 38 8 10 10 10 0.7409747370853187 78.19491619370578 0.0 3 0.7899060187661961 2.6438750305673744 15316.0 212.3630451612903 0.0 - - - - - - - 242.7 30 10 E2F3 E2F transcription factor 3 543 69 C20140716_OR021_01 C20140716_OR021_01 TB420196.[MT7]-EVTELSQEEK[MT7].2y6_1.heavy 740.393 / 877.475 9712.0 25.614299774169922 38 8 10 10 10 0.7409747370853187 78.19491619370578 0.0 3 0.7899060187661961 2.6438750305673744 9712.0 50.5075935828877 0.0 - - - - - - - 242.9 19 10 E2F3 E2F transcription factor 3 545 70 C20140716_OR021_01 C20140716_OR021_01 TB420292.[MT7]-TRYDTSLGLLTK[MT7].4b8_1.heavy 414.745 / 1038.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F2;E2F3 E2F transcription factor 2;E2F transcription factor 3 547 70 C20140716_OR021_01 C20140716_OR021_01 TB420292.[MT7]-TRYDTSLGLLTK[MT7].4b8_2.heavy 414.745 / 519.771 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F2;E2F3 E2F transcription factor 2;E2F transcription factor 3 549 70 C20140716_OR021_01 C20140716_OR021_01 TB420292.[MT7]-TRYDTSLGLLTK[MT7].4b4_1.heavy 414.745 / 680.348 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F2;E2F3 E2F transcription factor 2;E2F transcription factor 3 551 70 C20140716_OR021_01 C20140716_OR021_01 TB420292.[MT7]-TRYDTSLGLLTK[MT7].4b6_1.heavy 414.745 / 868.428 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F2;E2F3 E2F transcription factor 2;E2F transcription factor 3 553 71 C20140716_OR021_01 C20140716_OR021_01 TB442498.[MT7]-SYQFYAESILNPDAFIAYPC[CAM]R.3b5_1.heavy 890.432 / 833.395 9724.0 51.3916015625 48 18 10 10 10 5.457171924842042 18.32450972357711 0.0 3 0.988524317910162 11.50951226793853 9724.0 53.321549457950425 0.0 - - - - - - - 164.91666666666666 19 24 PNLIPRP3 pancreatic lipase-related protein 3 555 71 C20140716_OR021_01 C20140716_OR021_01 TB442498.[MT7]-SYQFYAESILNPDAFIAYPC[CAM]R.3b3_1.heavy 890.432 / 523.263 8663.0 51.3916015625 48 18 10 10 10 5.457171924842042 18.32450972357711 0.0 3 0.988524317910162 11.50951226793853 8663.0 64.39312319501444 0.0 - - - - - - - 237.91666666666666 17 24 PNLIPRP3 pancreatic lipase-related protein 3 557 71 C20140716_OR021_01 C20140716_OR021_01 TB442498.[MT7]-SYQFYAESILNPDAFIAYPC[CAM]R.3y8_1.heavy 890.432 / 997.492 7343.0 51.3916015625 48 18 10 10 10 5.457171924842042 18.32450972357711 0.0 3 0.988524317910162 11.50951226793853 7343.0 51.62794421312752 0.0 - - - - - - - 215.125 14 24 PNLIPRP3 pancreatic lipase-related protein 3 559 71 C20140716_OR021_01 C20140716_OR021_01 TB442498.[MT7]-SYQFYAESILNPDAFIAYPC[CAM]R.3y10_1.heavy 890.432 / 1209.57 8290.0 51.3916015625 48 18 10 10 10 5.457171924842042 18.32450972357711 0.0 3 0.988524317910162 11.50951226793853 8290.0 31.232055409228366 0.0 - - - - - - - 247.59259259259258 16 27 PNLIPRP3 pancreatic lipase-related protein 3 561 72 C20140716_OR021_01 C20140716_OR021_01 TB435933.[MT7]-YMSINTHLGK[MT7].2y4_1.heavy 726.4 / 598.379 2119.0 30.778425216674805 43 20 10 3 10 25.091893510732156 3.9853508846284798 0.059101104736328125 3 0.9988056919922824 35.707624963233066 2119.0 1.3989686127985215 0.0 - - - - - - - 267.3529411764706 4 17 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 563 72 C20140716_OR021_01 C20140716_OR021_01 TB435933.[MT7]-YMSINTHLGK[MT7].2b3_1.heavy 726.4 / 526.245 2926.0 30.778425216674805 43 20 10 3 10 25.091893510732156 3.9853508846284798 0.059101104736328125 3 0.9988056919922824 35.707624963233066 2926.0 16.71179117911791 0.0 - - - - - - - 168.33333333333334 5 12 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 565 72 C20140716_OR021_01 C20140716_OR021_01 TB435933.[MT7]-YMSINTHLGK[MT7].2y9_1.heavy 726.4 / 1144.63 2522.0 30.778425216674805 43 20 10 3 10 25.091893510732156 3.9853508846284798 0.059101104736328125 3 0.9988056919922824 35.707624963233066 2522.0 27.966732673267327 1.0 - - - - - - - 242.4 5 15 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 567 72 C20140716_OR021_01 C20140716_OR021_01 TB435933.[MT7]-YMSINTHLGK[MT7].2b5_1.heavy 726.4 / 753.372 2321.0 30.778425216674805 43 20 10 3 10 25.091893510732156 3.9853508846284798 0.059101104736328125 3 0.9988056919922824 35.707624963233066 2321.0 6.287637513751376 0.0 - - - - - - - 235.66666666666666 4 9 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 569 73 C20140716_OR021_01 C20140716_OR021_01 TB436004.[MT7]-SISYYPESASFDLR.2b4_1.heavy 889.94 / 595.321 19864.0 38.86180114746094 44 14 10 10 10 7.084374560880569 14.115572114466271 0.0 3 0.9433497194370369 5.1604724384931755 19864.0 69.51368242853296 0.0 - - - - - - - 263.5 39 6 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 571 73 C20140716_OR021_01 C20140716_OR021_01 TB436004.[MT7]-SISYYPESASFDLR.2y9_1.heavy 889.94 / 1021.49 47488.0 38.86180114746094 44 14 10 10 10 7.084374560880569 14.115572114466271 0.0 3 0.9433497194370369 5.1604724384931755 47488.0 179.16483705898196 0.0 - - - - - - - 230.5 94 12 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 573 73 C20140716_OR021_01 C20140716_OR021_01 TB436004.[MT7]-SISYYPESASFDLR.2y10_1.heavy 889.94 / 1184.56 8551.0 38.86180114746094 44 14 10 10 10 7.084374560880569 14.115572114466271 0.0 3 0.9433497194370369 5.1604724384931755 8551.0 16.431824698276287 0.0 - - - - - - - 239.45454545454547 17 11 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 575 73 C20140716_OR021_01 C20140716_OR021_01 TB436004.[MT7]-SISYYPESASFDLR.2b5_1.heavy 889.94 / 758.384 13418.0 38.86180114746094 44 14 10 10 10 7.084374560880569 14.115572114466271 0.0 3 0.9433497194370369 5.1604724384931755 13418.0 50.96423923665884 0.0 - - - - - - - 285.25 26 12 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 577 74 C20140716_OR021_01 C20140716_OR021_01 TB442394.[MT7]-DLFDMRPFEDALK[MT7].3y7_1.heavy 628.997 / 963.527 56223.0 45.7578010559082 43 13 10 10 10 1.6858379195457622 48.56621381079596 0.0 3 0.9172037194067372 4.259061457559927 56223.0 203.0023422874309 0.0 - - - - - - - 205.76470588235293 112 17 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 579 74 C20140716_OR021_01 C20140716_OR021_01 TB442394.[MT7]-DLFDMRPFEDALK[MT7].3b4_1.heavy 628.997 / 635.316 172989.0 45.7578010559082 43 13 10 10 10 1.6858379195457622 48.56621381079596 0.0 3 0.9172037194067372 4.259061457559927 172989.0 434.12431596350314 0.0 - - - - - - - 274.4166666666667 345 12 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 581 74 C20140716_OR021_01 C20140716_OR021_01 TB442394.[MT7]-DLFDMRPFEDALK[MT7].3b3_1.heavy 628.997 / 520.289 30040.0 45.7578010559082 43 13 10 10 10 1.6858379195457622 48.56621381079596 0.0 3 0.9172037194067372 4.259061457559927 30040.0 113.58755872292863 0.0 - - - - - - - 322.4 60 15 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 583 74 C20140716_OR021_01 C20140716_OR021_01 TB442394.[MT7]-DLFDMRPFEDALK[MT7].3y9_2.heavy 628.997 / 625.838 294437.0 45.7578010559082 43 13 10 10 10 1.6858379195457622 48.56621381079596 0.0 3 0.9172037194067372 4.259061457559927 294437.0 1418.297235597009 0.0 - - - - - - - 200.0 588 9 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 585 75 C20140716_OR021_01 C20140716_OR021_01 TB436009.[MT7]-LPVTTEMVEC[CAM]SLER.2y8_1.heavy 904.456 / 1023.46 4754.0 41.562049865722656 35 13 10 6 6 2.297382797920881 43.527791750899965 0.03900146484375 6 0.9183744978383498 4.28992877660234 4754.0 15.667152359176885 0.0 - - - - - - - 234.35714285714286 9 14 ALOX5 arachidonate 5-lipoxygenase 587 75 C20140716_OR021_01 C20140716_OR021_01 TB436009.[MT7]-LPVTTEMVEC[CAM]SLER.2y5_1.heavy 904.456 / 664.308 1471.0 41.562049865722656 35 13 10 6 6 2.297382797920881 43.527791750899965 0.03900146484375 6 0.9183744978383498 4.28992877660234 1471.0 2.9225165562913906 0.0 - - - - - - - 236.54545454545453 2 11 ALOX5 arachidonate 5-lipoxygenase 589 75 C20140716_OR021_01 C20140716_OR021_01 TB436009.[MT7]-LPVTTEMVEC[CAM]SLER.2y9_1.heavy 904.456 / 1152.5 1245.0 41.562049865722656 35 13 10 6 6 2.297382797920881 43.527791750899965 0.03900146484375 6 0.9183744978383498 4.28992877660234 1245.0 4.711565417826972 5.0 - - - - - - - 217.6153846153846 9 13 ALOX5 arachidonate 5-lipoxygenase 591 75 C20140716_OR021_01 C20140716_OR021_01 TB436009.[MT7]-LPVTTEMVEC[CAM]SLER.2y7_1.heavy 904.456 / 892.419 906.0 41.562049865722656 35 13 10 6 6 2.297382797920881 43.527791750899965 0.03900146484375 6 0.9183744978383498 4.28992877660234 906.0 1.6035398230088498 10.0 - - - - - - - 240.375 5 8 ALOX5 arachidonate 5-lipoxygenase 593 76 C20140716_OR021_01 C20140716_OR021_01 TB435843.[MT7]-AGRLPLGK[MT7].2y4_1.heavy 550.363 / 558.373 N/A N/A - - - - - - - - - 0.0 - - - - - - - KAZ kazrin 595 76 C20140716_OR021_01 C20140716_OR021_01 TB435843.[MT7]-AGRLPLGK[MT7].2y5_1.heavy 550.363 / 671.457 N/A N/A - - - - - - - - - 0.0 - - - - - - - KAZ kazrin 597 76 C20140716_OR021_01 C20140716_OR021_01 TB435843.[MT7]-AGRLPLGK[MT7].2b4_1.heavy 550.363 / 542.353 N/A N/A - - - - - - - - - 0.0 - - - - - - - KAZ kazrin 599 76 C20140716_OR021_01 C20140716_OR021_01 TB435843.[MT7]-AGRLPLGK[MT7].2y6_1.heavy 550.363 / 827.558 N/A N/A - - - - - - - - - 0.0 - - - - - - - KAZ kazrin 601 77 C20140716_OR021_01 C20140716_OR021_01 TB442298.[MT7]-IMEPHRPNVK[MT7].3y7_1.heavy 503.625 / 991.592 1237.0 22.879100799560547 36 13 10 3 10 1.7435156181448341 37.40765046316029 0.07880020141601562 3 0.9166272031074381 4.244100038384016 1237.0 1.30015015015015 1.0 - - - - - - - 253.66666666666666 2 6 IDO2 indoleamine 2,3-dioxygenase 2 603 77 C20140716_OR021_01 C20140716_OR021_01 TB442298.[MT7]-IMEPHRPNVK[MT7].3b3_1.heavy 503.625 / 518.276 7707.0 22.879100799560547 36 13 10 3 10 1.7435156181448341 37.40765046316029 0.07880020141601562 3 0.9166272031074381 4.244100038384016 7707.0 24.689395223003785 0.0 - - - - - - - 285.27272727272725 15 11 IDO2 indoleamine 2,3-dioxygenase 2 605 77 C20140716_OR021_01 C20140716_OR021_01 TB442298.[MT7]-IMEPHRPNVK[MT7].3y4_1.heavy 503.625 / 601.379 10752.0 22.879100799560547 36 13 10 3 10 1.7435156181448341 37.40765046316029 0.07880020141601562 3 0.9166272031074381 4.244100038384016 10752.0 14.513464019631504 0.0 - - - - - - - 221.77777777777777 21 9 IDO2 indoleamine 2,3-dioxygenase 2 607 77 C20140716_OR021_01 C20140716_OR021_01 TB442298.[MT7]-IMEPHRPNVK[MT7].3y9_2.heavy 503.625 / 626.341 11227.0 22.879100799560547 36 13 10 3 10 1.7435156181448341 37.40765046316029 0.07880020141601562 3 0.9166272031074381 4.244100038384016 11227.0 4.064270144024912 1.0 - - - - - - - 273.375 22 8 IDO2 indoleamine 2,3-dioxygenase 2 609 78 C20140716_OR021_01 C20140716_OR021_01 TB442299.[MT7]-RAPVAPTEEQLR.3y7_1.heavy 504.287 / 872.447 11233.0 23.868499755859375 44 14 10 10 10 1.850989191827723 37.991349747632896 0.0 3 0.9308437922370504 4.665643875607019 11233.0 135.90543209876543 0.0 - - - - - - - 360.0 22 3 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 611 78 C20140716_OR021_01 C20140716_OR021_01 TB442299.[MT7]-RAPVAPTEEQLR.3y6_1.heavy 504.287 / 775.394 18578.0 23.868499755859375 44 14 10 10 10 1.850989191827723 37.991349747632896 0.0 3 0.9308437922370504 4.665643875607019 18578.0 83.55185185185185 0.0 - - - - - - - 252.0 37 3 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 613 78 C20140716_OR021_01 C20140716_OR021_01 TB442299.[MT7]-RAPVAPTEEQLR.3b5_1.heavy 504.287 / 639.406 30352.0 23.868499755859375 44 14 10 10 10 1.850989191827723 37.991349747632896 0.0 3 0.9308437922370504 4.665643875607019 30352.0 333.49728395061726 0.0 - - - - - - - 237.6 60 10 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 615 78 C20140716_OR021_01 C20140716_OR021_01 TB442299.[MT7]-RAPVAPTEEQLR.3y5_1.heavy 504.287 / 674.347 20307.0 23.868499755859375 44 14 10 10 10 1.850989191827723 37.991349747632896 0.0 3 0.9308437922370504 4.665643875607019 20307.0 91.82023148148147 0.0 - - - - - - - 231.42857142857142 40 7 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 617 79 C20140716_OR021_01 C20140716_OR021_01 EFTU1_ECO24.FESEVYILSK.2y8.peptide 607.82 / 938.52 925988.0 36.31489944458008 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 925988.0 706.5554024750638 0.0 - - - - - - - 3173.0 1851 1 619 79 C20140716_OR021_01 C20140716_OR021_01 EFTU1_ECO24.FESEVYILSK.2y6.peptide 607.82 / 722.44 183508.0 36.31489944458008 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 183508.0 19.440266436808365 1.0 - - - - - - - 414.0 378 2 621 79 C20140716_OR021_01 C20140716_OR021_01 EFTU1_ECO24.FESEVYILSK.2y5.peptide 607.82 / 623.38 294578.0 36.31489944458008 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 294578.0 276.18028576093235 0.0 - - - - - - - 828.0 589 3 623 80 C20140716_OR021_01 C20140716_OR021_01 TB419909.[MT7]-VTVVPK[MT7].2y4_1.heavy 465.815 / 586.404 9593.0 25.23069953918457 46 16 10 10 10 1.8795686417550872 38.140343663920824 0.0 3 0.9605632292768451 6.194039916887473 9593.0 34.32402522405987 0.0 - - - - - - - 263.5 19 10 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 625 80 C20140716_OR021_01 C20140716_OR021_01 TB419909.[MT7]-VTVVPK[MT7].2y5_1.heavy 465.815 / 687.452 26355.0 25.23069953918457 46 16 10 10 10 1.8795686417550872 38.140343663920824 0.0 3 0.9605632292768451 6.194039916887473 26355.0 140.5381284120223 0.0 - - - - - - - 284.6 52 10 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 627 80 C20140716_OR021_01 C20140716_OR021_01 TB419909.[MT7]-VTVVPK[MT7].2b4_1.heavy 465.815 / 543.362 29940.0 25.23069953918457 46 16 10 10 10 1.8795686417550872 38.140343663920824 0.0 3 0.9605632292768451 6.194039916887473 29940.0 67.27081347094305 0.0 - - - - - - - 284.6 59 10 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 629 80 C20140716_OR021_01 C20140716_OR021_01 TB419909.[MT7]-VTVVPK[MT7].2y3_1.heavy 465.815 / 487.336 25617.0 25.23069953918457 46 16 10 10 10 1.8795686417550872 38.140343663920824 0.0 3 0.9605632292768451 6.194039916887473 25617.0 59.928591280566636 1.0 - - - - - - - 316.4 60 10 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 631 81 C20140716_OR021_01 C20140716_OR021_01 TB442483.[MT7]-TASGPALAFWQAVLAGDVGC[CAM]VSR.3b6_1.heavy 826.429 / 629.338 2760.0 54.40019989013672 47 17 10 10 10 2.4980122348955556 31.993144966053634 0.0 3 0.9773671629605413 8.187858745186137 2760.0 23.538223140495866 0.0 - - - - - - - 127.3076923076923 5 13 ASB10 ankyrin repeat and SOCS box-containing 10 633 81 C20140716_OR021_01 C20140716_OR021_01 TB442483.[MT7]-TASGPALAFWQAVLAGDVGC[CAM]VSR.3y8_1.heavy 826.429 / 849.388 3519.0 54.40019989013672 47 17 10 10 10 2.4980122348955556 31.993144966053634 0.0 3 0.9773671629605413 8.187858745186137 3519.0 37.85607452119707 0.0 - - - - - - - 156.42857142857142 7 14 ASB10 ankyrin repeat and SOCS box-containing 10 635 81 C20140716_OR021_01 C20140716_OR021_01 TB442483.[MT7]-TASGPALAFWQAVLAGDVGC[CAM]VSR.3b8_1.heavy 826.429 / 813.459 3967.0 54.40019989013672 47 17 10 10 10 2.4980122348955556 31.993144966053634 0.0 3 0.9773671629605413 8.187858745186137 3967.0 36.8001644977975 0.0 - - - - - - - 179.5 7 12 ASB10 ankyrin repeat and SOCS box-containing 10 637 81 C20140716_OR021_01 C20140716_OR021_01 TB442483.[MT7]-TASGPALAFWQAVLAGDVGC[CAM]VSR.3b7_1.heavy 826.429 / 742.422 2173.0 54.40019989013672 47 17 10 10 10 2.4980122348955556 31.993144966053634 0.0 3 0.9773671629605413 8.187858745186137 2173.0 36.823380654976376 0.0 - - - - - - - 120.5 4 14 ASB10 ankyrin repeat and SOCS box-containing 10 639 82 C20140716_OR021_01 C20140716_OR021_01 TB435836.[MT7]-ITFYEDR.2b3_1.heavy 544.281 / 506.31 23112.0 32.60940170288086 50 20 10 10 10 4.020806282498014 18.54255527261497 0.0 3 0.996516376400944 20.903576621319047 23112.0 126.83728019158399 0.0 - - - - - - - 273.61538461538464 46 13 CRYGA;CRYGB;CRYGC crystallin, gamma A;crystallin, gamma B;crystallin, gamma C 641 82 C20140716_OR021_01 C20140716_OR021_01 TB435836.[MT7]-ITFYEDR.2y4_1.heavy 544.281 / 582.252 18766.0 32.60940170288086 50 20 10 10 10 4.020806282498014 18.54255527261497 0.0 3 0.996516376400944 20.903576621319047 18766.0 259.6911111111111 0.0 - - - - - - - 234.875 37 8 CRYGA;CRYGB;CRYGC crystallin, gamma A;crystallin, gamma B;crystallin, gamma C 643 82 C20140716_OR021_01 C20140716_OR021_01 TB435836.[MT7]-ITFYEDR.2y5_1.heavy 544.281 / 729.32 22223.0 32.60940170288086 50 20 10 10 10 4.020806282498014 18.54255527261497 0.0 3 0.996516376400944 20.903576621319047 22223.0 75.73381326445664 0.0 - - - - - - - 258.38461538461536 44 13 CRYGA;CRYGB;CRYGC crystallin, gamma A;crystallin, gamma B;crystallin, gamma C 645 82 C20140716_OR021_01 C20140716_OR021_01 TB435836.[MT7]-ITFYEDR.2y6_1.heavy 544.281 / 830.368 103806.0 32.60940170288086 50 20 10 10 10 4.020806282498014 18.54255527261497 0.0 3 0.996516376400944 20.903576621319047 103806.0 341.1304722102528 0.0 - - - - - - - 230.33333333333334 207 3 CRYGA;CRYGB;CRYGC crystallin, gamma A;crystallin, gamma B;crystallin, gamma C 647 83 C20140716_OR021_01 C20140716_OR021_01 TB442480.[MT7]-K[MT7]FIQLLSQSPDGVLDLNK[MT7].3y3_1.heavy 816.479 / 518.342 14424.0 43.91320037841797 41 11 10 10 10 0.9261686759061372 62.88227089841166 0.0 3 0.8780036941333939 3.4968067124520608 14424.0 43.36898769604478 0.0 - - - - - - - 203.11111111111111 28 9 E2F3 E2F transcription factor 3 649 83 C20140716_OR021_01 C20140716_OR021_01 TB442480.[MT7]-K[MT7]FIQLLSQSPDGVLDLNK[MT7].3b4_1.heavy 816.479 / 805.517 9920.0 43.91320037841797 41 11 10 10 10 0.9261686759061372 62.88227089841166 0.0 3 0.8780036941333939 3.4968067124520608 9920.0 44.117515494194244 0.0 - - - - - - - 270.42857142857144 19 7 E2F3 E2F transcription factor 3 651 83 C20140716_OR021_01 C20140716_OR021_01 TB442480.[MT7]-K[MT7]FIQLLSQSPDGVLDLNK[MT7].3b5_1.heavy 816.479 / 918.602 6331.0 43.91320037841797 41 11 10 10 10 0.9261686759061372 62.88227089841166 0.0 3 0.8780036941333939 3.4968067124520608 6331.0 37.441440465756855 0.0 - - - - - - - 176.4 12 10 E2F3 E2F transcription factor 3 653 83 C20140716_OR021_01 C20140716_OR021_01 TB442480.[MT7]-K[MT7]FIQLLSQSPDGVLDLNK[MT7].3y5_1.heavy 816.479 / 746.453 14032.0 43.91320037841797 41 11 10 10 10 0.9261686759061372 62.88227089841166 0.0 3 0.8780036941333939 3.4968067124520608 14032.0 128.25322324349588 0.0 - - - - - - - 163.33333333333334 28 6 E2F3 E2F transcription factor 3 655 84 C20140716_OR021_01 C20140716_OR021_01 TB419931.[MT7]-TTLGWK[MT7].2y4_1.heavy 497.302 / 647.4 14306.0 30.235374927520752 40 20 4 6 10 8.443614191411788 11.843269686778502 0.03389930725097656 3 0.9953013843370851 17.997294091859093 14306.0 185.6739394153368 0.0 - - - - - - - 178.33333333333334 28 12 YPEL4;YPEL1;YPEL2;YPEL3 yippee-like 4 (Drosophila);yippee-like 1 (Drosophila);yippee-like 2 (Drosophila);yippee-like 3 (Drosophila) 657 84 C20140716_OR021_01 C20140716_OR021_01 TB419931.[MT7]-TTLGWK[MT7].2y5_1.heavy 497.302 / 748.447 17420.0 30.235374927520752 40 20 4 6 10 8.443614191411788 11.843269686778502 0.03389930725097656 3 0.9953013843370851 17.997294091859093 17420.0 258.55092783505154 0.0 - - - - - - - 176.9090909090909 34 11 YPEL4;YPEL1;YPEL2;YPEL3 yippee-like 4 (Drosophila);yippee-like 1 (Drosophila);yippee-like 2 (Drosophila);yippee-like 3 (Drosophila) 659 84 C20140716_OR021_01 C20140716_OR021_01 TB419931.[MT7]-TTLGWK[MT7].2b4_1.heavy 497.302 / 517.31 7591.0 30.235374927520752 40 20 4 6 10 8.443614191411788 11.843269686778502 0.03389930725097656 3 0.9953013843370851 17.997294091859093 7591.0 39.16591665891545 2.0 - - - - - - - 834.1428571428571 147 7 YPEL4;YPEL1;YPEL2;YPEL3 yippee-like 4 (Drosophila);yippee-like 1 (Drosophila);yippee-like 2 (Drosophila);yippee-like 3 (Drosophila) 661 84 C20140716_OR021_01 C20140716_OR021_01 TB419931.[MT7]-TTLGWK[MT7].2y3_1.heavy 497.302 / 534.316 43015.0 30.235374927520752 40 20 4 6 10 8.443614191411788 11.843269686778502 0.03389930725097656 3 0.9953013843370851 17.997294091859093 43015.0 282.44093350181646 0.0 - - - - - - - 269.05882352941177 86 17 YPEL4;YPEL1;YPEL2;YPEL3 yippee-like 4 (Drosophila);yippee-like 1 (Drosophila);yippee-like 2 (Drosophila);yippee-like 3 (Drosophila) 663 85 C20140716_OR021_01 C20140716_OR021_01 TB442486.[MT7]-NLGLPPILVHSDLVLTNWTK[MT7].3y3_1.heavy 840.159 / 578.342 3485.0 50.46497631072998 46 20 10 6 10 10.015066095475804 9.984956569100817 0.030300140380859375 3 0.998273397466737 29.696391171213104 3485.0 7.528841870824053 1.0 - - - - - - - 274.6666666666667 6 21 IDO2 indoleamine 2,3-dioxygenase 2 665 85 C20140716_OR021_01 C20140716_OR021_01 TB442486.[MT7]-NLGLPPILVHSDLVLTNWTK[MT7].3y6_1.heavy 840.159 / 906.516 7038.0 50.46497631072998 46 20 10 6 10 10.015066095475804 9.984956569100817 0.030300140380859375 3 0.998273397466737 29.696391171213104 7038.0 29.126666666666665 0.0 - - - - - - - 239.7058823529412 14 17 IDO2 indoleamine 2,3-dioxygenase 2 667 85 C20140716_OR021_01 C20140716_OR021_01 TB442486.[MT7]-NLGLPPILVHSDLVLTNWTK[MT7].3b4_1.heavy 840.159 / 542.342 23875.0 50.46497631072998 46 20 10 6 10 10.015066095475804 9.984956569100817 0.030300140380859375 3 0.998273397466737 29.696391171213104 23875.0 50.80113900900043 0.0 - - - - - - - 1289.75 47 8 IDO2 indoleamine 2,3-dioxygenase 2 669 85 C20140716_OR021_01 C20140716_OR021_01 TB442486.[MT7]-NLGLPPILVHSDLVLTNWTK[MT7].3y5_1.heavy 840.159 / 793.432 5106.0 50.46497631072998 46 20 10 6 10 10.015066095475804 9.984956569100817 0.030300140380859375 3 0.998273397466737 29.696391171213104 5106.0 23.21537874226917 0.0 - - - - - - - 211.11111111111111 10 18 IDO2 indoleamine 2,3-dioxygenase 2 671 86 C20140716_OR021_01 C20140716_OR021_01 TB442485.[MT7]-NLGLPPILVHSDLVLTNWTK[MT7].4y4_1.heavy 630.371 / 692.385 13516.0 50.48012638092041 46 20 10 6 10 8.968427190326945 11.150227110931642 0.030300140380859375 3 0.9916056092902333 13.460571782887108 13516.0 46.13197582864364 0.0 - - - - - - - 238.28571428571428 27 14 IDO2 indoleamine 2,3-dioxygenase 2 673 86 C20140716_OR021_01 C20140716_OR021_01 TB442485.[MT7]-NLGLPPILVHSDLVLTNWTK[MT7].4b7_1.heavy 630.371 / 849.531 5142.0 50.48012638092041 46 20 10 6 10 8.968427190326945 11.150227110931642 0.030300140380859375 3 0.9916056092902333 13.460571782887108 5142.0 73.46578533611422 0.0 - - - - - - - 670.1428571428571 10 7 IDO2 indoleamine 2,3-dioxygenase 2 675 86 C20140716_OR021_01 C20140716_OR021_01 TB442485.[MT7]-NLGLPPILVHSDLVLTNWTK[MT7].4b4_1.heavy 630.371 / 542.342 70184.0 50.48012638092041 46 20 10 6 10 8.968427190326945 11.150227110931642 0.030300140380859375 3 0.9916056092902333 13.460571782887108 70184.0 90.55505139793378 0.0 - - - - - - - 744.5714285714286 140 7 IDO2 indoleamine 2,3-dioxygenase 2 677 86 C20140716_OR021_01 C20140716_OR021_01 TB442485.[MT7]-NLGLPPILVHSDLVLTNWTK[MT7].4y3_1.heavy 630.371 / 578.342 25920.0 50.48012638092041 46 20 10 6 10 8.968427190326945 11.150227110931642 0.030300140380859375 3 0.9916056092902333 13.460571782887108 25920.0 38.0331382304973 0.0 - - - - - - - 334.25 51 8 IDO2 indoleamine 2,3-dioxygenase 2 679 87 C20140716_OR021_01 C20140716_OR021_01 TB435903.[MT7]-LLTEDSENQR.2y8_1.heavy 674.845 / 978.412 37746.0 26.34589958190918 50 20 10 10 10 3.7499569073875305 21.23453930834895 0.0 3 0.9908041389440257 12.859758048564947 37746.0 217.74462075681268 0.0 - - - - - - - 172.0 75 4 E2F3 E2F transcription factor 3 681 87 C20140716_OR021_01 C20140716_OR021_01 TB435903.[MT7]-LLTEDSENQR.2y5_1.heavy 674.845 / 633.295 30174.0 26.34589958190918 50 20 10 10 10 3.7499569073875305 21.23453930834895 0.0 3 0.9908041389440257 12.859758048564947 30174.0 83.76793604651161 0.0 - - - - - - - 252.2 60 5 E2F3 E2F transcription factor 3 683 87 C20140716_OR021_01 C20140716_OR021_01 TB435903.[MT7]-LLTEDSENQR.2y9_1.heavy 674.845 / 1091.5 46006.0 26.34589958190918 50 20 10 10 10 3.7499569073875305 21.23453930834895 0.0 3 0.9908041389440257 12.859758048564947 46006.0 49.86088326569586 0.0 - - - - - - - 191.0 92 3 E2F3 E2F transcription factor 3 685 87 C20140716_OR021_01 C20140716_OR021_01 TB435903.[MT7]-LLTEDSENQR.2y6_1.heavy 674.845 / 748.322 13309.0 26.34589958190918 50 20 10 10 10 3.7499569073875305 21.23453930834895 0.0 3 0.9908041389440257 12.859758048564947 13309.0 25.720663468898444 0.0 - - - - - - - 229.4 26 10 E2F3 E2F transcription factor 3 687 88 C20140716_OR021_01 C20140716_OR021_01 TB435839.[MT7]-INIAGWK[MT7].2y4_1.heavy 545.337 / 605.353 24727.0 36.97800064086914 50 20 10 10 10 18.030388794062002 5.546192106125481 0.0 3 0.9991004469825346 41.14493931642755 24727.0 222.18463768115942 0.0 - - - - - - - 248.4 49 5 PNLIPRP3 pancreatic lipase-related protein 3 689 88 C20140716_OR021_01 C20140716_OR021_01 TB435839.[MT7]-INIAGWK[MT7].2y5_1.heavy 545.337 / 718.437 4559.0 36.97800064086914 50 20 10 10 10 18.030388794062002 5.546192106125481 0.0 3 0.9991004469825346 41.14493931642755 4559.0 40.52444444444445 0.0 - - - - - - - 216.85714285714286 9 7 PNLIPRP3 pancreatic lipase-related protein 3 691 88 C20140716_OR021_01 C20140716_OR021_01 TB435839.[MT7]-INIAGWK[MT7].2y3_1.heavy 545.337 / 534.316 17129.0 36.97800064086914 50 20 10 10 10 18.030388794062002 5.546192106125481 0.0 3 0.9991004469825346 41.14493931642755 17129.0 147.2928502415459 0.0 - - - - - - - 256.2857142857143 34 7 PNLIPRP3 pancreatic lipase-related protein 3 693 88 C20140716_OR021_01 C20140716_OR021_01 TB435839.[MT7]-INIAGWK[MT7].2y6_1.heavy 545.337 / 832.48 12985.0 36.97800064086914 50 20 10 10 10 18.030388794062002 5.546192106125481 0.0 3 0.9991004469825346 41.14493931642755 12985.0 133.14329710144926 0.0 - - - - - - - 241.5 25 4 PNLIPRP3 pancreatic lipase-related protein 3 695 89 C20140716_OR021_01 C20140716_OR021_01 TB419932.[MT7]-ARMEEEAYSK[MT7].3b6_1.heavy 501.257 / 890.416 4068.0 21.468000411987305 43 13 10 10 10 1.5718634041721375 50.32043207633177 0.0 3 0.9274709481938075 4.554553813428545 4068.0 67.27846153846154 0.0 - - - - - - - 152.30769230769232 8 13 MRVI1 murine retrovirus integration site 1 homolog 697 89 C20140716_OR021_01 C20140716_OR021_01 TB419932.[MT7]-ARMEEEAYSK[MT7].3y3_1.heavy 501.257 / 541.31 14341.0 21.468000411987305 43 13 10 10 10 1.5718634041721375 50.32043207633177 0.0 3 0.9274709481938075 4.554553813428545 14341.0 62.18531973325449 0.0 - - - - - - - 245.76190476190476 28 21 MRVI1 murine retrovirus integration site 1 homolog 699 89 C20140716_OR021_01 C20140716_OR021_01 TB419932.[MT7]-ARMEEEAYSK[MT7].3b5_1.heavy 501.257 / 761.373 2399.0 21.468000411987305 43 13 10 10 10 1.5718634041721375 50.32043207633177 0.0 3 0.9274709481938075 4.554553813428545 2399.0 43.135865384615386 0.0 - - - - - - - 192.46153846153845 4 13 MRVI1 murine retrovirus integration site 1 homolog 701 89 C20140716_OR021_01 C20140716_OR021_01 TB419932.[MT7]-ARMEEEAYSK[MT7].3y4_1.heavy 501.257 / 612.347 6727.0 21.468000411987305 43 13 10 10 10 1.5718634041721375 50.32043207633177 0.0 3 0.9274709481938075 4.554553813428545 6727.0 25.799580372895907 0.0 - - - - - - - 165.0 13 18 MRVI1 murine retrovirus integration site 1 homolog 703 90 C20140716_OR021_01 C20140716_OR021_01 TB436016.[MT7]-GQGEPLDDRHPLC[CAM]AR.4y4_1.heavy 466.986 / 519.271 29211.0 23.239500045776367 44 14 10 10 10 3.1918804397535725 31.32949428635881 0.0 3 0.9354524193503134 4.831235233503095 29211.0 77.20275080906148 1.0 - - - - - - - 240.55555555555554 58 9 ASB10 ankyrin repeat and SOCS box-containing 10 705 90 C20140716_OR021_01 C20140716_OR021_01 TB436016.[MT7]-GQGEPLDDRHPLC[CAM]AR.4y5_1.heavy 466.986 / 616.323 43430.0 23.239500045776367 44 14 10 10 10 3.1918804397535725 31.32949428635881 0.0 3 0.9354524193503134 4.831235233503095 43430.0 124.64271472142676 0.0 - - - - - - - 208.8 86 10 ASB10 ankyrin repeat and SOCS box-containing 10 707 90 C20140716_OR021_01 C20140716_OR021_01 TB436016.[MT7]-GQGEPLDDRHPLC[CAM]AR.4b4_1.heavy 466.986 / 516.253 93196.0 23.239500045776367 44 14 10 10 10 3.1918804397535725 31.32949428635881 0.0 3 0.9354524193503134 4.831235233503095 93196.0 193.2723956642029 0.0 - - - - - - - 309.2 186 10 ASB10 ankyrin repeat and SOCS box-containing 10 709 90 C20140716_OR021_01 C20140716_OR021_01 TB436016.[MT7]-GQGEPLDDRHPLC[CAM]AR.4y6_1.heavy 466.986 / 753.383 9814.0 23.239500045776367 44 14 10 10 10 3.1918804397535725 31.32949428635881 0.0 3 0.9354524193503134 4.831235233503095 9814.0 98.0144593993326 0.0 - - - - - - - 231.8181818181818 19 11 ASB10 ankyrin repeat and SOCS box-containing 10 711 91 C20140716_OR021_01 C20140716_OR021_01 TB436017.[MT7]-GQGEPLDDRHPLC[CAM]AR.2y6_1.heavy 932.964 / 753.383 471.0 23.259699821472168 34 9 10 5 10 0.6544447188779252 80.14699579868154 0.04039955139160156 3 0.8181413610958221 2.8489352660230227 471.0 11.231538461538461 0.0 - - - - - - - 0.0 0 0 ASB10 ankyrin repeat and SOCS box-containing 10 713 91 C20140716_OR021_01 C20140716_OR021_01 TB436017.[MT7]-GQGEPLDDRHPLC[CAM]AR.2y8_1.heavy 932.964 / 1024.51 1099.0 23.259699821472168 34 9 10 5 10 0.6544447188779252 80.14699579868154 0.04039955139160156 3 0.8181413610958221 2.8489352660230227 1099.0 13.02 0.0 - - - - - - - 170.0 2 6 ASB10 ankyrin repeat and SOCS box-containing 10 715 91 C20140716_OR021_01 C20140716_OR021_01 TB436017.[MT7]-GQGEPLDDRHPLC[CAM]AR.2y5_1.heavy 932.964 / 616.323 78.0 23.259699821472168 34 9 10 5 10 0.6544447188779252 80.14699579868154 0.04039955139160156 3 0.8181413610958221 2.8489352660230227 78.0 0.232269955278493 9.0 - - - - - - - 0.0 0 0 ASB10 ankyrin repeat and SOCS box-containing 10 717 91 C20140716_OR021_01 C20140716_OR021_01 TB436017.[MT7]-GQGEPLDDRHPLC[CAM]AR.2b4_1.heavy 932.964 / 516.253 942.0 23.259699821472168 34 9 10 5 10 0.6544447188779252 80.14699579868154 0.04039955139160156 3 0.8181413610958221 2.8489352660230227 942.0 5.381106382978723 0.0 - - - - - - - 0.0 1 0 ASB10 ankyrin repeat and SOCS box-containing 10 719 92 C20140716_OR021_01 C20140716_OR021_01 TB436018.