Sequence Modifications Mass Mass Fractional Part Protein Groups Proteins Gene Names Protein Names Unique (Groups) Unique (Proteins) Acetyl (Protein N-term) Oxidation (M) Missed cleavages Identification type 1 Identification type 2 Identification type 3 Identification type 4 Experiment 1 Experiment 2 Experiment 3 Experiment 4 Retention time Calibrated retention time Charges PEP MS/MS scan number Raw file Score Delta score Intensity Intensity 1 Intensity 2 Intensity 3 Intensity 4 Reverse Potential contaminant id Protein group IDs Peptide ID Evidence IDs MS/MS IDs Best MS/MS Oxidation (M) site IDs MS/MS Count AAAAAAAAAPAAAATAPTTAATTAATAAQ Unmodified 2367.203 0.2030165 304 P37108;H0YLW0 SRP14 Signal recognition particle 14 kDa protein yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 55.292 55.362 3 0.0065512 10957 YJC_A_20141124_01 37.436 20.822 1557400 997690 559700 0 0 0 304 0 0;1 0 0 1 AAAAAAALQAK Unmodified 955.54508 0.5450795 181 P36578;H3BM89;H3BU31 RPL4 60S ribosomal protein L4 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 37.273 37.343 2 3.7279E-11 6802 YJC_B_20141124_01 94.309 52.88 363730 211350 152390 0 0 1 181 1 2;3 1;2 2 2 AAALEFLNR Unmodified 1003.5451 0.5450795 165 P31948;G3XAD8;F5GXD8;F5H783 STIP1 Stress-induced-phosphoprotein 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 62.885 62.885 2 0.0097202 13592 YJC_A_20141124_01 66.962 47.858 986760 986760 0 0 0 2 165 2 4 3 3 1 AAEEAFVNDIDESSPGTEWER Unmodified 2351.019 0.018963706 254 P09496-5;P09496-2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 68.395 68.395 2 0.009147 16966 YJC_A_20141124_01 43.956 37.729 835530 835530 0 0 0 3 254 3 5 4 4 1 AAFDDAIAELDTLSEESYK Unmodified 2086.9583 0.95826093 334 P62258;K7EM20;P62258-2 YWHAE 14-3-3 protein epsilon yes no 0 0 0 By MS/MS By matching By matching By matching 2 2 1 86.339 86.365 2;3 0.010813 31469 YJC_A_20141124_01 50.884 39.813 3860100 2780700 703650 375720 0 4 334 4 6;7;8;9;10 5;6 6 2 AAGAGKVTK Unmodified 801.47085 0.47085192 348 P68104;Q5VTE0 EEF1A1;EEF1A1P5 Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3 yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 1 16.856 16.835 2 2.6848E-07 3521 YJC_B_20141124_01 97.565 23.949 627270 46883 532430 0 47961 5 348 5 11;12;13 7 7 1 AAGVEAAAEVAATEIK Acetyl (Protein N-term) 1541.7937 0.7937022 211 P52272;P52272-2;M0R0N3;M0R019;M0R2T0;M0R0Y6;M0QYQ7 HNRNPM Heterogeneous nuclear ribonucleoprotein M yes no 1 0 0 By MS/MS By MS/MS By matching By matching 1 1 83.11 83.13 2 1.0248E-16 29021 YJC_A_20141124_01 93.738 62.848 2634500 1849400 785090 0 0 6 211 6 14;15 8;9 8 2 AAGVNVEPFWPGLFAK Unmodified 1701.8879 0.88787736 237 P05386 RPLP1 60S acidic ribosomal protein P1 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 84.085 84.106 2 0.00038945 29749 YJC_A_20141124_01 78.69 61.804 2406000 1826600 579430 0 0 7 237 7 16;17 10;11 10 2 AALQELLSK Unmodified 971.56515 0.56514624 343 P62851 RPS25 40S ribosomal protein S25 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 61.945 61.992 2 0.0019224 13217 YJC_A_20141124_01 72.321 46.747 3083900 1365100 745980 192960 779870 8 343 8 18;19;20;21 12 12 1 AAPRPSPAISVSVSAPAFYAPQKK Acetyl (Protein N-term) 2481.338 0.33799384 167 Q15942;H0Y2Y8;C9IZ41 ZYX Zyxin yes no 1 0 2 By MS/MS By matching By matching By matching 1 63.988 63.988 3 4.4084E-05 14112 YJC_A_20141124_01 63.522 48.946 2113500 2113500 0 0 0 9 167 9 22 13 13 1 AAQALALLR Acetyl (Protein N-term) 967.58147 0.581465 136 Q16401;F2Z3J2;Q16401-2 PSMD5 26S proteasome non-ATPase regulatory subunit 5 yes no 1 0 0 By MS/MS By matching By matching By matching 1 82.229 82.229 2 0.0085743 28443 YJC_A_20141124_01 56.916 17.294 0 0 0 0 0 10 136 10 23 14 14 1 AASAAAASAAAASAASGSPGPGEGSAGGEK Acetyl (Protein N-term) 2428.1102 0.11023833 371 Q13263;Q13263-2 TRIM28 Transcription intermediary factor 1-beta yes no 1 0 0 By MS/MS By MS/MS By matching By matching 1 1 59.312 59.333 3 5.7272E-07 12377 YJC_B_20141124_01 44.648 34.02 1410200 1104900 305320 0 0 11 371 11 24;25 15;16 16 2 AASAAAASAAAASAASGSPGPGEGSAGGEKR Acetyl (Protein N-term) 2584.2113 0.21134936 371 Q13263;Q13263-2 TRIM28 Transcription intermediary factor 1-beta yes no 1 0 1 By matching By MS/MS By matching By matching 1 1 56.754 56.824 3 2.365E-38 11733 YJC_B_20141124_01 88.244 78.867 2316000 1951600 364310 0 0 12 371 12 26;27 17;18 17 2 AAVEEGIVLGGGCALLR Unmodified 1683.8978 0.89779012 260 P10809 HSPD1 60 kDa heat shock protein, mitochondrial yes yes 0 0 0 By MS/MS By matching By matching By matching 2 2 1 70.482 70.488 2;3 0.0042785 18428 YJC_A_20141124_01 69.331 53.944 7857100 6186400 1204100 466610 0 13 260 13 28;29;30;31;32 19;20 19 2 AAVENLPTFLVELSR Unmodified 1657.9039 0.90392136 376 Q14974;J3QR48 KPNB1 Importin subunit beta-1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 87.682 87.653 2 0.0021123 32590 YJC_A_20141124_01 