[MT7]-EAAVQSGAGDYLLGIK[MT7].2b3_1.heavy 940.522 / 416.226 14301.0 38.998199462890625 41 11 10 10 10 1.0953916937063053 60.099059293582876 0.0 3 0.8675670251074319 3.3531314861106596 14301.0 132.66302325581395 0.0 - - - - - - - 215.0 28 3 FGF4 fibroblast growth factor 4 721 92 C20140716_OR021_01 C20140716_OR021_01 TB436018.[MT7]-EAAVQSGAGDYLLGIK[MT7].2y4_1.heavy 940.522 / 574.404 5926.0 38.998199462890625 41 11 10 10 10 1.0953916937063053 60.099059293582876 0.0 3 0.8675670251074319 3.3531314861106596 5926.0 20.68065289614329 1.0 - - - - - - - 232.2 11 5 FGF4 fibroblast growth factor 4 723 92 C20140716_OR021_01 C20140716_OR021_01 TB436018.[MT7]-EAAVQSGAGDYLLGIK[MT7].2b4_1.heavy 940.522 / 515.295 14945.0 38.998199462890625 41 11 10 10 10 1.0953916937063053 60.099059293582876 0.0 3 0.8675670251074319 3.3531314861106596 14945.0 89.20658914728682 0.0 - - - - - - - 232.2 29 10 FGF4 fibroblast growth factor 4 725 92 C20140716_OR021_01 C20140716_OR021_01 TB436018.[MT7]-EAAVQSGAGDYLLGIK[MT7].2y6_1.heavy 940.522 / 850.552 3865.0 38.998199462890625 41 11 10 10 10 1.0953916937063053 60.099059293582876 0.0 3 0.8675670251074319 3.3531314861106596 3865.0 41.046899224806204 0.0 - - - - - - - 180.6 7 10 FGF4 fibroblast growth factor 4 727 93 C20140716_OR021_01 C20140716_OR021_01 TB436019.[MT7]-DLFDMRPFEDALK[MT7].4b8_2.heavy 472 / 583.793 3116.0 45.776201248168945 42 16 10 6 10 2.712183442768214 29.661862634014184 0.036800384521484375 3 0.967710995647945 6.8495097019992865 3116.0 29.861666666666665 0.0 - - - - - - - 197.6 6 5 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 729 93 C20140716_OR021_01 C20140716_OR021_01 TB436019.[MT7]-DLFDMRPFEDALK[MT7].4b4_1.heavy 472 / 635.316 5472.0 45.776201248168945 42 16 10 6 10 2.712183442768214 29.661862634014184 0.036800384521484375 3 0.967710995647945 6.8495097019992865 5472.0 104.03999999999999 0.0 - - - - - - - 152.0 10 7 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 731 93 C20140716_OR021_01 C20140716_OR021_01 TB436019.[MT7]-DLFDMRPFEDALK[MT7].4b3_1.heavy 472 / 520.289 2052.0 45.776201248168945 42 16 10 6 10 2.712183442768214 29.661862634014184 0.036800384521484375 3 0.967710995647945 6.8495097019992865 2052.0 16.2 0.0 - - - - - - - 195.42857142857142 4 7 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 733 93 C20140716_OR021_01 C20140716_OR021_01 TB436019.[MT7]-DLFDMRPFEDALK[MT7].4b10_2.heavy 472 / 705.828 7296.0 45.776201248168945 42 16 10 6 10 2.712183442768214 29.661862634014184 0.036800384521484375 3 0.967710995647945 6.8495097019992865 7296.0 117.6 0.0 - - - - - - - 171.0 14 4 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 735 94 C20140716_OR021_01 C20140716_OR021_01 TB420170.[MT7]-WITGDVEVVLR.2y8_1.heavy 715.91 / 886.499 13496.0 44.229698181152344 46 16 10 10 10 2.7247999028433862 36.699942588682525 0.0 3 0.9687588453007144 6.964046202591864 13496.0 41.35314404851627 0.0 - - - - - - - 237.125 26 8 ALOX5 arachidonate 5-lipoxygenase 737 94 C20140716_OR021_01 C20140716_OR021_01 TB420170.[MT7]-WITGDVEVVLR.2y9_1.heavy 715.91 / 987.547 39708.0 44.229698181152344 46 16 10 10 10 2.7247999028433862 36.699942588682525 0.0 3 0.9687588453007144 6.964046202591864 39708.0 354.4691581275267 0.0 - - - - - - - 223.5 79 2 ALOX5 arachidonate 5-lipoxygenase 739 94 C20140716_OR021_01 C20140716_OR021_01 TB420170.[MT7]-WITGDVEVVLR.2y6_1.heavy 715.91 / 714.451 17066.0 44.229698181152344 46 16 10 10 10 2.7247999028433862 36.699942588682525 0.0 3 0.9687588453007144 6.964046202591864 17066.0 46.246157006960985 0.0 - - - - - - - 306.75 34 8 ALOX5 arachidonate 5-lipoxygenase 741 94 C20140716_OR021_01 C20140716_OR021_01 TB420170.[MT7]-WITGDVEVVLR.2y10_1.heavy 715.91 / 1100.63 37477.0 44.229698181152344 46 16 10 10 10 2.7247999028433862 36.699942588682525 0.0 3 0.9687588453007144 6.964046202591864 37477.0 95.15206511662961 0.0 - - - - - - - 357.0 74 5 ALOX5 arachidonate 5-lipoxygenase 743 95 C20140716_OR021_01 C20140716_OR021_01 TB442283.[MT7]-EVTELSQEEK[MT7].3y3_1.heavy 493.931 / 549.3 33417.0 25.614299774169922 48 18 10 10 10 3.199893191624586 31.251043085356855 0.0 3 0.9810255061189831 8.94516093053871 33417.0 173.77490558079168 0.0 - - - - - - - 316.0 66 8 E2F3 E2F transcription factor 3 745 95 C20140716_OR021_01 C20140716_OR021_01 TB442283.[MT7]-EVTELSQEEK[MT7].3b4_1.heavy 493.931 / 603.311 55236.0 25.614299774169922 48 18 10 10 10 3.199893191624586 31.251043085356855 0.0 3 0.9810255061189831 8.94516093053871 55236.0 182.86245709894987 0.0 - - - - - - - 210.66666666666666 110 6 E2F3 E2F transcription factor 3 747 95 C20140716_OR021_01 C20140716_OR021_01 TB442283.[MT7]-EVTELSQEEK[MT7].3b5_1.heavy 493.931 / 716.395 8498.0 25.614299774169922 48 18 10 10 10 3.199893191624586 31.251043085356855 0.0 3 0.9810255061189831 8.94516093053871 8498.0 59.116521739130434 1.0 - - - - - - - 229.83333333333334 16 6 E2F3 E2F transcription factor 3 749 95 C20140716_OR021_01 C20140716_OR021_01 TB442283.[MT7]-EVTELSQEEK[MT7].3y5_1.heavy 493.931 / 764.391 2297.0 25.614299774169922 48 18 10 10 10 3.199893191624586 31.251043085356855 0.0 3 0.9810255061189831 8.94516093053871 2297.0 12.317246376811594 1.0 - - - - - - - 230.0 9 7 E2F3 E2F transcription factor 3 751 96 C20140716_OR021_01 C20140716_OR021_01 SUCC_ECO24.LVQQFTK.2y4.peptide 432.25 / 523.29 63215.0 23.614900588989258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 63215.0 274.7573124955931 0.0 - - - - - - - 200.3 126 10 753 96 C20140716_OR021_01 C20140716_OR021_01 SUCC_ECO24.LVQQFTK.2y6.peptide 432.25 / 750.41 75637.0 23.614900588989258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 75637.0 538.7565714285714 0.0 - - - - - - - 155.55555555555554 151 9 755 96 C20140716_OR021_01 C20140716_OR021_01 SUCC_ECO24.LVQQFTK.2y5.peptide 432.25 / 651.35 350837.0 23.614900588989258 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 350837.0 957.5190967248805 0.0 - - - - - - - 220.4 701 10 757 97 C20140716_OR021_01 C20140716_OR021_01 TB435831.[MT7]-ALASVLGK[MT7].2y5_1.heavy 523.844 / 647.421 24129.0 34.369300842285156 50 20 10 10 10 5.2752360892717585 18.95649754963003 0.0 3 0.9911322078403401 13.095833889724213 24129.0 221.79376800000003 0.0 - - - - - - - 125.0 48 3 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 759 97 C20140716_OR021_01 C20140716_OR021_01 TB435831.[MT7]-ALASVLGK[MT7].2y3_1.heavy 523.844 / 461.32 40007.0 34.369300842285156 50 20 10 10 10 5.2752360892717585 18.95649754963003 0.0 3 0.9911322078403401 13.095833889724213 40007.0 175.49737333333331 0.0 - - - - - - - 208.33333333333334 80 6 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 761 97 C20140716_OR021_01 C20140716_OR021_01 TB435831.[MT7]-ALASVLGK[MT7].2y6_1.heavy 523.844 / 718.458 16753.0 34.369300842285156 50 20 10 10 10 5.2752360892717585 18.95649754963003 0.0 3 0.9911322078403401 13.095833889724213 16753.0 169.31698666666665 0.0 - - - - - - - 250.0 33 8 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 763 97 C20140716_OR021_01 C20140716_OR021_01 TB435831.[MT7]-ALASVLGK[MT7].2y7_1.heavy 523.844 / 831.542 10752.0 34.369300842285156 50 20 10 10 10 5.2752360892717585 18.95649754963003 0.0 3 0.9911322078403401 13.095833889724213 10752.0 52.756479999999996 0.0 - - - - - - - 281.25 21 8 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 765 98 C20140716_OR021_01 C20140716_OR021_01 TB435825.[MT7]-VTHFLPR.2y4_1.heavy 507.304 / 532.324 5321.0 28.384249687194824 43 17 10 6 10 3.159898568621031 31.646585429367015 0.038600921630859375 3 0.9709765385665693 7.226562084544638 5321.0 25.908523178807947 0.0 - - - - - - - 226.33333333333334 10 12 FGF4 fibroblast growth factor 4 767 98 C20140716_OR021_01 C20140716_OR021_01 TB435825.[MT7]-VTHFLPR.2y5_1.heavy 507.304 / 669.383 4642.0 28.384249687194824 43 17 10 6 10 3.159898568621031 31.646585429367015 0.038600921630859375 3 0.9709765385665693 7.226562084544638 4642.0 0.9645714285714286 0.0 - - - - - - - 271.8 9 10 FGF4 fibroblast growth factor 4 769 98 C20140716_OR021_01 C20140716_OR021_01 TB435825.[MT7]-VTHFLPR.2b4_1.heavy 507.304 / 629.353 1698.0 28.384249687194824 43 17 10 6 10 3.159898568621031 31.646585429367015 0.038600921630859375 3 0.9709765385665693 7.226562084544638 1698.0 4.594588235294118 3.0 - - - - - - - 249.0 5 5 FGF4 fibroblast growth factor 4 771 98 C20140716_OR021_01 C20140716_OR021_01 TB435825.[MT7]-VTHFLPR.2y6_1.heavy 507.304 / 770.431 8151.0 28.384249687194824 43 17 10 6 10 3.159898568621031 31.646585429367015 0.038600921630859375 3 0.9709765385665693 7.226562084544638 8151.0 24.1638205326502 0.0 - - - - - - - 226.33333333333334 16 6 FGF4 fibroblast growth factor 4 773 99 C20140716_OR021_01 C20140716_OR021_01 TB442472.[MT7]-DSVTNPGQYVLTGMHAGQPK[MT7].4y4_1.heavy 597.811 / 573.348 4972.0 35.119998931884766 48 18 10 10 10 2.812238637510091 27.838916419174197 0.0 3 0.9867794349056431 10.721553775305724 4972.0 7.009165460684998 1.0 - - - - - - - 631.1428571428571 9 7 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 775 99 C20140716_OR021_01 C20140716_OR021_01 TB442472.[MT7]-DSVTNPGQYVLTGMHAGQPK[MT7].4y5_1.heavy 597.811 / 644.385 7458.0 35.119998931884766 48 18 10 10 10 2.812238637510091 27.838916419174197 0.0 3 0.9867794349056431 10.721553775305724 7458.0 44.17479677355892 0.0 - - - - - - - 299.0 14 6 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 777 99 C20140716_OR021_01 C20140716_OR021_01 TB442472.[MT7]-DSVTNPGQYVLTGMHAGQPK[MT7].4y10_2.heavy 597.811 / 592.322 8011.0 35.119998931884766 48 18 10 10 10 2.812238637510091 27.838916419174197 0.0 3 0.9867794349056431 10.721553775305724 8011.0 16.48442655895455 0.0 - - - - - - - 725.125 16 8 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 779 99 C20140716_OR021_01 C20140716_OR021_01 TB442472.[MT7]-DSVTNPGQYVLTGMHAGQPK[MT7].4b5_1.heavy 597.811 / 661.327 14226.0 35.119998931884766 48 18 10 10 10 2.812238637510091 27.838916419174197 0.0 3 0.9867794349056431 10.721553775305724 14226.0 84.61721014492753 0.0 - - - - - - - 262.2 28 10 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 781 100 C20140716_OR021_01 C20140716_OR021_01 TB435829.[MT7]-IGGAHADTR.2y8_1.heavy 521.281 / 784.37 4306.0 16.127399444580078 44 14 10 10 10 2.586425872795318 29.178207794066463 0.0 3 0.946822789796472 5.327899265076195 4306.0 83.75642714570857 0.0 - - - - - - - 110.18181818181819 8 11 FGF4 fibroblast growth factor 4 783 100 C20140716_OR021_01 C20140716_OR021_01 TB435829.[MT7]-IGGAHADTR.2y5_1.heavy 521.281 / 599.29 1212.0 16.127399444580078 44 14 10 10 10 2.586425872795318 29.178207794066463 0.0 3 0.946822789796472 5.327899265076195 1212.0 25.97142857142857 0.0 - - - - - - - 150.7 2 10 FGF4 fibroblast growth factor 4 785 100 C20140716_OR021_01 C20140716_OR021_01 TB435829.[MT7]-IGGAHADTR.2b7_1.heavy 521.281 / 766.396 7274.0 16.127399444580078 44 14 10 10 10 2.586425872795318 29.178207794066463 0.0 3 0.946822789796472 5.327899265076195 7274.0 237.2709523809524 0.0 - - - - - - - 88.0 14 10 FGF4 fibroblast growth factor 4 787 100 C20140716_OR021_01 C20140716_OR021_01 TB435829.[MT7]-IGGAHADTR.2b5_1.heavy 521.281 / 580.332 1463.0 16.127399444580078 44 14 10 10 10 2.586425872795318 29.178207794066463 0.0 3 0.946822789796472 5.327899265076195 1463.0 7.123066104078762 0.0 - - - - - - - 135.91666666666666 2 12 FGF4 fibroblast growth factor 4 789 101 C20140716_OR021_01 C20140716_OR021_01 TB435827.[MT7]-ADGDFLVR.2y4_1.heavy 518.781 / 534.34 8817.0 32.02755165100098 40 18 8 6 8 5.587775577728465 17.896209074425975 0.033100128173828125 4 0.988350612965853 11.423214290464863 8817.0 16.064727496159755 1.0 - - - - - - - 738.625 20 8 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 791 101 C20140716_OR021_01 C20140716_OR021_01 TB435827.[MT7]-ADGDFLVR.2b4_1.heavy 518.781 / 503.222 10949.0 32.02755165100098 40 18 8 6 8 5.587775577728465 17.896209074425975 0.033100128173828125 4 0.988350612965853 11.423214290464863 10949.0 16.499780952316563 0.0 - - - - - - - 273.22727272727275 21 22 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 793 101 C20140716_OR021_01 C20140716_OR021_01 TB435827.[MT7]-ADGDFLVR.2y6_1.heavy 518.781 / 706.388 6976.0 32.02755165100098 40 18 8 6 8 5.587775577728465 17.896209074425975 0.033100128173828125 4 0.988350612965853 11.423214290464863 6976.0 11.132557270767991 1.0 - - - - - - - 726.5 13 8 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 795 101 C20140716_OR021_01 C20140716_OR021_01 TB435827.[MT7]-ADGDFLVR.2b5_1.heavy 518.781 / 650.29 5135.0 32.02755165100098 40 18 8 6 8 5.587775577728465 17.896209074425975 0.033100128173828125 4 0.988350612965853 11.423214290464863 5135.0 10.497067921478695 3.0 - - - - - - - 226.2 30 15 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 797 102 C20140716_OR021_01 C20140716_OR021_01 TB419920.[MT7]-WSTC[CAM]PR.2b3_1.heavy 475.735 / 519.268 2022.0 23.65559959411621 46 20 10 10 6 5.901647661499249 16.94442056450996 0.0 5 0.9989043161219804 37.28035780679226 2022.0 9.553339817900595 3.0 - - - - - - - 198.5 16 12 ASB10 ankyrin repeat and SOCS box-containing 10 799 102 C20140716_OR021_01 C20140716_OR021_01 TB419920.[MT7]-WSTC[CAM]PR.2y4_1.heavy 475.735 / 533.25 2311.0 23.65559959411621 46 20 10 10 6 5.901647661499249 16.94442056450996 0.0 5 0.9989043161219804 37.28035780679226 2311.0 1.9495783328223324 2.0 - - - - - - - 668.125 5 8 ASB10 ankyrin repeat and SOCS box-containing 10 801 102 C20140716_OR021_01 C20140716_OR021_01 TB419920.[MT7]-WSTC[CAM]PR.2y5_1.heavy 475.735 / 620.282 22678.0 23.65559959411621 46 20 10 10 6 5.901647661499249 16.94442056450996 0.0 5 0.9989043161219804 37.28035780679226 22678.0 391.14614951356884 0.0 - - - - - - - 207.5 45 16 ASB10 ankyrin repeat and SOCS box-containing 10 803 102 C20140716_OR021_01 C20140716_OR021_01 TB419920.[MT7]-WSTC[CAM]PR.2b4_1.heavy 475.735 / 679.299 1661.0 23.65559959411621 46 20 10 10 6 5.901647661499249 16.94442056450996 0.0 5 0.9989043161219804 37.28035780679226 1661.0 14.696405529953918 0.0 - - - - - - - 168.44444444444446 3 9 ASB10 ankyrin repeat and SOCS box-containing 10 805 103 C20140716_OR021_01 C20140716_OR021_01 TB435826.[MT7]-SGPGPIVTR.2y8_1.heavy 514.304 / 796.468 22844.0 22.80120086669922 48 18 10 10 10 8.918915413198395 11.212125619222483 0.0 3 0.9849729466364233 10.054954361552465 22844.0 197.06087912087912 0.0 - - - - - - - 170.625 45 8 ASB10 ankyrin repeat and SOCS box-containing 10 807 103 C20140716_OR021_01 C20140716_OR021_01 TB435826.[MT7]-SGPGPIVTR.2y5_1.heavy 514.304 / 585.372 6189.0 22.80120086669922 48 18 10 10 10 8.918915413198395 11.212125619222483 0.0 3 0.9849729466364233 10.054954361552465 6189.0 68.01098901098901 0.0 - - - - - - - 242.66666666666666 12 12 ASB10 ankyrin repeat and SOCS box-containing 10 809 103 C20140716_OR021_01 C20140716_OR021_01 TB435826.[MT7]-SGPGPIVTR.2y6_1.heavy 514.304 / 642.393 4733.0 22.80120086669922 48 18 10 10 10 8.918915413198395 11.212125619222483 0.0 3 0.9849729466364233 10.054954361552465 4733.0 16.194330669330668 0.0 - - - - - - - 283.1111111111111 9 9 ASB10 ankyrin repeat and SOCS box-containing 10 811 103 C20140716_OR021_01 C20140716_OR021_01 TB435826.[MT7]-SGPGPIVTR.2y7_1.heavy 514.304 / 739.446 10921.0 22.80120086669922 48 18 10 10 10 8.918915413198395 11.212125619222483 0.0 3 0.9849729466364233 10.054954361552465 10921.0 152.0139194139194 0.0 - - - - - - - 121.33333333333333 21 6 ASB10 ankyrin repeat and SOCS box-containing 10 813 104 C20140716_OR021_01 C20140716_OR021_01 TB436026.[MT7]-GAPAK[MT7]EEDIELDAK[MT7].4b8_2.heavy 480.268 / 543.787 19984.0 27.254475116729736 42 17 10 5 10 5.402378475522853 18.510365472001073 0.04590034484863281 3 0.9758654947122685 7.928039800110618 19984.0 125.64156786965995 0.0 - - - - - - - 249.0 39 6 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 815 104 C20140716_OR021_01 C20140716_OR021_01 TB436026.[MT7]-GAPAK[MT7]EEDIELDAK[MT7].4b7_2.heavy 480.268 / 486.274 3216.0 27.254475116729736 42 17 10 5 10 5.402378475522853 18.510365472001073 0.04590034484863281 3 0.9758654947122685 7.928039800110618 3216.0 34.95652173913044 0.0 - - - - - - - 229.8 6 10 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 817 104 C20140716_OR021_01 C20140716_OR021_01 TB436026.[MT7]-GAPAK[MT7]EEDIELDAK[MT7].4b13_2.heavy 480.268 / 814.424 1034.0 27.254475116729736 42 17 10 5 10 5.402378475522853 18.510365472001073 0.04590034484863281 3 0.9758654947122685 7.928039800110618 1034.0 12.722695652173913 1.0 - - - - - - - 282.09090909090907 2 11 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 819 104 C20140716_OR021_01 C20140716_OR021_01 TB436026.[MT7]-GAPAK[MT7]EEDIELDAK[MT7].4y3_1.heavy 480.268 / 477.279 10222.0 27.254475116729736 42 17 10 5 10 5.402378475522853 18.510365472001073 0.04590034484863281 3 0.9758654947122685 7.928039800110618 10222.0 38.998599394332686 0.0 - - - - - - - 258.5833333333333 20 12 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 821 105 C20140716_OR021_01 C20140716_OR021_01 TB442271.[MT7]-MLRADGDFLVR.3y6_1.heavy 479.598 / 706.388 5108.0 35.70109939575195 44 14 10 10 10 1.2766000100285007 49.71554975543589 0.0 3 0.9494685439402843 5.466828968143427 5108.0 15.628341384863122 0.0 - - - - - - - 236.57142857142858 10 7 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 823 105 C20140716_OR021_01 C20140716_OR021_01 TB442271.[MT7]-MLRADGDFLVR.3y4_1.heavy 479.598 / 534.34 4970.0 35.70109939575195 44 14 10 10 10 1.2766000100285007 49.71554975543589 0.0 3 0.9494685439402843 5.466828968143427 4970.0 60.504347826086956 0.0 - - - - - - - 220.8 9 5 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 825 105 C20140716_OR021_01 C20140716_OR021_01 TB442271.[MT7]-MLRADGDFLVR.3b8_1.heavy 479.598 / 1050.52 N/A 35.70109939575195 44 14 10 10 10 1.2766000100285007 49.71554975543589 0.0 3 0.9494685439402843 5.466828968143427 0.0 -0.0 0.0 - - - - - - - 0.0 0 0 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 827 105 C20140716_OR021_01 C20140716_OR021_01 TB442271.[MT7]-MLRADGDFLVR.3b7_1.heavy 479.598 / 903.448 1933.0 35.70109939575195 44 14 10 10 10 1.2766000100285007 49.71554975543589 0.0 3 0.9494685439402843 5.466828968143427 1933.0 13.727101449275361 0.0 - - - - - - - 207.0 3 4 LOC100291393;SHC2 SHC-transforming protein 2-like;SHC (Src homology 2 domain containing) transforming protein 2 829 106 C20140716_OR021_01 C20140716_OR021_01 TB420183.[MT7]-NLEAIVSVIAER.3y6_1.heavy 486.62 / 674.383 8019.0 48.95472526550293 46 20 10 6 10 8.758211962879036 11.417855656364772 0.03929901123046875 3 0.9947350154630586 17.000946058643166 8019.0 152.4196728577459 0.0 - - - - - - - 176.42857142857142 16 7 ALOX5 arachidonate 5-lipoxygenase 831 106 C20140716_OR021_01 C20140716_OR021_01 TB420183.[MT7]-NLEAIVSVIAER.3b4_1.heavy 486.62 / 572.316 13707.0 48.95472526550293 46 20 10 6 10 8.758211962879036 11.417855656364772 0.03929901123046875 3 0.9947350154630586 17.000946058643166 13707.0 -7.946086956521754 0.0 - - - - - - - 164.8 27 5 ALOX5 arachidonate 5-lipoxygenase 833 106 C20140716_OR021_01 C20140716_OR021_01 TB420183.[MT7]-NLEAIVSVIAER.3b5_1.heavy 486.62 / 685.4 3221.0 48.95472526550293 46 20 10 6 10 8.758211962879036 11.417855656364772 0.03929901123046875 3 0.9947350154630586 17.000946058643166 3221.0 0.0 0.0 - - - - - - - 274.25 6 4 ALOX5 arachidonate 5-lipoxygenase 835 106 C20140716_OR021_01 C20140716_OR021_01 TB420183.[MT7]-NLEAIVSVIAER.3b3_1.heavy 486.62 / 501.279 5826.0 48.95472526550293 46 20 10 6 10 8.758211962879036 11.417855656364772 0.03929901123046875 3 0.9947350154630586 17.000946058643166 5826.0 0.0 0.0 - - - - - - - 388.3333333333333 11 3 ALOX5 arachidonate 5-lipoxygenase 837 107 C20140716_OR021_01 C20140716_OR021_01 TNAA_ECO24.GLTFTYEPK.2y7.peptide 528.27 / 885.44 98090.0 33.537498474121094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 98090.0 455.661167575754 0.0 - - - - - - - 238.85714285714286 196 7 839 107 C20140716_OR021_01 C20140716_OR021_01 TNAA_ECO24.GLTFTYEPK.2y6.peptide 528.27 / 784.39 98870.0 33.537498474121094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 98870.0 455.89982545490153 0.0 - - - - - - - 208.875 197 8 841 107 C20140716_OR021_01 C20140716_OR021_01 TNAA_ECO24.GLTFTYEPK.2y5.peptide 528.27 / 637.32 204428.0 33.537498474121094 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 204428.0 1056.0558024220618 0.0 - - - - - - - 278.42857142857144 408 14 843 108 C20140716_OR021_01 C20140716_OR021_01 TB420184.[MT7]-NLEAIVSVIAER.2b3_1.heavy 729.426 / 501.279 37969.0 48.94490051269531 45 15 10 10 10 8.296822686920622 12.052806691607765 0.0 3 0.9506854371476635 5.5344397446679725 37969.0 57.75537501763276 0.0 - - - - - - - 1194.5714285714287 75 7 ALOX5 arachidonate 5-lipoxygenase 845 108 C20140716_OR021_01 C20140716_OR021_01 TB420184.[MT7]-NLEAIVSVIAER.2y9_1.heavy 729.426 / 957.573 44411.0 48.94490051269531 45 15 10 10 10 8.296822686920622 12.052806691607765 0.0 3 0.9506854371476635 5.5344397446679725 44411.0 106.19957016724042 0.0 - - - - - - - 205.85714285714286 88 14 ALOX5 arachidonate 5-lipoxygenase 847 108 C20140716_OR021_01 C20140716_OR021_01 TB420184.[MT7]-NLEAIVSVIAER.2b4_1.heavy 729.426 / 572.316 37832.0 48.94490051269531 45 15 10 10 10 8.296822686920622 12.052806691607765 0.0 3 0.9506854371476635 5.5344397446679725 37832.0 98.13451094091903 0.0 - - - - - - - 289.44444444444446 75 9 ALOX5 arachidonate 5-lipoxygenase 849 108 C20140716_OR021_01 C20140716_OR021_01 TB420184.[MT7]-NLEAIVSVIAER.2y11_1.heavy 729.426 / 1199.7 11171.0 48.94490051269531 45 15 10 10 10 8.296822686920622 12.052806691607765 0.0 3 0.9506854371476635 5.5344397446679725 11171.0 44.8470802919708 0.0 - - - - - - - 265.06666666666666 22 15 ALOX5 arachidonate 5-lipoxygenase 851 109 C20140716_OR021_01 C20140716_OR021_01 TB435962.[MT7]-NQAVPVQC[CAM]QLK[MT7].2y4_1.heavy 786.942 / 692.388 4700.0 26.185850143432617 41 16 10 5 10 2.583792704294653 38.7027952489319 0.0457000732421875 3 0.9620432537799141 6.314435344679593 4700.0 25.94563953488372 0.0 - - - - - - - 344.0 9 4 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 853 109 C20140716_OR021_01 C20140716_OR021_01 TB435962.[MT7]-NQAVPVQC[CAM]QLK[MT7].2y5_1.heavy 786.942 / 820.447 2980.0 26.185850143432617 41 16 10 5 10 2.583792704294653 38.7027952489319 0.0457000732421875 3 0.9620432537799141 6.314435344679593 2980.0 37.10657300170875 0.0 - - - - - - - 191.16666666666666 5 6 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 855 109 C20140716_OR021_01 C20140716_OR021_01 TB435962.[MT7]-NQAVPVQC[CAM]QLK[MT7].2b4_1.heavy 786.942 / 557.316 69006.0 26.185850143432617 41 16 10 5 10 2.583792704294653 38.7027952489319 0.0457000732421875 3 0.9620432537799141 6.314435344679593 69006.0 865.3590848680462 0.0 - - - - - - - 229.33333333333334 138 9 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 857 109 C20140716_OR021_01 C20140716_OR021_01 TB435962.[MT7]-NQAVPVQC[CAM]QLK[MT7].2y7_1.heavy 786.942 / 1016.57 90213.0 26.185850143432617 41 16 10 5 10 2.583792704294653 38.7027952489319 0.0457000732421875 3 0.9620432537799141 6.314435344679593 90213.0 532.4874971078443 0.0 - - - - - - - 229.33333333333334 180 12 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 859 110 C20140716_OR021_01 C20140716_OR021_01 TB442466.[MT7]-RDDLEALGHMFMY[MT7]FLR.4b8_1.heavy 576.298 / 1014.53 3509.0 51.71764945983887 44 17 10 7 10 2.1299525296020785 31.843539074278702 0.026897430419921875 3 0.9758429494041911 7.924324372246314 3509.0 149.67844416027282 0.0 - - - - - - - 85.875 7 8 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 861 110 C20140716_OR021_01 C20140716_OR021_01 TB442466.[MT7]-RDDLEALGHMFMY[MT7]FLR.4b5_1.heavy 576.298 / 773.391 3027.0 51.71764945983887 44 17 10 7 10 2.1299525296020785 31.843539074278702 0.026897430419921875 3 0.9758429494041911 7.924324372246314 3027.0 46.629514563106795 0.0 - - - - - - - 103.08333333333333 6 12 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 863 110 C20140716_OR021_01 C20140716_OR021_01 TB442466.[MT7]-RDDLEALGHMFMY[MT7]FLR.4b6_1.heavy 576.298 / 844.428 2442.0 51.71764945983887 44 17 10 7 10 2.1299525296020785 31.843539074278702 0.026897430419921875 3 0.9758429494041911 7.924324372246314 2442.0 43.38699029126214 0.0 - - - - - - - 134.66666666666666 4 12 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 865 110 C20140716_OR021_01 C20140716_OR021_01 TB442466.[MT7]-RDDLEALGHMFMY[MT7]FLR.4b3_1.heavy 576.298 / 531.264 3130.0 51.71764945983887 44 17 10 7 10 2.1299525296020785 31.843539074278702 0.026897430419921875 3 0.9758429494041911 7.924324372246314 3130.0 22.679571482459448 0.0 - - - - - - - 149.0 6 24 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 867 111 C20140716_OR021_01 C20140716_OR021_01 TB420009.[MT7]-EEEEEQK[MT7].2b3_1.heavy 604.798 / 532.237 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRVI1 murine retrovirus integration site 1 homolog 869 111 C20140716_OR021_01 C20140716_OR021_01 TB420009.[MT7]-EEEEEQK[MT7].2y5_1.heavy 604.798 / 806.401 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRVI1 murine retrovirus integration site 1 homolog 871 111 C20140716_OR021_01 C20140716_OR021_01 TB420009.[MT7]-EEEEEQK[MT7].2y3_1.heavy 604.798 / 548.316 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRVI1 murine retrovirus integration site 1 homolog 873 111 C20140716_OR021_01 C20140716_OR021_01 TB420009.[MT7]-EEEEEQK[MT7].2y6_1.heavy 604.798 / 935.444 N/A N/A - - - - - - - - - 0.0 - - - - - - - MRVI1 murine retrovirus integration site 1 homolog 875 112 C20140716_OR021_01 C20140716_OR021_01 TB442469.[MT7]-RGEYPDYQQWMGLSDSIR.3b6_1.heavy 782.375 / 862.417 25792.0 40.948123931884766 38 12 10 6 10 0.8162331511716849 64.3521395356125 0.038299560546875 3 0.8855915629951899 3.613292092278628 25792.0 38.3348762878807 0.0 - - - - - - - 236.92857142857142 51 14 CRYGB;CRYGC crystallin, gamma B;crystallin, gamma C 877 112 C20140716_OR021_01 C20140716_OR021_01 TB442469.[MT7]-RGEYPDYQQWMGLSDSIR.3b4_1.heavy 782.375 / 650.338 15732.0 40.948123931884766 38 12 10 6 10 0.8162331511716849 64.3521395356125 0.038299560546875 3 0.8855915629951899 3.613292092278628 15732.0 50.908457943925235 0.0 - - - - - - - 311.27272727272725 31 11 CRYGB;CRYGC crystallin, gamma B;crystallin, gamma C 879 112 C20140716_OR021_01 C20140716_OR021_01 TB442469.[MT7]-RGEYPDYQQWMGLSDSIR.3y8_1.heavy 782.375 / 878.44 27397.0 40.948123931884766 38 12 10 6 10 0.8162331511716849 64.3521395356125 0.038299560546875 3 0.8855915629951899 3.613292092278628 27397.0 325.17934579439253 0.0 - - - - - - - 261.55555555555554 54 9 CRYGB;CRYGC crystallin, gamma B;crystallin, gamma C 881 112 C20140716_OR021_01 C20140716_OR021_01 TB442469.[MT7]-RGEYPDYQQWMGLSDSIR.3y9_1.heavy 782.375 / 1064.52 31571.0 40.948123931884766 38 12 10 6 10 0.8162331511716849 64.3521395356125 0.038299560546875 3 0.8855915629951899 3.613292092278628 31571.0 187.36060747663552 0.0 - - - - - - - 334.375 63 8 CRYGB;CRYGC crystallin, gamma B;crystallin, gamma C 883 113 C20140716_OR021_01 C20140716_OR021_01 TB420388.[MT7]-HMPGC[CAM]EDLITPLLK[MT7].3y3_1.heavy 638.014 / 517.383 21074.0 39.929901123046875 50 20 10 10 10 6.134084140373113 16.302352186828234 0.0 3 0.9942913916372182 16.326399792309367 21074.0 -0.9737161716171627 0.0 - - - - - - - 275.5 42 4 PNLIPRP3 pancreatic lipase-related protein 3 885 113 C20140716_OR021_01 C20140716_OR021_01 TB420388.[MT7]-HMPGC[CAM]EDLITPLLK[MT7].3y4_1.heavy 638.014 / 614.436 77960.0 39.929901123046875 50 20 10 10 10 6.134084140373113 16.302352186828234 0.0 3 0.9942913916372182 16.326399792309367 77960.0 175.36321917483662 1.0 - - - - - - - 275.25 165 4 PNLIPRP3 pancreatic lipase-related protein 3 887 113 C20140716_OR021_01 C20140716_OR021_01 TB420388.[MT7]-HMPGC[CAM]EDLITPLLK[MT7].3y5_1.heavy 638.014 / 715.483 31542.0 39.929901123046875 50 20 10 10 10 6.134084140373113 16.302352186828234 0.0 3 0.9942913916372182 16.326399792309367 31542.0 -3.204557329462993 0.0 - - - - - - - 229.66666666666666 63 3 PNLIPRP3 pancreatic lipase-related protein 3 889 113 C20140716_OR021_01 C20140716_OR021_01 TB420388.[MT7]-HMPGC[CAM]EDLITPLLK[MT7].3b7_1.heavy 638.014 / 971.383 32782.0 39.929901123046875 50 20 10 10 10 6.134084140373113 16.302352186828234 0.0 3 0.9942913916372182 16.326399792309367 32782.0 -4.164682395644284 0.0 - - - - - - - 302.8 65 5 PNLIPRP3 pancreatic lipase-related protein 3 891 114 C20140716_OR021_01 C20140716_OR021_01 CH10_ECO24.SAGGIVLTGSAAAK.2y7.peptide 601.84 / 605.33 252445.0 27.6072998046875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 252445.0 211.219871019831 0.0 - - - - - - - 1802.0 504 1 893 114 C20140716_OR021_01 C20140716_OR021_01 CH10_ECO24.SAGGIVLTGSAAAK.2y8.peptide 601.84 / 718.41 271571.0 27.6072998046875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 271571.0 825.673923313777 0.0 - - - - - - - 2203.0 543 1 895 114 C20140716_OR021_01 C20140716_OR021_01 CH10_ECO24.SAGGIVLTGSAAAK.2y9.peptide 601.84 / 817.48 382222.0 27.6072998046875 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 382222.0 414.72558818531223 0.0 - - - - - - - 3738.3333333333335 764 3 897 115 C20140716_OR021_01 C20140716_OR021_01 TB442131.[MT7]-ARPDSAPGGR.2y8_1.heavy 564.306 / 756.364 748.0 14.380599975585938 40 12 10 10 8 1.359712961346033 63.25573814834627 0.0 4 0.89834384228535 3.8374781135499916 748.0 14.384615384615385 0.0 - - - - - - - 0.0 1 0 ASB10 ankyrin repeat and SOCS box-containing 10 899 115 C20140716_OR021_01 C20140716_OR021_01 TB442131.[MT7]-ARPDSAPGGR.2b4_1.heavy 564.306 / 584.327 1398.0 14.380599975585938 40 12 10 10 8 1.359712961346033 63.25573814834627 0.0 4 0.89834384228535 3.8374781135499916 1398.0 47.72825602968461 0.0 - - - - - - - 107.14285714285714 2 7 ASB10 ankyrin repeat and SOCS box-containing 10 901 115 C20140716_OR021_01 C20140716_OR021_01 TB442131.[MT7]-ARPDSAPGGR.2b6_1.heavy 564.306 / 742.396 163.0 14.380599975585938 40 12 10 10 8 1.359712961346033 63.25573814834627 0.0 4 0.89834384228535 3.8374781135499916 163.0 4.488769230769231 5.0 - - - - - - - 0.0 0 0 ASB10 ankyrin repeat and SOCS box-containing 10 903 115 C20140716_OR021_01 C20140716_OR021_01 TB442131.[MT7]-ARPDSAPGGR.2y6_1.heavy 564.306 / 544.284 N/A 14.380599975585938 40 12 10 10 8 1.359712961346033 63.25573814834627 0.0 4 0.89834384228535 3.8374781135499916 1723.0 7.018227106227107 0.0 - - - - - - - 212.28571428571428 3 21 ASB10 ankyrin repeat and SOCS box-containing 10 905 116 C20140716_OR021_01 C20140716_OR021_01 TB420280.[MT7]-LSGSEVTQGTVFLR.2y8_1.heavy 819.453 / 921.515 7453.0 37.53559875488281 50 20 10 10 10 6.720204283794195 14.880500023064846 0.0 3 0.9938326615174545 15.706883454944 7453.0 21.7500416752932 0.0 - - - - - - - 212.75 14 8 PNLIPRP3 pancreatic lipase-related protein 3 907 116 C20140716_OR021_01 C20140716_OR021_01 TB420280.[MT7]-LSGSEVTQGTVFLR.2y9_1.heavy 819.453 / 1020.58 7061.0 37.53559875488281 50 20 10 10 10 6.720204283794195 14.880500023064846 0.0 3 0.9938326615174545 15.706883454944 7061.0 13.169832972983501 0.0 - - - - - - - 677.6363636363636 14 11 PNLIPRP3 pancreatic lipase-related protein 3 909 116 C20140716_OR021_01 C20140716_OR021_01 TB420280.[MT7]-LSGSEVTQGTVFLR.2b6_1.heavy 819.453 / 717.39 5361.0 37.53559875488281 50 20 10 10 10 6.720204283794195 14.880500023064846 0.0 3 0.9938326615174545 15.706883454944 5361.0 12.518698979591838 1.0 - - - - - - - 278.0 10 8 PNLIPRP3 pancreatic lipase-related protein 3 911 116 C20140716_OR021_01 C20140716_OR021_01 TB420280.[MT7]-LSGSEVTQGTVFLR.2b5_1.heavy 819.453 / 618.321 9022.0 37.53559875488281 50 20 10 10 10 6.720204283794195 14.880500023064846 0.0 3 0.9938326615174545 15.706883454944 9022.0 27.53637768386696 0.0 - - - - - - - 635.2857142857143 18 7 PNLIPRP3 pancreatic lipase-related protein 3 913 117 C20140716_OR021_01 C20140716_OR021_01 TB435969.[MT7]-NLYTNEYVAIK[MT7].2y4_1.heavy 808.45 / 574.404 4931.0 34.66939926147461 44 14 10 10 10 1.650869964735462 43.74711352756856 0.0 3 0.94661315294114 5.317333559848557 4931.0 18.403732251521298 0.0 - - - - - - - 308.2857142857143 9 14 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 915 117 C20140716_OR021_01 C20140716_OR021_01 TB435969.[MT7]-NLYTNEYVAIK[MT7].2b3_1.heavy 808.45 / 535.3 11587.0 34.66939926147461 44 14 10 10 10 1.650869964735462 43.74711352756856 0.0 3 0.94661315294114 5.317333559848557 11587.0 90.96029554655871 0.0 - - - - - - - 233.0 23 9 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 917 117 C20140716_OR021_01 C20140716_OR021_01 TB435969.[MT7]-NLYTNEYVAIK[MT7].2y8_1.heavy 808.45 / 1081.6 12696.0 34.66939926147461 44 14 10 10 10 1.650869964735462 43.74711352756856 0.0 3 0.94661315294114 5.317333559848557 12696.0 38.992859946551846 0.0 - - - - - - - 334.57142857142856 25 7 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 919 117 C20140716_OR021_01 C20140716_OR021_01 TB435969.[MT7]-NLYTNEYVAIK[MT7].2b6_1.heavy 808.45 / 879.433 9368.0 34.66939926147461 44 14 10 10 10 1.650869964735462 43.74711352756856 0.0 3 0.94661315294114 5.317333559848557 9368.0 114.08972713208914 0.0 - - - - - - - 246.75 18 4 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 921 118 C20140716_OR021_01 C20140716_OR021_01 TB435816.[MT7]-AGAEDPK[MT7].2b3_1.heavy 488.271 / 344.205 1967.0 15.739399909973145 46 16 10 10 10 3.5294878436852 28.332722601358576 0.0 3 0.9656593675818139 6.6406026886349565 1967.0 9.96066558875316 0.0 - - - - - - - 177.94117647058823 3 17 DMBX1 diencephalon/mesencephalon homeobox 1 923 118 C20140716_OR021_01 C20140716_OR021_01 TB435816.[MT7]-AGAEDPK[MT7].2b4_1.heavy 488.271 / 473.248 3366.0 15.739399909973145 46 16 10 10 10 3.5294878436852 28.332722601358576 0.0 3 0.9656593675818139 6.6406026886349565 3366.0 13.583278259396701 0.0 - - - - - - - 229.1764705882353 6 17 DMBX1 diencephalon/mesencephalon homeobox 1 925 118 C20140716_OR021_01 C20140716_OR021_01 TB435816.[MT7]-AGAEDPK[MT7].2y6_1.heavy 488.271 / 760.396 1021.0 15.739399909973145 46 16 10 10 10 3.5294878436852 28.332722601358576 0.0 3 0.9656593675818139 6.6406026886349565 1021.0 19.856476478807636 1.0 - - - - - - - 138.66666666666666 3 12 DMBX1 diencephalon/mesencephalon homeobox 1 927 118 C20140716_OR021_01 C20140716_OR021_01 TB435816.[MT7]-AGAEDPK[MT7].2b5_1.heavy 488.271 / 588.275 30979.0 15.739399909973145 46 16 10 10 10 3.5294878436852 28.332722601358576 0.0 3 0.9656593675818139 6.6406026886349565 30979.0 288.36616180686667 0.0 - - - - - - - 139.3684210526316 61 19 DMBX1 diencephalon/mesencephalon homeobox 1 929 119 C20140716_OR021_01 C20140716_OR021_01 TB435966.[MT7]-ERLAQAIGIPEPR.2b8_1.heavy 797.463 / 983.575 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 931 119 C20140716_OR021_01 C20140716_OR021_01 TB435966.[MT7]-ERLAQAIGIPEPR.2y10_2.heavy 797.463 / 526.298 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 933 119 C20140716_OR021_01 C20140716_OR021_01 TB435966.[MT7]-ERLAQAIGIPEPR.2y11_1.heavy 797.463 / 1164.67 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 935 119 C20140716_OR021_01 C20140716_OR021_01 TB435966.[MT7]-ERLAQAIGIPEPR.2b10_2.heavy 797.463 / 597.36 N/A N/A - - - - - - - - - 0.0 - - - - - - - LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 937 120 C20140716_OR021_01 C20140716_OR021_01 TB435812.[MT7]-SPGADSK[MT7].2y4_1.heavy 475.263 / 564.311 2667.0 14.380599975585938 50 20 10 10 10 7.519297558901196 13.29911460700501 0.0 3 0.9948014718879509 17.109363400692118 2667.0 42.851893095768375 0.0 - - - - - - - 105.47058823529412 5 17 DMBX1 diencephalon/mesencephalon homeobox 1 939 120 C20140716_OR021_01 C20140716_OR021_01 TB435812.[MT7]-SPGADSK[MT7].2y5_1.heavy 475.263 / 621.332 7494.0 14.380599975585938 50 20 10 10 10 7.519297558901196 13.29911460700501 0.0 3 0.9948014718879509 17.109363400692118 7494.0 60.57527788649706 0.0 - - - - - - - 122.05882352941177 14 17 DMBX1 diencephalon/mesencephalon homeobox 1 941 120 C20140716_OR021_01 C20140716_OR021_01 TB435812.[MT7]-SPGADSK[MT7].2y3_1.heavy 475.263 / 493.274 4210.0 14.380599975585938 50 20 10 10 10 7.519297558901196 13.29911460700501 0.0 3 0.9948014718879509 17.109363400692118 4210.0 38.090476190476195 0.0 - - - - - - - 108.625 8 16 DMBX1 diencephalon/mesencephalon homeobox 1 943 120 C20140716_OR021_01 C20140716_OR021_01 TB435812.[MT7]-SPGADSK[MT7].2y6_1.heavy 475.263 / 718.385 35255.0 14.380599975585938 50 20 10 10 10 7.519297558901196 13.29911460700501 0.0 3 0.9948014718879509 17.109363400692118 35255.0 210.89083329293712 0.0 - - - - - - - 194.46666666666667 70 15 DMBX1 diencephalon/mesencephalon homeobox 1 945 121 C20140716_OR021_01 C20140716_OR021_01 TB435968.[MT7]-NLYTNEYVAIK[MT7].3b6_1.heavy 539.303 / 879.433 18914.0 34.66939926147461 43 13 10 10 10 1.3533415712148198 42.59969609446084 0.0 3 0.9194724496261851 4.319482604702281 18914.0 86.56131295294853 0.0 - - - - - - - 343.8 37 5 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 947 121 C20140716_OR021_01 C20140716_OR021_01 TB435968.[MT7]-NLYTNEYVAIK[MT7].3b5_1.heavy 539.303 / 750.39 6878.0 34.66939926147461 43 13 10 10 10 1.3533415712148198 42.59969609446084 0.0 3 0.9194724496261851 4.319482604702281 6878.0 69.0863570281324 0.0 - - - - - - - 268.09090909090907 13 11 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 949 121 C20140716_OR021_01 C20140716_OR021_01 TB435968.[MT7]-NLYTNEYVAIK[MT7].3y4_1.heavy 539.303 / 574.404 25915.0 34.66939926147461 43 13 10 10 10 1.3533415712148198 42.59969609446084 0.0 3 0.9194724496261851 4.319482604702281 25915.0 70.70684294036849 0.0 - - - - - - - 292.84615384615387 51 13 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 951 121 C20140716_OR021_01 C20140716_OR021_01 TB435968.[MT7]-NLYTNEYVAIK[MT7].3b3_1.heavy 539.303 / 535.3 12036.0 34.66939926147461 43 13 10 10 10 1.3533415712148198 42.59969609446084 0.0 3 0.9194724496261851 4.319482604702281 12036.0 39.74338678273743 0.0 - - - - - - - 319.2 24 10 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 953 122 C20140716_OR021_01 C20140716_OR021_01 TB420276.[MT7]-GLSWDSGPEEPGPR.3y7_1.heavy 543.266 / 781.384 1517.0 32.53379821777344 36 18 0 10 8 39.805865232369364 2.5121925981571662 0.0 4 0.9864959918276966 10.60818494935197 1517.0 21.059409693107497 0.0 - - - - - - - 129.54545454545453 3 11 MRVI1 murine retrovirus integration site 1 homolog 955 122 C20140716_OR021_01 C20140716_OR021_01 TB420276.[MT7]-GLSWDSGPEEPGPR.3y6_1.heavy 543.266 / 684.331 803.0 32.53379821777344 36 18 0 10 8 39.805865232369364 2.5121925981571662 0.0 4 0.9864959918276966 10.60818494935197 803.0 6.3157303370786515 2.0 - - - - - - - 0.0 1 0 MRVI1 murine retrovirus integration site 1 homolog 957 122 C20140716_OR021_01 C20140716_OR021_01 TB420276.[MT7]-GLSWDSGPEEPGPR.3b5_1.heavy 543.266 / 703.353 1428.0 32.53379821777344 36 18 0 10 8 39.805865232369364 2.5121925981571662 0.0 4 0.9864959918276966 10.60818494935197 1428.0 10.429213483146068 0.0 - - - - - - - 165.42857142857142 2 7 MRVI1 murine retrovirus integration site 1 homolog 959 122 C20140716_OR021_01 C20140716_OR021_01 TB420276.[MT7]-GLSWDSGPEEPGPR.3y5_1.heavy 543.266 / 555.289 1249.0 32.53379821777344 36 18 0 10 8 39.805865232369364 2.5121925981571662 0.0 4 0.9864959918276966 10.60818494935197 1249.0 14.204416401140364 4.0 - - - - - - - 200.625 13 16 MRVI1 murine retrovirus integration site 1 homolog 961 123 C20140716_OR021_01 C20140716_OR021_01 TB420275.[MT7]-ANATGGGGHVQMVQR.2y12_1.heavy 813.916 / 1226.61 738.0 19.8233003616333 39 13 10 6 10 0.8858947483921793 73.09135522300252 0.03280067443847656 3 0.9147902447389407 4.197440299628152 738.0 22.230367346938777 0.0 - - - - - - - 0.0 1 0 ALOX5 arachidonate 5-lipoxygenase 963 123 C20140716_OR021_01 C20140716_OR021_01 TB420275.[MT7]-ANATGGGGHVQMVQR.2y9_1.heavy 813.916 / 1011.52 639.0 19.8233003616333 39 13 10 6 10 0.8858947483921793 73.09135522300252 0.03280067443847656 3 0.9147902447389407 4.197440299628152 639.0 2.6081632653061217 0.0 - - - - - - - 0.0 1 0 ALOX5 arachidonate 5-lipoxygenase 965 123 C20140716_OR021_01 C20140716_OR021_01 TB420275.[MT7]-ANATGGGGHVQMVQR.2y10_1.heavy 813.916 / 1068.54 1180.0 19.8233003616333 39 13 10 6 10 0.8858947483921793 73.09135522300252 0.03280067443847656 3 0.9147902447389407 4.197440299628152 1180.0 47.97061224489796 0.0 - - - - - - - 133.42857142857142 2 7 ALOX5 arachidonate 5-lipoxygenase 967 123 C20140716_OR021_01 C20140716_OR021_01 TB420275.[MT7]-ANATGGGGHVQMVQR.2y11_1.heavy 813.916 / 1125.56 2262.0 19.8233003616333 39 13 10 6 10 0.8858947483921793 73.09135522300252 0.03280067443847656 3 0.9147902447389407 4.197440299628152 2262.0 59.08897959183673 0.0 - - - - - - - 89.18181818181819 4 11 ALOX5 arachidonate 5-lipoxygenase 969 124 C20140716_OR021_01 C20140716_OR021_01 TB435970.[MT7]-LPDLSEAAEQEK[MT7].2y4_1.heavy 809.432 / 677.359 1140.0 33.88302516937256 32 15 8 5 4 1.825765325231935 43.637077222820224 0.042697906494140625 7 0.9500896922792342 5.501032014353524 1140.0 1.5238095238095237 3.0 - - - - - - - 236.14285714285714 6 14 MRVI1 murine retrovirus integration site 1 homolog 971 124 C20140716_OR021_01 C20140716_OR021_01 TB435970.[MT7]-LPDLSEAAEQEK[MT7].2y8_1.heavy 809.432 / 1035.51 2052.0 33.88302516937256 32 15 8 5 4 1.825765325231935 43.637077222820224 0.042697906494140625 7 0.9500896922792342 5.501032014353524 2052.0 0.4405594405594404 3.0 - - - - - - - 240.66666666666666 5 9 MRVI1 murine retrovirus integration site 1 homolog 973 124 C20140716_OR021_01 C20140716_OR021_01 TB435970.[MT7]-LPDLSEAAEQEK[MT7].2y5_1.heavy 809.432 / 748.396 2394.0 33.88302516937256 32 15 8 5 4 1.825765325231935 43.637077222820224 0.042697906494140625 7 0.9500896922792342 5.501032014353524 2394.0 8.82 1.0 - - - - - - - 278.6666666666667 4 9 MRVI1 murine retrovirus integration site 1 homolog 975 124 C20140716_OR021_01 C20140716_OR021_01 TB435970.[MT7]-LPDLSEAAEQEK[MT7].2y6_1.heavy 809.432 / 819.433 912.0 33.88302516937256 32 15 8 5 4 1.825765325231935 43.637077222820224 0.042697906494140625 7 0.9500896922792342 5.501032014353524 912.0 -0.026666666666666672 4.0 - - - - - - - 199.5 2 8 MRVI1 murine retrovirus integration site 1 homolog 977 125 C20140716_OR021_01 C20140716_OR021_01 TB442455.[MT7]-HLAEEMSAVFHPANSTGIR.3b5_1.heavy 737.708 / 724.375 5674.0 36.99945068359375 45 20 10 5 10 12.225502900525505 8.179622614600301 0.04290008544921875 3 0.9929014556022243 14.639305649998816 5674.0 19.33362962962963 0.0 - - - - - - - 303.75 11 4 KAZ kazrin 979 125 C20140716_OR021_01 C20140716_OR021_01 TB442455.[MT7]-HLAEEMSAVFHPANSTGIR.3b8_1.heavy 737.708 / 1013.48 7295.0 36.99945068359375 45 20 10 5 10 12.225502900525505 8.179622614600301 0.04290008544921875 3 0.9929014556022243 14.639305649998816 7295.0 21.15373430150249 0.0 - - - - - - - 675.2857142857143 14 7 KAZ kazrin 981 125 C20140716_OR021_01 C20140716_OR021_01 TB442455.[MT7]-HLAEEMSAVFHPANSTGIR.3y8_1.heavy 737.708 / 815.437 37285.0 36.99945068359375 45 20 10 5 10 12.225502900525505 8.179622614600301 0.04290008544921875 3 0.9929014556022243 14.639305649998816 37285.0 104.757704166819 0.0 - - - - - - - 270.0 74 3 KAZ kazrin 983 125 C20140716_OR021_01 C20140716_OR021_01 TB442455.[MT7]-HLAEEMSAVFHPANSTGIR.3y9_1.heavy 737.708 / 952.496 9321.0 36.99945068359375 45 20 10 5 10 12.225502900525505 8.179622614600301 0.04290008544921875 3 0.9929014556022243 14.639305649998816 9321.0 61.10433333333334 0.0 - - - - - - - 228.46153846153845 18 13 KAZ kazrin 985 126 C20140716_OR021_01 C20140716_OR021_01 TPX_ECO57.DLSDVTLGQFAGK.2y7.peptide 675.85 / 720.4 442328.0 38.513099670410156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 442328.0 284.31557487502147 0.0 - - - - - - - 306.1 884 10 987 126 C20140716_OR021_01 C20140716_OR021_01 TPX_ECO57.DLSDVTLGQFAGK.2y8.peptide 675.85 / 821.45 985157.0 38.513099670410156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 985157.0 617.8393742565222 0.0 - - - - - - - 287.6666666666667 1970 9 989 126 C20140716_OR021_01 C20140716_OR021_01 TPX_ECO57.DLSDVTLGQFAGK.2y6.peptide 675.85 / 607.32 1191840.0 38.513099670410156 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 1191840.0 701.2424924062127 0.0 - - - - - - - 333.5 2383 6 991 127 C20140716_OR021_01 C20140716_OR021_01 TB420377.[MT7]-EAAVQSGAGDYLLGIK[MT7].3b4_1.heavy 627.35 / 515.295 92536.0 38.998199462890625 45 15 10 10 10 1.6910641962484267 39.85014190147599 0.0 3 0.9503154394962949 5.513620776617413 92536.0 346.719686794326 0.0 - - - - - - - 690.5 185 10 FGF4 fibroblast growth factor 4 993 127 C20140716_OR021_01 C20140716_OR021_01 TB420377.[MT7]-EAAVQSGAGDYLLGIK[MT7].3b5_1.heavy 627.35 / 643.353 63118.0 38.998199462890625 45 15 10 10 10 1.6910641962484267 39.85014190147599 0.0 3 0.9503154394962949 5.513620776617413 63118.0 362.08997584541066 0.0 - - - - - - - 310.5 126 8 FGF4 fibroblast growth factor 4 995 127 C20140716_OR021_01 C20140716_OR021_01 TB420377.[MT7]-EAAVQSGAGDYLLGIK[MT7].3b10_1.heavy 627.35 / 1030.49 102066.0 38.998199462890625 45 15 10 10 10 1.6910641962484267 39.85014190147599 0.0 3 0.9503154394962949 5.513620776617413 102066.0 227.57099094057156 0.0 - - - - - - - 230.0 204 6 FGF4 fibroblast growth factor 4 997 127 C20140716_OR021_01 C20140716_OR021_01 TB420377.[MT7]-EAAVQSGAGDYLLGIK[MT7].3y4_1.heavy 627.35 / 574.404 141843.0 38.998199462890625 45 15 10 10 10 1.6910641962484267 39.85014190147599 0.0 3 0.9503154394962949 5.513620776617413 141843.0 394.1223733719247 0.0 - - - - - - - 276.0 283 7 FGF4 fibroblast growth factor 4 999 128 C20140716_OR021_01 C20140716_OR021_01 TB420270.[MT7]-LPDLSEAAEQEK[MT7].3y3_1.heavy 539.957 / 548.316 7231.0 33.85100173950195 46 16 10 10 10 1.6750342224248866 39.80018185548218 0.0 3 0.9657351866727263 6.647988128861581 7231.0 12.828630540840736 0.0 - - - - - - - 332.0 14 8 MRVI1 murine retrovirus integration site 1 homolog 1001 128 C20140716_OR021_01 C20140716_OR021_01 TB420270.[MT7]-LPDLSEAAEQEK[MT7].3b6_1.heavy 539.957 / 799.432 5950.0 33.85100173950195 46 16 10 10 10 1.6750342224248866 39.80018185548218 0.0 3 0.9657351866727263 6.647988128861581 5950.0 63.022600726221015 0.0 - - - - - - - 137.5 11 6 MRVI1 murine retrovirus integration site 1 homolog 1003 128 C20140716_OR021_01 C20140716_OR021_01 TB420270.[MT7]-LPDLSEAAEQEK[MT7].3b4_1.heavy 539.957 / 583.357 5858.0 33.85100173950195 46 16 10 10 10 1.6750342224248866 39.80018185548218 0.0 3 0.9657351866727263 6.647988128861581 5858.0 32.995466776874686 0.0 - - - - - - - 194.75 11 8 MRVI1 murine retrovirus integration site 1 homolog 1005 128 C20140716_OR021_01 C20140716_OR021_01 TB420270.[MT7]-LPDLSEAAEQEK[MT7].3y4_1.heavy 539.957 / 677.359 6133.0 33.85100173950195 46 16 10 10 10 1.6750342224248866 39.80018185548218 0.0 3 0.9657351866727263 6.647988128861581 6133.0 11.33953971315302 1.0 - - - - - - - 229.0 12 10 MRVI1 murine retrovirus integration site 1 homolog 1007 129 C20140716_OR021_01 C20140716_OR021_01 TB420372.[MT7]-GQGEPLDDRHPLC[CAM]AR.3y6_1.heavy 622.312 / 753.383 9346.0 23.239500045776367 40 10 10 10 10 0.9208444245041868 65.55394719511739 0.0 3 0.8352717600146464 2.9979745367063115 9346.0 44.639151744100474 0.0 - - - - - - - 232.27272727272728 18 11 ASB10 ankyrin repeat and SOCS box-containing 10 1009 129 C20140716_OR021_01 C20140716_OR021_01 TB420372.[MT7]-GQGEPLDDRHPLC[CAM]AR.3b4_1.heavy 622.312 / 516.253 24612.0 23.239500045776367 40 10 10 10 10 0.9208444245041868 65.55394719511739 0.0 3 0.8352717600146464 2.9979745367063115 24612.0 93.41372727272727 0.0 - - - - - - - 302.64285714285717 49 14 ASB10 ankyrin repeat and SOCS box-containing 10 1011 129 C20140716_OR021_01 C20140716_OR021_01 TB420372.[MT7]-GQGEPLDDRHPLC[CAM]AR.3y8_2.heavy 622.312 / 512.759 61810.0 23.239500045776367 40 10 10 10 10 0.9208444245041868 65.55394719511739 0.0 3 0.8352717600146464 2.9979745367063115 61810.0 507.19004755652804 0.0 - - - - - - - 329.42857142857144 123 7 ASB10 ankyrin repeat and SOCS box-containing 10 1013 129 C20140716_OR021_01 C20140716_OR021_01 TB420372.[MT7]-GQGEPLDDRHPLC[CAM]AR.3y5_1.heavy 622.312 / 616.323 25173.0 23.239500045776367 40 10 10 10 10 0.9208444245041868 65.55394719511739 0.0 3 0.8352717600146464 2.9979745367063115 25173.0 57.24594952729724 0.0 - - - - - - - 303.75 50 8 ASB10 ankyrin repeat and SOCS box-containing 10 1015 130 C20140716_OR021_01 C20140716_OR021_01 TB442147.[MT7]-FNFNAYK[MT7].2y4_1.heavy 596.324 / 639.358 7393.0 34.719600677490234 34 14 4 10 6 1.3806766806613058 49.30848450763082 0.0 5 0.9371506233832273 4.896780256792482 7393.0 105.76846715328466 0.0 - - - - - - - 328.8 14 5 PNLIPRP3 pancreatic lipase-related protein 3 1017 130 C20140716_OR021_01 C20140716_OR021_01 TB442147.[MT7]-FNFNAYK[MT7].2b4_1.heavy 596.324 / 667.332 4244.0 34.719600677490234 34 14 4 10 6 1.3806766806613058 49.30848450763082 0.0 5 0.9371506233832273 4.896780256792482 4244.0 22.252603406326035 0.0 - - - - - - - 328.8 8 5 PNLIPRP3 pancreatic lipase-related protein 3 1019 130 C20140716_OR021_01 C20140716_OR021_01 TB442147.[MT7]-FNFNAYK[MT7].2y3_1.heavy 596.324 / 525.315 5203.0 34.719600677490234 34 14 4 10 6 1.3806766806613058 49.30848450763082 0.0 5 0.9371506233832273 4.896780256792482 5203.0 10.314089524380895 0.0 - - - - - - - 313.14285714285717 10 7 PNLIPRP3 pancreatic lipase-related protein 3 1021 130 C20140716_OR021_01 C20140716_OR021_01 TB442147.[MT7]-FNFNAYK[MT7].2y6_1.heavy 596.324 / 900.47 4381.0 34.719600677490234 34 14 4 10 6 1.3806766806613058 49.30848450763082 0.0 5 0.9371506233832273 4.896780256792482 4381.0 44.44956204379562 2.0 - - - - - - - 274.0 27 6 PNLIPRP3 pancreatic lipase-related protein 3 1023 131 C20140716_OR021_01 C20140716_OR021_01 TB420503.[MT7]-GAVDSYDVTVDEELGEIQLVR.3y7_1.heavy 817.751 / 814.478 38236.0 45.64670181274414 46 16 10 10 10 2.8785053292851948 26.868485938732352 0.0 3 0.9661856024975181 6.692372423042046 38236.0 75.59045464339582 0.0 - - - - - - - 204.0 76 1 ALOX5 arachidonate 5-lipoxygenase 1025 131 C20140716_OR021_01 C20140716_OR021_01 TB420503.[MT7]-GAVDSYDVTVDEELGEIQLVR.3b5_1.heavy 817.751 / 574.295 13357.0 45.64670181274414 46 16 10 10 10 2.8785053292851948 26.868485938732352 0.0 3 0.9661856024975181 6.692372423042046 13357.0 -4.365032679738562 0.0 - - - - - - - 238.0 26 6 ALOX5 arachidonate 5-lipoxygenase 1027 131 C20140716_OR021_01 C20140716_OR021_01 TB420503.[MT7]-GAVDSYDVTVDEELGEIQLVR.3y8_1.heavy 817.751 / 927.562 15906.0 45.64670181274414 46 16 10 10 10 2.8785053292851948 26.868485938732352 0.0 3 0.9661856024975181 6.692372423042046 15906.0 -15.594117647058823 0.0 - - - - - - - 283.3333333333333 31 9 ALOX5 arachidonate 5-lipoxygenase 1029 131 C20140716_OR021_01 C20140716_OR021_01 TB420503.[MT7]-GAVDSYDVTVDEELGEIQLVR.3b7_1.heavy 817.751 / 852.386 32016.0 45.64670181274414 46 16 10 10 10 2.8785053292851948 26.868485938732352 0.0 3 0.9661856024975181 6.692372423042046 32016.0 -15.694117647058818 0.0 - - - - - - - 204.0 64 4 ALOX5 arachidonate 5-lipoxygenase 1031 132 C20140716_OR021_01 C20140716_OR021_01 TB435804.[MT7]-AAEVLK[MT7].2y4_1.heavy 459.797 / 632.41 12690.0 23.614900588989258 50 20 10 10 10 14.048357168850833 7.118270043826063 0.0 3 0.9987164660721468 34.44389286444402 12690.0 79.88459016393442 0.0 - - - - - - - 234.46153846153845 25 13 E2F3 E2F transcription factor 3 1033 132 C20140716_OR021_01 C20140716_OR021_01 TB435804.[MT7]-AAEVLK[MT7].2y5_1.heavy 459.797 / 703.447 27919.0 23.614900588989258 50 20 10 10 10 14.048357168850833 7.118270043826063 0.0 3 0.9987164660721468 34.44389286444402 27919.0 202.51026245659372 0.0 - - - - - - - 173.0 55 10 E2F3 E2F transcription factor 3 1035 132 C20140716_OR021_01 C20140716_OR021_01 TB435804.[MT7]-AAEVLK[MT7].2b4_1.heavy 459.797 / 515.295 24569.0 23.614900588989258 50 20 10 10 10 14.048357168850833 7.118270043826063 0.0 3 0.9987164660721468 34.44389286444402 24569.0 27.956334413553925 0.0 - - - - - - - 186.5 49 6 E2F3 E2F transcription factor 3 1037 132 C20140716_OR021_01 C20140716_OR021_01 TB435804.[MT7]-AAEVLK[MT7].2y3_1.heavy 459.797 / 503.367 24670.0 23.614900588989258 50 20 10 10 10 14.048357168850833 7.118270043826063 0.0 3 0.9987164660721468 34.44389286444402 24670.0 71.29589490968802 0.0 - - - - - - - 228.75 49 8 E2F3 E2F transcription factor 3 1039 133 C20140716_OR021_01 C20140716_OR021_01 TB420504.[MT7]-TGEFAIVSGK[MT7]LEPGMTYTK[MT7].4b4_1.heavy 616.09 / 579.289 8685.0 37.938899993896484 47 17 10 10 10 1.9748261104253375 39.196526167836495 0.0 3 0.9797293663292497 8.653510934899485 8685.0 13.544730077120823 0.0 - - - - - - - 210.75 17 8 PNLIPRP3 pancreatic lipase-related protein 3 1041 133 C20140716_OR021_01 C20140716_OR021_01 TB420504.[MT7]-TGEFAIVSGK[MT7]LEPGMTYTK[MT7].4b5_1.heavy 616.09 / 650.327 21907.0 37.938899993896484 47 17 10 10 10 1.9748261104253375 39.196526167836495 0.0 3 0.9797293663292497 8.653510934899485 21907.0 61.01281222884302 0.0 - - - - - - - 240.71428571428572 43 7 PNLIPRP3 pancreatic lipase-related protein 3 1043 133 C20140716_OR021_01 C20140716_OR021_01 TB420504.[MT7]-TGEFAIVSGK[MT7]LEPGMTYTK[MT7].4y3_1.heavy 616.09 / 555.326 10630.0 37.938899993896484 47 17 10 10 10 1.9748261104253375 39.196526167836495 0.0 3 0.9797293663292497 8.653510934899485 10630.0 11.25084085682568 0.0 - - - - - - - 680.625 21 8 PNLIPRP3 pancreatic lipase-related protein 3 1045 133 C20140716_OR021_01 C20140716_OR021_01 TB420504.[MT7]-TGEFAIVSGK[MT7]LEPGMTYTK[MT7].4b6_1.heavy 616.09 / 763.411 7000.0 37.938899993896484 47 17 10 10 10 1.9748261104253375 39.196526167836495 0.0 3 0.9797293663292497 8.653510934899485 7000.0 17.98792417690734 0.0 - - - - - - - 245.0 14 9 PNLIPRP3 pancreatic lipase-related protein 3 1047 134 C20140716_OR021_01 C20140716_OR021_01 TB420264.[MT7]-LARDDQIHILK[MT7].3y3_1.heavy 537.326 / 517.383 14277.0 29.606199264526367 41 11 10 10 10 0.901695057295835 66.53624051807914 0.0 3 0.8739388705122277 3.438746856803785 14277.0 74.22293577981652 0.0 - - - - - - - 218.0 28 10 ALOX5 arachidonate 5-lipoxygenase 1049 134 C20140716_OR021_01 C20140716_OR021_01 TB420264.[MT7]-LARDDQIHILK[MT7].3b6_1.heavy 537.326 / 843.444 6321.0 29.606199264526367 41 11 10 10 10 0.901695057295835 66.53624051807914 0.0 3 0.8739388705122277 3.438746856803785 6321.0 35.18110091743119 0.0 - - - - - - - 171.28571428571428 12 7 ALOX5 arachidonate 5-lipoxygenase 1051 134 C20140716_OR021_01 C20140716_OR021_01 TB420264.[MT7]-LARDDQIHILK[MT7].3b5_1.heavy 537.326 / 715.385 6321.0 29.606199264526367 41 11 10 10 10 0.901695057295835 66.53624051807914 0.0 3 0.8739388705122277 3.438746856803785 6321.0 24.742752293577983 0.0 - - - - - - - 199.83333333333334 12 12 ALOX5 arachidonate 5-lipoxygenase 1053 134 C20140716_OR021_01 C20140716_OR021_01 TB420264.[MT7]-LARDDQIHILK[MT7].3b7_1.heavy 537.326 / 956.528 5449.0 29.606199264526367 41 11 10 10 10 0.901695057295835 66.53624051807914 0.0 3 0.8739388705122277 3.438746856803785 5449.0 28.16149847094801 0.0 - - - - - - - 218.0 10 3 ALOX5 arachidonate 5-lipoxygenase 1055 135 C20140716_OR021_01 C20140716_OR021_01 TB442192.[MT7]-LAQAIGIPEPR.2y8_1.heavy 654.891 / 852.494 19541.0 36.26940155029297 50 20 10 10 10 16.383176683107077 6.103822349856692 0.0 3 0.9930848963532553 14.832434493421356 19541.0 77.49503007374057 0.0 - - - - - - - 260.7 39 10 LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 1057 135 C20140716_OR021_01 C20140716_OR021_01 TB442192.[MT7]-LAQAIGIPEPR.2b4_1.heavy 654.891 / 528.326 41557.0 36.26940155029297 50 20 10 10 10 16.383176683107077 6.103822349856692 0.0 3 0.9930848963532553 14.832434493421356 41557.0 260.19191531685135 0.0 - - - - - - - 260.6666666666667 83 6 LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 1059 135 C20140716_OR021_01 C20140716_OR021_01 TB442192.[MT7]-LAQAIGIPEPR.2y6_1.heavy 654.891 / 668.373 31526.0 36.26940155029297 50 20 10 10 10 16.383176683107077 6.103822349856692 0.0 3 0.9930848963532553 14.832434493421356 31526.0 116.98015226507312 1.0 - - - - - - - 260.7142857142857 68 7 LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 1061 135 C20140716_OR021_01 C20140716_OR021_01 TB442192.[MT7]-LAQAIGIPEPR.2y10_1.heavy 654.891 / 1051.59 53021.0 36.26940155029297 50 20 10 10 10 16.383176683107077 6.103822349856692 0.0 3 0.9930848963532553 14.832434493421356 53021.0 96.75889890906276 0.0 - - - - - - - 234.6 106 5 LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 1063 136 C20140716_OR021_01 C20140716_OR021_01 TB442110.[MT7]-TTSIENLR.2b4_1.heavy 539.305 / 547.321 4035.0 26.936800003051758 50 20 10 10 10 6.030524727636854 16.582304943003926 0.0 3 0.9951304092597753 17.67826925919455 4035.0 40.35000000000001 0.0 - - - - - - - 224.0 8 8 DMBX1 diencephalon/mesencephalon homeobox 1 1065 136 C20140716_OR021_01 C20140716_OR021_01 TB442110.[MT7]-TTSIENLR.2y6_1.heavy 539.305 / 731.405 7621.0 26.936800003051758 50 20 10 10 10 6.030524727636854 16.582304943003926 0.0 3 0.9951304092597753 17.67826925919455 7621.0 53.18822916666667 0.0 - - - - - - - 252.0 15 12 DMBX1 diencephalon/mesencephalon homeobox 1 1067 136 C20140716_OR021_01 C20140716_OR021_01 TB442110.[MT7]-TTSIENLR.2b5_1.heavy 539.305 / 676.363 7509.0 26.936800003051758 50 20 10 10 10 6.030524727636854 16.582304943003926 0.0 3 0.9951304092597753 17.67826925919455 7509.0 26.817857142857143 0.0 - - - - - - - 240.0 15 7 DMBX1 diencephalon/mesencephalon homeobox 1 1069 136 C20140716_OR021_01 C20140716_OR021_01 TB442110.[MT7]-TTSIENLR.2y7_1.heavy 539.305 / 832.452 22752.0 26.936800003051758 50 20 10 10 10 6.030524727636854 16.582304943003926 0.0 3 0.9951304092597753 17.67826925919455 22752.0 251.22 0.0 - - - - - - - 261.3333333333333 45 6 DMBX1 diencephalon/mesencephalon homeobox 1 1071 137 C20140716_OR021_01 C20140716_OR021_01 ENO_ECO24.IQLVGDDLFVTNTK.2y8.peptide 781.92 / 937.5 270354.0 41.949100494384766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 270354.0 791.6168226017617 0.0 - - - - - - - 717.1111111111111 540 9 1073 137 C20140716_OR021_01 C20140716_OR021_01 ENO_ECO24.IQLVGDDLFVTNTK.2y6.peptide 781.92 / 709.39 372839.0 41.949100494384766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 372839.0 474.658951921809 0.0 - - - - - - - 286.6666666666667 745 3 1075 137 C20140716_OR021_01 C20140716_OR021_01 ENO_ECO24.IQLVGDDLFVTNTK.2y5.peptide 781.92 / 562.32 570110.0 41.949100494384766 27 -3 10 10 10 null 0.0 0.0 3 0.0 0.0 570110.0 534.1799263197071 0.0 - - - - - - - 215.0 1140 1 1077 138 C20140716_OR021_01 C20140716_OR021_01 TB442119.[MT7]-VQVWFK[MT7].2y4_1.heavy 547.834 / 723.431 13174.0 38.29460144042969 50 20 10 10 10 14.950680224219662 6.688658877072559 0.0 3 0.9985066988115031 31.932623846982985 13174.0 152.20099409412714 0.0 - - - - - - - 150.14285714285714 26 7 DMBX1;CRX;OTX1;OTX2 diencephalon/mesencephalon homeobox 1;cone-rod homeobox;orthodenticle homeobox 1;orthodenticle homeobox 2 1079 138 C20140716_OR021_01 C20140716_OR021_01 TB442119.