64.476 51.684 1093900 853010 240840 0 0 14 376 14 33;34 21 21 1 AAVESLGFILFR Unmodified 1321.7394 0.73942221 412 Q99460;Q99460-2;H7C378 PSMD1 26S proteasome non-ATPase regulatory subunit 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 85.59 85.59 2 0.0086761 30831 YJC_A_20141124_01 55.04 25.036 487300 487300 0 0 0 15 412 15 35 22 22 1 AAVLQQVLER Acetyl (Protein N-term) 1167.6612 0.66117189 263 P12270 TPR Nucleoprotein TPR yes yes 1 0 0 By MS/MS By matching By matching By matching 1 87.7 87.7 2 0.011043 32715 YJC_A_20141124_01 56.404 32.173 509730 509730 0 0 0 16 263 16 36 23 23 1 AAVPSGASTGIYEALELR Unmodified 1803.9367 0.93667805 242 P06733;K7EM90;P13929;P09104;E5RI09;E5RG95;K7EPM1;K7EKN2;E5RGZ4;P13929-3;B7Z2X9;P13929-2;F5H1C3;F5H0C8 ENO1;ENO3;ENO2 Alpha-enolase;Enolase;Beta-enolase;Gamma-enolase yes no 0 0 0 By matching By MS/MS By matching By MS/MS 1 2 1 1 73.06 73.106 2;3 0.013407 19302 YJC_B_20141124_01 51.971 35.449 16201000 10123000 4102300 673960 1302000 17 242 17 37;38;39;40;41 24;25;26 24 3 AAVQAAEVK Acetyl (Protein N-term) 927.50255 0.50254598 184 Q15046;H3BRC9 KARS Lysine--tRNA ligase yes no 1 0 0 By MS/MS By MS/MS By matching By matching 1 1 45.304 45.325 2 0.017199 8007 YJC_A_20141124_01 57.149 18.873 684450 387420 297030 0 0 18 184 18 42;43 27;28;29 27 3 ACGLVASNLNLKPGECLR Acetyl (Protein N-term) 2013.0136 0.013564934 253 P09382;F8WEI7 LGALS1 Galectin-1 yes no 1 0 1 By MS/MS By matching By matching By matching 2 2 1 68.341 68.347 2;3 0.0015378 16913 YJC_A_20141124_01 60.631 47.356 8830000 7049000 1389100 391830 0 19 253 19 44;45;46;47;48 30;31 31 2 ACLIFFDEIDAIGGAR Unmodified 1766.8662 0.86615564 303 P35998;B7Z5E2 PSMC2 26S protease regulatory subunit 7 yes no 0 0 0 By MS/MS By matching By matching By matching 1 86.8 86.8 2 0.020537 31922 YJC_A_20141124_01 49.595 32.848 615970 615970 0 0 0 20 303 20 49 32 32 1 ACPLDQAIGLLVAIFHK Acetyl (Protein N-term) 1907.0339 0.033889671 241 P06703;R4GN98 S100A6 Protein S100-A6;Protein S100 yes no 1 0 0 By matching By MS/MS By MS/MS By matching 1 1 1 94.728 94.691 2 6.7609E-167 32600 YJC_C_20141124_01 137.73 106.41 25393000 14878000 6272900 4242200 0 21 241 21 50;51;52 33;34 34 2 ADGSTITR Unmodified 819.40865 0.4086456 82 CON__Q1RMN8 yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 26.345 26.419 2 0.0077833 3465 YJC_D_20141124_01 81.95 27.174 1003300 0 0 235700 767600 + 22 82 22 53;54 35 35 1 ADINTKWAATR Unmodified 1245.6466 0.64658446 105 P50914;E7EPB3 RPL14 60S ribosomal protein L14 yes no 0 0 1 By MS/MS By matching By matching By matching 1 45.436 45.436 3 0.027421 8095 YJC_A_20141124_01 60.641 39.246 310140 310140 0 0 0 23 105 23 55 36 36 1 ADLINNLGTIAK Unmodified 1241.698 0.69795133 250;247;387 P08238;Q14568;Q58FF8;P07900;P07900-2 HSP90AB1;HSP90AA2;HSP90AB2P;HSP90AA1 Heat shock protein HSP 90-beta;Putative heat shock protein HSP 90-alpha A2;Putative heat shock protein HSP 90-beta 2;Heat shock protein HSP 90-alpha no no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 63.925 63.921 2 2.77E-31 13938 YJC_B_20141124_01 110.15 65.536 11796000 8858200 2345000 593200 0 24 250;387;247 24 56;57;58 37;38 38 2 ADQLTEEQIAEFK Acetyl (Protein N-term) 1562.7464 0.74641766 174 P62158;H0Y7A7;F8WBR5;M0QZ52;G3V479 CALM1;CALM2;CALM3 Calmodulin yes no 1 0 0 By MS/MS By matching By matching By matching 1 1 69.968 69.988 2 0.0012021 18057 YJC_A_20141124_01 74.966 50.113 2870200 2331300 538900 0 0 25 174 25 59;60 39 39 1 AEAESLYQSK Unmodified 1124.535 0.53496832 73 CON__P04264;P04264 KRT1 Keratin, type II cytoskeletal 1 yes no 0 0 0 By matching By matching By MS/MS By matching 1 1 1 1 40.163 40.261 2 1.5804E-10 5566 YJC_C_20141124_01 96.604 62.714 888950 166970 380800 176520 164660 + 26 73 26 61;62;63;64 40 40 1 AEEGIAAGGVMDVNTALQEVLK Acetyl (Protein N-term) 2256.1308 0.13076276 283 P25398 RPS12 40S ribosomal protein S12 yes yes 1 0 0 By MS/MS By matching By matching By matching 2 1 1 94.398 94.371 2;3 3.7688E-113 38100 YJC_A_20141124_01 124.31 106.63 4419900 3461700 606260 351950 0 27 283 27 65;66;67;68 41;42 42 2 AEEQPQVELFVK Acetyl (Protein N-term) 1457.7402 0.74021007 217 O00299 CLIC1 Chloride intracellular channel protein 1 yes yes 1 0 0 By MS/MS By matching By matching By matching 1 1 70.915 70.936 2 0.0072329 18784 YJC_A_20141124_01 49.243 34.812 1160700 806580 354170 0 0 28 217 28 69;70 43 43 1 AEESFLVQNK Unmodified 1163.5823 0.58225287 396 Q6ZP70 yes yes 0 0 0 By matching By matching By MS/MS By matching 1 1 60.707 60.702 2 0.019462 10083 YJC_C_20141124_01 48.091 9.3407 4117600 0 74509 4043100 0 29 396 29 71;72 44 44 1 AEFEVHEVYAVDVLVSSGEGK Unmodified 2263.1008 0.10084284 429 Q9UQ80;F8VR77 PA2G4 Proliferation-associated protein 2G4 yes no 0 0 0 By matching By matching By MS/MS By matching 1 74.529 74.477 3 0.010295 18515 YJC_C_20141124_01 55.453 32.426 0 0 0 0 0 30 429 30 73 