[MT7]-VQVWFK[MT7].2y5_1.heavy 547.834 / 851.49 11775.0 38.29460144042969 50 20 10 10 10 14.950680224219662 6.688658877072559 0.0 3 0.9985066988115031 31.932623846982985 11775.0 200.77884615384613 0.0 - - - - - - - 175.0 23 4 DMBX1;CRX;OTX1;OTX2 diencephalon/mesencephalon homeobox 1;cone-rod homeobox;orthodenticle homeobox 1;orthodenticle homeobox 2 1081 138 C20140716_OR021_01 C20140716_OR021_01 TB442119.[MT7]-VQVWFK[MT7].2b4_1.heavy 547.834 / 657.384 2682.0 38.29460144042969 50 20 10 10 10 14.950680224219662 6.688658877072559 0.0 3 0.9985066988115031 31.932623846982985 2682.0 16.835264255058245 0.0 - - - - - - - 225.0 5 14 DMBX1;CRX;OTX1;OTX2 diencephalon/mesencephalon homeobox 1;cone-rod homeobox;orthodenticle homeobox 1;orthodenticle homeobox 2 1083 138 C20140716_OR021_01 C20140716_OR021_01 TB442119.[MT7]-VQVWFK[MT7].2y3_1.heavy 547.834 / 624.363 30080.0 38.29460144042969 50 20 10 10 10 14.950680224219662 6.688658877072559 0.0 3 0.9985066988115031 31.932623846982985 30080.0 113.95009680577742 0.0 - - - - - - - 276.875 60 8 DMBX1;CRX;OTX1;OTX2 diencephalon/mesencephalon homeobox 1;cone-rod homeobox;orthodenticle homeobox 1;orthodenticle homeobox 2 1085 139 C20140716_OR021_01 C20140716_OR021_01 TB420123.[MT7]-WESLVALSLAR.3y6_1.heavy 463.605 / 630.393 911.0 48.154300689697266 34 11 10 3 10 1.0868147461883015 63.76864962934853 0.0635986328125 3 0.8693517830234602 3.3764847714769113 911.0 2.397368421052631 1.0 - - - - - - - 0.0 1 0 FGF4 fibroblast growth factor 4 1087 139 C20140716_OR021_01 C20140716_OR021_01 TB420123.[MT7]-WESLVALSLAR.3b5_1.heavy 463.605 / 759.416 228.0 48.154300689697266 34 11 10 3 10 1.0868147461883015 63.76864962934853 0.0635986328125 3 0.8693517830234602 3.3764847714769113 228.0 -1.5 3.0 - - - - - - - 0.0 0 0 FGF4 fibroblast growth factor 4 1089 139 C20140716_OR021_01 C20140716_OR021_01 TB420123.[MT7]-WESLVALSLAR.3b3_1.heavy 463.605 / 547.263 987.0 48.154300689697266 34 11 10 3 10 1.0868147461883015 63.76864962934853 0.0635986328125 3 0.8693517830234602 3.3764847714769113 987.0 -1.5 1.0 - - - - - - - 0.0 1 0 FGF4 fibroblast growth factor 4 1091 139 C20140716_OR021_01 C20140716_OR021_01 TB420123.[MT7]-WESLVALSLAR.3y5_1.heavy 463.605 / 559.356 1594.0 48.154300689697266 34 11 10 3 10 1.0868147461883015 63.76864962934853 0.0635986328125 3 0.8693517830234602 3.3764847714769113 1594.0 9.752763157894735 0.0 - - - - - - - 133.0 3 4 FGF4 fibroblast growth factor 4 1093 140 C20140716_OR021_01 C20140716_OR021_01 TB420124.[MT7]-NLALPFVEVSR.2y8_1.heavy 694.905 / 946.536 30101.0 43.681800842285156 48 18 10 10 10 5.0078556522983115 19.968626682381686 0.0 3 0.9858314294800422 10.35583773413125 30101.0 147.1455133928571 0.0 - - - - - - - 268.8 60 10 IDO2 indoleamine 2,3-dioxygenase 2 1095 140 C20140716_OR021_01 C20140716_OR021_01 TB420124.[MT7]-NLALPFVEVSR.2y9_1.heavy 694.905 / 1017.57 36704.0 43.681800842285156 48 18 10 10 10 5.0078556522983115 19.968626682381686 0.0 3 0.9858314294800422 10.35583773413125 36704.0 234.3157142857143 0.0 - - - - - - - 224.0 73 8 IDO2 indoleamine 2,3-dioxygenase 2 1097 140 C20140716_OR021_01 C20140716_OR021_01 TB420124.[MT7]-NLALPFVEVSR.2y10_1.heavy 694.905 / 1130.66 19806.0 43.681800842285156 48 18 10 10 10 5.0078556522983115 19.968626682381686 0.0 3 0.9858314294800422 10.35583773413125 19806.0 45.025134099616864 0.0 - - - - - - - 719.1428571428571 39 7 IDO2 indoleamine 2,3-dioxygenase 2 1099 140 C20140716_OR021_01 C20140716_OR021_01 TB420124.[MT7]-NLALPFVEVSR.2y7_1.heavy 694.905 / 833.452 79450.0 43.681800842285156 48 18 10 10 10 5.0078556522983115 19.968626682381686 0.0 3 0.9858314294800422 10.35583773413125 79450.0 143.37849035908226 0.0 - - - - - - - 256.0 158 7 IDO2 indoleamine 2,3-dioxygenase 2 1101 141 C20140716_OR021_01 C20140716_OR021_01 TB420121.[MT7]-RAPSFPYSYR.3b4_1.heavy 463.246 / 556.332 8775.0 29.892900466918945 50 20 10 10 10 8.053929833905407 12.416298882940392 0.0 3 0.9900087339989989 12.336439943954165 8775.0 6.792388998265034 0.0 - - - - - - - 210.33333333333334 17 12 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1103 141 C20140716_OR021_01 C20140716_OR021_01 TB420121.[MT7]-RAPSFPYSYR.3b5_1.heavy 463.246 / 703.401 4168.0 29.892900466918945 50 20 10 10 10 8.053929833905407 12.416298882940392 0.0 3 0.9900087339989989 12.336439943954165 4168.0 0.0 2.0 - - - - - - - 274.25 8 8 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1105 141 C20140716_OR021_01 C20140716_OR021_01 TB420121.[MT7]-RAPSFPYSYR.3y4_1.heavy 463.246 / 588.278 17770.0 29.892900466918945 50 20 10 10 10 8.053929833905407 12.416298882940392 0.0 3 0.9900087339989989 12.336439943954165 17770.0 -1.5 1.0 - - - - - - - 255.66666666666666 35 3 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1107 141 C20140716_OR021_01 C20140716_OR021_01 TB420121.[MT7]-RAPSFPYSYR.3y5_1.heavy 463.246 / 685.33 21280.0 29.892900466918945 50 20 10 10 10 8.053929833905407 12.416298882940392 0.0 3 0.9900087339989989 12.336439943954165 21280.0 106.18918678171684 0.0 - - - - - - - 219.5 42 6 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1109 142 C20140716_OR021_01 C20140716_OR021_01 TB420122.[MT7]-NLALPFVEVSR.3y6_1.heavy 463.605 / 736.399 2465.0 43.681800842285156 44 14 10 10 10 1.9057748407588788 37.63835008069592 0.0 3 0.9344990548134525 4.795556763695879 2465.0 -0.011004464285713667 0.0 - - - - - - - 252.0 4 4 IDO2 indoleamine 2,3-dioxygenase 2 1111 142 C20140716_OR021_01 C20140716_OR021_01 TB420122.[MT7]-NLALPFVEVSR.3b4_1.heavy 463.605 / 556.357 12437.0 43.681800842285156 44 14 10 10 10 1.9057748407588788 37.63835008069592 0.0 3 0.9344990548134525 4.795556763695879 12437.0 137.69535714285712 0.0 - - - - - - - 246.4 24 5 IDO2 indoleamine 2,3-dioxygenase 2 1113 142 C20140716_OR021_01 C20140716_OR021_01 TB420122.[MT7]-NLALPFVEVSR.3y4_1.heavy 463.605 / 490.262 16583.0 43.681800842285156 44 14 10 10 10 1.9057748407588788 37.63835008069592 0.0 3 0.9344990548134525 4.795556763695879 16583.0 175.602125 0.0 - - - - - - - 336.0 33 2 IDO2 indoleamine 2,3-dioxygenase 2 1115 142 C20140716_OR021_01 C20140716_OR021_01 TB420122.[MT7]-NLALPFVEVSR.3y5_1.heavy 463.605 / 589.33 12213.0 43.681800842285156 44 14 10 10 10 1.9057748407588788 37.63835008069592 0.0 3 0.9344990548134525 4.795556763695879 12213.0 215.90839285714287 0.0 - - - - - - - 140.0 24 4 IDO2 indoleamine 2,3-dioxygenase 2 1117 143 C20140716_OR021_01 C20140716_OR021_01 TB442304.[MT7]-MPLLSC[CAM]QFLK[MT7].2y9_1.heavy 762.93 / 1249.71 6269.0 44.229698181152344 43 13 10 10 10 1.5577745600507382 42.28626550487274 0.0 3 0.9268900966647716 4.536199353749582 6269.0 24.918619246861926 0.0 - - - - - - - 230.28571428571428 12 7 IDO2 indoleamine 2,3-dioxygenase 2 1119 143 C20140716_OR021_01 C20140716_OR021_01 TB442304.[MT7]-MPLLSC[CAM]QFLK[MT7].2y3_1.heavy 762.93 / 551.367 2448.0 44.229698181152344 43 13 10 10 10 1.5577745600507382 42.28626550487274 0.0 3 0.9268900966647716 4.536199353749582 2448.0 0.2733668341708542 1.0 - - - - - - - 227.0 4 5 IDO2 indoleamine 2,3-dioxygenase 2 1121 143 C20140716_OR021_01 C20140716_OR021_01 TB442304.[MT7]-MPLLSC[CAM]QFLK[MT7].2y6_1.heavy 762.93 / 926.489 6866.0 44.229698181152344 43 13 10 10 10 1.5577745600507382 42.28626550487274 0.0 3 0.9268900966647716 4.536199353749582 6866.0 14.292196652719666 0.0 - - - - - - - 281.7142857142857 13 7 IDO2 indoleamine 2,3-dioxygenase 2 1123 143 C20140716_OR021_01 C20140716_OR021_01 TB442304.[MT7]-MPLLSC[CAM]QFLK[MT7].2y7_1.heavy 762.93 / 1039.57 5195.0 44.229698181152344 43 13 10 10 10 1.5577745600507382 42.28626550487274 0.0 3 0.9268900966647716 4.536199353749582 5195.0 0.27191834598272696 1.0 - - - - - - - 208.83333333333334 10 6 IDO2 indoleamine 2,3-dioxygenase 2 1125 144 C20140716_OR021_01 C20140716_OR021_01 TB420512.[MT7]-EVRLDPSDANFVDVIHTNAAR.4y5_1.heavy 621.574 / 532.284 26434.0 37.49190139770508 43 13 10 10 10 2.5116183559929275 31.93071343927753 0.0 3 0.9170302088075304 4.254542291276354 26434.0 43.77050002056079 0.0 - - - - - - - 299.4 52 10 PNLIPRP3 pancreatic lipase-related protein 3 1127 144 C20140716_OR021_01 C20140716_OR021_01 TB420512.[MT7]-EVRLDPSDANFVDVIHTNAAR.4b8_2.heavy 621.574 / 528.776 15461.0 37.49190139770508 43 13 10 10 10 2.5116183559929275 31.93071343927753 0.0 3 0.9170302088075304 4.254542291276354 15461.0 39.838976098364284 0.0 - - - - - - - 349.2 30 10 PNLIPRP3 pancreatic lipase-related protein 3 1129 144 C20140716_OR021_01 C20140716_OR021_01 TB420512.[MT7]-EVRLDPSDANFVDVIHTNAAR.4b5_1.heavy 621.574 / 757.432 10349.0 37.49190139770508 43 13 10 10 10 2.5116183559929275 31.93071343927753 0.0 3 0.9170302088075304 4.254542291276354 10349.0 52.29842245989305 0.0 - - - - - - - 238.1818181818182 20 11 PNLIPRP3 pancreatic lipase-related protein 3 1131 144 C20140716_OR021_01 C20140716_OR021_01 TB420512.[MT7]-EVRLDPSDANFVDVIHTNAAR.4y6_1.heavy 621.574 / 669.343 22693.0 37.49190139770508 43 13 10 10 10 2.5116183559929275 31.93071343927753 0.0 3 0.9170302088075304 4.254542291276354 22693.0 36.239376409460526 1.0 - - - - - - - 261.9 63 10 PNLIPRP3 pancreatic lipase-related protein 3 1133 145 C20140716_OR021_01 C20140716_OR021_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y7.peptide 503.96 / 728.39 100201.0 36.630001068115234 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 100201.0 881.2592795336423 0.0 - - - - - - - 276.4 200 5 1135 145 C20140716_OR021_01 C20140716_OR021_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y6.peptide 503.96 / 631.34 19839.0 36.630001068115234 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 19839.0 24.31312841247913 2.0 - - - - - - - 173.0 91 8 1137 145 C20140716_OR021_01 C20140716_OR021_01 RBSB_ECOLI.LAATIAQLPDQIGAK.3y5.peptide 503.96 / 516.31 19839.0 36.630001068115234 25 -3 10 10 8 null 0.0 0.0 4 0.0 0.0 19839.0 124.551693702643 0.0 - - - - - - - 226.2 39 10 1139 146 C20140716_OR021_01 C20140716_OR021_01 TB420256.[MT7]-LGHNLFGIYQK[MT7].3y6_1.heavy 526.64 / 899.511 5807.0 37.14939880371094 48 18 10 10 10 5.88651118961617 16.987991151091396 0.0 3 0.9889299612768451 11.718886447244044 5807.0 0.0 0.0 - - - - - - - 395.0 11 3 ITLN2 intelectin 2 1141 146 C20140716_OR021_01 C20140716_OR021_01 TB420256.[MT7]-LGHNLFGIYQK[MT7].3b4_1.heavy 526.64 / 566.317 24769.0 37.14939880371094 48 18 10 10 10 5.88651118961617 16.987991151091396 0.0 3 0.9889299612768451 11.718886447244044 24769.0 129.59308016877637 0.0 - - - - - - - 223.88888888888889 49 9 ITLN2 intelectin 2 1143 146 C20140716_OR021_01 C20140716_OR021_01 TB420256.[MT7]-LGHNLFGIYQK[MT7].3b7_1.heavy 526.64 / 883.491 4029.0 37.14939880371094 48 18 10 10 10 5.88651118961617 16.987991151091396 0.0 3 0.9889299612768451 11.718886447244044 4029.0 38.403130016051364 0.0 - - - - - - - 119.0 8 2 ITLN2 intelectin 2 1145 146 C20140716_OR021_01 C20140716_OR021_01 TB420256.[MT7]-LGHNLFGIYQK[MT7].3y5_1.heavy 526.64 / 752.442 15170.0 37.14939880371094 48 18 10 10 10 5.88651118961617 16.987991151091396 0.0 3 0.9889299612768451 11.718886447244044 15170.0 165.99163209587633 0.0 - - - - - - - 190.0 30 5 ITLN2 intelectin 2 1147 147 C20140716_OR021_01 C20140716_OR021_01 TB420255.[MT7]-GEMGYGAPGRPGER.3b6_1.heavy 526.592 / 739.32 3337.0 22.12125062942505 30 16 0 6 8 3.5481699365875894 28.18354300588371 0.03339958190917969 4 0.9699820377434751 7.105249802506415 3337.0 35.37858357071725 0.0 - - - - - - - 129.77777777777777 6 9 COL10A1 collagen, type X, alpha 1 1149 147 C20140716_OR021_01 C20140716_OR021_01 TB420255.[MT7]-GEMGYGAPGRPGER.3b4_1.heavy 526.592 / 519.235 3393.0 22.12125062942505 30 16 0 6 8 3.5481699365875894 28.18354300588371 0.03339958190917969 4 0.9699820377434751 7.105249802506415 3393.0 22.627967594223314 1.0 - - - - - - - 204.89473684210526 31 19 COL10A1 collagen, type X, alpha 1 1151 147 C20140716_OR021_01 C20140716_OR021_01 TB420255.[MT7]-GEMGYGAPGRPGER.3b8_1.heavy 526.592 / 907.41 445.0 22.12125062942505 30 16 0 6 8 3.5481699365875894 28.18354300588371 0.03339958190917969 4 0.9699820377434751 7.105249802506415 445.0 0.5011218868646585 41.0 - - - - - - - 581.1111111111111 110 9 COL10A1 collagen, type X, alpha 1 1153 147 C20140716_OR021_01 C20140716_OR021_01 TB420255.[MT7]-GEMGYGAPGRPGER.3y12_2.heavy 526.592 / 624.301 2058.0 22.12125062942505 30 16 0 6 8 3.5481699365875894 28.18354300588371 0.03339958190917969 4 0.9699820377434751 7.105249802506415 2058.0 1.6431137724550897 1.0 - - - - - - - 170.11764705882354 4 17 COL10A1 collagen, type X, alpha 1 1155 148 C20140716_OR021_01 C20140716_OR021_01 TB442439.[MT7]-K[MT7]LDELIQSC[CAM]TLDLK[MT7].4b4_1.heavy 527.805 / 774.46 3875.0 40.61655044555664 37 11 10 6 10 1.1590288264435218 57.17749217870568 0.039398193359375 3 0.8518361666965517 3.1657537542640584 3875.0 60.99537037037037 0.0 - - - - - - - 215.5 7 6 E2F3 E2F transcription factor 3 1157 148 C20140716_OR021_01 C20140716_OR021_01 TB442439.[MT7]-K[MT7]LDELIQSC[CAM]TLDLK[MT7].4b5_1.heavy 527.805 / 887.544 4521.0 40.61655044555664 37 11 10 6 10 1.1590288264435218 57.17749217870568 0.039398193359375 3 0.8518361666965517 3.1657537542640584 4521.0 83.72222222222223 0.0 - - - - - - - 161.75 9 4 E2F3 E2F transcription factor 3 1159 148 C20140716_OR021_01 C20140716_OR021_01 TB442439.[MT7]-K[MT7]LDELIQSC[CAM]TLDLK[MT7].4y3_1.heavy 527.805 / 519.326 14424.0 40.61655044555664 37 11 10 6 10 1.1590288264435218 57.17749217870568 0.039398193359375 3 0.8518361666965517 3.1657537542640584 14424.0 64.52842105263157 0.0 - - - - - - - 175.125 28 8 E2F3 E2F transcription factor 3 1161 148 C20140716_OR021_01 C20140716_OR021_01 TB442439.[MT7]-K[MT7]LDELIQSC[CAM]TLDLK[MT7].4b3_1.heavy 527.805 / 645.417 4198.0 40.61655044555664 37 11 10 6 10 1.1590288264435218 57.17749217870568 0.039398193359375 3 0.8518361666965517 3.1657537542640584 4198.0 15.983176427488813 0.0 - - - - - - - 225.0 8 11 E2F3 E2F transcription factor 3 1163 149 C20140716_OR021_01 C20140716_OR021_01 TB442438.[MT7]-LDPSDANFVDVIHTNAAR.3y6_1.heavy 700.359 / 669.343 67204.0 38.29460144042969 44 14 10 10 10 1.8940181823249023 36.33469957193334 0.0 3 0.9317985980467335 4.698572924727893 67204.0 115.72120155292728 0.0 - - - - - - - 310.6666666666667 134 3 PNLIPRP3 pancreatic lipase-related protein 3 1165 149 C20140716_OR021_01 C20140716_OR021_01 TB442438.[MT7]-LDPSDANFVDVIHTNAAR.3b5_1.heavy 700.359 / 672.332 35058.0 38.29460144042969 44 14 10 10 10 1.8940181823249023 36.33469957193334 0.0 3 0.9317985980467335 4.698572924727893 35058.0 47.1508055845582 1.0 - - - - - - - 466.0 147 1 PNLIPRP3 pancreatic lipase-related protein 3 1167 149 C20140716_OR021_01 C20140716_OR021_01 TB442438.[MT7]-LDPSDANFVDVIHTNAAR.3b7_1.heavy 700.359 / 857.412 44026.0 38.29460144042969 44 14 10 10 10 1.8940181823249023 36.33469957193334 0.0 3 0.9317985980467335 4.698572924727893 44026.0 80.87527165012244 0.0 - - - - - - - 271.3333333333333 88 3 PNLIPRP3 pancreatic lipase-related protein 3 1169 149 C20140716_OR021_01 C20140716_OR021_01 TB442438.[MT7]-LDPSDANFVDVIHTNAAR.3y9_1.heavy 700.359 / 996.522 58003.0 38.29460144042969 44 14 10 10 10 1.8940181823249023 36.33469957193334 0.0 3 0.9317985980467335 4.698572924727893 58003.0 172.1791633113579 0.0 - - - - - - - 765.4285714285714 116 7 PNLIPRP3 pancreatic lipase-related protein 3 1171 150 C20140716_OR021_01 C20140716_OR021_01 TB420252.[MT7]-DVK[MT7]PENFLIGR.2b3_1.heavy 788.458 / 631.402 5981.0 34.719600677490234 42 12 10 10 10 1.2345790000608101 53.25558427230688 0.0 3 0.8844575783945595 3.59516235082098 5981.0 13.651645853138593 0.0 - - - - - - - 218.5 11 10 CSNK1G3;CSNK1G1 casein kinase 1, gamma 3;casein kinase 1, gamma 1 1173 150 C20140716_OR021_01 C20140716_OR021_01 TB420252.[MT7]-DVK[MT7]PENFLIGR.2y8_1.heavy 788.458 / 945.515 11678.0 34.719600677490234 42 12 10 10 10 1.2345790000608101 53.25558427230688 0.0 3 0.8844575783945595 3.59516235082098 11678.0 71.29726315789475 0.0 - - - - - - - 237.5 23 6 CSNK1G3;CSNK1G1 casein kinase 1, gamma 3;casein kinase 1, gamma 1 1175 150 C20140716_OR021_01 C20140716_OR021_01 TB420252.[MT7]-DVK[MT7]PENFLIGR.2b6_1.heavy 788.458 / 971.54 570.0 34.719600677490234 42 12 10 10 10 1.2345790000608101 53.25558427230688 0.0 3 0.8844575783945595 3.59516235082098 570.0 1.6798735511064278 4.0 - - - - - - - 0.0 1 0 CSNK1G3;CSNK1G1 casein kinase 1, gamma 3;casein kinase 1, gamma 1 1177 150 C20140716_OR021_01 C20140716_OR021_01 TB420252.[MT7]-DVK[MT7]PENFLIGR.2y10_2.heavy 788.458 / 658.894 11963.0 34.719600677490234 42 12 10 10 10 1.2345790000608101 53.25558427230688 0.0 3 0.8844575783945595 3.59516235082098 11963.0 99.85956842105264 0.0 - - - - - - - 218.5 23 10 CSNK1G3;CSNK1G1 casein kinase 1, gamma 3;casein kinase 1, gamma 1 1179 151 C20140716_OR021_01 C20140716_OR021_01 TB435950.[MT7]-SRAPQLHLEYR.2y8_1.heavy 757.421 / 1055.56 914.0 26.951066970825195 19 8 0 5 6 0.5667102924707781 95.4868516747238 0.0428009033203125 6 0.771956899404525 2.5335661666110907 914.0 7.064541484716157 3.0 - - - - - - - 200.125 2 8 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1181 151 C20140716_OR021_01 C20140716_OR021_01 TB435950.[MT7]-SRAPQLHLEYR.2y9_1.heavy 757.421 / 1126.6 1600.0 26.951066970825195 19 8 0 5 6 0.5667102924707781 95.4868516747238 0.0428009033203125 6 0.771956899404525 2.5335661666110907 1600.0 17.553680118664005 0.0 - - - - - - - 179.57142857142858 3 7 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1183 151 C20140716_OR021_01 C20140716_OR021_01 TB435950.[MT7]-SRAPQLHLEYR.2b6_1.heavy 757.421 / 797.475 457.0 26.951066970825195 19 8 0 5 6 0.5667102924707781 95.4868516747238 0.0428009033203125 6 0.771956899404525 2.5335661666110907 457.0 2.395923459839332 8.0 - - - - - - - 0.0 1 0 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1185 151 C20140716_OR021_01 C20140716_OR021_01 TB435950.[MT7]-SRAPQLHLEYR.2b9_1.heavy 757.421 / 1176.66 N/A 26.951066970825195 19 8 0 5 6 0.5667102924707781 95.4868516747238 0.0428009033203125 6 0.771956899404525 2.5335661666110907 800.0 2.4627840990083265 4.0 - - - - - - - 228.66666666666666 25 12 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1187 152 C20140716_OR021_01 C20140716_OR021_01 TB420397.[MT7]-GLPGPQGPTGPSGPPGVGK[MT7].3b6_1.heavy 649.03 / 694.4 14607.0 28.828774452209473 37 14 10 3 10 1.962871921522759 42.88987502896285 0.07309913635253906 3 0.9445007700662038 5.214222406961101 14607.0 95.1082011787177 0.0 - - - - - - - 221.41666666666666 29 12 COL10A1 collagen, type X, alpha 1 1189 152 C20140716_OR021_01 C20140716_OR021_01 TB420397.[MT7]-GLPGPQGPTGPSGPPGVGK[MT7].3y6_1.heavy 649.03 / 698.432 20472.0 28.828774452209473 37 14 10 3 10 1.962871921522759 42.88987502896285 0.07309913635253906 3 0.9445007700662038 5.214222406961101 20472.0 63.674213381555155 0.0 - - - - - - - 243.6 40 10 COL10A1 collagen, type X, alpha 1 1191 152 C20140716_OR021_01 C20140716_OR021_01 TB420397.[MT7]-GLPGPQGPTGPSGPPGVGK[MT7].3b7_1.heavy 649.03 / 751.422 6971.0 28.828774452209473 37 14 10 3 10 1.962871921522759 42.88987502896285 0.07309913635253906 3 0.9445007700662038 5.214222406961101 6971.0 12.597434072332689 0.0 - - - - - - - 308.35714285714283 13 14 COL10A1 collagen, type X, alpha 1 1193 152 C20140716_OR021_01 C20140716_OR021_01 TB420397.[MT7]-GLPGPQGPTGPSGPPGVGK[MT7].3y5_1.heavy 649.03 / 601.379 19033.0 28.828774452209473 37 14 10 3 10 1.962871921522759 42.88987502896285 0.07309913635253906 3 0.9445007700662038 5.214222406961101 19033.0 49.24498652839205 0.0 - - - - - - - 790.4285714285714 38 7 COL10A1 collagen, type X, alpha 1 1195 153 C20140716_OR021_01 C20140716_OR021_01 TB420110.[MT7]-NLTEENTEK[MT7].3b6_1.heavy 455.908 / 845.412 1801.0 20.097224235534668 45 18 10 7 10 5.315567427572644 18.81266701298624 0.029300689697265625 3 0.988318947215887 11.407690158308663 1801.0 47.03011333333333 0.0 - - - - - - - 136.36363636363637 3 11 MRVI1 murine retrovirus integration site 1 homolog 1197 153 C20140716_OR021_01 C20140716_OR021_01 TB420110.[MT7]-NLTEENTEK[MT7].3y3_1.heavy 455.908 / 521.305 11558.0 20.097224235534668 45 18 10 7 10 5.315567427572644 18.81266701298624 0.029300689697265625 3 0.988318947215887 11.407690158308663 11558.0 19.579942136041858 0.0 - - - - - - - 665.4 23 10 MRVI1 murine retrovirus integration site 1 homolog 1199 153 C20140716_OR021_01 C20140716_OR021_01 TB420110.[MT7]-NLTEENTEK[MT7].3b4_1.heavy 455.908 / 602.327 16662.0 20.097224235534668 45 18 10 7 10 5.315567427572644 18.81266701298624 0.029300689697265625 3 0.988318947215887 11.407690158308663 16662.0 50.705731835205995 0.0 - - - - - - - 727.8181818181819 33 11 MRVI1 murine retrovirus integration site 1 homolog 1201 153 C20140716_OR021_01 C20140716_OR021_01 TB420110.[MT7]-NLTEENTEK[MT7].3b5_1.heavy 455.908 / 731.369 6555.0 20.097224235534668 45 18 10 7 10 5.315567427572644 18.81266701298624 0.029300689697265625 3 0.988318947215887 11.407690158308663 6555.0 49.818 0.0 - - - - - - - 162.5 13 20 MRVI1 murine retrovirus integration site 1 homolog 1203 154 C20140716_OR021_01 C20140716_OR021_01 TB420112.[MT7]-NLTEENTEK[MT7].2y4_1.heavy 683.359 / 635.348 4758.0 20.104549407958984 44 17 10 7 10 87.23790444259708 1.146290716620783 0.029300689697265625 3 0.9784941347638799 8.400448999410871 4758.0 49.195822222222226 0.0 - - - - - - - 192.65 9 20 MRVI1 murine retrovirus integration site 1 homolog 1205 154 C20140716_OR021_01 C20140716_OR021_01 TB420112.[MT7]-NLTEENTEK[MT7].2y8_1.heavy 683.359 / 1107.56 4557.0 20.104549407958984 44 17 10 7 10 87.23790444259708 1.146290716620783 0.029300689697265625 3 0.9784941347638799 8.400448999410871 4557.0 31.898999999999997 0.0 - - - - - - - 135.35294117647058 9 17 MRVI1 murine retrovirus integration site 1 homolog 1207 154 C20140716_OR021_01 C20140716_OR021_01 TB420112.[MT7]-NLTEENTEK[MT7].2y3_1.heavy 683.359 / 521.305 2755.0 20.104549407958984 44 17 10 7 10 87.23790444259708 1.146290716620783 0.029300689697265625 3 0.9784941347638799 8.400448999410871 2755.0 8.713999999999999 1.0 - - - - - - - 665.2857142857143 5 14 MRVI1 murine retrovirus integration site 1 homolog 1209 154 C20140716_OR021_01 C20140716_OR021_01 TB420112.[MT7]-NLTEENTEK[MT7].2y7_1.heavy 683.359 / 994.481 7212.0 20.104549407958984 44 17 10 7 10 87.23790444259708 1.146290716620783 0.029300689697265625 3 0.9784941347638799 8.400448999410871 7212.0 100.00640000000001 0.0 - - - - - - - 103.84615384615384 14 13 MRVI1 murine retrovirus integration site 1 homolog 1211 155 C20140716_OR021_01 C20140716_OR021_01 TB420524.[MT7]-GEQGFPGLPGTLGYPGIPGAAGLK[MT7].4y4_1.heavy 636.353 / 532.357 3008.0 45.39489936828613 42 18 10 6 8 7.8566754670631465 12.728029866986521 0.039600372314453125 4 0.9803104190726737 8.780696320416546 3008.0 6.751122194513716 2.0 - - - - - - - 254.69230769230768 6 13 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1213 155 C20140716_OR021_01 C20140716_OR021_01 TB420524.[MT7]-GEQGFPGLPGTLGYPGIPGAAGLK[MT7].4b7_1.heavy 636.353 / 817.396 2407.0 45.39489936828613 42 18 10 6 8 7.8566754670631465 12.728029866986521 0.039600372314453125 4 0.9803104190726737 8.780696320416546 2407.0 12.433157936618457 1.0 - - - - - - - 200.5 4 8 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1215 155 C20140716_OR021_01 C20140716_OR021_01 TB420524.[MT7]-GEQGFPGLPGTLGYPGIPGAAGLK[MT7].4b5_1.heavy 636.353 / 663.322 6418.0 45.39489936828613 42 18 10 6 8 7.8566754670631465 12.728029866986521 0.039600372314453125 4 0.9803104190726737 8.780696320416546 6418.0 78.55119840399003 0.0 - - - - - - - 200.66666666666666 12 6 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1217 155 C20140716_OR021_01 C20140716_OR021_01 TB420524.[MT7]-GEQGFPGLPGTLGYPGIPGAAGLK[MT7].4y7_1.heavy 636.353 / 757.469 4814.0 45.39489936828613 42 18 10 6 8 7.8566754670631465 12.728029866986521 0.039600372314453125 4 0.9803104190726737 8.780696320416546 4814.0 8.408509731874219 0.0 - - - - - - - 210.7 9 10 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1219 156 C20140716_OR021_01 C20140716_OR021_01 TB442431.[MT7]-SGLDVMPNISDVLLRK[MT7].3y7_1.heavy 682.394 / 974.612 25426.0 45.1244010925293 50 20 10 10 10 6.3979749105578865 15.629945630918435 0.0 3 0.9912322127434123 13.170417429863356 25426.0 188.36691215880893 0.0 - - - - - - - 240.88888888888889 50 9 MRVI1 murine retrovirus integration site 1 homolog 1221 156 C20140716_OR021_01 C20140716_OR021_01 TB442431.[MT7]-SGLDVMPNISDVLLRK[MT7].3b6_1.heavy 682.394 / 747.383 18487.0 45.1244010925293 50 20 10 10 10 6.3979749105578865 15.629945630918435 0.0 3 0.9912322127434123 13.170417429863356 18487.0 81.611384336319 1.0 - - - - - - - 236.54545454545453 42 11 MRVI1 murine retrovirus integration site 1 homolog 1223 156 C20140716_OR021_01 C20140716_OR021_01 TB442431.[MT7]-SGLDVMPNISDVLLRK[MT7].3b4_1.heavy 682.394 / 517.274 63268.0 45.1244010925293 50 20 10 10 10 6.3979749105578865 15.629945630918435 0.0 3 0.9912322127434123 13.170417429863356 63268.0 171.299102977946 0.0 - - - - - - - 292.4 126 5 MRVI1 murine retrovirus integration site 1 homolog 1225 156 C20140716_OR021_01 C20140716_OR021_01 TB442431.[MT7]-SGLDVMPNISDVLLRK[MT7].3b5_1.heavy 682.394 / 616.342 36649.0 45.1244010925293 50 20 10 10 10 6.3979749105578865 15.629945630918435 0.0 3 0.9912322127434123 13.170417429863356 36649.0 398.82146029793637 0.0 - - - - - - - 260.1 73 10 MRVI1 murine retrovirus integration site 1 homolog 1227 157 C20140716_OR021_01 C20140716_OR021_01 TB420525.[MT7]-LTHVNYTSPLVAMHFTDVVK[MT7].4y5_1.heavy 640.851 / 705.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1229 157 C20140716_OR021_01 C20140716_OR021_01 TB420525.[MT7]-LTHVNYTSPLVAMHFTDVVK[MT7].4b4_1.heavy 640.851 / 595.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1231 157 C20140716_OR021_01 C20140716_OR021_01 TB420525.[MT7]-LTHVNYTSPLVAMHFTDVVK[MT7].4y7_1.heavy 640.851 / 989.554 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1233 157 C20140716_OR021_01 C20140716_OR021_01 TB420525.[MT7]-LTHVNYTSPLVAMHFTDVVK[MT7].4y6_1.heavy 640.851 / 852.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1235 158 C20140716_OR021_01 C20140716_OR021_01 TB420258.[MT7]-ESEVYYILC[CAM]K[MT7].3b6_1.heavy 531.281 / 915.422 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEFB121 defensin, beta 121 1237 158 C20140716_OR021_01 C20140716_OR021_01 TB420258.[MT7]-ESEVYYILC[CAM]K[MT7].3y3_1.heavy 531.281 / 564.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEFB121 defensin, beta 121 1239 158 C20140716_OR021_01 C20140716_OR021_01 TB420258.[MT7]-ESEVYYILC[CAM]K[MT7].3b4_1.heavy 531.281 / 589.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEFB121 defensin, beta 121 1241 158 C20140716_OR021_01 C20140716_OR021_01 TB420258.[MT7]-ESEVYYILC[CAM]K[MT7].3b5_1.heavy 531.281 / 752.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEFB121 defensin, beta 121 1243 159 C20140716_OR021_01 C20140716_OR021_01 TB420526.[MT7]-LTHVNYTSPLVAMHFTDVVK[MT7].3y7_1.heavy 854.133 / 989.554 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1245 159 C20140716_OR021_01 C20140716_OR021_01 TB420526.[MT7]-LTHVNYTSPLVAMHFTDVVK[MT7].3y6_1.heavy 854.133 / 852.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1247 159 C20140716_OR021_01 C20140716_OR021_01 TB420526.[MT7]-LTHVNYTSPLVAMHFTDVVK[MT7].3b4_1.heavy 854.133 / 595.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1249 159 C20140716_OR021_01 C20140716_OR021_01 TB420526.[MT7]-LTHVNYTSPLVAMHFTDVVK[MT7].3y5_1.heavy 854.133 / 705.426 N/A N/A - - - - - - - - - 0.0 - - - - - - - ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1251 160 C20140716_OR021_01 C20140716_OR021_01 TB420259.[MT7]-ESEVYYILC[CAM]K[MT7].2y5_1.heavy 796.418 / 840.477 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEFB121 defensin, beta 121 1253 160 C20140716_OR021_01 C20140716_OR021_01 TB420259.[MT7]-ESEVYYILC[CAM]K[MT7].2b4_1.heavy 796.418 / 589.295 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEFB121 defensin, beta 121 1255 160 C20140716_OR021_01 C20140716_OR021_01 TB420259.[MT7]-ESEVYYILC[CAM]K[MT7].2y3_1.heavy 796.418 / 564.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEFB121 defensin, beta 121 1257 160 C20140716_OR021_01 C20140716_OR021_01 TB420259.[MT7]-ESEVYYILC[CAM]K[MT7].2b5_1.heavy 796.418 / 752.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - DEFB121 defensin, beta 121 1259 161 C20140716_OR021_01 C20140716_OR021_01 TB420343.[MT7]-LAGC[CAM]TFQDIILEAR.3y7_1.heavy 584.314 / 829.478 N/A N/A - - - - - - - - - 0.0 - - - - - - - DMBX1 diencephalon/mesencephalon homeobox 1 1261 161 C20140716_OR021_01 C20140716_OR021_01 TB420343.[MT7]-LAGC[CAM]TFQDIILEAR.3b4_1.heavy 584.314 / 546.283 N/A N/A - - - - - - - - - 0.0 - - - - - - - DMBX1 diencephalon/mesencephalon homeobox 1 1263 161 C20140716_OR021_01 C20140716_OR021_01 TB420343.[MT7]-LAGC[CAM]TFQDIILEAR.3b5_1.heavy 584.314 / 647.33 N/A N/A - - - - - - - - - 0.0 - - - - - - - DMBX1 diencephalon/mesencephalon homeobox 1 1265 161 C20140716_OR021_01 C20140716_OR021_01 TB420343.[MT7]-LAGC[CAM]TFQDIILEAR.3y5_1.heavy 584.314 / 601.367 N/A N/A - - - - - - - - - 0.0 - - - - - - - DMBX1 diencephalon/mesencephalon homeobox 1 1267 162 C20140716_OR021_01 C20140716_OR021_01 TB420344.[MT7]-LAGC[CAM]TFQDIILEAR.2b8_1.heavy 875.968 / 1037.48 15962.0 46.33345127105713 40 14 10 6 10 2.0076376882256257 40.791483872538535 0.033000946044921875 3 0.9464204232660541 5.307674568672231 15962.0 -1.5 1.0 - - - - - - - 240.16666666666666 31 6 DMBX1 diencephalon/mesencephalon homeobox 1 1269 162 C20140716_OR021_01 C20140716_OR021_01 TB420344.[MT7]-LAGC[CAM]TFQDIILEAR.2y9_1.heavy 875.968 / 1104.6 10866.0 46.33345127105713 40 14 10 6 10 2.0076376882256257 40.791483872538535 0.033000946044921875 3 0.9464204232660541 5.307674568672231 10866.0 -0.18072349272349442 0.0 - - - - - - - 302.14285714285717 21 7 DMBX1 diencephalon/mesencephalon homeobox 1 1271 162 C20140716_OR021_01 C20140716_OR021_01 TB420344.[MT7]-LAGC[CAM]TFQDIILEAR.2y6_1.heavy 875.968 / 714.451 12404.0 46.33345127105713 40 14 10 6 10 2.0076376882256257 40.791483872538535 0.033000946044921875 3 0.9464204232660541 5.307674568672231 12404.0 -3.230208333333337 0.0 - - - - - - - 144.0 24 6 DMBX1 diencephalon/mesencephalon homeobox 1 1273 162 C20140716_OR021_01 C20140716_OR021_01 TB420344.[MT7]-LAGC[CAM]TFQDIILEAR.2y10_1.heavy 875.968 / 1205.65 5673.0 46.33345127105713 40 14 10 6 10 2.0076376882256257 40.791483872538535 0.033000946044921875 3 0.9464204232660541 5.307674568672231 5673.0 -11.818749999999994 0.0 - - - - - - - 211.4 11 5 DMBX1 diencephalon/mesencephalon homeobox 1 1275 163 C20140716_OR021_01 C20140716_OR021_01 TB442173.[MT7]-THYPDVVMR.2y4_1.heavy 631.328 / 504.296 4708.0 27.243000030517578 43 13 10 10 10 1.9601260929660123 51.01712607104912 0.0 3 0.9216247079626942 4.379198452956938 4708.0 24.913347196658645 0.0 - - - - - - - 261.3333333333333 9 9 DMBX1 diencephalon/mesencephalon homeobox 1 1277 163 C20140716_OR021_01 C20140716_OR021_01 TB442173.[MT7]-THYPDVVMR.2y8_1.heavy 631.328 / 1016.5 6277.0 27.243000030517578 43 13 10 10 10 1.9601260929660123 51.01712607104912 0.0 3 0.9216247079626942 4.379198452956938 6277.0 27.353209168791054 0.0 - - - - - - - 268.8 12 5 DMBX1 diencephalon/mesencephalon homeobox 1 1279 163 C20140716_OR021_01 C20140716_OR021_01 TB442173.[MT7]-THYPDVVMR.2y6_1.heavy 631.328 / 716.376 6389.0 27.243000030517578 43 13 10 10 10 1.9601260929660123 51.01712607104912 0.0 3 0.9216247079626942 4.379198452956938 6389.0 56.38828571428571 1.0 - - - - - - - 149.33333333333334 12 6 DMBX1 diencephalon/mesencephalon homeobox 1 1281 163 C20140716_OR021_01 C20140716_OR021_01 TB442173.[MT7]-THYPDVVMR.2y7_1.heavy 631.328 / 879.439 5044.0 27.243000030517578 43 13 10 10 10 1.9601260929660123 51.01712607104912 0.0 3 0.9216247079626942 4.379198452956938 5044.0 55.50651785714285 0.0 - - - - - - - 224.0 10 7 DMBX1 diencephalon/mesencephalon homeobox 1 1283 164 C20140716_OR021_01 C20140716_OR021_01 TB442178.[MT7]-DIQFDSEK[MT7].3y3_1.heavy 423.89 / 507.289 31970.0 27.425600051879883 48 18 10 10 10 4.295614767681288 23.279554943419328 0.0 3 0.9878065586140166 11.164953974057715 31970.0 143.24632697195344 0.0 - - - - - - - 641.0 63 7 ALOX5 arachidonate 5-lipoxygenase 1285 164 C20140716_OR021_01 C20140716_OR021_01 TB442178.[MT7]-DIQFDSEK[MT7].3b5_1.heavy 423.89 / 763.374 1861.0 27.425600051879883 48 18 10 10 10 4.295614767681288 23.279554943419328 0.0 3 0.9878065586140166 11.164953974057715 1861.0 32.95165137614679 0.0 - - - - - - - 191.25 3 4 ALOX5 arachidonate 5-lipoxygenase 1287 164 C20140716_OR021_01 C20140716_OR021_01 TB442178.[MT7]-DIQFDSEK[MT7].3y4_1.heavy 423.89 / 622.316 6131.0 27.425600051879883 48 18 10 10 10 4.295614767681288 23.279554943419328 0.0 3 0.9878065586140166 11.164953974057715 6131.0 27.60432200992914 1.0 - - - - - - - 200.33333333333334 14 6 ALOX5 arachidonate 5-lipoxygenase 1289 164 C20140716_OR021_01 C20140716_OR021_01 TB442178.[MT7]-DIQFDSEK[MT7].3b3_1.heavy 423.89 / 501.279 40619.0 27.425600051879883 48 18 10 10 10 4.295614767681288 23.279554943419328 0.0 3 0.9878065586140166 11.164953974057715 40619.0 122.0341135054248 0.0 - - - - - - - 229.8 81 10 ALOX5 arachidonate 5-lipoxygenase 1291 165 C20140716_OR021_01 C20140716_OR021_01 TB442320.[MT7]-LGHNLFGIYQK[MT7].2y5_1.heavy 789.456 / 752.442 4119.0 37.14939880371094 44 14 10 10 10 2.559593691694925 33.455626520910776 0.0 3 0.9412894552002672 5.068229369136375 4119.0 21.38266258867508 0.0 - - - - - - - 372.4 8 5 ITLN2 intelectin 2 1293 165 C20140716_OR021_01 C20140716_OR021_01 TB442320.[MT7]-LGHNLFGIYQK[MT7].2b4_1.heavy 789.456 / 566.317 4119.0 37.14939880371094 44 14 10 10 10 2.559593691694925 33.455626520910776 0.0 3 0.9412894552002672 5.068229369136375 4119.0 43.357894736842105 0.0 - - - - - - - 251.22222222222223 8 9 ITLN2 intelectin 2 1295 165 C20140716_OR021_01 C20140716_OR021_01 TB442320.[MT7]-LGHNLFGIYQK[MT7].2y6_1.heavy 789.456 / 899.511 2790.0 37.14939880371094 44 14 10 10 10 2.559593691694925 33.455626520910776 0.0 3 0.9412894552002672 5.068229369136375 2790.0 4.642998544564732 1.0 - - - - - - - 247.0 5 7 ITLN2 intelectin 2 1297 165 C20140716_OR021_01 C20140716_OR021_01 TB442320.[MT7]-LGHNLFGIYQK[MT7].2b7_1.heavy 789.456 / 883.491 797.0 37.14939880371094 44 14 10 10 10 2.559593691694925 33.455626520910776 0.0 3 0.9412894552002672 5.068229369136375 797.0 0.39924812030075185 6.0 - - - - - - - 243.83333333333334 5 6 ITLN2 intelectin 2 1299 166 C20140716_OR021_01 C20140716_OR021_01 TB420147.[MT7]-GFPGPPGSPGQK[MT7].3y7_1.heavy 471.929 / 814.454 798.0 27.097225189208984 38 20 10 2 6 3.617198459047264 27.645704578326914 0.087799072265625 6 0.9900570962181205 12.366455753403566 798.0 1.6680000000000001 4.0 - - - - - - - 0.0 1 0 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1301 166 C20140716_OR021_01 C20140716_OR021_01 TB420147.[MT7]-GFPGPPGSPGQK[MT7].3y3_1.heavy 471.929 / 476.295 2736.0 27.097225189208984 38 20 10 2 6 3.617198459047264 27.645704578326914 0.087799072265625 6 0.9900570962181205 12.366455753403566 2736.0 1.0 6.0 - - - - - - - 270.75 7 8 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1303 166 C20140716_OR021_01 C20140716_OR021_01 TB420147.[MT7]-GFPGPPGSPGQK[MT7].3b4_1.heavy 471.929 / 503.273 12654.0 27.097225189208984 38 20 10 2 6 3.617198459047264 27.645704578326914 0.087799072265625 6 0.9900570962181205 12.366455753403566 12654.0 55.71523170731707 1.0 - - - - - - - 228.0 25 5 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1305 166 C20140716_OR021_01 C20140716_OR021_01 TB420147.[MT7]-GFPGPPGSPGQK[MT7].3y4_1.heavy 471.929 / 573.348 5700.0 27.097225189208984 38 20 10 2 6 3.617198459047264 27.645704578326914 0.087799072265625 6 0.9900570962181205 12.366455753403566 5700.0 30.0 0.0 - - - - - - - 205.2 11 5 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1307 167 C20140716_OR021_01 C20140716_OR021_01 TB420430.[MT7]-VVGAEVAY[MT7]FIDVLMK[MT7].3b5_1.heavy 696.071 / 600.347 762.0 54.636199951171875 43 15 10 10 8 2.1719521558793575 37.60501081572653 0.0 4 0.9566028101559234 5.902667522799234 762.0 6.253298956210753 10.0 - - - - - - - 0.0 1 0 PNLIPRP3 pancreatic lipase-related protein 3 1309 167 C20140716_OR021_01 C20140716_OR021_01 TB420430.[MT7]-VVGAEVAY[MT7]FIDVLMK[MT7].3y4_1.heavy 696.071 / 634.408 519.0 54.636199951171875 43 15 10 10 8 2.1719521558793575 37.60501081572653 0.0 4 0.9566028101559234 5.902667522799234 519.0 1.0467625899280573 21.0 - - - - - - - 0.0 1 0 PNLIPRP3 pancreatic lipase-related protein 3 1311 167 C20140716_OR021_01 C20140716_OR021_01 TB420430.[MT7]-VVGAEVAY[MT7]FIDVLMK[MT7].3y5_1.heavy 696.071 / 749.435 519.0 54.636199951171875 43 15 10 10 8 2.1719521558793575 37.60501081572653 0.0 4 0.9566028101559234 5.902667522799234 519.0 4.358508577753182 4.0 - - - - - - - 0.0 1 0 PNLIPRP3 pancreatic lipase-related protein 3 1313 167 C20140716_OR021_01 C20140716_OR021_01 TB420430.[MT7]-VVGAEVAY[MT7]FIDVLMK[MT7].3b8_2.heavy 696.071 / 539.313 1108.0 54.636199951171875 43 15 10 10 8 2.1719521558793575 37.60501081572653 0.0 4 0.9566028101559234 5.902667522799234 1108.0 19.496538461538464 1.0 - - - - - - - 113.85714285714286 2 7 PNLIPRP3 pancreatic lipase-related protein 3 1315 168 C20140716_OR021_01 C20140716_OR021_01 TB442176.[MT7]-IGC[CAM]GNFGELR.2b8_1.heavy 633.823 / 979.442 14582.0 33.17940139770508 41 17 10 6 8 1.0425036311643743 54.96810129968241 0.0391998291015625 4 0.9740742608144679 7.64810814493502 14582.0 69.91557306215084 0.0 - - - - - - - 227.55555555555554 29 9 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1317 168 C20140716_OR021_01 C20140716_OR021_01 TB442176.[MT7]-IGC[CAM]GNFGELR.2y9_1.heavy 633.823 / 1009.45 62551.0 33.17940139770508 41 17 10 6 8 1.0425036311643743 54.96810129968241 0.0391998291015625 4 0.9740742608144679 7.64810814493502 62551.0 206.46716796875 0.0 - - - - - - - 224.0 125 8 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1319 168 C20140716_OR021_01 C20140716_OR021_01 TB442176.[MT7]-IGC[CAM]GNFGELR.2b5_1.heavy 633.823 / 646.31 4349.0 33.17940139770508 41 17 10 6 8 1.0425036311643743 54.96810129968241 0.0391998291015625 4 0.9740742608144679 7.64810814493502 4349.0 9.792306002491022 0.0 - - - - - - - 657.8571428571429 8 7 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1321 168 C20140716_OR021_01 C20140716_OR021_01 TB442176.[MT7]-IGC[CAM]GNFGELR.2y7_1.heavy 633.823 / 792.4 4861.0 33.17940139770508 41 17 10 6 8 1.0425036311643743 54.96810129968241 0.0391998291015625 4 0.9740742608144679 7.64810814493502 4861.0 6.867453125 2.0 - - - - - - - 347.42857142857144 46 7 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1323 169 C20140716_OR021_01 C20140716_OR021_01 TB420531.[MT7]-VHLIGHSLGAHLAGEAGSRIPGLGR.4y13_2.heavy 655.623 / 620.841 805.0 30.903300762176514 32 13 10 7 2 1.295092788466372 46.72838057563323 0.029600143432617188 12 0.9231937781104557 4.424298976012691 805.0 0.8098996413082873 7.0 - - - - - - - 232.33333333333334 3 15 PNLIPRP3 pancreatic lipase-related protein 3 1325 169 C20140716_OR021_01 C20140716_OR021_01 TB420531.[MT7]-VHLIGHSLGAHLAGEAGSRIPGLGR.4y6_1.heavy 655.623 / 612.383 1073.0 30.903300762176514 32 13 10 7 2 1.295092788466372 46.72838057563323 0.029600143432617188 12 0.9231937781104557 4.424298976012691 1073.0 0.7495112708520528 22.0 - - - - - - - 747.0714285714286 3 14 PNLIPRP3 pancreatic lipase-related protein 3 1327 169 C20140716_OR021_01 C20140716_OR021_01 TB420531.[MT7]-VHLIGHSLGAHLAGEAGSRIPGLGR.4y17_2.heavy 655.623 / 809.942 983.0 30.903300762176514 32 13 10 7 2 1.295092788466372 46.72838057563323 0.029600143432617188 12 0.9231937781104557 4.424298976012691 983.0 1.6935820895522387 1.0 - - - - - - - 0.0 1 0 PNLIPRP3 pancreatic lipase-related protein 3 1329 169 C20140716_OR021_01 C20140716_OR021_01 TB420531.[MT7]-VHLIGHSLGAHLAGEAGSRIPGLGR.4y14_2.heavy 655.623 / 677.383 1967.0 30.903300762176514 32 13 10 7 2 1.295092788466372 46.72838057563323 0.029600143432617188 12 0.9231937781104557 4.424298976012691 1967.0 4.493170293112749 2.0 - - - - - - - 211.27272727272728 3 22 PNLIPRP3 pancreatic lipase-related protein 3 1331 170 C20140716_OR021_01 C20140716_OR021_01 TB442428.[MT7]-IYDITNVLEGIHLIK[MT7].4y4_1.heavy 508.054 / 654.442 2931.0 51.43440055847168 47 20 10 7 10 5.639868279363078 17.730910554402733 0.028598785400390625 3 0.9910898489975654 13.064621751106854 2931.0 118.18702124311565 0.0 - - - - - - - 139.0 5 4 E2F3 E2F transcription factor 3 1333 170 C20140716_OR021_01 C20140716_OR021_01 TB442428.[MT7]-IYDITNVLEGIHLIK[MT7].4b4_1.heavy 508.054 / 649.368 3147.0 51.43440055847168 47 20 10 7 10 5.639868279363078 17.730910554402733 0.028598785400390625 3 0.9910898489975654 13.064621751106854 3147.0 146.6908064516129 0.0 - - - - - - - 139.0 6 8 E2F3 E2F transcription factor 3 1335 170 C20140716_OR021_01 C20140716_OR021_01 TB442428.[MT7]-IYDITNVLEGIHLIK[MT7].4y3_1.heavy 508.054 / 517.383 4968.0 51.43440055847168 47 20 10 7 10 5.639868279363078 17.730910554402733 0.028598785400390625 3 0.9910898489975654 13.064621751106854 4968.0 37.7243051685157 0.0 - - - - - - - 101.6470588235294 9 17 E2F3 E2F transcription factor 3 1337 170 C20140716_OR021_01 C20140716_OR021_01 TB442428.[MT7]-IYDITNVLEGIHLIK[MT7].4b3_1.heavy 508.054 / 536.284 12342.0 51.43440055847168 47 20 10 7 10 5.639868279363078 17.730910554402733 0.028598785400390625 3 0.9910898489975654 13.064621751106854 12342.0 450.5331707317073 0.0 - - - - - - - 130.14285714285714 24 14 E2F3 E2F transcription factor 3 1339 171 C20140716_OR021_01 C20140716_OR021_01 TB442422.[MT7]-DDLEALGHMFMYFLR.3y7_1.heavy 667.994 / 1007.48 283.0 54.5890007019043 46 16 10 10 10 4.258423084594023 23.482871009641237 0.0 3 0.9671224265875343 6.78758646305299 283.0 2.828111444778111 0.0 - - - - - - - 0.0 0 0 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1341 171 C20140716_OR021_01 C20140716_OR021_01 TB442422.[MT7]-DDLEALGHMFMYFLR.3y6_1.heavy 667.994 / 876.444 188.0 54.5890007019043 46 16 10 10 10 4.258423084594023 23.482871009641237 0.0 3 0.9671224265875343 6.78758646305299 188.0 17.961230769230767 0.0 - - - - - - - 0.0 0 0 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1343 171 C20140716_OR021_01 C20140716_OR021_01 TB442422.[MT7]-DDLEALGHMFMYFLR.3b4_1.heavy 667.994 / 617.29 592.0 54.5890007019043 46 16 10 10 10 4.258423084594023 23.482871009641237 0.0 3 0.9671224265875343 6.78758646305299 592.0 5.208510638297872 0.0 - - - - - - - 0.0 1 0 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1345 171 C20140716_OR021_01 C20140716_OR021_01 TB442422.[MT7]-DDLEALGHMFMYFLR.3b5_1.heavy 667.994 / 688.327 377.0 54.5890007019043 46 16 10 10 10 4.258423084594023 23.482871009641237 0.0 3 0.9671224265875343 6.78758646305299 377.0 32.37179104477612 0.0 - - - - - - - 0.0 0 0 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1347 172 C20140716_OR021_01 C20140716_OR021_01 TB442170.[MT7]-AMENLFINR.2y8_1.heavy 626.335 / 1036.52 37532.0 38.33940124511719 40 10 10 10 10 0.9940706874129587 66.19633802431133 0.0 3 0.8432358974473362 3.0753538539567984 37532.0 158.4791842048682 0.0 - - - - - - - 175.0 75 4 ALOX5 arachidonate 5-lipoxygenase 1349 172 C20140716_OR021_01 C20140716_OR021_01 TB442170.[MT7]-AMENLFINR.2b4_1.heavy 626.335 / 590.273 12355.0 38.33940124511719 40 10 10 10 10 0.9940706874129587 66.19633802431133 0.0 3 0.8432358974473362 3.0753538539567984 12355.0 28.33493059994521 0.0 - - - - - - - 375.44444444444446 24 9 ALOX5 arachidonate 5-lipoxygenase 1351 172 C20140716_OR021_01 C20140716_OR021_01 TB442170.[MT7]-AMENLFINR.2y6_1.heavy 626.335 / 776.441 11073.0 38.33940124511719 40 10 10 10 10 0.9940706874129587 66.19633802431133 0.0 3 0.8432358974473362 3.0753538539567984 11073.0 71.11907510729614 0.0 - - - - - - - 233.28571428571428 22 7 ALOX5 arachidonate 5-lipoxygenase 1353 172 C20140716_OR021_01 C20140716_OR021_01 TB442170.[MT7]-AMENLFINR.2b5_1.heavy 626.335 / 703.357 8975.0 38.33940124511719 40 10 10 10 10 0.9940706874129587 66.19633802431133 0.0 3 0.8432358974473362 3.0753538539567984 8975.0 17.5333544044094 1.0 - - - - - - - 283.14285714285717 19 7 ALOX5 arachidonate 5-lipoxygenase 1355 173 C20140716_OR021_01 C20140716_OR021_01 TB442229.[MT7]-DFQIQVQPVR.2b3_1.heavy 687.387 / 535.263 34926.0 34.07600021362305 50 20 10 10 10 4.432941960136287 18.321548036760923 0.0 3 0.9913807445772835 13.283577656677481 34926.0 177.8050909090909 0.0 - - - - - - - 165.4 69 5 MRVI1 murine retrovirus integration site 1 homolog 1357 173 C20140716_OR021_01 C20140716_OR021_01 TB442229.[MT7]-DFQIQVQPVR.2y9_1.heavy 687.387 / 1114.64 16638.0 34.07600021362305 50 20 10 10 10 4.432941960136287 18.321548036760923 0.0 3 0.9913807445772835 13.283577656677481 16638.0 167.78294071146243 0.0 - - - - - - - 165.4 33 5 MRVI1 murine retrovirus integration site 1 homolog 1359 173 C20140716_OR021_01 C20140716_OR021_01 TB442229.[MT7]-DFQIQVQPVR.2y6_1.heavy 687.387 / 726.426 22413.0 34.07600021362305 50 20 10 10 10 4.432941960136287 18.321548036760923 0.0 3 0.9913807445772835 13.283577656677481 22413.0 29.14119596377993 1.0 - - - - - - - 255.57142857142858 50 7 MRVI1 murine retrovirus integration site 1 homolog 1361 173 C20140716_OR021_01 C20140716_OR021_01 TB442229.[MT7]-DFQIQVQPVR.2y7_1.heavy 687.387 / 839.51 17738.0 34.07600021362305 50 20 10 10 10 4.432941960136287 18.321548036760923 0.0 3 0.9913807445772835 13.283577656677481 17738.0 190.4603143610013 0.0 - - - - - - - 275.3333333333333 35 3 MRVI1 murine retrovirus integration site 1 homolog 1363 174 C20140716_OR021_01 C20140716_OR021_01 TB420043.[MT7]-GSLPWQGLK[MT7].2y6_1.heavy 637.379 / 872.511 52079.0 37.41699981689453 43 18 10 5 10 3.4816023865589316 24.242604009905868 0.0428009033203125 3 0.9829959999067086 9.450820130019972 52079.0 220.04110318949344 0.0 - - - - - - - 260.0 104 5 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1365 174 C20140716_OR021_01 C20140716_OR021_01 TB420043.[MT7]-GSLPWQGLK[MT7].2y4_1.heavy 637.379 / 589.379 7792.0 37.41699981689453 43 18 10 5 10 3.4816023865589316 24.242604009905868 0.0428009033203125 3 0.9829959999067086 9.450820130019972 7792.0 11.810789980732178 1.0 - - - - - - - 211.25 15 8 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1367 174 C20140716_OR021_01 C20140716_OR021_01 TB420043.[MT7]-GSLPWQGLK[MT7].2y5_1.heavy 637.379 / 775.458 5974.0 37.41699981689453 43 18 10 5 10 3.4816023865589316 24.242604009905868 0.0428009033203125 3 0.9829959999067086 9.450820130019972 5974.0 21.506739665016227 0.0 - - - - - - - 260.0 11 7 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1369 174 C20140716_OR021_01 C20140716_OR021_01 TB420043.[MT7]-GSLPWQGLK[MT7].2b6_1.heavy 637.379 / 813.438 4805.0 37.41699981689453 43 18 10 5 10 3.4816023865589316 24.242604009905868 0.0428009033203125 3 0.9829959999067086 9.450820130019972 4805.0 11.492309540612295 1.0 - - - - - - - 260.0 12 3 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1371 175 C20140716_OR021_01 C20140716_OR021_01 TB420248.[MT7]-SC[CAM]YSVGC[CAM]GSSGFR.3y6_1.heavy 523.23 / 610.294 9867.0 22.10455083847046 27 5 10 6 6 0.6749166406672404 103.88874844903498 0.03339958190917969 5 0.6046366433057522 1.894036231360804 9867.0 0.0 3.0 - - - - - - - 233.0 19 8 KRTAP13-1 keratin associated protein 13-1 1373 175 C20140716_OR021_01 C20140716_OR021_01 TB420248.[MT7]-SC[CAM]YSVGC[CAM]GSSGFR.3b4_1.heavy 523.23 / 642.267 47250.0 22.10455083847046 27 5 10 6 6 0.6749166406672404 103.88874844903498 0.03339958190917969 5 0.6046366433057522 1.894036231360804 47250.0 211.43835616438358 0.0 - - - - - - - 269.9230769230769 94 13 KRTAP13-1 keratin associated protein 13-1 1375 175 C20140716_OR021_01 C20140716_OR021_01 TB420248.[MT7]-SC[CAM]YSVGC[CAM]GSSGFR.3b3_1.heavy 523.23 / 555.235 548.0 22.10455083847046 27 5 10 6 6 0.6749166406672404 103.88874844903498 0.03339958190917969 5 0.6046366433057522 1.894036231360804 548.0 1.6656534954407294 11.0 - - - - - - - 317.0 3 9 KRTAP13-1 keratin associated protein 13-1 1377 175 C20140716_OR021_01 C20140716_OR021_01 TB420248.[MT7]-SC[CAM]YSVGC[CAM]GSSGFR.3y8_1.heavy 523.23 / 827.346 219.0 22.10455083847046 27 5 10 6 6 0.6749166406672404 103.88874844903498 0.03339958190917969 5 0.6046366433057522 1.894036231360804 219.0 1.990909090909091 12.0 - - - - - - - 183.0 3 6 KRTAP13-1 keratin associated protein 13-1 1379 176 C20140716_OR021_01 C20140716_OR021_01 TB436086.[MT7]-ADSPGSLTITPVAPGGGLLGPSHSY[MT7]SSSPLSLFR.4b7_1.heavy 904.233 / 772.396 2015.0 44.629398345947266 44 16 10 10 8 3.2528600521145035 30.742177160371703 0.0 4 0.967396849220087 6.816250134421632 2015.0 5.575985714399344 0.0 - - - - - - - 235.57142857142858 4 14 DMBX1 diencephalon/mesencephalon homeobox 1 1381 176 C20140716_OR021_01 C20140716_OR021_01 TB436086.[MT7]-ADSPGSLTITPVAPGGGLLGPSHSY[MT7]SSSPLSLFR.4y9_1.heavy 904.233 / 993.536 549.0 44.629398345947266 44 16 10 10 8 3.2528600521145035 30.742177160371703 0.0 4 0.967396849220087 6.816250134421632 549.0 0.3991814461118691 13.0 - - - - - - - 216.0 2 14 DMBX1 diencephalon/mesencephalon homeobox 1 1383 176 C20140716_OR021_01 C20140716_OR021_01 TB436086.[MT7]-ADSPGSLTITPVAPGGGLLGPSHSY[MT7]SSSPLSLFR.4b5_1.heavy 904.233 / 572.28 1648.0 44.629398345947266 44 16 10 10 8 3.2528600521145035 30.742177160371703 0.0 4 0.967396849220087 6.816250134421632 1648.0 2.56167577413479 2.0 - - - - - - - 667.1428571428571 3 7 DMBX1 diencephalon/mesencephalon homeobox 1 1385 176 C20140716_OR021_01 C20140716_OR021_01 TB436086.[MT7]-ADSPGSLTITPVAPGGGLLGPSHSY[MT7]SSSPLSLFR.4b6_1.heavy 904.233 / 659.312 2381.0 44.629398345947266 44 16 10 10 8 3.2528600521145035 30.742177160371703 0.0 4 0.967396849220087 6.816250134421632 2381.0 2.926654329642232 1.0 - - - - - - - 274.7692307692308 4 13 DMBX1 diencephalon/mesencephalon homeobox 1 1387 177 C20140716_OR021_01 C20140716_OR021_01 TB420042.[MT7]-GSLPWQGLK[MT7].3y3_1.heavy 425.255 / 461.32 35498.0 37.449100494384766 50 20 10 10 10 6.839782351845455 14.62034825903763 0.0 3 0.9979909874360307 27.529499007151767 35498.0 341.909031007752 0.0 - - - - - - - 193.5 70 4 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1389 177 C20140716_OR021_01 C20140716_OR021_01 TB420042.[MT7]-GSLPWQGLK[MT7].3b4_1.heavy 425.255 / 499.3 7487.0 37.449100494384766 50 20 10 10 10 6.839782351845455 14.62034825903763 0.0 3 0.9979909874360307 27.529499007151767 7487.0 81.54445736434108 0.0 - - - - - - - 258.0 14 8 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1391 177 C20140716_OR021_01 C20140716_OR021_01 TB420042.[MT7]-GSLPWQGLK[MT7].3b5_1.heavy 425.255 / 685.379 3485.0 37.449100494384766 50 20 10 10 10 6.839782351845455 14.62034825903763 0.0 3 0.9979909874360307 27.529499007151767 3485.0 52.112906976744185 0.0 - - - - - - - 129.0 6 3 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1393 177 C20140716_OR021_01 C20140716_OR021_01 TB420042.[MT7]-GSLPWQGLK[MT7].3y4_1.heavy 425.255 / 589.379 4260.0 37.449100494384766 50 20 10 10 10 6.839782351845455 14.62034825903763 0.0 3 0.9979909874360307 27.529499007151767 4260.0 -0.6604651162790702 0.0 - - - - - - - 258.0 8 1 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1395 178 C20140716_OR021_01 C20140716_OR021_01 TB442420.[MT7]-LYGSPFFTDEC[CAM]TFK[MT7].2y4_1.heavy 1000.49 / 699.362 1805.0 43.819698333740234 36 8 10 10 8 1.1094243516822606 78.0752464927436 0.0 4 0.7758058962603892 2.556116675118291 1805.0 9.071761658031088 1.0 - - - - - - - 182.33333333333334 4 6 FGF4 fibroblast growth factor 4 1397 178 C20140716_OR021_01 C20140716_OR021_01 TB442420.[MT7]-LYGSPFFTDEC[CAM]TFK[MT7].2y5_1.heavy 1000.49 / 828.404 1483.0 43.819698333740234 36 8 10 10 8 1.1094243516822606 78.0752464927436 0.0 4 0.7758058962603892 2.556116675118291 1483.0 10.49139534883721 1.0 - - - - - - - 144.75 2 4 FGF4 fibroblast growth factor 4 1399 178 C20140716_OR021_01 C20140716_OR021_01 TB442420.[MT7]-LYGSPFFTDEC[CAM]TFK[MT7].2b4_1.heavy 1000.49 / 565.31 10509.0 43.819698333740234 36 8 10 10 8 1.1094243516822606 78.0752464927436 0.0 4 0.7758058962603892 2.556116675118291 10509.0 155.99296875 0.0 - - - - - - - 64.0 21 2 FGF4 fibroblast growth factor 4 1401 178 C20140716_OR021_01 C20140716_OR021_01 TB442420.[MT7]-LYGSPFFTDEC[CAM]TFK[MT7].2y7_1.heavy 1000.49 / 1044.48 3095.0 43.819698333740234 36 8 10 10 8 1.1094243516822606 78.0752464927436 0.0 4 0.7758058962603892 2.556116675118291 3095.0 14.913730569948186 0.0 - - - - - - - 180.4 6 5 FGF4 fibroblast growth factor 4 1403 179 C20140716_OR021_01 C20140716_OR021_01 TB436081.[MT7]-SLGYGGC[CAM]GFPSLGYGVGFC[CAM]RPTYLASR.3y23_2.heavy 1015.16 / 1240.09 5995.0 43.51495170593262 36 11 10 5 10 0.9157002031453308 68.61542080955905 0.04579925537109375 3 0.8653102403782547 3.3242635838074643 5995.0 27.90111722096549 0.0 - - - - - - - 255.42857142857142 11 7 KRTAP13-1 keratin associated protein 13-1 1405 179 C20140716_OR021_01 C20140716_OR021_01 TB436081.[MT7]-SLGYGGC[CAM]GFPSLGYGVGFC[CAM]RPTYLASR.3b4_1.heavy 1015.16 / 565.31 3787.0 43.51495170593262 36 11 10 5 10 0.9157002031453308 68.61542080955905 0.04579925537109375 3 0.8653102403782547 3.3242635838074643 3787.0 18.132828708018884 0.0 - - - - - - - 198.66666666666666 7 9 KRTAP13-1 keratin associated protein 13-1 1407 179 C20140716_OR021_01 C20140716_OR021_01 TB436081.[MT7]-SLGYGGC[CAM]GFPSLGYGVGFC[CAM]RPTYLASR.3b8_1.heavy 1015.16 / 896.405 1473.0 43.51495170593262 36 11 10 5 10 0.9157002031453308 68.61542080955905 0.04579925537109375 3 0.8653102403782547 3.3242635838074643 1473.0 10.252399638336346 0.0 - - - - - - - 157.6 2 10 KRTAP13-1 keratin associated protein 13-1 1409 179 C20140716_OR021_01 C20140716_OR021_01 TB436081.[MT7]-SLGYGGC[CAM]GFPSLGYGVGFC[CAM]RPTYLASR.3b7_1.heavy 1015.16 / 839.384 1157.0 43.51495170593262 36 11 10 5 10 0.9157002031453308 68.61542080955905 0.04579925537109375 3 0.8653102403782547 3.3242635838074643 1157.0 2.059342870251284 2.0 - - - - - - - 263.0 3 6 KRTAP13-1 keratin associated protein 13-1 1411 180 C20140716_OR021_01 C20140716_OR021_01 TB419986.[MT7]-INQAERER.2b3_1.heavy 580.319 / 500.295 659.0 16.564699172973633 45 17 10 10 8 2.995807099765054 26.607793568799426 0.0 4 0.977231153244475 8.163273724498747 659.0 5.292183048433049 1.0 - - - - - - - 0.0 1 0 MRVI1 murine retrovirus integration site 1 homolog 1413 180 C20140716_OR021_01 C20140716_OR021_01 TB419986.[MT7]-INQAERER.2b4_1.heavy 580.319 / 571.332 N/A 16.564699172973633 45 17 10 10 8 2.995807099765054 26.607793568799426 0.0 4 0.977231153244475 8.163273724498747 2254.0 4.794149797570849 0.0 - - - - - - - 677.3333333333334 4 15 MRVI1 murine retrovirus integration site 1 homolog 1415 180 C20140716_OR021_01 C20140716_OR021_01 TB419986.[MT7]-INQAERER.2b5_1.heavy 580.319 / 700.375 589.0 16.564699172973633 45 17 10 10 8 2.995807099765054 26.607793568799426 0.0 4 0.977231153244475 8.163273724498747 589.0 7.645673076923076 0.0 - - - - - - - 0.0 1 0 MRVI1 murine retrovirus integration site 1 homolog 1417 180 C20140716_OR021_01 C20140716_OR021_01 TB419986.[MT7]-INQAERER.2y7_1.heavy 580.319 / 902.444 867.0 16.564699172973633 45 17 10 10 8 2.995807099765054 26.607793568799426 0.0 4 0.977231153244475 8.163273724498747 867.0 34.852322981366456 0.0 - - - - - - - 0.0 1 0 MRVI1 murine retrovirus integration site 1 homolog 1419 181 C20140716_OR021_01 C20140716_OR021_01 TB420046.[MT7]-GDEGTPGPPGPR.2b4_1.heavy 640.821 / 503.222 999.0 19.659299850463867 44 20 10 6 8 18.286682533366516 5.4684604393135015 0.03279876708984375 4 0.9970711998342204 22.79877149265567 999.0 1.4985 0.0 - - - - - - - 0.0 1 0 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1421 181 C20140716_OR021_01 C20140716_OR021_01 TB420046.[MT7]-GDEGTPGPPGPR.2y9_1.heavy 640.821 / 835.442 1598.0 19.659299850463867 44 20 10 6 8 18.286682533366516 5.4684604393135015 0.03279876708984375 4 0.9970711998342204 22.79877149265567 1598.0 3.652571428571429 1.0 - - - - - - - 150.0 3 15 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1423 181 C20140716_OR021_01 C20140716_OR021_01 TB420046.[MT7]-GDEGTPGPPGPR.2y10_1.heavy 640.821 / 964.485 1598.0 19.659299850463867 44 20 10 6 8 18.286682533366516 5.4684604393135015 0.03279876708984375 4 0.9970711998342204 22.79877149265567 1598.0 29.7228 0.0 - - - - - - - 118.18181818181819 3 11 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1425 181 C20140716_OR021_01 C20140716_OR021_01 TB420046.[MT7]-GDEGTPGPPGPR.2y7_1.heavy 640.821 / 677.373 3447.0 19.659299850463867 44 20 10 6 8 18.286682533366516 5.4684604393135015 0.03279876708984375 4 0.9970711998342204 22.79877149265567 3447.0 1.5331356560415124 1.0 - - - - - - - 270.8333333333333 7 12 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1427 182 C20140716_OR021_01 C20140716_OR021_01 TB436082.[MT7]-GIQPALEQYLVTAGGGEGAAVVAAAAAASMDK[MT7].3b9_1.heavy 1092.58 / 1144.61 9163.0 52.93109893798828 44 14 10 10 10 1.4686317778139422 54.27231020965833 0.0 3 0.9349725330577245 4.813178390171469 9163.0 101.61334852118304 0.0 - - - - - - - 175.28571428571428 18 21 E2F3 E2F transcription factor 3 1429 182 C20140716_OR021_01 C20140716_OR021_01 TB436082.[MT7]-GIQPALEQYLVTAGGGEGAAVVAAAAAASMDK[MT7].3b5_1.heavy 1092.58 / 611.363 5345.0 52.93109893798828 44 14 10 10 10 1.4686317778139422 54.27231020965833 0.0 3 0.9349725330577245 4.813178390171469 5345.0 33.424930102516306 0.0 - - - - - - - 133.11111111111111 10 18 E2F3 E2F transcription factor 3 1431 182 C20140716_OR021_01 C20140716_OR021_01 TB436082.[MT7]-GIQPALEQYLVTAGGGEGAAVVAAAAAASMDK[MT7].3b8_1.heavy 1092.58 / 981.549 10794.0 52.93109893798828 44 14 10 10 10 1.4686317778139422 54.27231020965833 0.0 3 0.9349725330577245 4.813178390171469 10794.0 144.43769784172662 0.0 - - - - - - - 133.6 21 20 E2F3 E2F transcription factor 3 1433 182 C20140716_OR021_01 C20140716_OR021_01 TB436082.[MT7]-GIQPALEQYLVTAGGGEGAAVVAAAAAASMDK[MT7].3b7_1.heavy 1092.58 / 853.49 4512.0 52.93109893798828 44 14 10 10 10 1.4686317778139422 54.27231020965833 0.0 3 0.9349725330577245 4.813178390171469 4512.0 125.87826086956522 0.0 - - - - - - - 90.25 9 20 E2F3 E2F transcription factor 3 1435 183 C20140716_OR021_01 C20140716_OR021_01 TB420045.[MT7]-DLTYASLC[CAM]FPEAIK[MT7].3b6_1.heavy 639.341 / 795.401 11610.0 43.23080062866211 48 18 10 10 10 7.284099537973724 13.728532878865327 0.0 3 0.9890257969194822 11.77003901045003 11610.0 65.36934782608697 0.0 - - - - - - - 316.25 23 4 ALOX5 arachidonate 5-lipoxygenase 1437 183 C20140716_OR021_01 C20140716_OR021_01 TB420045.[MT7]-DLTYASLC[CAM]FPEAIK[MT7].3b4_1.heavy 639.341 / 637.331 11495.0 43.23080062866211 48 18 10 10 10 7.284099537973724 13.728532878865327 0.0 3 0.9890257969194822 11.77003901045003 11495.0 34.218449275362325 0.0 - - - - - - - 261.3636363636364 22 11 ALOX5 arachidonate 5-lipoxygenase 1439 183 C20140716_OR021_01 C20140716_OR021_01 TB420045.