45 45 1 AEFVEVTKLVTDLTK Unmodified 1691.9346 0.93455278 72 CON__P02769 yes yes 0 0 1 By MS/MS By matching By matching By MS/MS 1 1 1 85.041 85.154 3 2.8209E-15 30538 YJC_A_20141124_01 91.845 65.862 5162300 4261500 317400 0 583370 + 31 72 31 74;75;76 46;47 46 2 AEGSDVANAVLDGADCIMLSGETAK Unmodified 2493.1363 0.13631842 268 P14618;P14618-3;P14618-2;H3BTN5;Q504U3 PKM;PKM2 Pyruvate kinase PKM;Pyruvate kinase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 83.397 83.426 3 0.0040637 29111 YJC_A_20141124_01 42.663 29.055 1954900 1378900 386100 189880 0 32 268 32 77;78;79 48 48 1 AELGAGAPPAVVAR Unmodified 1277.7092 0.70918471 385 Q3KQU3;Q3KQU3-2;Q3KQU3-4 MAP7D1 MAP7 domain-containing protein 1 yes no 0 0 0 By matching By matching By matching By MS/MS 1 49.214 49.414 2 0.0047296 9295 YJC_D_20141124_01 69.229 36.899 1651700 0 0 0 1651700 33 385 33 80 49 49 1 AELLDNEKPAAVVAPITTGYTVK Unmodified 2399.2948 0.29479162 419 Q9HB71;Q9HB71-3 CACYBP Calcyclin-binding protein yes no 0 0 1 By MS/MS By matching By matching By matching 1 63.887 63.887 3 0.0083423 14156 YJC_A_20141124_01 43.476 28.743 769950 769950 0 0 0 34 419 34 81 50 50 1 AELNEFLTR Unmodified 1091.5611 0.56112349 279 P23396;P23396-2;F2Z2S8;H0YF32;H0YCJ7;E9PPU1;H0YEU2;E9PL09;E9PQ96;E9PJH4;E9PK82;H0YES8;E9PQX2 RPS3 40S ribosomal protein S3 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 61.703 61.724 2 0.0012432 13038 YJC_A_20141124_01 75.509 47.737 1281400 1009800 271630 0 0 35 279 35 82;83 51 51 1 AESEQEAYLR Unmodified 1194.5517 0.55168102 421 Q9NR28;Q9NR28-2;Q9NR28-3 DIABLO Diablo homolog, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 43.353 43.353 2 0.016699 7394 YJC_A_20141124_01 53.034 9.0762 5632100 5632100 0 0 0 36 421 36 84 52 52 1 AESEQEAYLRED Unmodified 1438.6212 0.62121715 421 Q9NR28;Q9NR28-2;Q9NR28-3 DIABLO Diablo homolog, mitochondrial yes no 0 0 1 By matching By MS/MS By matching By matching 1 45.88 45.921 2 5.9596E-54 9054 YJC_B_20141124_01 121.21 95.734 363160 0 363160 0 0 37 421 37 85 53 53 1 AEVEETLKR Acetyl (Protein N-term) 1115.5823 0.58225287 17 Q9NP97;Q8TF09;B4DFR2;H3BNG9;H3BPA0;Q7Z4M1;Q9NP97-2 DYNLRB1;DYNLRB2 Dynein light chain roadblock-type 1;Dynein light chain roadblock-type 2 yes no 1 0 1 By MS/MS By matching By matching By matching 1 1 52.357 52.377 2 0.015778 10021 YJC_A_20141124_01 43.308 15.826 749960 474670 275290 0 0 38 17 38 86;87 54 54 1 AFEDEKK Unmodified 865.41815 0.41814765 429 Q9UQ80 PA2G4 Proliferation-associated protein 2G4 yes yes 0 0 1 By MS/MS By matching By matching By matching 1 1 23.548 23.568 2 0.0049893 2901 YJC_A_20141124_01 94.006 9.0909 791340 402990 388360 0 0 39 429 39 88;89 55 55 1 AFITNIPFDVK Unmodified 1263.6863 0.68632401 211 P52272;P52272-2;M0R0N3;M0R019;M0R2T0;M0R0Y6;M0QYQ7 HNRNPM Heterogeneous nuclear ribonucleoprotein M yes no 0 0 0 By MS/MS By matching By matching By matching 1 73.291 73.291 2 1.0967E-10 20699 YJC_A_20141124_01 92.247 68.157 706210 706210 0 0 0 40 211 40 90 56 56 1 AFKDTGKTPVEPEVAIHR Acetyl (Protein N-term) 2036.0691 0.069089203 329 P60866;P60866-2;E5RIP1;E5RJX2 RPS20 40S ribosomal protein S20 yes no 1 0 2 By MS/MS By MS/MS By matching By MS/MS 1 1 1 1 52.308 52.33 4 0.00022219 10053 YJC_A_20141124_01 65.652 54.009 6370000 2674900 1964000 97707 1633400 41 329 41 91;92;93;94 57;58;59 57 3 AFLTLAEDILR Unmodified 1260.7078 0.70778773 330 P61026 RAB10 Ras-related protein Rab-10 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 86.716 86.686 2 4.7141E-198 31854 YJC_A_20141124_01 156.58 102.52 1201100 1042300 158750 0 0 42 330 42 95;96 60 60 1 AFMEALQAGADISMIGQFGVGFYSAYLVAEK 2 Oxidation (M) 3315.5832 0.58318743 250;247 P08238;P07900;P07900-2 HSP90AB1;HSP90AA1 Heat shock protein HSP 90-beta;Heat shock protein HSP 90-alpha no no 0 2 0 By matching By MS/MS By MS/MS By matching 1 2 2 1 94.353 94.315 3;4 7.1083E-25 32237 YJC_C_20141124_01 74.973 63.327 19858000 688790 8779300 8536800 1853200 43 250;247 43 97;98;99;100;101;102 61;62;63;64 63 23;24 4 AFMEALQAGADISMIGQFGVGFYSAYLVAEK Oxidation (M) 3299.5883 0.58827281 250;247 P08238;P07900;P07900-2 HSP90AB1;HSP90AA1 Heat shock protein HSP 90-beta;Heat shock protein HSP 90-alpha no no 0 1 0 By matching By MS/MS By MS/MS By MS/MS 2 2 2 1 94.475 94.443 3;4 6.712E-150 33710 YJC_B_20141124_01 124.13 111.11 100700000 49161000 18247000 17042000 16248000 44 250;247 43 103;104;105;106;107;108;109 65;66;67;68 65 23;24 4 AFMEALQAGADISMIGQFGVGFYSAYLVAEK Unmodified 3283.5934 0.59335818 250;247 P08238;P07900;P07900-2 HSP90AB1;HSP90AA1 Heat shock protein HSP 90-beta;Heat shock protein HSP 90-alpha no no 0 0 0 By matching By matching By MS/MS By matching 1 1 1 94.704 94.666 3 6.8997E-127 32403 YJC_C_20141124_01 117.21 96.903 26663000 1086800 5623600 19953000 0 45 250;247 43 110;111;112 69 69 1 AFVDFLSDEIK Unmodified 1282.6445 0.64451877 365 Q07021 C1QBP Complement component 1 