[MT7]-DLTYASLC[CAM]FPEAIK[MT7].3b5_1.heavy 639.341 / 708.369 15979.0 43.23080062866211 48 18 10 10 10 7.284099537973724 13.728532878865327 0.0 3 0.9890257969194822 11.77003901045003 15979.0 9.440564636321776 1.0 - - - - - - - 246.42857142857142 34 7 ALOX5 arachidonate 5-lipoxygenase 1441 183 C20140716_OR021_01 C20140716_OR021_01 TB420045.[MT7]-DLTYASLC[CAM]FPEAIK[MT7].3y5_1.heavy 639.341 / 701.431 41269.0 43.23080062866211 48 18 10 10 10 7.284099537973724 13.728532878865327 0.0 3 0.9890257969194822 11.77003901045003 41269.0 103.81332298136645 0.0 - - - - - - - 690.0 82 8 ALOX5 arachidonate 5-lipoxygenase 1443 184 C20140716_OR021_01 C20140716_OR021_01 TB442226.[MT7]-AGLLQQPPALGR.2y8_1.heavy 682.91 / 866.484 14778.0 34.02949905395508 47 17 10 10 10 4.589760617283097 21.78762866704688 0.0 3 0.9791891046766944 8.540060075458284 14778.0 50.330869565217384 0.0 - - - - - - - 193.2 29 5 E2F3 E2F transcription factor 3 1445 184 C20140716_OR021_01 C20140716_OR021_01 TB442226.[MT7]-AGLLQQPPALGR.2y9_1.heavy 682.91 / 979.568 24170.0 34.02949905395508 47 17 10 10 10 4.589760617283097 21.78762866704688 0.0 3 0.9791891046766944 8.540060075458284 24170.0 168.1391304347826 0.0 - - - - - - - 138.0 48 2 E2F3 E2F transcription factor 3 1447 184 C20140716_OR021_01 C20140716_OR021_01 TB442226.[MT7]-AGLLQQPPALGR.2y6_1.heavy 682.91 / 610.367 54555.0 34.02949905395508 47 17 10 10 10 4.589760617283097 21.78762866704688 0.0 3 0.9791891046766944 8.540060075458284 54555.0 53.03174767321613 0.0 - - - - - - - 276.0 109 3 E2F3 E2F transcription factor 3 1449 184 C20140716_OR021_01 C20140716_OR021_01 TB442226.[MT7]-AGLLQQPPALGR.2y11_1.heavy 682.91 / 1149.67 9944.0 34.02949905395508 47 17 10 10 10 4.589760617283097 21.78762866704688 0.0 3 0.9791891046766944 8.540060075458284 9944.0 4.0656899488926745 0.0 - - - - - - - 248.4 19 5 E2F3 E2F transcription factor 3 1451 185 C20140716_OR021_01 C20140716_OR021_01 TB442323.[MT7]-ERLAQAIGIPEPR.3b6_1.heavy 531.978 / 813.47 5999.0 33.38435077667236 34 13 10 3 8 2.5919199822378944 38.581437963088206 0.07799911499023438 4 0.9169338264577999 4.252038056505463 5999.0 0.0 2.0 - - - - - - - 191.5 12 4 LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 1453 185 C20140716_OR021_01 C20140716_OR021_01 TB442323.[MT7]-ERLAQAIGIPEPR.3y6_1.heavy 531.978 / 668.373 19530.0 33.38435077667236 34 13 10 3 8 2.5919199822378944 38.581437963088206 0.07799911499023438 4 0.9169338264577999 4.252038056505463 19530.0 35.71499334272428 0.0 - - - - - - - 255.0 39 1 LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 1455 185 C20140716_OR021_01 C20140716_OR021_01 TB442323.[MT7]-ERLAQAIGIPEPR.3b5_1.heavy 531.978 / 742.433 3574.0 33.38435077667236 34 13 10 3 8 2.5919199822378944 38.581437963088206 0.07799911499023438 4 0.9169338264577999 4.252038056505463 3574.0 26.525781249999998 1.0 - - - - - - - 255.4 7 5 LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 1457 185 C20140716_OR021_01 C20140716_OR021_01 TB442323.[MT7]-ERLAQAIGIPEPR.3b8_1.heavy 531.978 / 983.575 7914.0 33.38435077667236 34 13 10 3 8 2.5919199822378944 38.581437963088206 0.07799911499023438 4 0.9169338264577999 4.252038056505463 7914.0 7.78322908863466 1.0 - - - - - - - 170.33333333333334 15 3 LOC100288711;LOC100506764;LOC100508483;LOC100510321;DUX4;LOC285299;DUX4L4;DUX4L7;DUX4L6;DUX4L5;DUX4L3;DUX4L2 double homeobox 2 pseudogene;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox protein 4-like;double homeobox 4;FSHD region gene 2 family, member C-like;double homeobox 4 like 4;double homeobox 4 like 7;double homeobox 4 like 6;double homeobox 4 like 5;double homeobox 4 like 3;double homeobox 4 like 2 1459 186 C20140716_OR021_01 C20140716_OR021_01 TB420435.[MT7]-EILLPNNYNAYESYK[MT7].4y4_1.heavy 530.529 / 670.353 N/A 33.87946701049805 18 11 0 5 2 1.1505778376448008 56.65566020291557 0.042697906494140625 15 0.8774660766728383 3.4889634656413437 0.0 0.0 36.0 - - - - - - - 400.0 2 2 FGF4 fibroblast growth factor 4 1461 186 C20140716_OR021_01 C20140716_OR021_01 TB420435.[MT7]-EILLPNNYNAYESYK[MT7].4b4_1.heavy 530.529 / 613.404 2401.0 33.87946701049805 18 11 0 5 2 1.1505778376448008 56.65566020291557 0.042697906494140625 15 0.8774660766728383 3.4889634656413437 2401.0 8.87335861423221 2.0 - - - - - - - 228.57142857142858 5 7 FGF4 fibroblast growth factor 4 1463 186 C20140716_OR021_01 C20140716_OR021_01 TB420435.[MT7]-EILLPNNYNAYESYK[MT7].4y3_1.heavy 530.529 / 541.31 934.0 33.87946701049805 18 11 0 5 2 1.1505778376448008 56.65566020291557 0.042697906494140625 15 0.8774660766728383 3.4889634656413437 934.0 2.6988764044943823 16.0 - - - - - - - 266.75 17 8 FGF4 fibroblast growth factor 4 1465 186 C20140716_OR021_01 C20140716_OR021_01 TB420435.[MT7]-EILLPNNYNAYESYK[MT7].4b3_1.heavy 530.529 / 500.32 1601.0 33.87946701049805 18 11 0 5 2 1.1505778376448008 56.65566020291557 0.042697906494140625 15 0.8774660766728383 3.4889634656413437 1601.0 2.5812524550224887 7.0 - - - - - - - 266.7 15 10 FGF4 fibroblast growth factor 4 1467 187 C20140716_OR021_01 C20140716_OR021_01 TB420434.[MT7]-K[MT7]LDELIQSC[CAM]TLDLK[MT7].3y7_1.heavy 703.405 / 980.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F3 E2F transcription factor 3 1469 187 C20140716_OR021_01 C20140716_OR021_01 TB420434.[MT7]-K[MT7]LDELIQSC[CAM]TLDLK[MT7].3b4_1.heavy 703.405 / 774.46 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F3 E2F transcription factor 3 1471 187 C20140716_OR021_01 C20140716_OR021_01 TB420434.[MT7]-K[MT7]LDELIQSC[CAM]TLDLK[MT7].3b5_1.heavy 703.405 / 887.544 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F3 E2F transcription factor 3 1473 187 C20140716_OR021_01 C20140716_OR021_01 TB420434.[MT7]-K[MT7]LDELIQSC[CAM]TLDLK[MT7].3b3_1.heavy 703.405 / 645.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F3 E2F transcription factor 3 1475 188 C20140716_OR021_01 C20140716_OR021_01 TB419984.[MT7]-EENSSGLK[MT7].2b3_1.heavy 576.311 / 517.237 2535.0 18.037567138671875 40 18 6 6 10 4.586699619828772 21.802168942498383 0.03460121154785156 3 0.9856538901772567 10.291406202511086 2535.0 14.831764348618282 0.0 - - - - - - - 191.1 5 10 KAZ kazrin 1477 188 C20140716_OR021_01 C20140716_OR021_01 TB419984.[MT7]-EENSSGLK[MT7].2y4_1.heavy 576.311 / 548.352 N/A 18.037567138671875 40 18 6 6 10 4.586699619828772 21.802168942498383 0.03460121154785156 3 0.9856538901772567 10.291406202511086 3291.0 2.528908317487699 5.0 - - - - - - - 293.5 17 10 KAZ kazrin 1479 188 C20140716_OR021_01 C20140716_OR021_01 TB419984.[MT7]-EENSSGLK[MT7].2y5_1.heavy 576.311 / 635.385 3202.0 18.037567138671875 40 18 6 6 10 4.586699619828772 21.802168942498383 0.03460121154785156 3 0.9856538901772567 10.291406202511086 3202.0 35.97752808988764 0.0 - - - - - - - 187.21428571428572 6 14 KAZ kazrin 1481 188 C20140716_OR021_01 C20140716_OR021_01 TB419984.[MT7]-EENSSGLK[MT7].2y7_1.heavy 576.311 / 878.47 5560.0 18.037567138671875 40 18 6 6 10 4.586699619828772 21.802168942498383 0.03460121154785156 3 0.9856538901772567 10.291406202511086 5560.0 64.65842696629214 0.0 - - - - - - - 138.22222222222223 11 9 KAZ kazrin 1483 189 C20140716_OR021_01 C20140716_OR021_01 TB442327.[MT7]-LARDDQIHILK[MT7].4b5_1.heavy 403.246 / 715.385 25332.0 29.596949577331543 31 7 10 6 8 0.6996401824461677 104.33750430501674 0.036998748779296875 4 0.7269956775835072 2.3060134687163907 25332.0 342.70659017453136 0.0 - - - - - - - 181.63636363636363 50 11 ALOX5 arachidonate 5-lipoxygenase 1485 189 C20140716_OR021_01 C20140716_OR021_01 TB442327.[MT7]-LARDDQIHILK[MT7].4b7_1.heavy 403.246 / 956.528 91.0 29.596949577331543 31 7 10 6 8 0.6996401824461677 104.33750430501674 0.036998748779296875 4 0.7269956775835072 2.3060134687163907 91.0 1.5 3.0 - - - - - - - 0.0 0 0 ALOX5 arachidonate 5-lipoxygenase 1487 189 C20140716_OR021_01 C20140716_OR021_01 TB442327.[MT7]-LARDDQIHILK[MT7].4y3_1.heavy 403.246 / 517.383 53206.0 29.596949577331543 31 7 10 6 8 0.6996401824461677 104.33750430501674 0.036998748779296875 4 0.7269956775835072 2.3060134687163907 53206.0 187.96342905826614 0.0 - - - - - - - 681.125 106 8 ALOX5 arachidonate 5-lipoxygenase 1489 189 C20140716_OR021_01 C20140716_OR021_01 TB442327.[MT7]-LARDDQIHILK[MT7].4b6_1.heavy 403.246 / 843.444 N/A 29.596949577331543 31 7 10 6 8 0.6996401824461677 104.33750430501674 0.036998748779296875 4 0.7269956775835072 2.3060134687163907 0.0 0.0 1.0 - - - - - - - 0.0 0 0 ALOX5 arachidonate 5-lipoxygenase 1491 190 C20140716_OR021_01 C20140716_OR021_01 TB419980.[MT7]-EAINRLHEAVPGVR.3b9_2.heavy 568.992 / 589.824 5273.0 28.006200790405273 43 13 10 10 10 0.9834533121733835 60.001159075803365 0.0 3 0.908654167225881 4.051867955824512 5273.0 24.06187455862657 0.0 - - - - - - - 360.42857142857144 10 7 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 1493 190 C20140716_OR021_01 C20140716_OR021_01 TB419980.[MT7]-EAINRLHEAVPGVR.3y7_1.heavy 568.992 / 727.41 2980.0 28.006200790405273 43 13 10 10 10 0.9834533121733835 60.001159075803365 0.0 3 0.908654167225881 4.051867955824512 2980.0 16.28604651162791 0.0 - - - - - - - 263.8 5 10 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 1495 190 C20140716_OR021_01 C20140716_OR021_01 TB419980.[MT7]-EAINRLHEAVPGVR.3y6_1.heavy 568.992 / 598.367 7451.0 28.006200790405273 43 13 10 10 10 0.9834533121733835 60.001159075803365 0.0 3 0.908654167225881 4.051867955824512 7451.0 36.86427268581851 0.0 - - - - - - - 248.5 14 6 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 1497 190 C20140716_OR021_01 C20140716_OR021_01 TB419980.[MT7]-EAINRLHEAVPGVR.3y8_1.heavy 568.992 / 864.469 2866.0 28.006200790405273 43 13 10 10 10 0.9834533121733835 60.001159075803365 0.0 3 0.908654167225881 4.051867955824512 2866.0 0.16677332063973438 1.0 - - - - - - - 272.25 6 8 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 1499 191 C20140716_OR021_01 C20140716_OR021_01 TB420140.[MT7]-EDIPYYFYR.2b3_1.heavy 705.347 / 502.263 22089.0 39.66299819946289 47 17 10 10 10 2.1961743746796794 35.663697997144034 0.0 3 0.9769911613664999 8.120425155382993 22089.0 -1.066586190246257 0.0 - - - - - - - 276.0 44 2 ALOX5 arachidonate 5-lipoxygenase 1501 191 C20140716_OR021_01 C20140716_OR021_01 TB420140.[MT7]-EDIPYYFYR.2y8_1.heavy 705.347 / 1136.54 6489.0 39.66299819946289 47 17 10 10 10 2.1961743746796794 35.663697997144034 0.0 3 0.9769911613664999 8.120425155382993 6489.0 -1.1755434782608702 1.0 - - - - - - - 256.2857142857143 12 7 ALOX5 arachidonate 5-lipoxygenase 1503 191 C20140716_OR021_01 C20140716_OR021_01 TB420140.[MT7]-EDIPYYFYR.2y6_1.heavy 705.347 / 908.43 33823.0 39.66299819946289 47 17 10 10 10 2.1961743746796794 35.663697997144034 0.0 3 0.9769911613664999 8.120425155382993 33823.0 -2.4509420289855086 0.0 - - - - - - - 276.0 67 4 ALOX5 arachidonate 5-lipoxygenase 1505 191 C20140716_OR021_01 C20140716_OR021_01 TB420140.[MT7]-EDIPYYFYR.2y7_1.heavy 705.347 / 1021.51 12011.0 39.66299819946289 47 17 10 10 10 2.1961743746796794 35.663697997144034 0.0 3 0.9769911613664999 8.120425155382993 12011.0 10.990372670807455 1.0 - - - - - - - 220.8 24 5 ALOX5 arachidonate 5-lipoxygenase 1507 192 C20140716_OR021_01 C20140716_OR021_01 TB442186.[MT7]-EAEGSHGEGK[MT7].3b4_1.heavy 430.217 / 531.253 12422.0 13.372899770736694 44 18 10 6 10 3.8918134226091516 25.694962512606256 0.03880023956298828 3 0.9852448828348539 10.14741874953956 12422.0 192.41892730286526 0.0 - - - - - - - 111.47058823529412 24 17 DMBX1 diencephalon/mesencephalon homeobox 1 1509 192 C20140716_OR021_01 C20140716_OR021_01 TB442186.[MT7]-EAEGSHGEGK[MT7].3b5_1.heavy 430.217 / 618.285 26739.0 13.372899770736694 44 18 10 6 10 3.8918134226091516 25.694962512606256 0.03880023956298828 3 0.9852448828348539 10.14741874953956 26739.0 576.8292338709678 0.0 - - - - - - - 79.9375 53 16 DMBX1 diencephalon/mesencephalon homeobox 1 1511 192 C20140716_OR021_01 C20140716_OR021_01 TB442186.[MT7]-EAEGSHGEGK[MT7].3y4_1.heavy 430.217 / 534.3 83554.0 13.372899770736694 44 18 10 6 10 3.8918134226091516 25.694962512606256 0.03880023956298828 3 0.9852448828348539 10.14741874953956 83554.0 1193.033044768069 0.0 - - - - - - - 139.8421052631579 167 19 DMBX1 diencephalon/mesencephalon homeobox 1 1513 192 C20140716_OR021_01 C20140716_OR021_01 TB442186.[MT7]-EAEGSHGEGK[MT7].3y5_1.heavy 430.217 / 671.359 2266.0 13.372899770736694 44 18 10 6 10 3.8918134226091516 25.694962512606256 0.03880023956298828 3 0.9852448828348539 10.14741874953956 2266.0 39.03323170731707 0.0 - - - - - - - 89.85714285714286 4 14 DMBX1 diencephalon/mesencephalon homeobox 1 1515 193 C20140716_OR021_01 C20140716_OR021_01 TB442511.[MT7]-AC[CAM]HILEC[CAM]C[CAM]EGLAQSIISTVGQAFELR.4y10_1.heavy 777.386 / 1107.58 6367.0 54.5890007019043 38 8 10 10 10 0.6416322772506301 89.64602297300183 0.0 3 0.7686440198872045 2.5146022127202756 6367.0 508.38046153846153 0.0 - - - - - - - 129.3846153846154 12 13 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 1517 193 C20140716_OR021_01 C20140716_OR021_01 TB442511.[MT7]-AC[CAM]HILEC[CAM]C[CAM]EGLAQSIISTVGQAFELR.4b4_1.heavy 777.386 / 626.32 2652.0 54.5890007019043 38 8 10 10 10 0.6416322772506301 89.64602297300183 0.0 3 0.7686440198872045 2.5146022127202756 2652.0 247.99599999999998 0.0 - - - - - - - 64.91666666666667 5 12 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 1519 193 C20140716_OR021_01 C20140716_OR021_01 TB442511.[MT7]-AC[CAM]HILEC[CAM]C[CAM]EGLAQSIISTVGQAFELR.4y7_1.heavy 777.386 / 820.431 1790.0 54.5890007019043 38 8 10 10 10 0.6416322772506301 89.64602297300183 0.0 3 0.7686440198872045 2.5146022127202756 1790.0 53.521 0.0 - - - - - - - 90.0 3 13 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 1521 193 C20140716_OR021_01 C20140716_OR021_01 TB442511.[MT7]-AC[CAM]HILEC[CAM]C[CAM]EGLAQSIISTVGQAFELR.4b3_1.heavy 777.386 / 513.236 1750.0 54.5890007019043 38 8 10 10 10 0.6416322772506301 89.64602297300183 0.0 3 0.7686440198872045 2.5146022127202756 1750.0 27.223025379778786 0.0 - - - - - - - 119.1 3 20 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 1523 194 C20140716_OR021_01 C20140716_OR021_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y7.peptide 661.38 / 836.43 307206.0 46.165568033854164 23 -3 10 6 10 null 0.0 0.033100128173828125 3 0.0 0.0 307206.0 979.6061009027133 0.0 - - - - - - - 306.2857142857143 614 14 1525 194 C20140716_OR021_01 C20140716_OR021_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y9.peptide 661.38 / 502.76 679131.0 46.165568033854164 23 -3 10 6 10 null 0.0 0.033100128173828125 3 0.0 0.0 679131.0 750.875480641593 0.0 - - - - - - - 708.1428571428571 1358 7 1527 194 C20140716_OR021_01 C20140716_OR021_01 BLAT_ECOLX.VAGPLLRSALPAGWFIADK.3y17.peptide 661.38 / 906.51 523845.0 46.165568033854164 23 -3 10 6 10 null 0.0 0.033100128173828125 3 0.0 0.0 523845.0 396.9068777790652 0.0 - - - - - - - 234.5 1047 8 1529 195 C20140716_OR021_01 C20140716_OR021_01 TB420136.[MT7]-HLFEDSQNK[MT7].2y4_1.heavy 703.369 / 620.348 2678.0 23.48979949951172 46 16 10 10 10 3.1647786653022725 31.597786314844505 0.0 3 0.9675080401030931 6.827967166059285 2678.0 19.43931729385153 0.0 - - - - - - - 289.6666666666667 5 9 PNLIPRP3 pancreatic lipase-related protein 3 1531 195 C20140716_OR021_01 C20140716_OR021_01 TB420136.[MT7]-HLFEDSQNK[MT7].2y8_1.heavy 703.369 / 1124.57 2678.0 23.48979949951172 46 16 10 10 10 3.1647786653022725 31.597786314844505 0.0 3 0.9675080401030931 6.827967166059285 2678.0 35.70666666666666 0.0 - - - - - - - 140.875 5 8 PNLIPRP3 pancreatic lipase-related protein 3 1533 195 C20140716_OR021_01 C20140716_OR021_01 TB420136.[MT7]-HLFEDSQNK[MT7].2y5_1.heavy 703.369 / 735.375 1621.0 23.48979949951172 46 16 10 10 10 3.1647786653022725 31.597786314844505 0.0 3 0.9675080401030931 6.827967166059285 1621.0 11.888450287385297 0.0 - - - - - - - 197.2 3 5 PNLIPRP3 pancreatic lipase-related protein 3 1535 195 C20140716_OR021_01 C20140716_OR021_01 TB420136.[MT7]-HLFEDSQNK[MT7].2y7_1.heavy 703.369 / 1011.49 5074.0 23.48979949951172 46 16 10 10 10 3.1647786653022725 31.597786314844505 0.0 3 0.9675080401030931 6.827967166059285 5074.0 69.81248226950355 0.0 - - - - - - - 155.0 10 5 PNLIPRP3 pancreatic lipase-related protein 3 1537 196 C20140716_OR021_01 C20140716_OR021_01 TB442311.[MT7]-TQFFIPYTIK[MT7].2y5_1.heavy 773.45 / 765.463 1289.0 44.69219970703125 26 7 10 5 4 0.46598834411641804 108.40595433277633 0.040802001953125 7 0.7318550337337167 2.327862393809582 1289.0 1.6986821705426356 3.0 - - - - - - - 223.68421052631578 3 19 COL10A1 collagen, type X, alpha 1 1539 196 C20140716_OR021_01 C20140716_OR021_01 TB442311.[MT7]-TQFFIPYTIK[MT7].2y3_1.heavy 773.45 / 505.347 1096.0 44.69219970703125 26 7 10 5 4 0.46598834411641804 108.40595433277633 0.040802001953125 7 0.7318550337337167 2.327862393809582 1096.0 6.528368879784713 6.0 - - - - - - - 169.8181818181818 2 11 COL10A1 collagen, type X, alpha 1 1541 196 C20140716_OR021_01 C20140716_OR021_01 TB442311.[MT7]-TQFFIPYTIK[MT7].2b5_1.heavy 773.45 / 781.437 451.0 44.69219970703125 26 7 10 5 4 0.46598834411641804 108.40595433277633 0.040802001953125 7 0.7318550337337167 2.327862393809582 451.0 2.330749354005168 24.0 - - - - - - - 0.0 1 0 COL10A1 collagen, type X, alpha 1 1543 196 C20140716_OR021_01 C20140716_OR021_01 TB442311.[MT7]-TQFFIPYTIK[MT7].2y7_1.heavy 773.45 / 1025.62 1547.0 44.69219970703125 26 7 10 5 4 0.46598834411641804 108.40595433277633 0.040802001953125 7 0.7318550337337167 2.327862393809582 1547.0 11.992248062015504 0.0 - - - - - - - 176.26315789473685 3 19 COL10A1 collagen, type X, alpha 1 1545 197 C20140716_OR021_01 C20140716_OR021_01 TB442517.[MT7]-TIEVLMNTYSVVQLPEEAVGLVTPETLQK[MT7].3y7_1.heavy 1163.97 / 960.548 12172.0 54.5890007019043 43 13 10 10 10 1.2199570649952138 54.64673190521521 0.0 3 0.921231381596707 4.368103697174584 12172.0 408.3668965517241 0.0 - - - - - - - 68.5 24 16 ASB10 ankyrin repeat and SOCS box-containing 10 1547 197 C20140716_OR021_01 C20140716_OR021_01 TB442517.[MT7]-TIEVLMNTYSVVQLPEEAVGLVTPETLQK[MT7].3y6_1.heavy 1163.97 / 859.5 12143.0 54.5890007019043 43 13 10 10 10 1.2199570649952138 54.64673190521521 0.0 3 0.921231381596707 4.368103697174584 12143.0 453.3640438871473 0.0 - - - - - - - 54.8125 24 16 ASB10 ankyrin repeat and SOCS box-containing 10 1549 197 C20140716_OR021_01 C20140716_OR021_01 TB442517.[MT7]-TIEVLMNTYSVVQLPEEAVGLVTPETLQK[MT7].3b4_1.heavy 1163.97 / 587.352 10365.0 54.5890007019043 43 13 10 10 10 1.2199570649952138 54.64673190521521 0.0 3 0.921231381596707 4.368103697174584 10365.0 509.3146551724137 0.0 - - - - - - - 74.8125 20 16 ASB10 ankyrin repeat and SOCS box-containing 10 1551 197 C20140716_OR021_01 C20140716_OR021_01 TB442517.[MT7]-TIEVLMNTYSVVQLPEEAVGLVTPETLQK[MT7].3y10_1.heavy 1163.97 / 1229.72 7362.0 54.5890007019043 43 13 10 10 10 1.2199570649952138 54.64673190521521 0.0 3 0.921231381596707 4.368103697174584 7362.0 162.2178620689655 0.0 - - - - - - - 68.375 14 16 ASB10 ankyrin repeat and SOCS box-containing 10 1553 198 C20140716_OR021_01 C20140716_OR021_01 TB420137.[MT7]-FLDWGAPNAK[MT7].3y3_1.heavy 469.594 / 476.295 16022.0 39.525299072265625 45 15 10 10 10 1.6517245014590902 43.69083127513321 0.0 3 0.9547714250100049 5.781030972079515 16022.0 -0.29025362318840564 0.0 - - - - - - - 276.0 32 1 CRYGB crystallin, gamma B 1555 198 C20140716_OR021_01 C20140716_OR021_01 TB420137.[MT7]-FLDWGAPNAK[MT7].3b5_1.heavy 469.594 / 763.39 9530.0 39.525299072265625 45 15 10 10 10 1.6517245014590902 43.69083127513321 0.0 3 0.9547714250100049 5.781030972079515 9530.0 -0.6905797101449309 0.0 - - - - - - - 241.5 19 4 CRYGB crystallin, gamma B 1557 198 C20140716_OR021_01 C20140716_OR021_01 TB420137.[MT7]-FLDWGAPNAK[MT7].3y4_1.heavy 469.594 / 573.348 18370.0 39.525299072265625 45 15 10 10 10 1.6517245014590902 43.69083127513321 0.0 3 0.9547714250100049 5.781030972079515 18370.0 110.39748792270531 0.0 - - - - - - - 322.0 36 3 CRYGB crystallin, gamma B 1559 198 C20140716_OR021_01 C20140716_OR021_01 TB420137.[MT7]-FLDWGAPNAK[MT7].3b3_1.heavy 469.594 / 520.289 13397.0 39.525299072265625 45 15 10 10 10 1.6517245014590902 43.69083127513321 0.0 3 0.9547714250100049 5.781030972079515 13397.0 55.53768417874396 0.0 - - - - - - - 276.0 26 3 CRYGB crystallin, gamma B 1561 199 C20140716_OR021_01 C20140716_OR021_01 TB442514.[MT7]-GIQPALEQYLVTAGGGEGAAVVAAAAAASMDK[MT7].4y4_1.heavy 819.685 / 624.314 37584.0 52.93109893798828 46 16 10 10 10 1.8915263339355894 41.99043397206273 0.0 3 0.9600903037243304 6.156984954764778 37584.0 338.8869064748201 0.0 - - - - - - - 178.61904761904762 75 21 E2F3 E2F transcription factor 3 1563 199 C20140716_OR021_01 C20140716_OR021_01 TB442514.[MT7]-GIQPALEQYLVTAGGGEGAAVVAAAAAASMDK[MT7].4b8_1.heavy 819.685 / 981.549 54615.0 52.93109893798828 46 16 10 10 10 1.8915263339355894 41.99043397206273 0.0 3 0.9600903037243304 6.156984954764778 54615.0 377.9611211031175 0.0 - - - - - - - 194.27777777777777 109 18 E2F3 E2F transcription factor 3 1565 199 C20140716_OR021_01 C20140716_OR021_01 TB442514.[MT7]-GIQPALEQYLVTAGGGEGAAVVAAAAAASMDK[MT7].4b7_1.heavy 819.685 / 853.49 17239.0 52.93109893798828 46 16 10 10 10 1.8915263339355894 41.99043397206273 0.0 3 0.9600903037243304 6.156984954764778 17239.0 112.21040779849308 0.0 - - - - - - - 142.52380952380952 34 21 E2F3 E2F transcription factor 3 1567 199 C20140716_OR021_01 C20140716_OR021_01 TB442514.[MT7]-GIQPALEQYLVTAGGGEGAAVVAAAAAASMDK[MT7].4b5_1.heavy 819.685 / 611.363 28918.0 52.93109893798828 46 16 10 10 10 1.8915263339355894 41.99043397206273 0.0 3 0.9600903037243304 6.156984954764778 28918.0 277.5475532398002 0.0 - - - - - - - 184.2 57 20 E2F3 E2F transcription factor 3 1569 200 C20140716_OR021_01 C20140716_OR021_01 TB442419.[MT7]-HLLDK[MT7]PFYNDFER.4b4_1.heavy 496.265 / 623.363 2968.0 34.98037624359131 36 17 10 3 6 1.5536885258343425 39.856636438480606 0.051097869873046875 5 0.97315617954559 7.515603845662653 2968.0 27.408197530864197 0.0 - - - - - - - 212.14285714285714 5 7 ALOX5 arachidonate 5-lipoxygenase 1571 200 C20140716_OR021_01 C20140716_OR021_01 TB442419.[MT7]-HLLDK[MT7]PFYNDFER.4y7_1.heavy 496.265 / 990.432 405.0 34.98037624359131 36 17 10 3 6 1.5536885258343425 39.856636438480606 0.051097869873046875 5 0.97315617954559 7.515603845662653 405.0 5.88 1.0 - - - - - - - 0.0 1 0 ALOX5 arachidonate 5-lipoxygenase 1573 200 C20140716_OR021_01 C20140716_OR021_01 TB442419.[MT7]-HLLDK[MT7]PFYNDFER.4y6_1.heavy 496.265 / 843.363 1214.0 34.98037624359131 36 17 10 3 6 1.5536885258343425 39.856636438480606 0.051097869873046875 5 0.97315617954559 7.515603845662653 1214.0 17.985185185185184 0.0 - - - - - - - 270.0 2 3 ALOX5 arachidonate 5-lipoxygenase 1575 200 C20140716_OR021_01 C20140716_OR021_01 TB442419.[MT7]-HLLDK[MT7]PFYNDFER.4b3_1.heavy 496.265 / 508.336 1349.0 34.98037624359131 36 17 10 3 6 1.5536885258343425 39.856636438480606 0.051097869873046875 5 0.97315617954559 7.515603845662653 1349.0 9.917648148148146 3.0 - - - - - - - 202.5 4 6 ALOX5 arachidonate 5-lipoxygenase 1577 201 C20140716_OR021_01 C20140716_OR021_01 TB420443.[MT7]-DDLEALGHMFMY[MT7]FLR.4b4_1.heavy 537.273 / 617.29 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1579 201 C20140716_OR021_01 C20140716_OR021_01 TB420443.[MT7]-DDLEALGHMFMY[MT7]FLR.4y6_2.heavy 537.273 / 510.776 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1581 201 C20140716_OR021_01 C20140716_OR021_01 TB420443.[MT7]-DDLEALGHMFMY[MT7]FLR.4b5_1.heavy 537.273 / 688.327 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1583 201 C20140716_OR021_01 C20140716_OR021_01 TB420443.[MT7]-DDLEALGHMFMY[MT7]FLR.4y7_2.heavy 537.273 / 576.297 N/A N/A - - - - - - - - - 0.0 - - - - - - - CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1585 202 C20140716_OR021_01 C20140716_OR021_01 TB442417.[MT7]-TFSTELVGLPWSPEK[MT7].2y8_1.heavy 990.04 / 1057.58 8797.0 45.69357395172119 37 11 10 6 10 0.7731244686429437 81.37003650998177 0.036701202392578125 3 0.8554131321807845 3.205683636516119 8797.0 17.669188034188036 0.0 - - - - - - - 274.875 17 8 PNLIPRP3 pancreatic lipase-related protein 3 1587 202 C20140716_OR021_01 C20140716_OR021_01 TB442417.[MT7]-TFSTELVGLPWSPEK[MT7].2y3_1.heavy 990.04 / 517.31 7393.0 45.69357395172119 37 11 10 6 10 0.7731244686429437 81.37003650998177 0.036701202392578125 3 0.8554131321807845 3.205683636516119 7393.0 29.066495726495727 0.0 - - - - - - - 228.77777777777777 14 9 PNLIPRP3 pancreatic lipase-related protein 3 1589 202 C20140716_OR021_01 C20140716_OR021_01 TB442417.[MT7]-TFSTELVGLPWSPEK[MT7].2y6_1.heavy 990.04 / 887.474 10856.0 45.69357395172119 37 11 10 6 10 0.7731244686429437 81.37003650998177 0.036701202392578125 3 0.8554131321807845 3.205683636516119 10856.0 53.40919786096257 0.0 - - - - - - - 117.0 21 8 PNLIPRP3 pancreatic lipase-related protein 3 1591 202 C20140716_OR021_01 C20140716_OR021_01 TB442417.[MT7]-TFSTELVGLPWSPEK[MT7].2b5_1.heavy 990.04 / 710.348 5287.0 45.69357395172119 37 11 10 6 10 0.7731244686429437 81.37003650998177 0.036701202392578125 3 0.8554131321807845 3.205683636516119 5287.0 27.14181818181818 0.0 - - - - - - - 127.14285714285714 10 7 PNLIPRP3 pancreatic lipase-related protein 3 1593 203 C20140716_OR021_01 C20140716_OR021_01 TB442212.[MT7]-LREEHILMR.3b4_1.heavy 447.591 / 672.38 4429.0 26.936800003051758 43 13 10 10 10 2.327768749041992 42.959593834720756 0.0 3 0.926330988215039 4.518736516637787 4429.0 23.140962762956395 1.0 - - - - - - - 214.77777777777777 10 9 MRVI1 murine retrovirus integration site 1 homolog 1595 203 C20140716_OR021_01 C20140716_OR021_01 TB442212.[MT7]-LREEHILMR.3b5_1.heavy 447.591 / 809.439 5111.0 26.936800003051758 43 13 10 10 10 2.327768749041992 42.959593834720756 0.0 3 0.926330988215039 4.518736516637787 5111.0 67.34875183553598 0.0 - - - - - - - 114.0 10 1 MRVI1 murine retrovirus integration site 1 homolog 1597 203 C20140716_OR021_01 C20140716_OR021_01 TB442212.[MT7]-LREEHILMR.3y4_1.heavy 447.591 / 532.328 17263.0 26.936800003051758 43 13 10 10 10 2.327768749041992 42.959593834720756 0.0 3 0.926330988215039 4.518736516637787 17263.0 191.9517350928641 0.0 - - - - - - - 268.54545454545456 34 11 MRVI1 murine retrovirus integration site 1 homolog 1599 203 C20140716_OR021_01 C20140716_OR021_01 TB442212.[MT7]-LREEHILMR.3y5_1.heavy 447.591 / 669.386 4997.0 26.936800003051758 43 13 10 10 10 2.327768749041992 42.959593834720756 0.0 3 0.926330988215039 4.518736516637787 4997.0 28.763935389133625 0.0 - - - - - - - 275.85714285714283 9 7 MRVI1 murine retrovirus integration site 1 homolog 1601 204 C20140716_OR021_01 C20140716_OR021_01 TB442418.[MT7]-SRTAFTAQQLEALEK[MT7].4y4_1.heavy 496.029 / 604.379 9676.0 33.893699645996094 44 14 10 10 10 8.241896482132129 12.133129822340429 0.0 3 0.9424302949509465 5.118697967672061 9676.0 37.50408662547588 0.0 - - - - - - - 235.6 19 5 DMBX1 diencephalon/mesencephalon homeobox 1 1603 204 C20140716_OR021_01 C20140716_OR021_01 TB442418.[MT7]-SRTAFTAQQLEALEK[MT7].4b8_2.heavy 496.029 / 504.273 8369.0 33.893699645996094 44 14 10 10 10 8.241896482132129 12.133129822340429 0.0 3 0.9424302949509465 5.118697967672061 8369.0 30.193225399331713 2.0 - - - - - - - 224.42857142857142 21 7 DMBX1 diencephalon/mesencephalon homeobox 1 1605 204 C20140716_OR021_01 C20140716_OR021_01 TB442418.[MT7]-SRTAFTAQQLEALEK[MT7].4b7_1.heavy 496.029 / 879.481 3269.0 33.893699645996094 44 14 10 10 10 8.241896482132129 12.133129822340429 0.0 3 0.9424302949509465 5.118697967672061 3269.0 34.81110687022901 0.0 - - - - - - - 235.6 6 5 DMBX1 diencephalon/mesencephalon homeobox 1 1607 204 C20140716_OR021_01 C20140716_OR021_01 TB442418.[MT7]-SRTAFTAQQLEALEK[MT7].4y3_1.heavy 496.029 / 533.341 6669.0 33.893699645996094 44 14 10 10 10 8.241896482132129 12.133129822340429 0.0 3 0.9424302949509465 5.118697967672061 6669.0 21.163870928131637 0.0 - - - - - - - 262.0 13 5 DMBX1 diencephalon/mesencephalon homeobox 1 1609 205 C20140716_OR021_01 C20140716_OR021_01 TB420038.[MT7]-DDQIHILK[MT7].2b3_1.heavy 635.374 / 503.222 2198.0 29.077167510986328 32 13 9 6 4 1.6721645106852356 46.909050269507794 0.035900115966796875 8 0.9096696023937635 4.074935270612681 2198.0 11.989090909090908 4.0 - - - - - - - 753.7142857142857 7 7 ALOX5 arachidonate 5-lipoxygenase 1611 205 C20140716_OR021_01 C20140716_OR021_01 TB420038.[MT7]-DDQIHILK[MT7].2y4_1.heavy 635.374 / 654.442 N/A 29.077167510986328 32 13 9 6 4 1.6721645106852356 46.909050269507794 0.035900115966796875 8 0.9096696023937635 4.074935270612681 0.0 0.0 40.0 - - - - - - - 316.25 6 8 ALOX5 arachidonate 5-lipoxygenase 1613 205 C20140716_OR021_01 C20140716_OR021_01 TB420038.[MT7]-DDQIHILK[MT7].2b5_1.heavy 635.374 / 753.365 1429.0 29.077167510986328 32 13 9 6 4 1.6721645106852356 46.909050269507794 0.035900115966796875 8 0.9096696023937635 4.074935270612681 1429.0 1.1727129273523353 2.0 - - - - - - - 250.0 3 11 ALOX5 arachidonate 5-lipoxygenase 1615 205 C20140716_OR021_01 C20140716_OR021_01 TB420038.[MT7]-DDQIHILK[MT7].2b4_1.heavy 635.374 / 616.306 3407.0 29.077167510986328 32 13 9 6 4 1.6721645106852356 46.909050269507794 0.035900115966796875 8 0.9096696023937635 4.074935270612681 3407.0 5.0876578652017255 1.0 - - - - - - - 275.0 8 10 ALOX5 arachidonate 5-lipoxygenase 1617 206 C20140716_OR021_01 C20140716_OR021_01 TB420230.[MT7]-MPLLSC[CAM]QFLK[MT7].3y3_1.heavy 508.956 / 551.367 11541.0 44.19459915161133 37 20 2 5 10 24.511251374751087 4.079759065382092 0.0467987060546875 3 0.9959418772754113 19.36657417954045 11541.0 36.61233407738095 0.0 - - - - - - - 238.0 23 8 IDO2 indoleamine 2,3-dioxygenase 2 1619 206 C20140716_OR021_01 C20140716_OR021_01 TB420230.