Q subcomponent-binding protein, mitochondrial yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 77.181 77.202 2 0.0030785 24070 YJC_A_20141124_01 65.179 48.981 870950 612990 257960 0 0 46 365 44 113;114 70 70 1 AFVDFLSDEIKEER Unmodified 1696.8308 0.83081599 365 Q07021 C1QBP Complement component 1 Q subcomponent-binding protein, mitochondrial yes yes 0 0 1 By MS/MS By matching By matching By matching 1 1 74.403 74.424 3 0.025862 21676 YJC_A_20141124_01 55.261 35.154 2160000 1730700 429260 0 0 47 365 45 115;116 71 71 1 AFVHWYVGEGMEEGEFSEAR Unmodified 2329.011 0.010981977 349;150 Q9BQE3;F5H5D3;P68363;P68366;A8MUB1 TUBA1C;TUBA1B;TUBA4A Tubulin alpha-1C chain;Tubulin alpha-1B chain;Tubulin alpha-4A chain no no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 70.472 70.519 3 0.02696 18536 YJC_A_20141124_01 43.946 34.46 4182800 2401500 876010 616950 288370 48 150;349 46 117;118;119;120 72 72 1 AGAIAPCEVTVPAQNTGLGPEK Unmodified 2179.0943 0.094317676 158 P05388;F8VW21;Q8NHW5;F8VPE8;F8VU65;F8VWS0;Q3B7A4;G3V210;F8VQY6;F8VRK7 RPLP0;RPLP0P6 60S acidic ribosomal protein P0;60S acidic ribosomal protein P0-like yes no 0 0 0 By MS/MS By matching By matching By matching 1 57.401 57.401 2 0.0027117 11563 YJC_A_20141124_01 49.125 35.423 592550 592550 0 0 0 49 158 47 121 73;74 74 2 AGEARPGPTAESASGPSEDPSVNFLK Unmodified 2570.2249 0.22487416 101 Q13501;E7EMC7;E9PFW8;Q13501-2 SQSTM1 Sequestosome-1 yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 57.103 57.174 3 1.8599E-12 11489 YJC_A_20141124_01 79.589 69.252 3187900 2022200 1165700 0 0 50 101 48 122;123 75;76 75 2 AGELTPEEEAQYKK Acetyl (Protein N-term) 1633.7835 0.78353145 423 Q9NZT1 CALML5 Calmodulin-like protein 5 yes yes 1 0 1 By matching By MS/MS By matching By matching 1 49.268 49.309 2 0.0052243 9834 YJC_B_20141124_01 43.761 34.225 728660 0 728660 0 0 51 423 49 124 77 77 1 AGFAGDDAPR Unmodified 975.44101 0.44100836 327 P60709;P63261;I3L3I0;I3L1U9;I3L4N8;P63267;P68133;P62736;P68032;E7EVS6;I3L3R2;Q5T8M8;A6NL76;Q5T8M7;Q6S8J3;G5E9R0;K7EM38;J3KT65;A5A3E0;C9JTX5;C9JUM1;C9JZR7;F8WB63;B8ZZJ2;C9JFL5;F6UVQ4;F6QUT6;P63267-2;P0CG38;P0CG39;F8WCH0 ACTB;ACTG1;ACTG2;ACTA1;ACTA2;ACTC1;POTEE;POTEF;POTEI;POTEJ Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed;Actin, gamma-enteric smooth muscle;Actin, alpha skeletal muscle;Actin, aortic smooth muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member E;POTE ankyrin domain family member F;POTE ankyrin domain family member I;POTE ankyrin domain family member J yes no 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 1 1 1 1 38.671 38.743 2 0.00061799 7092 YJC_B_20141124_01 75.652 46.482 17141000 9355300 5515100 325810 1945000 52 327 50 125;126;127;128 78;79;80;81 79 4 AGFYYTGVNDK Unmodified 1233.5666 0.5666028 126 Q13490;E9PMH5;Q13490-2;H0YDY3;E9PNM6 BIRC2 Baculoviral IAP repeat-containing protein 2 no no 0 0 0 By matching By MS/MS By matching By matching 1 53.126 53.266 2 0.00029667 10814 YJC_B_20141124_01 75.788 53.227 343380 0 343380 0 0 53 126 51 129 82 82 1 AGLTMNDIDAFEFHEAFSGQILANFK Unmodified 2885.3694 0.3694299 143 P55084;F5GZQ3;P55084-2;B5MD38 HADHB Trifunctional enzyme subunit beta, mitochondrial;3-ketoacyl-CoA thiolase yes no 0 0 0 By matching By matching By MS/MS By matching 1 1 1 88.035 88.031 3 0.0008638 28117 YJC_C_20141124_01 54.626 47.464 2999200 1167400 1469700 362060 0 54 143 52 130;131;132 83 83 1 AGNLGGGVVTIER Unmodified 1241.6728 0.67279921 199 P35268;K7EJT5;K7EP65;K7EKS7;K7ELC4;K7EMH1;K7ERI7 RPL22 60S ribosomal protein L22 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 52.241 52.288 2 2.3864E-29 9992 YJC_A_20141124_01 101.61 44.459 2409500 1505300 540130 0 364090 55 199 53 133;134;135 84 84 1 AGTVVLDDVELR Acetyl (Protein N-term) 1327.6983 0.69834526 282 P25205 MCM3 DNA replication licensing factor MCM3 yes yes 1 0 0 By MS/MS By matching By matching By matching 1 75.541 75.541 2 0.00050095 22642 YJC_A_20141124_01 64.945 48.171 0 0 0 0 0 56 282 54 136 85 85 1 AHGGYSVFAGVGER Unmodified 1405.6739 0.67386184 239 P06576;F8VPV9;H0YH81;F8W0P7;F8W079;H0YI37 ATP5B ATP synthase subunit beta, mitochondrial;ATP synthase subunit beta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 54.159 54.134 3 0.0047549 10572 YJC_A_20141124_01 63.727 48.34 1078600 1044000 0 34606 0 57 239 55 137;138 86 86 1 AHSSMVGVNLPQK Unmodified 1366.7027 0.70271913 41 P00558;B7Z7A9 PGK1 Phosphoglycerate kinase 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 46.65 46.65 3 3.2318E-14 8402 YJC_A_20141124_01 92.943 69.267 886780 886780 0 0 0 58 41 56 139 87 87 1 AIDLFTDAIK Unmodified 1105.6019 0.60192568 154 P50502;H7C3I1;F6VDH7;Q8IZP2;Q8NFI4 ST13;ST13P4;ST13P5 Hsc70-interacting protein;Putative protein FAM10A4;Putative protein FAM10A5 yes no 0 0 0 By MS/MS By matching By matching By matching 1 70.611 70.611 2 0.022624 18572 YJC_A_20141124_01 47.302 