[MT7]-MPLLSC[CAM]QFLK[MT7].3b4_1.heavy 508.956 / 599.371 8628.0 44.19459915161133 37 20 2 5 10 24.511251374751087 4.079759065382092 0.0467987060546875 3 0.9959418772754113 19.36657417954045 8628.0 12.48468144784548 0.0 - - - - - - - 288.0 17 7 IDO2 indoleamine 2,3-dioxygenase 2 1621 206 C20140716_OR021_01 C20140716_OR021_01 TB420230.[MT7]-MPLLSC[CAM]QFLK[MT7].3b5_1.heavy 508.956 / 686.403 1233.0 44.19459915161133 37 20 2 5 10 24.511251374751087 4.079759065382092 0.0467987060546875 3 0.9959418772754113 19.36657417954045 1233.0 0.871463429208828 4.0 - - - - - - - 224.0 64 2 IDO2 indoleamine 2,3-dioxygenase 2 1623 206 C20140716_OR021_01 C20140716_OR021_01 TB420230.[MT7]-MPLLSC[CAM]QFLK[MT7].3y4_1.heavy 508.956 / 679.426 1569.0 44.19459915161133 37 20 2 5 10 24.511251374751087 4.079759065382092 0.0467987060546875 3 0.9959418772754113 19.36657417954045 1569.0 15.998196428571427 0.0 - - - - - - - 179.2 3 5 IDO2 indoleamine 2,3-dioxygenase 2 1625 207 C20140716_OR021_01 C20140716_OR021_01 TB442043.[MT7]-NSALLR.2b3_1.heavy 409.254 / 417.221 15324.0 23.574100494384766 42 12 10 10 10 1.0260272685850627 57.03126735758197 0.0 3 0.8945185751457773 3.7660044506731913 15324.0 48.25036226316658 0.0 - - - - - - - 270.4 30 15 ITLN2 intelectin 2 1627 207 C20140716_OR021_01 C20140716_OR021_01 TB442043.[MT7]-NSALLR.2y5_1.heavy 409.254 / 559.356 33127.0 23.574100494384766 42 12 10 10 10 1.0260272685850627 57.03126735758197 0.0 3 0.8945185751457773 3.7660044506731913 33127.0 128.76206172980508 0.0 - - - - - - - 289.85714285714283 66 7 ITLN2 intelectin 2 1629 207 C20140716_OR021_01 C20140716_OR021_01 TB442043.[MT7]-NSALLR.2b4_1.heavy 409.254 / 530.305 23324.0 23.574100494384766 42 12 10 10 10 1.0260272685850627 57.03126735758197 0.0 3 0.8945185751457773 3.7660044506731913 23324.0 40.94825377140703 1.0 - - - - - - - 281.625 62 8 ITLN2 intelectin 2 1631 207 C20140716_OR021_01 C20140716_OR021_01 TB442043.[MT7]-NSALLR.2b5_1.heavy 409.254 / 643.39 10817.0 23.574100494384766 42 12 10 10 10 1.0260272685850627 57.03126735758197 0.0 3 0.8945185751457773 3.7660044506731913 10817.0 44.16408284023669 0.0 - - - - - - - 312.0 21 13 ITLN2 intelectin 2 1633 208 C20140716_OR021_01 C20140716_OR021_01 TB420234.[MT7]-DGVPGFPGSEGVK[MT7].3y7_1.heavy 511.943 / 817.454 178.0 32.477399826049805 39 15 10 6 8 5.459680221010538 18.31609104415476 0.037601470947265625 4 0.9584316688031724 6.032051889537086 178.0 0.20056338028169016 27.0 - - - - - - - 0.0 1 0 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1635 208 C20140716_OR021_01 C20140716_OR021_01 TB420234.[MT7]-DGVPGFPGSEGVK[MT7].3y6_1.heavy 511.943 / 720.401 1422.0 32.477399826049805 39 15 10 6 8 5.459680221010538 18.31609104415476 0.037601470947265625 4 0.9584316688031724 6.032051889537086 1422.0 7.806897648036418 1.0 - - - - - - - 227.11111111111111 2 9 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1637 208 C20140716_OR021_01 C20140716_OR021_01 TB420234.[MT7]-DGVPGFPGSEGVK[MT7].3b5_1.heavy 511.943 / 570.3 2222.0 32.477399826049805 39 15 10 6 8 5.459680221010538 18.31609104415476 0.037601470947265625 4 0.9584316688031724 6.032051889537086 2222.0 2.1811042944785277 2.0 - - - - - - - 825.4285714285714 4 7 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1639 208 C20140716_OR021_01 C20140716_OR021_01 TB420234.[MT7]-DGVPGFPGSEGVK[MT7].3y5_1.heavy 511.943 / 663.379 1155.0 32.477399826049805 39 15 10 6 8 5.459680221010538 18.31609104415476 0.037601470947265625 4 0.9584316688031724 6.032051889537086 1155.0 2.1767932489451476 2.0 - - - - - - - 234.27272727272728 4 11 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1641 209 C20140716_OR021_01 C20140716_OR021_01 TB420030.[MT7]-GVINDVINDR.2y8_1.heavy 629.847 / 958.495 8446.0 34.07600021362305 50 20 10 10 10 6.532996850125178 15.306910793640427 0.0 3 0.9953306049565761 18.053562960571398 8446.0 134.90648913043478 0.0 - - - - - - - 170.71428571428572 16 7 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1643 209 C20140716_OR021_01 C20140716_OR021_01 TB420030.[MT7]-GVINDVINDR.2y5_1.heavy 629.847 / 616.341 10466.0 34.07600021362305 50 20 10 10 10 6.532996850125178 15.306910793640427 0.0 3 0.9953306049565761 18.053562960571398 10466.0 29.024578113476252 0.0 - - - - - - - 298.25 20 8 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1645 209 C20140716_OR021_01 C20140716_OR021_01 TB420030.[MT7]-GVINDVINDR.2b5_1.heavy 629.847 / 643.353 11751.0 34.07600021362305 50 20 10 10 10 6.532996850125178 15.306910793640427 0.0 3 0.9953306049565761 18.053562960571398 11751.0 31.151459826868596 0.0 - - - - - - - 317.09090909090907 23 11 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1647 209 C20140716_OR021_01 C20140716_OR021_01 TB420030.[MT7]-GVINDVINDR.2y7_1.heavy 629.847 / 845.411 7895.0 34.07600021362305 50 20 10 10 10 6.532996850125178 15.306910793640427 0.0 3 0.9953306049565761 18.053562960571398 7895.0 68.46494071146245 0.0 - - - - - - - 229.66666666666666 15 6 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1649 210 C20140716_OR021_01 C20140716_OR021_01 TB420238.[MT7]-TQFFIPYTIK[MT7].3y3_1.heavy 515.969 / 505.347 8429.0 43.503501892089844 45 15 10 10 10 1.1549399304924373 55.080609433248384 0.0 3 0.9585299579146179 6.039246244205293 8429.0 68.7628947368421 0.0 - - - - - - - 213.75 16 8 COL10A1 collagen, type X, alpha 1 1651 210 C20140716_OR021_01 C20140716_OR021_01 TB420238.[MT7]-TQFFIPYTIK[MT7].3b3_2.heavy 515.969 / 261.146 3987.0 43.503501892089844 45 15 10 10 10 1.1549399304924373 55.080609433248384 0.0 3 0.9585299579146179 6.039246244205293 3987.0 52.46052631578947 0.0 - - - - - - - 159.6 7 5 COL10A1 collagen, type X, alpha 1 1653 210 C20140716_OR021_01 C20140716_OR021_01 TB420238.[MT7]-TQFFIPYTIK[MT7].3b5_1.heavy 515.969 / 781.437 2392.0 43.503501892089844 45 15 10 10 10 1.1549399304924373 55.080609433248384 0.0 3 0.9585299579146179 6.039246244205293 2392.0 20.248070175438595 0.0 - - - - - - - 205.2 4 5 COL10A1 collagen, type X, alpha 1 1655 210 C20140716_OR021_01 C20140716_OR021_01 TB420238.[MT7]-TQFFIPYTIK[MT7].3y5_1.heavy 515.969 / 765.463 2734.0 43.503501892089844 45 15 10 10 10 1.1549399304924373 55.080609433248384 0.0 3 0.9585299579146179 6.039246244205293 2734.0 31.17719298245614 0.0 - - - - - - - 228.0 5 3 COL10A1 collagen, type X, alpha 1 1657 211 C20140716_OR021_01 C20140716_OR021_01 TB420237.[MT7]-K[MT7]IGC[CAM]GNFGELR.3y7_1.heavy 513.617 / 792.4 7598.0 29.110050678253174 40 14 10 6 10 2.636363250548328 37.93104003372879 0.03579902648925781 3 0.9368178074716655 4.883727525102772 7598.0 92.67125180304862 0.0 - - - - - - - 201.55555555555554 15 9 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1659 211 C20140716_OR021_01 C20140716_OR021_01 TB420237.[MT7]-K[MT7]IGC[CAM]GNFGELR.3b6_1.heavy 513.617 / 918.507 2722.0 29.110050678253174 40 14 10 6 10 2.636363250548328 37.93104003372879 0.03579902648925781 3 0.9368178074716655 4.883727525102772 2722.0 18.295920874544507 0.0 - - - - - - - 226.5 5 4 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1661 211 C20140716_OR021_01 C20140716_OR021_01 TB420237.[MT7]-K[MT7]IGC[CAM]GNFGELR.3y5_1.heavy 513.617 / 621.336 8732.0 29.110050678253174 40 14 10 6 10 2.636363250548328 37.93104003372879 0.03579902648925781 3 0.9368178074716655 4.883727525102772 8732.0 41.931409136808 0.0 - - - - - - - 226.75 17 12 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1663 211 C20140716_OR021_01 C20140716_OR021_01 TB420237.[MT7]-K[MT7]IGC[CAM]GNFGELR.3y9_1.heavy 513.617 / 1009.45 1814.0 29.110050678253174 40 14 10 6 10 2.636363250548328 37.93104003372879 0.03579902648925781 3 0.9368178074716655 4.883727525102772 1814.0 15.73203539823009 1.0 - - - - - - - 272.0 3 5 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1665 212 C20140716_OR021_01 C20140716_OR021_01 TB420031.[MT7]-THYPDVVMR.3y3_1.heavy 421.221 / 405.228 29237.0 27.243000030517578 46 16 10 10 10 3.4617306736254747 28.88728483757804 0.0 3 0.9669971959829637 6.774624759057925 29237.0 25.595187137998735 1.0 - - - - - - - 242.0 58 6 DMBX1 diencephalon/mesencephalon homeobox 1 1667 212 C20140716_OR021_01 C20140716_OR021_01 TB420031.[MT7]-THYPDVVMR.3y6_1.heavy 421.221 / 716.376 18190.0 27.243000030517578 46 16 10 10 10 3.4617306736254747 28.88728483757804 0.0 3 0.9669971959829637 6.774624759057925 18190.0 -0.381408955411236 2.0 - - - - - - - 167.5 38 8 DMBX1 diencephalon/mesencephalon homeobox 1 1669 212 C20140716_OR021_01 C20140716_OR021_01 TB420031.[MT7]-THYPDVVMR.3y4_1.heavy 421.221 / 504.296 43410.0 27.243000030517578 46 16 10 10 10 3.4617306736254747 28.88728483757804 0.0 3 0.9669971959829637 6.774624759057925 43410.0 127.31440298507462 0.0 - - - - - - - 334.6666666666667 86 6 DMBX1 diencephalon/mesencephalon homeobox 1 1671 212 C20140716_OR021_01 C20140716_OR021_01 TB420031.[MT7]-THYPDVVMR.3y5_1.heavy 421.221 / 619.323 34482.0 27.243000030517578 46 16 10 10 10 3.4617306736254747 28.88728483757804 0.0 3 0.9669971959829637 6.774624759057925 34482.0 173.57222688830137 0.0 - - - - - - - 210.88888888888889 68 9 DMBX1 diencephalon/mesencephalon homeobox 1 1673 213 C20140716_OR021_01 C20140716_OR021_01 TB419896.[MT7]-AALRSPDSPK[MT7].3y3_1.heavy 443.929 / 475.3 9652.0 20.08947467803955 34 11 10 3 10 1.617018368694852 47.31102328074772 0.060298919677734375 3 0.8760521834238212 3.4685786265252165 9652.0 11.732220872287396 0.0 - - - - - - - 239.53846153846155 19 13 E2F3 E2F transcription factor 3 1675 213 C20140716_OR021_01 C20140716_OR021_01 TB419896.[MT7]-AALRSPDSPK[MT7].3y5_1.heavy 443.929 / 687.379 1207.0 20.08947467803955 34 11 10 3 10 1.617018368694852 47.31102328074772 0.060298919677734375 3 0.8760521834238212 3.4685786265252165 1207.0 0.7993377483443707 2.0 - - - - - - - 160.04545454545453 3 22 E2F3 E2F transcription factor 3 1677 213 C20140716_OR021_01 C20140716_OR021_01 TB419896.[MT7]-AALRSPDSPK[MT7].3y9_2.heavy 443.929 / 557.82 4273.0 20.08947467803955 34 11 10 3 10 1.617018368694852 47.31102328074772 0.060298919677734375 3 0.8760521834238212 3.4685786265252165 4273.0 6.796023856858847 0.0 - - - - - - - 195.23529411764707 8 17 E2F3 E2F transcription factor 3 1679 213 C20140716_OR021_01 C20140716_OR021_01 TB419896.[MT7]-AALRSPDSPK[MT7].3b7_2.heavy 443.929 / 428.244 16640.0 20.08947467803955 34 11 10 3 10 1.617018368694852 47.31102328074772 0.060298919677734375 3 0.8760521834238212 3.4685786265252165 16640.0 45.003557967737066 0.0 - - - - - - - 693.8666666666667 33 15 E2F3 E2F transcription factor 3 1681 214 C20140716_OR021_01 C20140716_OR021_01 TB419997.[MT7]-GGSGGGGGPPAK[MT7].2b8_1.heavy 593.825 / 631.292 2229.0 15.160599708557129 34 18 2 6 8 3.652188711621138 22.065830271585206 0.035999298095703125 4 0.9824096136367335 9.291503612965592 2229.0 41.30205882352941 0.0 - - - - - - - 104.5 4 12 E2F3 E2F transcription factor 3 1683 214 C20140716_OR021_01 C20140716_OR021_01 TB419997.[MT7]-GGSGGGGGPPAK[MT7].2y4_1.heavy 593.825 / 556.357 2331.0 15.160599708557129 34 18 2 6 8 3.652188711621138 22.065830271585206 0.035999298095703125 4 0.9824096136367335 9.291503612965592 2331.0 25.14353048780488 1.0 - - - - - - - 100.94117647058823 13 17 E2F3 E2F transcription factor 3 1685 214 C20140716_OR021_01 C20140716_OR021_01 TB419997.[MT7]-GGSGGGGGPPAK[MT7].2y5_1.heavy 593.825 / 613.379 820.0 15.160599708557129 34 18 2 6 8 3.652188711621138 22.065830271585206 0.035999298095703125 4 0.9824096136367335 9.291503612965592 820.0 24.698141074611662 0.0 - - - - - - - 0.0 1 0 E2F3 E2F transcription factor 3 1687 214 C20140716_OR021_01 C20140716_OR021_01 TB419997.[MT7]-GGSGGGGGPPAK[MT7].2b7_1.heavy 593.825 / 574.27 820.0 15.160599708557129 34 18 2 6 8 3.652188711621138 22.065830271585206 0.035999298095703125 4 0.9824096136367335 9.291503612965592 820.0 2.3262411347517733 1.0 - - - - - - - 0.0 1 0 E2F3 E2F transcription factor 3 1689 215 C20140716_OR021_01 C20140716_OR021_01 TB420035.[MT7]-YVPVK[MT7]PK[MT7].3y6_2.heavy 421.611 / 478.331 61073.0 24.0851993560791 46 16 10 10 10 2.8494446049214672 35.09455836666671 0.0 3 0.9645912225623973 6.539085505787561 61073.0 348.67807275091536 0.0 - - - - - - - 235.66666666666666 122 12 DEFB121 defensin, beta 121 1691 215 C20140716_OR021_01 C20140716_OR021_01 TB420035.[MT7]-YVPVK[MT7]PK[MT7].3y3_1.heavy 421.611 / 660.465 16510.0 24.0851993560791 46 16 10 10 10 2.8494446049214672 35.09455836666671 0.0 3 0.9645912225623973 6.539085505787561 16510.0 113.76766056284772 0.0 - - - - - - - 137.4 33 10 DEFB121 defensin, beta 121 1693 215 C20140716_OR021_01 C20140716_OR021_01 TB420035.[MT7]-YVPVK[MT7]PK[MT7].3y5_1.heavy 421.611 / 856.586 1758.0 24.0851993560791 46 16 10 10 10 2.8494446049214672 35.09455836666671 0.0 3 0.9645912225623973 6.539085505787561 1758.0 45.10657894736842 0.0 - - - - - - - 167.8 3 5 DEFB121 defensin, beta 121 1695 215 C20140716_OR021_01 C20140716_OR021_01 TB420035.[MT7]-YVPVK[MT7]PK[MT7].3y5_2.heavy 421.611 / 428.797 310640.0 24.0851993560791 46 16 10 10 10 2.8494446049214672 35.09455836666671 0.0 3 0.9645912225623973 6.539085505787561 310640.0 870.7223521252778 0.0 - - - - - - - 183.2 621 5 DEFB121 defensin, beta 121 1697 216 C20140716_OR021_01 C20140716_OR021_01 TB420132.[MT7]-DSLLELSPVER.3y6_1.heavy 467.928 / 700.399 1238.0 39.43709945678711 48 18 10 10 10 4.634193848117001 17.24539176992185 0.0 3 0.9885902483331267 11.542781494808919 1238.0 3.2546918804482563 1.0 - - - - - - - 344.0 2 2 FGF4 fibroblast growth factor 4 1699 216 C20140716_OR021_01 C20140716_OR021_01 TB420132.[MT7]-DSLLELSPVER.3b4_1.heavy 467.928 / 573.336 3988.0 39.43709945678711 48 18 10 10 10 4.634193848117001 17.24539176992185 0.0 3 0.9885902483331267 11.542781494808919 3988.0 5.5627862648231465 1.0 - - - - - - - 229.33333333333334 9 3 FGF4 fibroblast growth factor 4 1701 216 C20140716_OR021_01 C20140716_OR021_01 TB420132.[MT7]-DSLLELSPVER.3b5_1.heavy 467.928 / 702.379 3851.0 39.43709945678711 48 18 10 10 10 4.634193848117001 17.24539176992185 0.0 3 0.9885902483331267 11.542781494808919 3851.0 21.88195333480079 0.0 - - - - - - - 367.0 7 3 FGF4 fibroblast growth factor 4 1703 216 C20140716_OR021_01 C20140716_OR021_01 TB420132.[MT7]-DSLLELSPVER.3y5_1.heavy 467.928 / 587.315 3713.0 39.43709945678711 48 18 10 10 10 4.634193848117001 17.24539176992185 0.0 3 0.9885902483331267 11.542781494808919 3713.0 21.45808329297821 0.0 - - - - - - - 298.1666666666667 7 6 FGF4 fibroblast growth factor 4 1705 217 C20140716_OR021_01 C20140716_OR021_01 TB419898.[MT7]-EALQER.2y4_1.heavy 445.247 / 545.304 N/A 18.095200220743816 38 18 10 6 4 2.4616225006378487 31.34893139038568 0.0345001220703125 7 0.9870975191350584 10.853197173944936 13103.0 35.16953969044929 0.0 - - - - - - - 1220.0 26 7 KAZ kazrin 1707 217 C20140716_OR021_01 C20140716_OR021_01 TB419898.[MT7]-EALQER.2b3_1.heavy 445.247 / 458.273 5784.0 18.095200220743816 38 18 10 6 4 2.4616225006378487 31.34893139038568 0.0345001220703125 7 0.9870975191350584 10.853197173944936 5784.0 23.598100397624478 0.0 - - - - - - - 249.47826086956522 11 23 KAZ kazrin 1709 217 C20140716_OR021_01 C20140716_OR021_01 TB419898.[MT7]-EALQER.2y5_1.heavy 445.247 / 616.341 16809.0 18.095200220743816 38 18 10 6 4 2.4616225006378487 31.34893139038568 0.0345001220703125 7 0.9870975191350584 10.853197173944936 16809.0 34.213008849557525 2.0 - - - - - - - 235.47368421052633 35 19 KAZ kazrin 1711 217 C20140716_OR021_01 C20140716_OR021_01 TB419898.[MT7]-EALQER.2b4_1.heavy 445.247 / 586.332 6868.0 18.095200220743816 38 18 10 6 4 2.4616225006378487 31.34893139038568 0.0345001220703125 7 0.9870975191350584 10.853197173944936 6868.0 17.035357650938213 3.0 - - - - - - - 662.5555555555555 20 9 KAZ kazrin 1713 218 C20140716_OR021_01 C20140716_OR021_01 TB442318.[MT7]-NQAVPVQC[CAM]QLK[MT7].3b6_1.heavy 524.964 / 753.438 9314.0 26.185850143432617 45 20 10 5 10 15.443455441560259 6.4752347930429845 0.0457000732421875 3 0.9928663761833042 14.603224277565007 9314.0 153.59929824561405 0.0 - - - - - - - 182.0 18 5 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1715 218 C20140716_OR021_01 C20140716_OR021_01 TB442318.[MT7]-NQAVPVQC[CAM]QLK[MT7].3b4_1.heavy 524.964 / 557.316 142769.0 26.185850143432617 45 20 10 5 10 15.443455441560259 6.4752347930429845 0.0457000732421875 3 0.9928663761833042 14.603224277565007 142769.0 254.4218822385506 0.0 - - - - - - - 326.625 285 8 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1717 218 C20140716_OR021_01 C20140716_OR021_01 TB442318.[MT7]-NQAVPVQC[CAM]QLK[MT7].3y4_1.heavy 524.964 / 692.388 30326.0 26.185850143432617 45 20 10 5 10 15.443455441560259 6.4752347930429845 0.0457000732421875 3 0.9928663761833042 14.603224277565007 30326.0 123.26387207436508 0.0 - - - - - - - 208.33333333333334 60 6 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1719 218 C20140716_OR021_01 C20140716_OR021_01 TB442318.[MT7]-NQAVPVQC[CAM]QLK[MT7].3y5_1.heavy 524.964 / 820.447 7155.0 26.185850143432617 45 20 10 5 10 15.443455441560259 6.4752347930429845 0.0457000732421875 3 0.9928663761833042 14.603224277565007 7155.0 72.55365754695107 0.0 - - - - - - - 202.11111111111111 14 9 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1721 219 C20140716_OR021_01 C20140716_OR021_01 TB442317.[MT7]-GPGTLEC[CAM]AELLLR.2b8_1.heavy 786.93 / 930.447 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 1723 219 C20140716_OR021_01 C20140716_OR021_01 TB442317.[MT7]-GPGTLEC[CAM]AELLLR.2y8_1.heavy 786.93 / 1003.52 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 1725 219 C20140716_OR021_01 C20140716_OR021_01 TB442317.[MT7]-GPGTLEC[CAM]AELLLR.2y9_1.heavy 786.93 / 1116.61 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 1727 219 C20140716_OR021_01 C20140716_OR021_01 TB442317.[MT7]-GPGTLEC[CAM]AELLLR.2y7_1.heavy 786.93 / 874.482 N/A N/A - - - - - - - - - 0.0 - - - - - - - ASB10 ankyrin repeat and SOCS box-containing 10 1729 220 C20140716_OR021_01 C20140716_OR021_01 TB436079.[MT7]-VTGC[CAM]NTEHHC[CAM]IGGGGFFPQGK[MT7]PR.4y4_1.heavy 701.096 / 601.39 3209.0 27.41427516937256 36 15 10 1 10 1.9123780445243834 40.94142208877138 0.09059906005859375 3 0.9549942238375951 5.795432071812745 3209.0 26.350918867668966 0.0 - - - - - - - 257.875 6 8 ITLN2 intelectin 2 1731 220 C20140716_OR021_01 C20140716_OR021_01 TB436079.[MT7]-VTGC[CAM]NTEHHC[CAM]IGGGGFFPQGK[MT7]PR.4b5_1.heavy 701.096 / 676.32 1490.0 27.41427516937256 36 15 10 1 10 1.9123780445243834 40.94142208877138 0.09059906005859375 3 0.9549942238375951 5.795432071812745 1490.0 6.052302224027622 0.0 - - - - - - - 258.0 2 4 ITLN2 intelectin 2 1733 220 C20140716_OR021_01 C20140716_OR021_01 TB436079.[MT7]-VTGC[CAM]NTEHHC[CAM]IGGGGFFPQGK[MT7]PR.4b7_1.heavy 701.096 / 906.411 1834.0 27.41427516937256 36 15 10 1 10 1.9123780445243834 40.94142208877138 0.09059906005859375 3 0.9549942238375951 5.795432071812745 1834.0 31.08231304347826 0.0 - - - - - - - 229.42857142857142 3 7 ITLN2 intelectin 2 1735 220 C20140716_OR021_01 C20140716_OR021_01 TB436079.[MT7]-VTGC[CAM]NTEHHC[CAM]IGGGGFFPQGK[MT7]PR.4y6_1.heavy 701.096 / 826.502 9054.0 27.41427516937256 36 15 10 1 10 1.9123780445243834 40.94142208877138 0.09059906005859375 3 0.9549942238375951 5.795432071812745 9054.0 100.84590546006066 0.0 - - - - - - - 267.44444444444446 18 9 ITLN2 intelectin 2 1737 221 C20140716_OR021_01 C20140716_OR021_01 TB420410.[MT7]-LYGSPFFTDEC[CAM]TFK[MT7].3y3_1.heavy 667.329 / 539.331 66713.0 43.819698333740234 46 16 10 10 10 1.9140412260620945 41.44991188782175 0.0 3 0.9605359911004144 6.191887714188142 66713.0 93.2760584605325 0.0 - - - - - - - 228.0 133 5 FGF4 fibroblast growth factor 4 1739 221 C20140716_OR021_01 C20140716_OR021_01 TB420410.[MT7]-LYGSPFFTDEC[CAM]TFK[MT7].3b6_1.heavy 667.329 / 809.431 56335.0 43.819698333740234 46 16 10 10 10 1.9140412260620945 41.44991188782175 0.0 3 0.9605359911004144 6.191887714188142 56335.0 69.64482981298616 0.0 - - - - - - - 361.0 112 6 FGF4 fibroblast growth factor 4 1741 221 C20140716_OR021_01 C20140716_OR021_01 TB420410.[MT7]-LYGSPFFTDEC[CAM]TFK[MT7].3b4_1.heavy 667.329 / 565.31 81082.0 43.819698333740234 46 16 10 10 10 1.9140412260620945 41.44991188782175 0.0 3 0.9605359911004144 6.191887714188142 81082.0 134.92113769271663 0.0 - - - - - - - 285.0 162 6 FGF4 fibroblast growth factor 4 1743 221 C20140716_OR021_01 C20140716_OR021_01 TB420410.[MT7]-LYGSPFFTDEC[CAM]TFK[MT7].3y4_1.heavy 667.329 / 699.362 42993.0 43.819698333740234 46 16 10 10 10 1.9140412260620945 41.44991188782175 0.0 3 0.9605359911004144 6.191887714188142 42993.0 115.82799643944753 0.0 - - - - - - - 278.6666666666667 85 9 FGF4 fibroblast growth factor 4 1745 222 C20140716_OR021_01 C20140716_OR021_01 TB420169.[MT7]-DDGLLVWEAIR.2y9_1.heavy 715.892 / 1056.62 17496.0 46.85555076599121 43 17 10 6 10 3.086224639632339 32.402048352485764 0.032901763916015625 3 0.9703479723982584 7.1491786094003285 17496.0 49.36323765936581 0.0 - - - - - - - 712.1428571428571 34 7 ALOX5 arachidonate 5-lipoxygenase 1747 222 C20140716_OR021_01 C20140716_OR021_01 TB420169.[MT7]-DDGLLVWEAIR.2b4_1.heavy 715.892 / 545.269 18109.0 46.85555076599121 43 17 10 6 10 3.086224639632339 32.402048352485764 0.032901763916015625 3 0.9703479723982584 7.1491786094003285 18109.0 42.20090810810811 0.0 - - - - - - - 254.91666666666666 36 12 ALOX5 arachidonate 5-lipoxygenase 1749 222 C20140716_OR021_01 C20140716_OR021_01 TB420169.[MT7]-DDGLLVWEAIR.2b5_1.heavy 715.892 / 658.353 12422.0 46.85555076599121 43 17 10 6 10 3.086224639632339 32.402048352485764 0.032901763916015625 3 0.9703479723982584 7.1491786094003285 12422.0 88.01874285714285 0.0 - - - - - - - 667.0 24 8 ALOX5 arachidonate 5-lipoxygenase 1751 222 C20140716_OR021_01 C20140716_OR021_01 TB420169.[MT7]-DDGLLVWEAIR.2y7_1.heavy 715.892 / 886.515 14872.0 46.85555076599121 43 17 10 6 10 3.086224639632339 32.402048352485764 0.032901763916015625 3 0.9703479723982584 7.1491786094003285 14872.0 57.99447976462896 1.0 - - - - - - - 245.8125 29 16 ALOX5 arachidonate 5-lipoxygenase 1753 223 C20140716_OR021_01 C20140716_OR021_01 TB420360.[MT7]-GVVTIEQIVDTLPDR.3y7_1.heavy 600.339 / 815.426 3382.0 48.879600524902344 40 20 2 10 8 6.303965350102869 15.863031353490575 0.0 4 0.9944194304980842 16.512808127708674 3382.0 15.929710144927535 0.0 - - - - - - - 195.5 6 12 ALOX5 arachidonate 5-lipoxygenase 1755 223 C20140716_OR021_01 C20140716_OR021_01 TB420360.[MT7]-GVVTIEQIVDTLPDR.3b6_1.heavy 600.339 / 743.442 1864.0 48.879600524902344 40 20 2 10 8 6.303965350102869 15.863031353490575 0.0 4 0.9944194304980842 16.512808127708674 1864.0 6.303381642512077 1.0 - - - - - - - 213.9 3 10 ALOX5 arachidonate 5-lipoxygenase 1757 223 C20140716_OR021_01 C20140716_OR021_01 TB420360.[MT7]-GVVTIEQIVDTLPDR.3y6_1.heavy 600.339 / 716.357 3382.0 48.879600524902344 40 20 2 10 8 6.303965350102869 15.863031353490575 0.0 4 0.9944194304980842 16.512808127708674 3382.0 30.797439613526567 1.0 - - - - - - - 212.30769230769232 18 13 ALOX5 arachidonate 5-lipoxygenase 1759 223 C20140716_OR021_01 C20140716_OR021_01 TB420360.[MT7]-GVVTIEQIVDTLPDR.3b4_1.heavy 600.339 / 501.315 N/A 48.879600524902344 40 20 2 10 8 6.303965350102869 15.863031353490575 0.0 4 0.9944194304980842 16.512808127708674 3865.0 1.17636927334652 2.0 - - - - - - - 276.0 12 6 ALOX5 arachidonate 5-lipoxygenase 1761 224 C20140716_OR021_01 C20140716_OR021_01 TB420363.[MT7]-LPVTTEMVEC[CAM]SLER.3y7_1.heavy 603.307 / 892.419 6568.0 41.532798767089844 42 15 9 10 8 3.0016080272458106 33.31547593566277 0.0 4 0.9557604723128147 5.845785835924158 6568.0 -1.213087071240107 0.0 - - - - - - - 189.3 13 10 ALOX5 arachidonate 5-lipoxygenase 1763 224 C20140716_OR021_01 C20140716_OR021_01 TB420363.[MT7]-LPVTTEMVEC[CAM]SLER.3b6_1.heavy 603.307 / 785.453 13388.0 41.532798767089844 42 15 9 10 8 3.0016080272458106 33.31547593566277 0.0 4 0.9557604723128147 5.845785835924158 13388.0 -0.6355063291139231 1.0 - - - - - - - 176.8 35 5 ALOX5 arachidonate 5-lipoxygenase 1765 224 C20140716_OR021_01 C20140716_OR021_01 TB420363.[MT7]-LPVTTEMVEC[CAM]SLER.3y6_1.heavy 603.307 / 793.351 15409.0 41.532798767089844 42 15 9 10 8 3.0016080272458106 33.31547593566277 0.0 4 0.9557604723128147 5.845785835924158 15409.0 -2.4381329113924046 0.0 - - - - - - - 252.66666666666666 30 3 ALOX5 arachidonate 5-lipoxygenase 1767 224 C20140716_OR021_01 C20140716_OR021_01 TB420363.[MT7]-LPVTTEMVEC[CAM]SLER.3y5_1.heavy 603.307 / 664.308 14904.0 41.532798767089844 42 15 9 10 8 3.0016080272458106 33.31547593566277 0.0 4 0.9557604723128147 5.845785835924158 14904.0 -3.9324538258575217 0.0 - - - - - - - 328.6 29 5 ALOX5 arachidonate 5-lipoxygenase 1769 225 C20140716_OR021_01 C20140716_OR021_01 TB420223.[MT7]-SRAPQLHLEYR.3b6_1.heavy 505.283 / 797.475 3901.0 26.97960090637207 43 13 10 10 10 3.412446079128559 29.30449234396024 0.0 3 0.9218840135581354 4.386558391677634 3901.0 52.48346061837057 0.0 - - - - - - - 157.875 7 8 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1771 225 C20140716_OR021_01 C20140716_OR021_01 TB420223.[MT7]-SRAPQLHLEYR.3b5_1.heavy 505.283 / 684.391 2636.0 26.97960090637207 43 13 10 10 10 3.412446079128559 29.30449234396024 0.0 3 0.9218840135581354 4.386558391677634 2636.0 16.278236966824643 1.0 - - - - - - - 231.8 6 5 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1773 225 C20140716_OR021_01 C20140716_OR021_01 TB420223.[MT7]-SRAPQLHLEYR.3y4_1.heavy 505.283 / 580.309 10331.0 26.97960090637207 43 13 10 10 10 3.412446079128559 29.30449234396024 0.0 3 0.9218840135581354 4.386558391677634 10331.0 113.7762286165651 0.0 - - - - - - - 231.8 20 10 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1775 225 C20140716_OR021_01 C20140716_OR021_01 TB420223.[MT7]-SRAPQLHLEYR.3y5_1.heavy 505.283 / 717.368 4006.0 26.97960090637207 43 13 10 10 10 3.412446079128559 29.30449234396024 0.0 3 0.9218840135581354 4.386558391677634 4006.0 47.39708921036769 0.0 - - - - - - - 231.8 8 5 CSNK1G2;CSNK1G3;CSNK1G1 casein kinase 1, gamma 2;casein kinase 1, gamma 3;casein kinase 1, gamma 1 1777 226 C20140716_OR021_01 C20140716_OR021_01 TB442401.[MT7]-DLTYASLC[CAM]FPEAIK[MT7].2y5_1.heavy 958.508 / 701.431 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 1779 226 C20140716_OR021_01 C20140716_OR021_01 TB442401.[MT7]-DLTYASLC[CAM]FPEAIK[MT7].2y9_1.heavy 958.508 / 1208.65 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 1781 226 C20140716_OR021_01 C20140716_OR021_01 TB442401.[MT7]-DLTYASLC[CAM]FPEAIK[MT7].2b5_1.heavy 958.508 / 708.369 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 1783 226 C20140716_OR021_01 C20140716_OR021_01 TB442401.[MT7]-DLTYASLC[CAM]FPEAIK[MT7].2y7_1.heavy 958.508 / 1008.53 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 1785 227 C20140716_OR021_01 C20140716_OR021_01 TB420220.[MT7]-LGAEMVINTSGK[MT7].2b4_1.heavy 754.423 / 515.295 10393.0 33.9379997253418 50 20 10 10 10 11.182296490344127 8.942706901605554 0.0 3 0.9918288921690871 13.643498033449434 10393.0 72.16555687289474 0.0 - - - - - - - 269.25 20 8 PNLIPRP3 pancreatic lipase-related protein 3 1787 227 C20140716_OR021_01 C20140716_OR021_01 TB420220.[MT7]-LGAEMVINTSGK[MT7].2b6_1.heavy 754.423 / 745.404 7584.0 33.9379997253418 50 20 10 10 10 11.182296490344127 8.942706901605554 0.0 3 0.9918288921690871 13.643498033449434 7584.0 6.908176432901286 1.0 - - - - - - - 735.4285714285714 18 7 PNLIPRP3 pancreatic lipase-related protein 3 1789 227 C20140716_OR021_01 C20140716_OR021_01 TB420220.[MT7]-LGAEMVINTSGK[MT7].2y6_1.heavy 754.423 / 763.443 6460.0 33.9379997253418 50 20 10 10 10 11.182296490344127 8.942706901605554 0.0 3 0.9918288921690871 13.643498033449434 6460.0 37.63076441281139 0.0 - - - - - - - 254.42857142857142 12 7 PNLIPRP3 pancreatic lipase-related protein 3 1791 227 C20140716_OR021_01 C20140716_OR021_01 TB420220.[MT7]-LGAEMVINTSGK[MT7].2b5_1.heavy 754.423 / 646.335 5899.0 33.9379997253418 50 20 10 10 10 11.182296490344127 8.942706901605554 0.0 3 0.9918288921690871 13.643498033449434 5899.0 26.453834816528797 0.0 - - - - - - - 234.08333333333334 11 12 PNLIPRP3 pancreatic lipase-related protein 3 1793 228 C20140716_OR021_01 C20140716_OR021_01 TB420221.[MT7]-IMEPHRPNVK[MT7].2b3_1.heavy 754.934 / 518.276 1573.0 22.947524547576904 38 14 10 6 8 0.9562330721595437 66.46075305145594 0.03869819641113281 4 0.9390127838592608 4.97176579305076 1573.0 13.546000000000001 0.0 - - - - - - - 201.88888888888889 3 9 IDO2 indoleamine 2,3-dioxygenase 2 1795 228 C20140716_OR021_01 C20140716_OR021_01 TB420221.[MT7]-IMEPHRPNVK[MT7].2y4_1.heavy 754.934 / 601.379 847.0 22.947524547576904 38 14 10 6 8 0.9562330721595437 66.46075305145594 0.03869819641113281 4 0.9390127838592608 4.97176579305076 847.0 2.377227722772277 1.0 - - - - - - - 0.0 1 0 IDO2 indoleamine 2,3-dioxygenase 2 1797 228 C20140716_OR021_01 C20140716_OR021_01 TB420221.[MT7]-IMEPHRPNVK[MT7].2y8_1.heavy 754.934 / 1120.63 605.0 22.947524547576904 38 14 10 6 8 0.9562330721595437 66.46075305145594 0.03869819641113281 4 0.9390127838592608 4.97176579305076 605.0 3.5666666666666664 0.0 - - - - - - - 0.0 1 0 IDO2 indoleamine 2,3-dioxygenase 2 1799 228 C20140716_OR021_01 C20140716_OR021_01 TB420221.[MT7]-IMEPHRPNVK[MT7].2y7_1.heavy 754.934 / 991.592 3086.0 22.947524547576904 38 14 10 6 8 0.9562330721595437 66.46075305145594 0.03869819641113281 4 0.9390127838592608 4.97176579305076 3086.0 0.0 1.0 - - - - - - - 151.5 6 8 IDO2 indoleamine 2,3-dioxygenase 2 1801 229 C20140716_OR021_01 C20140716_OR021_01 TB420028.