10.717 870600 870600 0 0 0 59 154 57 140 88 88 1 AIEINPDSAQPYK Unmodified 1444.7198 0.71980898 154 P50502;H7C3I1;F6VDH7;Q8IZP2;Q8NFI4 ST13;ST13P4;ST13P5 Hsc70-interacting protein;Putative protein FAM10A4;Putative protein FAM10A5 yes no 0 0 0 By MS/MS By matching By matching By matching 1 52.398 52.398 2 0.013239 10055 YJC_A_20141124_01 48.527 28.097 379750 379750 0 0 0 60 154 58 141 89 89 1 AIGGGLSSVGGGSSTIK Unmodified 1446.7678 0.7678218 68 P02538;CON__P02538;P48668;CON__P48668 KRT6A;KRT6C Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C yes no 0 0 0 By matching By MS/MS By matching By matching 1 50.715 50.756 2 0.0014617 10212 YJC_B_20141124_01 73.593 53.164 191170 0 191170 0 0 + 61 68 59 142 90 90 1 AIIIFVPVPQLK Unmodified 1336.8482 0.84824438 34 P62081;B5MCP9 RPS7 40S ribosomal protein S7 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 81.824 81.845 2 0.0083816 28042 YJC_A_20141124_01 56.043 53.544 1947600 1695700 251930 0 0 62 34 60 143;144 91 91 1 AIKVEQATKPSFESGR Unmodified 1746.9264 0.92644771 306 P38159;P38159-2;H0Y6E7;H3BT71 RBMX RNA-binding motif protein, X chromosome;RNA-binding motif protein, X chromosome, N-terminally processed yes no 0 0 2 By matching By matching By MS/MS By matching 1 1 1 42.353 42.482 4 0.010303 6075 YJC_C_20141124_01 47.774 37.643 753480 0 236760 250140 266570 63 306 61 145;146;147 92 92 1 AILELHYSQELSLLYLLQDDVDR Unmodified 2745.4225 0.42251133 111 P78527;E7EUY0;P78527-2 PRKDC DNA-dependent protein kinase catalytic subunit yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 90.725 90.722 3 9.5785E-21 31197 YJC_B_20141124_01 85.855 76.9 5829800 2541300 1964700 1323800 0 64 111 62 148;149;150 93;94 94 2 AILVDLEPGTMDSVR Oxidation (M) 1630.8236 0.82362212 245 P07437;Q5JP53;Q9BVA1;Q13885;E9PBJ4;G3V5W4;G3V2R8;G3V3R4;G3V2N6 TUBB;TUBB2B;TUBB2A;TUBB3 Tubulin beta chain;Tubulin beta-2B chain;Tubulin beta-2A chain no no 0 1 0 By MS/MS By MS/MS By matching By matching 1 1 1 64.143 64.139 2 1.7017E-46 14232 YJC_A_20141124_01 109.55 85.736 3552900 2655000 503240 394590 0 65 245 63 151;152;153 95;96 95 20 2 AILVDLEPGTMDSVR Unmodified 1614.8287 0.8287075 245 P07437;Q5JP53;Q9BVA1;Q13885;E9PBJ4;G3V5W4;G3V2R8;G3V3R4;G3V2N6 TUBB;TUBB2B;TUBB2A;TUBB3 Tubulin beta chain;Tubulin beta-2B chain;Tubulin beta-2A chain no no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 69.516 69.512 2 0.021661 17683 YJC_A_20141124_01 44.252 30.662 6356200 5164100 837550 354550 0 66 245 63 154;155;156 97 97 1 AINQQTGAFVEISR Unmodified 1532.7947 0.79470526 215 Q92945;M0R3J3 KHSRP Far upstream element-binding protein 2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 56.761 56.761 2 0.0041599 11375 YJC_A_20141124_01 73.279 46.181 381570 381570 0 0 0 67 215 64 157 98 98 1 AKKPAGATPK Unmodified 967.58147 0.581465 271 P16401 HIST1H1B Histone H1.5 yes yes 0 0 2 By matching By MS/MS By matching By matching 1 16.651 16.592 3 0.0020104 3477 YJC_B_20141124_01 80.916 49.282 187620 0 187620 0 0 68 271 65 158 99 99 1 AKLNWLSVDFNNWK Unmodified 1733.8889 0.88893999 16 Q15185;B4DP11;B4DDC6 PTGES3 Prostaglandin E synthase 3 yes no 0 0 1 By MS/MS By matching By matching By matching 1 77.34 77.34 3 0.010175 24366 YJC_A_20141124_01 38.445 26.241 802160 802160 0 0 0 69 16 66 159 100 100 0 AKWTLPR Unmodified 870.50757 0.50757178 361 Q04609-3 yes yes 0 0 1 By matching By MS/MS By matching By matching 1 1 1 49.476 49.572 2 1.9236E-23 9908 YJC_B_20141124_01 76.774 43.416 2266500000 0 693190000 469710000 1103600000 70 361 67 160;161;162 101 101 0 ALAAAGYDVEK Unmodified 1106.5608 0.56078914 257;272 P10412;P16402;Q02539;P22492;P16403 HIST1H1E;HIST1H1D;HIST1H1A;HIST1H1T;HIST1H1C Histone H1.4;Histone H1.3;Histone H1.1;Histone H1t;Histone H1.2 no no 0 0 0 By matching By matching By MS/MS By matching 1 1 1 45.884 45.98 2 5.7266E-05 6826 YJC_C_20141124_01 68.536 37.923 7913200 0 4617500 749140 2546500 71 257;272 68 163;164;165 102 102 0 ALAAAGYDVEKNNSR Unmodified 1577.7798 0.77978347 257;272 P10412;P16402;Q02539;P22492;P16403 HIST1H1E;HIST1H1D;HIST1H1A;HIST1H1T;HIST1H1C Histone H1.4;Histone H1.3;Histone H1.1;Histone H1t;Histone H1.2 no no 0 0 1 By matching By matching By matching By MS/MS 1 1 1 1 42.085 42.182 2 0.016169 7264 YJC_D_20141124_01 75.998 50.053 3819500 917260 981590 303470 1617100 72 257;272 69 166;167;168;169 103 103 1 ALAAGGYDVEK Unmodified 1092.5451 0.54513908 271 P16401 HIST1H1B Histone H1.5 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 1 44.637 44.709 2 1.6E-05 6567 YJC_C_20141124_01 78.342 38.073 8316400 1295100 4147200 610230 2263900 73 271 70 170;171;172;173 104;105;106 106 3 ALAAGGYDVEKNNSR Unmodified 1563.7641 0.76413341 271 P16401 HIST1H1B Histone H1.5 yes yes 0 0 1 By MS/MS By matching By matching By MS/MS 1 1 1 40.502 40.616 2 3.177E-47 6804 YJC_D_20141124_01 110.97 89.723 981490 283730 284290 0 413470 74 271 71 174;175;176 