[MT7]-AMENLFINR.3b4_1.heavy 417.893 / 590.273 3504.0 38.33940124511719 45 15 10 10 10 1.666944251083276 44.31924071000108 0.0 3 0.9519595056554535 5.6079543984623275 3504.0 34.5420902090209 0.0 - - - - - - - 269.5 7 2 ALOX5 arachidonate 5-lipoxygenase 1803 229 C20140716_OR021_01 C20140716_OR021_01 TB420028.[MT7]-AMENLFINR.3b5_1.heavy 417.893 / 703.357 1348.0 38.33940124511719 45 15 10 10 10 1.666944251083276 44.31924071000108 0.0 3 0.9519595056554535 5.6079543984623275 1348.0 19.96038518518519 0.0 - - - - - - - 135.0 2 1 ALOX5 arachidonate 5-lipoxygenase 1805 229 C20140716_OR021_01 C20140716_OR021_01 TB420028.[MT7]-AMENLFINR.3b3_1.heavy 417.893 / 476.229 3773.0 38.33940124511719 45 15 10 10 10 1.666944251083276 44.31924071000108 0.0 3 0.9519595056554535 5.6079543984623275 3773.0 8.900697329376854 0.0 - - - - - - - 202.5 7 4 ALOX5 arachidonate 5-lipoxygenase 1807 229 C20140716_OR021_01 C20140716_OR021_01 TB420028.[MT7]-AMENLFINR.3y4_1.heavy 417.893 / 549.314 3773.0 38.33940124511719 45 15 10 10 10 1.666944251083276 44.31924071000108 0.0 3 0.9519595056554535 5.6079543984623275 3773.0 40.944037037037035 0.0 - - - - - - - 242.8 7 5 ALOX5 arachidonate 5-lipoxygenase 1809 230 C20140716_OR021_01 C20140716_OR021_01 TB420553.[MT7]-LAHLVLSFLTMGYVWQEGEAQPAEVLPR.4b4_1.heavy 825.441 / 579.373 653.0 54.5890007019043 47 17 10 10 10 2.5442475083428238 32.12812687291476 0.0 3 0.9741757727824047 7.663190750676183 653.0 11.336154949784792 4.0 - - - - - - - 0.0 1 0 IDO2 indoleamine 2,3-dioxygenase 2 1811 230 C20140716_OR021_01 C20140716_OR021_01 TB420553.[MT7]-LAHLVLSFLTMGYVWQEGEAQPAEVLPR.4y11_1.heavy 825.441 / 1166.62 857.0 54.5890007019043 47 17 10 10 10 2.5442475083428238 32.12812687291476 0.0 3 0.9741757727824047 7.663190750676183 857.0 7.373664889872272 0.0 - - - - - - - 0.0 1 0 IDO2 indoleamine 2,3-dioxygenase 2 1813 230 C20140716_OR021_01 C20140716_OR021_01 TB420553.[MT7]-LAHLVLSFLTMGYVWQEGEAQPAEVLPR.4b5_1.heavy 825.441 / 678.442 796.0 54.5890007019043 47 17 10 10 10 2.5442475083428238 32.12812687291476 0.0 3 0.9741757727824047 7.663190750676183 796.0 9.292376853180297 0.0 - - - - - - - 0.0 1 0 IDO2 indoleamine 2,3-dioxygenase 2 1815 230 C20140716_OR021_01 C20140716_OR021_01 TB420553.[MT7]-LAHLVLSFLTMGYVWQEGEAQPAEVLPR.4y7_1.heavy 825.441 / 781.457 1286.0 54.5890007019043 47 17 10 10 10 2.5442475083428238 32.12812687291476 0.0 3 0.9741757727824047 7.663190750676183 1286.0 9.491532380662814 0.0 - - - - - - - 103.11111111111111 2 18 IDO2 indoleamine 2,3-dioxygenase 2 1817 231 C20140716_OR021_01 C20140716_OR021_01 TB442057.[MT7]-SLGYGSR.2y5_1.heavy 442.241 / 539.257 10245.0 20.920475482940674 43 20 10 3 10 21.963499770498572 4.553008447875882 0.06929969787597656 3 0.9983310248733432 30.204873200221932 10245.0 78.9637709182956 0.0 - - - - - - - 189.78571428571428 20 14 KRTAP13-1;KRTAP13-2 keratin associated protein 13-1;keratin associated protein 13-2 1819 231 C20140716_OR021_01 C20140716_OR021_01 TB442057.[MT7]-SLGYGSR.2b4_1.heavy 442.241 / 565.31 2815.0 20.920475482940674 43 20 10 3 10 21.963499770498572 4.553008447875882 0.06929969787597656 3 0.9983310248733432 30.204873200221932 2815.0 14.317530825780857 0.0 - - - - - - - 190.5 5 16 KRTAP13-1;KRTAP13-2 keratin associated protein 13-1;keratin associated protein 13-2 1821 231 C20140716_OR021_01 C20140716_OR021_01 TB442057.[MT7]-SLGYGSR.2y6_1.heavy 442.241 / 652.341 13373.0 20.920475482940674 43 20 10 3 10 21.963499770498572 4.553008447875882 0.06929969787597656 3 0.9983310248733432 30.204873200221932 13373.0 95.21910529535722 0.0 - - - - - - - 198.46153846153845 26 13 KRTAP13-1;KRTAP13-2 keratin associated protein 13-1;keratin associated protein 13-2 1823 231 C20140716_OR021_01 C20140716_OR021_01 TB442057.[MT7]-SLGYGSR.2b5_1.heavy 442.241 / 622.332 3206.0 20.920475482940674 43 20 10 3 10 21.963499770498572 4.553008447875882 0.06929969787597656 3 0.9983310248733432 30.204873200221932 3206.0 18.949201277955268 0.0 - - - - - - - 189.0 6 12 KRTAP13-1;KRTAP13-2 keratin associated protein 13-1;keratin associated protein 13-2 1825 232 C20140716_OR021_01 C20140716_OR021_01 TB420551.[MT7]-TAVPLSLESY[MT7]HISEEYGFLLPDSLK[MT7].4y4_1.heavy 810.941 / 606.358 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDO2 indoleamine 2,3-dioxygenase 2 1827 232 C20140716_OR021_01 C20140716_OR021_01 TB420551.[MT7]-TAVPLSLESY[MT7]HISEEYGFLLPDSLK[MT7].4y5_1.heavy 810.941 / 703.411 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDO2 indoleamine 2,3-dioxygenase 2 1829 232 C20140716_OR021_01 C20140716_OR021_01 TB420551.[MT7]-TAVPLSLESY[MT7]HISEEYGFLLPDSLK[MT7].4b17_2.heavy 810.941 / 1083.05 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDO2 indoleamine 2,3-dioxygenase 2 1831 232 C20140716_OR021_01 C20140716_OR021_01 TB420551.[MT7]-TAVPLSLESY[MT7]HISEEYGFLLPDSLK[MT7].4y6_1.heavy 810.941 / 816.495 N/A N/A - - - - - - - - - 0.0 - - - - - - - IDO2 indoleamine 2,3-dioxygenase 2 1833 233 C20140716_OR021_01 C20140716_OR021_01 TB420022.[MT7]-TGWEGSPLPR.2b4_1.heavy 622.331 / 618.3 8166.0 32.01927661895752 40 16 10 6 8 3.350327884926706 29.847824880037873 0.033100128173828125 4 0.9690135376324472 6.99275815066034 8166.0 18.31440553893789 1.0 - - - - - - - 1229.5 20 10 MRVI1 murine retrovirus integration site 1 homolog 1835 233 C20140716_OR021_01 C20140716_OR021_01 TB420022.[MT7]-TGWEGSPLPR.2y9_1.heavy 622.331 / 998.505 22344.0 32.01927661895752 40 16 10 6 8 3.350327884926706 29.847824880037873 0.033100128173828125 4 0.9690135376324472 6.99275815066034 22344.0 286.9035988857939 0.0 - - - - - - - 224.35714285714286 44 14 MRVI1 murine retrovirus integration site 1 homolog 1837 233 C20140716_OR021_01 C20140716_OR021_01 TB420022.[MT7]-TGWEGSPLPR.2y6_1.heavy 622.331 / 626.362 10678.0 32.01927661895752 40 16 10 6 8 3.350327884926706 29.847824880037873 0.033100128173828125 4 0.9690135376324472 6.99275815066034 10678.0 64.4797682534094 1.0 - - - - - - - 234.69230769230768 21 13 MRVI1 murine retrovirus integration site 1 homolog 1839 233 C20140716_OR021_01 C20140716_OR021_01 TB420022.[MT7]-TGWEGSPLPR.2y7_1.heavy 622.331 / 755.405 6820.0 32.01927661895752 40 16 10 6 8 3.350327884926706 29.847824880037873 0.033100128173828125 4 0.9690135376324472 6.99275815066034 6820.0 83.39777158774373 0.0 - - - - - - - 179.52941176470588 13 17 MRVI1 murine retrovirus integration site 1 homolog 1841 234 C20140716_OR021_01 C20140716_OR021_01 TB420226.[MT7]-SYEC[CAM]TTDC[CAM]PNLQPYFSR.3b3_1.heavy 761.337 / 524.247 5054.0 35.84560012817383 47 17 10 10 10 4.420128031911964 22.62377905753652 0.0 3 0.9787636598444747 8.45378025088213 5054.0 7.497414756486066 0.0 - - - - - - - 175.5 10 6 CRYGB crystallin, gamma B 1843 234 C20140716_OR021_01 C20140716_OR021_01 TB420226.[MT7]-SYEC[CAM]TTDC[CAM]PNLQPYFSR.3b7_1.heavy 761.337 / 1001.4 4317.0 35.84560012817383 47 17 10 10 10 4.420128031911964 22.62377905753652 0.0 3 0.9787636598444747 8.45378025088213 4317.0 5.143607159057099 1.0 - - - - - - - 304.22222222222223 8 9 CRYGB crystallin, gamma B 1845 234 C20140716_OR021_01 C20140716_OR021_01 TB420226.[MT7]-SYEC[CAM]TTDC[CAM]PNLQPYFSR.3y5_1.heavy 761.337 / 669.336 15689.0 35.84560012817383 47 17 10 10 10 4.420128031911964 22.62377905753652 0.0 3 0.9787636598444747 8.45378025088213 15689.0 35.642040143751586 0.0 - - - - - - - 192.83333333333334 31 6 CRYGB crystallin, gamma B 1847 234 C20140716_OR021_01 C20140716_OR021_01 TB420226.[MT7]-SYEC[CAM]TTDC[CAM]PNLQPYFSR.3y9_1.heavy 761.337 / 1121.57 5054.0 35.84560012817383 47 17 10 10 10 4.420128031911964 22.62377905753652 0.0 3 0.9787636598444747 8.45378025088213 5054.0 39.60245149679045 0.0 - - - - - - - 210.66666666666666 10 9 CRYGB crystallin, gamma B 1849 235 C20140716_OR021_01 C20140716_OR021_01 TB420418.[MT7]-IYDITNVLEGIHLIK[MT7].3y3_1.heavy 677.069 / 517.383 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F3 E2F transcription factor 3 1851 235 C20140716_OR021_01 C20140716_OR021_01 TB420418.[MT7]-IYDITNVLEGIHLIK[MT7].3b6_1.heavy 677.069 / 864.458 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F3 E2F transcription factor 3 1853 235 C20140716_OR021_01 C20140716_OR021_01 TB420418.[MT7]-IYDITNVLEGIHLIK[MT7].3b4_1.heavy 677.069 / 649.368 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F3 E2F transcription factor 3 1855 235 C20140716_OR021_01 C20140716_OR021_01 TB420418.[MT7]-IYDITNVLEGIHLIK[MT7].3b3_1.heavy 677.069 / 536.284 N/A N/A - - - - - - - - - 0.0 - - - - - - - E2F3 E2F transcription factor 3 1857 236 C20140716_OR021_01 C20140716_OR021_01 TB420367.[MT7]-ATEVMMQYVENLK[MT7].3b4_1.heavy 615.323 / 545.305 1579.0 41.6890983581543 30 10 4 10 6 0.577609740469661 90.14002622913483 0.0 6 0.8201778419900484 2.865543023028368 1579.0 2.6014099750428246 5.0 - - - - - - - 228.25 3 12 MRVI1 murine retrovirus integration site 1 homolog 1859 236 C20140716_OR021_01 C20140716_OR021_01 TB420367.[MT7]-ATEVMMQYVENLK[MT7].3b5_1.heavy 615.323 / 676.346 2000.0 41.6890983581543 30 10 4 10 6 0.577609740469661 90.14002622913483 0.0 6 0.8201778419900484 2.865543023028368 2000.0 3.881856540084388 2.0 - - - - - - - 289.5 4 16 MRVI1 murine retrovirus integration site 1 homolog 1861 236 C20140716_OR021_01 C20140716_OR021_01 TB420367.[MT7]-ATEVMMQYVENLK[MT7].3y4_1.heavy 615.323 / 647.385 N/A 41.6890983581543 30 10 4 10 6 0.577609740469661 90.14002622913483 0.0 6 0.8201778419900484 2.865543023028368 737.0 0.5727979274611399 19.0 - - - - - - - 192.0 3 17 MRVI1 murine retrovirus integration site 1 homolog 1863 236 C20140716_OR021_01 C20140716_OR021_01 TB420367.[MT7]-ATEVMMQYVENLK[MT7].3b7_1.heavy 615.323 / 935.445 526.0 41.6890983581543 30 10 4 10 6 0.577609740469661 90.14002622913483 0.0 6 0.8201778419900484 2.865543023028368 526.0 0.6658227848101266 10.0 - - - - - - - 153.84615384615384 7 13 MRVI1 murine retrovirus integration site 1 homolog 1865 237 C20140716_OR021_01 C20140716_OR021_01 TB420168.[MT7]-DDGLLVWEAIR.3b4_1.heavy 477.597 / 545.269 2451.0 46.84732532501221 39 13 10 6 10 1.0240923289483277 65.09829707945254 0.032901763916015625 3 0.9042855399937691 3.956827617278518 2451.0 8.859634980988591 0.0 - - - - - - - 214.33333333333334 4 9 ALOX5 arachidonate 5-lipoxygenase 1867 237 C20140716_OR021_01 C20140716_OR021_01 TB420168.[MT7]-DDGLLVWEAIR.3b5_1.heavy 477.597 / 658.353 1226.0 46.84732532501221 39 13 10 6 10 1.0240923289483277 65.09829707945254 0.032901763916015625 3 0.9042855399937691 3.956827617278518 1226.0 13.635227272727272 0.0 - - - - - - - 263.0 2 2 ALOX5 arachidonate 5-lipoxygenase 1869 237 C20140716_OR021_01 C20140716_OR021_01 TB420168.[MT7]-DDGLLVWEAIR.3y4_1.heavy 477.597 / 488.283 3852.0 46.84732532501221 39 13 10 6 10 1.0240923289483277 65.09829707945254 0.032901763916015625 3 0.9042855399937691 3.956827617278518 3852.0 28.267528517110264 0.0 - - - - - - - 175.33333333333334 7 3 ALOX5 arachidonate 5-lipoxygenase 1871 237 C20140716_OR021_01 C20140716_OR021_01 TB420168.[MT7]-DDGLLVWEAIR.3y5_1.heavy 477.597 / 674.362 3765.0 46.84732532501221 39 13 10 6 10 1.0240923289483277 65.09829707945254 0.032901763916015625 3 0.9042855399937691 3.956827617278518 3765.0 26.512471482889737 0.0 - - - - - - - 219.0 7 4 ALOX5 arachidonate 5-lipoxygenase 1873 238 C20140716_OR021_01 C20140716_OR021_01 TB442345.[MT7]-LGHVELADLLLRR.3b5_1.heavy 550.337 / 680.385 725.0 42.108899434407554 28 16 2 6 4 2.47324706328228 33.20160807516254 0.036899566650390625 8 0.9653416057024848 6.609913473969288 725.0 4.181831034932788 2.0 - - - - - - - 0.0 1 0 ASB10 ankyrin repeat and SOCS box-containing 10 1875 238 C20140716_OR021_01 C20140716_OR021_01 TB442345.[MT7]-LGHVELADLLLRR.3b8_1.heavy 550.337 / 979.533 907.0 42.108899434407554 28 16 2 6 4 2.47324706328228 33.20160807516254 0.036899566650390625 8 0.9653416057024848 6.609913473969288 907.0 0.0 0.0 - - - - - - - 0.0 1 0 ASB10 ankyrin repeat and SOCS box-containing 10 1877 238 C20140716_OR021_01 C20140716_OR021_01 TB442345.[MT7]-LGHVELADLLLRR.3y9_2.heavy 550.337 / 549.835 N/A 42.108899434407554 28 16 2 6 4 2.47324706328228 33.20160807516254 0.036899566650390625 8 0.9653416057024848 6.609913473969288 4987.0 1.7498245614035088 2.0 - - - - - - - 1802.0 31 8 ASB10 ankyrin repeat and SOCS box-containing 10 1879 238 C20140716_OR021_01 C20140716_OR021_01 TB442345.[MT7]-LGHVELADLLLRR.3y5_1.heavy 550.337 / 670.472 453.0 42.108899434407554 28 16 2 6 4 2.47324706328228 33.20160807516254 0.036899566650390625 8 0.9653416057024848 6.609913473969288 453.0 4.48021978021978 8.0 - - - - - - - 287.0 4 6 ASB10 ankyrin repeat and SOCS box-containing 10 1881 239 C20140716_OR021_01 C20140716_OR021_01 TB420167.[MT7]-GVDFVLNYSK[MT7].3y3_1.heavy 477.269 / 541.31 7667.0 38.11370086669922 50 20 10 10 10 31.443918933307646 3.180265163897012 0.0 3 0.9996630469608568 67.23036751745995 7667.0 12.92697205899988 1.0 - - - - - - - 269.5 16 4 ALOX5 arachidonate 5-lipoxygenase 1883 239 C20140716_OR021_01 C20140716_OR021_01 TB420167.[MT7]-GVDFVLNYSK[MT7].3b4_1.heavy 477.269 / 563.295 24211.0 38.11370086669922 50 20 10 10 10 31.443918933307646 3.180265163897012 0.0 3 0.9996630469608568 67.23036751745995 24211.0 80.5265801189812 0.0 - - - - - - - 224.33333333333334 48 3 ALOX5 arachidonate 5-lipoxygenase 1885 239 C20140716_OR021_01 C20140716_OR021_01 TB420167.[MT7]-GVDFVLNYSK[MT7].3b5_1.heavy 477.269 / 662.363 11837.0 38.11370086669922 50 20 10 10 10 31.443918933307646 3.180265163897012 0.0 3 0.9996630469608568 67.23036751745995 11837.0 166.5948148148148 0.0 - - - - - - - 179.66666666666666 23 3 ALOX5 arachidonate 5-lipoxygenase 1887 239 C20140716_OR021_01 C20140716_OR021_01 TB420167.[MT7]-GVDFVLNYSK[MT7].3y4_1.heavy 477.269 / 655.353 6456.0 38.11370086669922 50 20 10 10 10 31.443918933307646 3.180265163897012 0.0 3 0.9996630469608568 67.23036751745995 6456.0 71.34311111111111 0.0 - - - - - - - 202.0 12 2 ALOX5 arachidonate 5-lipoxygenase 1889 240 C20140716_OR021_01 C20140716_OR021_01 TB420411.[MT7]-ITGLDPAGPFFHNTPK[MT7].4y4_1.heavy 500.777 / 603.358 2322.0 39.17399883270264 36 18 6 2 10 5.068972310004852 19.727864719762948 0.08739852905273438 3 0.9845126416017992 9.904021876209525 2322.0 2.914644351464435 0.0 - - - - - - - 234.14285714285714 4 7 PNLIPRP3 pancreatic lipase-related protein 3 1891 240 C20140716_OR021_01 C20140716_OR021_01 TB420411.[MT7]-ITGLDPAGPFFHNTPK[MT7].4y5_1.heavy 500.777 / 740.417 1502.0 39.17399883270264 36 18 6 2 10 5.068972310004852 19.727864719762948 0.08739852905273438 3 0.9845126416017992 9.904021876209525 1502.0 3.342664714494875 1.0 - - - - - - - 222.25 18 8 PNLIPRP3 pancreatic lipase-related protein 3 1893 240 C20140716_OR021_01 C20140716_OR021_01 TB420411.[MT7]-ITGLDPAGPFFHNTPK[MT7].4b5_1.heavy 500.777 / 644.374 6009.0 39.17399883270264 36 18 6 2 10 5.068972310004852 19.727864719762948 0.08739852905273438 3 0.9845126416017992 9.904021876209525 6009.0 8.602522179169577 0.0 - - - - - - - 318.6666666666667 12 3 PNLIPRP3 pancreatic lipase-related protein 3 1895 240 C20140716_OR021_01 C20140716_OR021_01 TB420411.[MT7]-ITGLDPAGPFFHNTPK[MT7].4b4_1.heavy 500.777 / 529.347 2458.0 39.17399883270264 36 18 6 2 10 5.068972310004852 19.727864719762948 0.08739852905273438 3 0.9845126416017992 9.904021876209525 2458.0 1.131221781826424 2.0 - - - - - - - 296.1666666666667 4 6 PNLIPRP3 pancreatic lipase-related protein 3 1897 241 C20140716_OR021_01 C20140716_OR021_01 TB420352.[MT7]-SISYYPESASFDLR.3y7_1.heavy 593.629 / 795.399 15178.0 38.86180114746094 45 15 10 10 10 2.4823763173438933 31.86930448415565 0.0 3 0.9580847473523022 6.0068608072782865 15178.0 70.83798474529736 0.0 - - - - - - - 205.0 30 8 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1899 241 C20140716_OR021_01 C20140716_OR021_01 TB420352.[MT7]-SISYYPESASFDLR.3b4_1.heavy 593.629 / 595.321 26801.0 38.86180114746094 45 15 10 10 10 2.4823763173438933 31.86930448415565 0.0 3 0.9580847473523022 6.0068608072782865 26801.0 138.82656327219397 0.0 - - - - - - - 273.25 53 8 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1901 241 C20140716_OR021_01 C20140716_OR021_01 TB420352.[MT7]-SISYYPESASFDLR.3y8_1.heavy 593.629 / 924.442 6974.0 38.86180114746094 45 15 10 10 10 2.4823763173438933 31.86930448415565 0.0 3 0.9580847473523022 6.0068608072782865 6974.0 61.74501287714007 0.0 - - - - - - - 214.85714285714286 13 7 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1903 241 C20140716_OR021_01 C20140716_OR021_01 TB420352.[MT7]-SISYYPESASFDLR.3y9_1.heavy 593.629 / 1021.49 11486.0 38.86180114746094 45 15 10 10 10 2.4823763173438933 31.86930448415565 0.0 3 0.9580847473523022 6.0068608072782865 11486.0 113.3060533140825 0.0 - - - - - - - 307.375 22 8 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1905 242 C20140716_OR021_01 C20140716_OR021_01 TB442162.[MT7]-GVVSIFGVASR.2y8_1.heavy 618.365 / 836.463 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGF4 fibroblast growth factor 4 1907 242 C20140716_OR021_01 C20140716_OR021_01 TB442162.[MT7]-GVVSIFGVASR.2y9_1.heavy 618.365 / 935.531 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGF4 fibroblast growth factor 4 1909 242 C20140716_OR021_01 C20140716_OR021_01 TB442162.[MT7]-GVVSIFGVASR.2y6_1.heavy 618.365 / 636.346 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGF4 fibroblast growth factor 4 1911 242 C20140716_OR021_01 C20140716_OR021_01 TB442162.[MT7]-GVVSIFGVASR.2y10_1.heavy 618.365 / 1034.6 N/A N/A - - - - - - - - - 0.0 - - - - - - - FGF4 fibroblast growth factor 4 1913 243 C20140716_OR021_01 C20140716_OR021_01 TB435993.[MT7]-IVGFRPELGDPVK[MT7].2y4_1.heavy 858.008 / 602.363 134.0 36.0132999420166 30 11 10 5 4 3.8348489181963448 26.0766465989052 0.047397613525390625 8 0.867318858531036 3.3499213306851936 134.0 0.8925748502994011 29.0 - - - - - - - 210.28571428571428 2 7 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1915 243 C20140716_OR021_01 C20140716_OR021_01 TB435993.[MT7]-IVGFRPELGDPVK[MT7].2b4_1.heavy 858.008 / 561.352 534.0 36.0132999420166 30 11 10 5 4 3.8348489181963448 26.0766465989052 0.047397613525390625 8 0.867318858531036 3.3499213306851936 534.0 2.0 13.0 - - - - - - - 0.0 1 0 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1917 243 C20140716_OR021_01 C20140716_OR021_01 TB435993.[MT7]-IVGFRPELGDPVK[MT7].2b7_1.heavy 858.008 / 943.548 935.0 36.0132999420166 30 11 10 5 4 3.8348489181963448 26.0766465989052 0.047397613525390625 8 0.867318858531036 3.3499213306851936 935.0 5.117786535487357 5.0 - - - - - - - 0.0 1 0 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1919 243 C20140716_OR021_01 C20140716_OR021_01 TB435993.[MT7]-IVGFRPELGDPVK[MT7].2b10_1.heavy 858.008 / 1228.68 8549.0 36.0132999420166 30 11 10 5 4 3.8348489181963448 26.0766465989052 0.047397613525390625 8 0.867318858531036 3.3499213306851936 8549.0 33.06849564381422 0.0 - - - - - - - 237.66666666666666 17 9 ATP1B4 ATPase, Na+/K+ transporting, beta 4 polypeptide 1921 244 C20140716_OR021_01 C20140716_OR021_01 TB435796.[MT7]-DPINQR.2y4_1.heavy 443.747 / 530.305 4161.0 18.239299774169922 46 20 10 6 10 25.860677564738754 3.8668747077358416 0.03459930419921875 3 0.9996815730914977 69.15856360984527 4161.0 4.197730138713745 1.0 - - - - - - - 707.7142857142857 8 7 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 1923 244 C20140716_OR021_01 C20140716_OR021_01 TB435796.[MT7]-DPINQR.2b3_1.heavy 443.747 / 470.273 8520.0 18.239299774169922 46 20 10 6 10 25.860677564738754 3.8668747077358416 0.03459930419921875 3 0.9996815730914977 69.15856360984527 8520.0 3.527950310559006 1.0 - - - - - - - 743.0 17 7 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 1925 244 C20140716_OR021_01 C20140716_OR021_01 TB435796.[MT7]-DPINQR.2y5_1.heavy 443.747 / 627.357 129135.0 18.239299774169922 46 20 10 6 10 25.860677564738754 3.8668747077358416 0.03459930419921875 3 0.9996815730914977 69.15856360984527 129135.0 600.1098273457192 0.0 - - - - - - - 283.2142857142857 258 14 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 1927 244 C20140716_OR021_01 C20140716_OR021_01 TB435796.[MT7]-DPINQR.2b4_1.heavy 443.747 / 584.316 4607.0 18.239299774169922 46 20 10 6 10 25.860677564738754 3.8668747077358416 0.03459930419921875 3 0.9996815730914977 69.15856360984527 4607.0 16.741945539098005 0.0 - - - - - - - 297.26666666666665 9 15 SHC2 SHC (Src homology 2 domain containing) transforming protein 2 1929 245 C20140716_OR021_01 C20140716_OR021_01 TB435991.[MT7]-ERLAMC[CAM]TNLPEAR.3b4_1.heavy 568.96 / 614.374 4427.0 29.808700561523438 31 5 10 6 10 0.5355690846677827 86.08308498185991 0.035400390625 3 0.6288954326903952 1.9595807660284734 4427.0 16.66956790123457 1.0 - - - - - - - 246.85714285714286 8 14 DMBX1 diencephalon/mesencephalon homeobox 1 1931 245 C20140716_OR021_01 C20140716_OR021_01 TB435991.[MT7]-ERLAMC[CAM]TNLPEAR.3b5_1.heavy 568.96 / 745.415 2052.0 29.808700561523438 31 5 10 6 10 0.5355690846677827 86.08308498185991 0.035400390625 3 0.6288954326903952 1.9595807660284734 2052.0 20.013333333333335 2.0 - - - - - - - 189.0 4 12 DMBX1 diencephalon/mesencephalon homeobox 1 1933 245 C20140716_OR021_01 C20140716_OR021_01 TB435991.[MT7]-ERLAMC[CAM]TNLPEAR.3b8_1.heavy 568.96 / 1120.54 2592.0 29.808700561523438 31 5 10 6 10 0.5355690846677827 86.08308498185991 0.035400390625 3 0.6288954326903952 1.9595807660284734 2592.0 11.28 0.0 - - - - - - - 283.5 5 8 DMBX1 diencephalon/mesencephalon homeobox 1 1935 245 C20140716_OR021_01 C20140716_OR021_01 TB435991.[MT7]-ERLAMC[CAM]TNLPEAR.3b8_2.heavy 568.96 / 560.772 17493.0 29.808700561523438 31 5 10 6 10 0.5355690846677827 86.08308498185991 0.035400390625 3 0.6288954326903952 1.9595807660284734 17493.0 44.137430555555554 0.0 - - - - - - - 688.5 34 8 DMBX1 diencephalon/mesencephalon homeobox 1 1937 246 C20140716_OR021_01 C20140716_OR021_01 TB435792.[MT7]-GLPGPK[MT7].2y4_1.heavy 428.778 / 542.342 35849.0 21.404800415039062 47 17 10 10 10 7.535997730783266 13.269643061530797 0.0 2 0.9733006269547131 7.53599827861202 35849.0 112.03275504791907 0.0 - - - - - - - 248.85714285714286 71 14 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1939 246 C20140716_OR021_01 C20140716_OR021_01 TB435792.[MT7]-GLPGPK[MT7].2y3_1.heavy 428.778 / 445.289 25183.0 21.404800415039062 47 17 10 10 10 7.535997730783266 13.269643061530797 0.0 2 0.9733006269547131 7.53599827861202 25183.0 79.89691227269641 0.0 - - - - - - - 255.66666666666666 50 12 COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) 1941 247 C20140716_OR021_01 C20140716_OR021_01 TB420219.[MT7]-LGAEMVINTSGK[MT7].3b6_1.heavy 503.285 / 745.404 10838.0 33.960899353027344 43 18 10 5 10 6.249625582760049 16.00095856555883 0.04579925537109375 3 0.9843241519307935 9.844142268822182 10838.0 50.132994652406424 0.0 - - - - - - - 270.9 21 10 PNLIPRP3 pancreatic lipase-related protein 3 1943 247 C20140716_OR021_01 C20140716_OR021_01 TB420219.[MT7]-LGAEMVINTSGK[MT7].3b4_1.heavy 503.285 / 515.295 25132.0 33.960899353027344 43 18 10 5 10 6.249625582760049 16.00095856555883 0.04579925537109375 3 0.9843241519307935 9.844142268822182 25132.0 76.87363328536964 0.0 - - - - - - - 654.0 50 7 PNLIPRP3 pancreatic lipase-related protein 3 1945 247 C20140716_OR021_01 C20140716_OR021_01 TB420219.[MT7]-LGAEMVINTSGK[MT7].3b5_1.heavy 503.285 / 646.335 22329.0 33.960899353027344 43 18 10 5 10 6.249625582760049 16.00095856555883 0.04579925537109375 3 0.9843241519307935 9.844142268822182 22329.0 65.30106902811167 0.0 - - - - - - - 221.625 44 8 PNLIPRP3 pancreatic lipase-related protein 3 1947 247 C20140716_OR021_01 C20140716_OR021_01 TB420219.[MT7]-LGAEMVINTSGK[MT7].3y5_1.heavy 503.285 / 650.359 10184.0 33.960899353027344 43 18 10 5 10 6.249625582760049 16.00095856555883 0.04579925537109375 3 0.9843241519307935 9.844142268822182 10184.0 59.96617723453018 0.0 - - - - - - - 280.22222222222223 20 9 PNLIPRP3 pancreatic lipase-related protein 3 1949 248 C20140716_OR021_01 C20140716_OR021_01 TB420150.[MT7]-YPGMFIALSK[MT7].2y4_1.heavy 707.904 / 562.368 15372.0 43.322200775146484 44 14 10 10 10 2.885154660132275 34.660186984712745 0.0 3 0.9481232173119356 5.394860924734179 15372.0 140.68980788675427 0.0 - - - - - - - 242.11111111111111 30 9 FGF4 fibroblast growth factor 4 1951 248 C20140716_OR021_01 C20140716_OR021_01 TB420150.[MT7]-YPGMFIALSK[MT7].2y5_1.heavy 707.904 / 675.452 5392.0 43.322200775146484 44 14 10 10 10 2.885154660132275 34.660186984712745 0.0 3 0.9481232173119356 5.394860924734179 5392.0 4.314301343696862 2.0 - - - - - - - 662.8888888888889 14 9 FGF4 fibroblast growth factor 4 1953 248 C20140716_OR021_01 C20140716_OR021_01 TB420150.[MT7]-YPGMFIALSK[MT7].2y9_1.heavy 707.904 / 1107.64 45544.0 43.322200775146484 44 14 10 10 10 2.885154660132275 34.660186984712745 0.0 3 0.9481232173119356 5.394860924734179 45544.0 253.14973545242205 0.0 - - - - - - - 252.0 91 5 FGF4 fibroblast growth factor 4 1955 248 C20140716_OR021_01 C20140716_OR021_01 TB420150.[MT7]-YPGMFIALSK[MT7].2y6_1.heavy 707.904 / 822.521 5048.0 43.322200775146484 44 14 10 10 10 2.885154660132275 34.660186984712745 0.0 3 0.9481232173119356 5.394860924734179 5048.0 18.14736434108527 0.0 - - - - - - - 183.7 10 10 FGF4 fibroblast growth factor 4 1957 249 C20140716_OR021_01 C20140716_OR021_01 TB420152.[MT7]-K[MT7]FEYSPSK[MT7].2y4_1.heavy 709.406 / 562.332 N/A N/A - - - - - - - - - 0.0 - - - - - - - PNLIPRP3 pancreatic lipase-related protein 3 1959 249 C20140716_OR021_01 C20140716_OR021_01 TB420152.[MT7]-K[MT7]FEYSPSK[MT7].2b3_1.heavy 709.406 / 693.417 N/A N/A - - - - - - - - - 0.0 - - - - - - - PNLIPRP3 pancreatic lipase-related protein 3 1961 249 C20140716_OR021_01 C20140716_OR021_01 TB420152.[MT7]-K[MT7]FEYSPSK[MT7].2y5_1.heavy 709.406 / 725.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - PNLIPRP3 pancreatic lipase-related protein 3 1963 249 C20140716_OR021_01 C20140716_OR021_01 TB420152.[MT7]-K[MT7]FEYSPSK[MT7].2b5_1.heavy 709.406 / 943.513 N/A N/A - - - - - - - - - 0.0 - - - - - - - PNLIPRP3 pancreatic lipase-related protein 3 1965 250 C20140716_OR021_01 C20140716_OR021_01 TB420358.[MT7]-EVENVFVQLSLAFR.3y7_1.heavy 599.001 / 834.483 688.0 54.636199951171875 34 12 4 10 8 0.939529352715041 62.45174088066848 0.0 4 0.8973641770508735 3.8187957501439413 688.0 22.15862935465448 1.0 - - - - - - - 34.0 5 1 MRVI1 murine retrovirus integration site 1 homolog 1967 250 C20140716_OR021_01 C20140716_OR021_01 TB420358.[MT7]-EVENVFVQLSLAFR.3b4_1.heavy 599.001 / 616.306 963.0 54.636199951171875 34 12 4 10 8 0.939529352715041 62.45174088066848 0.0 4 0.8973641770508735 3.8187957501439413 963.0 -7.479611650485437 0.0 - - - - - - - 0.0 1 0 MRVI1 murine retrovirus integration site 1 homolog 1969 250 C20140716_OR021_01 C20140716_OR021_01 TB420358.[MT7]-EVENVFVQLSLAFR.3b5_1.heavy 599.001 / 715.374 894.0 54.636199951171875 34 12 4 10 8 0.939529352715041 62.45174088066848 0.0 4 0.8973641770508735 3.8187957501439413 894.0 17.14160405234276 1.0 - - - - - - - 80.33333333333333 2 3 MRVI1 murine retrovirus integration site 1 homolog 1971 250 C20140716_OR021_01 C20140716_OR021_01 TB420358.[MT7]-EVENVFVQLSLAFR.3y5_1.heavy 599.001 / 593.341 1445.0 54.636199951171875 34 12 4 10 8 0.939529352715041 62.45174088066848 0.0 4 0.8973641770508735 3.8187957501439413 1445.0 22.472501685203905 0.0 - - - - - - - 84.0 2 9 MRVI1 murine retrovirus integration site 1 homolog 1973 251 C20140716_OR021_01 C20140716_OR021_01 TB420425.[MT7]-WMEWNPGFPLSIDAK[MT7].3y7_1.heavy 693.692 / 887.532 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 1975 251 C20140716_OR021_01 C20140716_OR021_01 TB420425.[MT7]-WMEWNPGFPLSIDAK[MT7].3b5_1.heavy 693.692 / 891.394 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 1977 251 C20140716_OR021_01 C20140716_OR021_01 TB420425.[MT7]-WMEWNPGFPLSIDAK[MT7].3b3_1.heavy 693.692 / 591.272 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 1979 251 C20140716_OR021_01 C20140716_OR021_01 TB420425.[MT7]-WMEWNPGFPLSIDAK[MT7].3y5_1.heavy 693.692 / 677.395 N/A N/A - - - - - - - - - 0.0 - - - - - - - ALOX5 arachidonate 5-lipoxygenase 1981 252 C20140716_OR021_01 C20140716_OR021_01 TB442334.[MT7]-ANATGGGGHVQMVQR.3y6_1.heavy 542.947 / 760.413 21035.0 19.83970069885254 47 17 10 10 10 3.8360189876246733 26.06869265314082 0.0 3 0.9756869725292567 7.898761177360293 21035.0 76.20398204429901 0.0 - - - - - - - 155.6 42 15 ALOX5 arachidonate 5-lipoxygenase 1983 252 C20140716_OR021_01 C20140716_OR021_01 TB442334.[MT7]-ANATGGGGHVQMVQR.3y4_1.heavy 542.947 / 533.286 16852.0 19.83970069885254 47 17 10 10 10 3.8360189876246733 26.06869265314082 0.0 3 0.9756869725292567 7.898761177360293 16852.0 35.72529986052999 0.0 - - - - - - - 776.75 33 8 ALOX5 arachidonate 5-lipoxygenase 1985 252 C20140716_OR021_01 C20140716_OR021_01 TB442334.[MT7]-ANATGGGGHVQMVQR.3b8_1.heavy 542.947 / 730.36 22887.0 19.83970069885254 47 17 10 10 10 3.8360189876246733 26.06869265314082 0.0 3 0.9756869725292567 7.898761177360293 22887.0 167.91164897968724 0.0 - - - - - - - 166.64285714285714 45 14 ALOX5 arachidonate 5-lipoxygenase 1987 252 C20140716_OR021_01 C20140716_OR021_01 TB442334.[MT7]-ANATGGGGHVQMVQR.3y5_1.heavy 542.947 / 661.345 37468.0 19.83970069885254 47 17 10 10 10 3.8360189876246733 26.06869265314082 0.0 3 0.9756869725292567 7.898761177360293 37468.0 263.2790126082758 0.0 - - - - - - - 194.3 74 20 ALOX5 arachidonate 5-lipoxygenase