107;108 108 2 ALAAPAAEEK Unmodified 969.51311 0.51311067 358 Q01650 SLC7A5 Large neutral amino acids transporter small subunit 1 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 35.576 35.646 2 0.0009281 5279 YJC_A_20141124_01 63.216 45.743 285030 182680 102340 0 0 75 358 72 177;178 109;110 109 1 ALADTENLR Unmodified 1001.5142 0.5141733 418 Q9HAV7 GRPEL1 GrpE protein homolog 1, mitochondrial yes yes 0 0 0 By matching By matching By matching By MS/MS 1 42.278 42.478 2 0.0017643 7394 YJC_D_20141124_01 76.221 15.393 852890 0 0 0 852890 76 418 73 179 111 111 1 ALALGASTVMMGSLLAATTEAPGEYFFSDGIR Unmodified 3246.5941 0.59408647 170 P12268;H0Y4R1 IMPDH2 Inosine-5'-monophosphate dehydrogenase 2 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 94.5 94.444 3 3.5766E-37 33767 YJC_B_20141124_01 87.648 42.965 6043900 0 3897400 2146600 0 77 170 74 180;181 112 112 1 ALEESNYELEGK Unmodified 1380.6409 0.64088996 76 P13645;CON__P13645;CON__P02535-1 KRT10 Keratin, type I cytoskeletal 10 yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 48.376 48.421 2 5.824E-124 7350 YJC_C_20141124_01 139.48 115.2 1396500 0 648530 747920 0 + 78 76 75 182;183;184 113;114;115 115 3 ALEHFTDLYDIK Unmodified 1463.7296 0.72964538 354 Q00610;Q00610-2 CLTC Clathrin heavy chain 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 64.58 64.6 3 0.00054419 14497 YJC_A_20141124_01 77.062 61.243 1170100 940900 229220 0 0 79 354 76 185;186 116 116 1 ALELDSNLYR Unmodified 1192.6088 0.60880197 302 P35579;P35579-2 MYH9 Myosin-9 yes no 0 0 0 By MS/MS By matching By matching By matching 1 59.865 59.865 2 0.00079663 12412 YJC_A_20141124_01 82.494 56.378 647330 647330 0 0 0 80 302 77 187 117 117 1 ALEWLGGIDTGGSTGYNPGLK Unmodified 2105.0429 0.042934032 66 CON__ENSEMBL:ENSBTAP00000033053 yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 74.133 74.207 2 0.001644 22502 YJC_D_20141124_01 62.648 42.985 2294100 0 0 661100 1633000 + 81 66 78 188;189 118;119 119 2 ALGDYDYK Unmodified 943.42871 0.42871234 224 O75688;O75688-2;C9JIR6;O75688-4;B8ZZF0;O75688-5 PPM1B Protein phosphatase 1B yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 45.922 45.942 2 0.0012995 8193 YJC_A_20141124_01 89.698 59.38 7366400 5313300 2053100 0 0 82 224 79 190;191 120;121 120 2 ALGGEDVR Unmodified 815.41373 0.41373097 75 CON__P12763 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 34.273 34.343 2 0.002187 4996 YJC_A_20141124_01 91.853 31.093 849970 614880 235100 0 0 + 83 75 80 192;193 122;123 122 2 ALHKAALTIDEK Unmodified 1308.7402 0.74015049 77 CON__P34955 yes yes 0 0 1 By MS/MS By matching By matching By matching 1 1 38.647 38.718 3 0.0085429 6114 YJC_A_20141124_01 44.612 30.603 245970 189580 56383 0 0 + 84 77 81 194;195 124 124 0 ALIAAQYSGAQVR Unmodified 1346.7306 0.73064844 28 P26641;B4DTG2 EEF1G Elongation factor 1-gamma yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 52.441 52.463 2 7.0393E-96 10057 YJC_A_20141124_01 130.19 69.495 3380900 2491000 644880 134030 111050 85 28 82 196;197;198;199 125 125 1 ALIAGGGAPEIELALR Unmodified 1549.8828 0.88279198 318 P50991;P50991-2;B7Z9L0;B7Z2F4 CCT4 T-complex protein 1 subunit delta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 73.262 73.283 2 0.0032873 20808 YJC_A_20141124_01 62.69 47.303 1515100 1234600 280440 0 0 86 318 83 200;201 126 126 1 ALINADELASDVAGAEALLDR Unmodified 2126.0855 0.085527129 2 Q13813;Q13813-3;Q13813-2;A6NG51 SPTAN1 Spectrin alpha chain, non-erythrocytic 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 92.917 92.917 3 0.013122 37176 YJC_A_20141124_01 56.719 33.492 354810 354810 0 0 0 87 2 84 202 127 127 1 ALKAWSVAR Unmodified 1000.5818 0.58179936 72 CON__P02769 yes yes 0 0 1 By MS/MS By MS/MS By matching By MS/MS 1 1 1 1 46.721 46.793 3 0.0048573 8470 YJC_A_20141124_01 72.928 27.593 22495000 8109900 2154000 723790 11507000 + 88 72 85 203;204;205;206 128;129;130 128 3 ALLELQLEPEELYQTFQR Unmodified 2219.1474 0.1473991 265 P13639 EEF2 Elongation factor 2 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 86.707 86.703 3 3.0811E-67 31860 YJC_A_20141124_01 115.66 101.3 6165600 5141800 656340 367430 0 89 265 86 207;208;209 131 131 1 ALLFIPR Unmodified 828.52216 0.52215921 250 P08238 HSP90AB1 Heat shock protein HSP 90-beta yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 67.666 67.687 2 0.01216 16477 YJC_A_20141124_01 91.584 24.591 8318400 7065200 1253300 0 0 90 250 87 210;211 132 132 1 ALLFVPR Unmodified 814.50651 0.50650915 247 P07900;P07900-2;Q86U12 HSP90AA1 Heat shock protein HSP 90-alpha yes no 0 0 0 By MS/MS By matching By matching By matching 1 64.009 64.009 2 0.0056739 14161 YJC_A_20141124_01 80.377 23.867 2309800 2309800 0 0 0 91 247 88 212 133 133 1 ALMLQGVDLLADAVAVTMGPK 2 Oxidation (M) 2144.1221 0.12211233 260 P10809;E7ESH4;E7EXB4;C9JL25;B7Z712;C9J0S9;C9JL19;C9JCQ4 HSPD1 60 kDa heat shock protein, mitochondrial yes no 0 2 0 By MS/MS By matching By MS/MS By matching 1 1 1 89.765 89.762 3 5.126E-12 34430 YJC_A_20141124_01 84.436 69.592 2095600 1458800 344340 292420 0 92 260 89 213;214;215 134;135 134 30;31 2 ALPGQLKPFETLLSQNQGGK Unmodified 2125.1532 0.15315318 252 P09211 GSTP1 Glutathione S-transferase P yes yes 0 0 1 By MS/MS By matching By matching By matching 1 1 1 72.865 72.861 3 0.00037762 20159 YJC_A_20141124_01 66.809 44.375 6635500 4979300 1275300 380920 0 93 252 90 216;217;218 136 136 1 ALQFLEEVK Unmodified 1075.5914 0.59136099 308 P40227;P40227-2;B4DPJ8 CCT6A T-complex protein 1 subunit zeta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 66.493 66.513 2 0.020045 15805 YJC_A_20141124_01 54.259 24.516 1009200 750600 258560 0 0 94 308 91 219;220 137 137 0 ALQPLEEGEDEEK Unmodified 1485.6835 0.68348305 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 47.629 47.753 2 0.0024851 8821 YJC_D_20141124_01 73.758 58.596 7648200 0 0 1254200 6394000 95 375 92 221;222 138 138 1 ALSDHHIYLEGTLLKPNMVTPGHACTQK Unmodified 3130.5692 0.56920912 183 P04075;H3BQN4;J3KPS3;P04075-2;H3BU78 ALDOA Fructose-bisphosphate aldolase A yes no 0 0 1 By MS/MS By matching By matching By matching 1 59.682 59.682 5 0.011844 12358 YJC_A_20141124_01 22.649 15.483 1708200 1708200 0 0 0 96 183 93 223 139;140 140 2 ALTVPELTQQMFDAK Unmodified 1690.86 0.86000763 350 P68371;P04350;Q13509-2 TUBB4B;TUBB4A Tubulin beta-4B chain;Tubulin beta-4A chain no no 0 0 0 By MS/MS By matching By matching By matching 1 1 77.753 77.773 2 0.020221 24803 YJC_A_20141124_01 46.318 22.829 1203500 900460 303010 0 0 97 350 94 224;225 141 141 1 ALTVPELTQQVFDAK Unmodified 1658.8879 0.88793694 245 P07437;Q5JP53;Q5ST81 TUBB Tubulin beta chain yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 76.696 76.716 3 0.0044504 23490 YJC_A_20141124_01 76.357 60.559 2426800 1862000 564790 0 0 98 245 95 226;227 142;143 142 1 AMADELSEK Unmodified 992.44846 0.4484615 360 Q03135;E9PCT5 CAV1 Caveolin-1;Caveolin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 41.277 41.348 2 0.02512 6826 YJC_A_20141124_01 58.592 36.742 936640 527450 409200 0 0 99 360 96 228;229 144 144 1 AMQDAEVSK Unmodified 977.4488 0.44879585 307 P38646;H0YBG6 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 30.375 30.449 2 0.015098 4218 YJC_D_20141124_01 64.82 24.468 634580 0 0 107700 526880 100 307 97 230;231 145;146 146 2 ANEPNHVELGR Unmodified 1234.6054 0.60544792 180 Q9P253;H0YMC9 VPS18 Vacuolar protein sorting-associated protein 18 homolog yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 38.851 38.925 2 0.014362 6269 YJC_D_20141124_01 46.796 17.263 1521800 0 0 479720 1042100 101 180 98 232;233 147 147 1 ANLQIDQINTDLNLER Unmodified 1868.9592 0.9592044 302 P35579;P35579-2 MYH9 Myosin-9 yes no 0 0 0 By MS/MS By matching By matching By matching 1 68.491 68.491 2 0.013002 17092 YJC_A_20141124_01 53.504 34.83 909030 909030 0 0 0 102 302 99 234 148 148 1 ANVINKQEHDIIK Unmodified 1520.8311 0.83109076 126 Q13490;E9PMH5;Q13490-2;E9PI77;E9PIW1 BIRC2 Baculoviral IAP repeat-containing protein 2 yes no 0 0 1 By matching By MS/MS By matching By matching 1 41.211 41.351 3 0.0085618 7805 YJC_B_20141124_01 73.435 51.66 436350 0 436350 0 0 103 126 100 235 149 149 1 APIIAVTRNPQTAR Unmodified 1506.8631 0.86305959 268 P14618;P14618-3;P14618-2;H3BTN5;Q504U3 PKM;PKM2 Pyruvate kinase PKM;Pyruvate kinase yes no 0 0 1 By MS/MS By matching By matching By matching 1 44.903 44.903 3 0.010065 7908 YJC_A_20141124_01 42.425 15.327 630350 630350 0 0 0 104 268 101 236 150 150 0 APILIATDVASR Unmodified 1225.703 0.7030367 55 Q92841;Q92841-3;C9JMU5;H3BLZ8;Q92841-1;Q92841-2;P17844;J3KTA4;B4DLW8 DDX17;DDX5 Probable ATP-dependent RNA helicase DDX17;Probable ATP-dependent RNA helicase DDX5 yes no 0 0 0 By MS/MS By matching By matching By matching 1 58.915 58.915 2 0.018536 12089 YJC_A_20141124_01 46.159 26.882 670450 670450 0 0 0 105 55 102 237 151 151 1 APVLSDSSCK Unmodified 1062.5016 0.5015597 67 CON__P00761 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 35.212 35.282 2 3.865E-07 5173 YJC_A_20141124_01 93.561 71.601 14921000 7204400 7716600 0 0 + 106 67 103 238;239 152;153 152 2 AQAAAPASVPAQAPK Unmodified 1376.7412 0.74121312 309 P47914 RPL29 60S ribosomal protein L29 yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 1 1 39.225 39.322 2 5.3596E-10 7235 YJC_B_20141124_01 89.136 65.308 1688200 625330 701370 132930 228610 107 309 104 240;241;242;243 154 154 1 AQAAAPASVPAQAPKRTQAPTK Unmodified 2159.1811 0.18109927 309 P47914 RPL29 60S ribosomal protein L29 yes yes 0 0 2 By MS/MS By matching By matching By matching 1 1 1 35.604 35.684 4 0.014793 5306 YJC_A_20141124_01 34.476 28.202 984280 349430 504810 0 130050 108 309 105 244;245;246 155 155 1 AQAALAVNISAAR Unmodified 1254.7044 0.70443369 308 P40227;P40227-2 CCT6A T-complex protein 1 subunit zeta yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 53.979 54.008 2 1.4143E-14 10510 YJC_A_20141124_01 93.243 76.221 1426900 918560 439920 68372 0 109 308 106 247;248;249 156;157 156 2 AQADIALIGLAVMGQNLILNMNDHGFVVCAFNR Acetyl (Protein N-term) 3626.816 0.81599811 320 P52209;F5H7U0 PGD 6-phosphogluconate dehydrogenase, decarboxylating yes no 1 0 0 By matching By MS/MS By matching By matching 1 1 94.728 94.673 3 3.4104E-21 33993 YJC_B_20141124_01 70.028 53.564 3275600 0 2031400 1244300 0 110 320 107 250;251 158 158 1 AQALAIETEAELQR Unmodified 1541.8049 0.80493559 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 59.739 59.763 2 3.3004E-51 12452 YJC_D_20141124_01 115.8 83.362 1503800 0 0 407070 1096800 111 375 108 252;253 159;160 160 2 AQAVSEDAGGNEGR Unmodified 1359.6015 0.60148476 59 P55884;C9JZG1;P55884-2 EIF3B Eukaryotic translation initiation factor 3 subunit B yes no 0 0 0 By MS/MS By matching By matching By MS/MS 1 1 1 29.822 29.902 2 0.0024086 4124 YJC_D_20141124_01 76.574 59.51 805170 520490 152980 0 131700 112 59 109 254;255;256 161;162 162 2 AQFEGIVTDLIR Unmodified 1360.7351 0.73506511 307 P38646;H0YBG6 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By MS/MS 2 1 1 2 77.321 77.386 2;3 2.2257E-07 25284 YJC_D_20141124_01 86.911 55.432 33437000 3967200 932680 2730900 25806000 113 307 110 257;258;259;260;261;262 163;164;165;166 165 4 AQIFANTVDNAR Unmodified 1318.663 0.6629628 161 P05783;F8VZY9 KRT18 Keratin, type I cytoskeletal 18 yes no 0 0 0 By MS/MS By matching By matching By matching 1 50.918 50.918 2 0.021092 9645 YJC_A_20141124_01 45.347 29.406 369860 369860 0 0 0 114 161 111 263 167 167 1 AQIHDLVLVGGSTR Unmodified 1464.8049 0.80487601 249 P08107;P08107-2;E7EP94;V9GZ37 HSPA1A Heat shock 70 kDa protein 1A/1B yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 55.415 55.462 3 0.008158 10990 YJC_A_20141124_01 60.55 38.608 3940600 2952500 560450 229450 198160 115 249 112 264;265;266;267 168 168 1 AQLELEVSK Unmodified 1015.555 0.55497548 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 50.173 50.297 2 0.0019433 9505 YJC_D_20141124_01 72.289 44.861 2438400 0 0 707970 1730400 116 375 113 268;269 169 169 1 AQLGGPEAAK Unmodified 940.49779 0.49779495 234 P04792;C9J3N8 HSPB1 Heat shock protein beta-1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 32.446 32.526 2 0.0024308 4508 YJC_A_20141124_01 70.728 22.769 2849600 1960700 480420 0 408460 117 234 114 270;271;272 170 170 1 AQLGVQAFADALLIIPK Unmodified 1767.0295 0.02945622 308 P40227;P40227-2;B4DPJ8 CCT6A T-complex protein 1 subunit zeta yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 2 1 1 93.612 93.575 2 0.0018745 31771 YJC_C_20141124_01 65.105 53.515 2950200 2024500 707810 217960 0 118 308 115 273;274;275;276 171;172;173 173 3 AQQLAEVEVK Unmodified 1113.603 0.60298831 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 45.27 45.394 2 2.0217E-33 8217 YJC_D_20141124_01 113.38 74.625 1419200 0 0 389980 1029200 119 375 116 277;278 174;175 175 2 AQQLAEVEVKK Unmodified 1241.698 0.69795133 375 Q14764 MVP Major vault protein yes yes 0 0 1 By matching By matching By matching By MS/MS 1 1 39.14 39.264 3 0.0036106 6353 YJC_D_20141124_01 65.695 34.546 1783100 0 0 571710 1211400 120 375 117 279;280 176 176 1 AQYEDIANR Unmodified 1078.5043 0.5043369 74 P05787;CON__P05787;P05787-2;F8VUG2;O95678;CON__O95678 KRT8;KRT75 Keratin, type II cytoskeletal 8;Keratin, type II cytoskeletal 75 no no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 41.225 41.296 2 0.00062757 6837 YJC_A_20141124_01 86.898 68.116 695710 385510 310200 0 0 + 121 74 118 281;282 177;178 177 2 AQYEEIAQR Unmodified 1106.5356 0.53563702 68;78 P35908;CON__P35908;Q01546;P19013;F5H8K9;CON__P19013;CON__ENSEMBL:ENSBTAP00000038253;P02538;CON__P02538;P48668;CON__P48668;CON__P04259 KRT2;KRT76;KRT4;KRT6A;KRT6C Keratin, type II cytoskeletal 2 epidermal;Keratin, type II cytoskeletal 2 oral;Keratin, type II cytoskeletal 4;Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C no no 0 0 0 By matching By matching By MS/MS By matching 1 1 1 1 41.365 41.462 2 0.0016678 5850 YJC_C_20141124_01 83.862 44.013 745840 87053 298170 235940 124680 + 122 78;68 119 283;284;285;286 179 179 1 ARFEELNADLFR Unmodified 1479.747 0.74702678 262 P11142;E9PKE3;P11142-2;E9PN89;E9PNE6;A8K7Q2;P54652 HSPA8;HSPA2 Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2 yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 1 66.232 66.228 3 0.0099137 15277 YJC_B_20141124_01 64.534 52.226 3644900 2258500 1181000 205360 0 123 262 120 287;288;289 180;181 181 1 ASASGSGAQVGGPISSGSSASSVTVTR Unmodified 2364.1517 0.15170921 232 P02545;P02545-3;P02545-5;P02545-4 LMNA Prelamin-A/C;Lamin-A/C yes no 0 0 0 By MS/MS By matching By matching By matching 1 48.22 48.22 2 0.00070972 8857 YJC_A_20141124_01 47.286 16.171 0 0 0 0 0 124 232 121 290 182 182 1 ASATPRLADSGSVPHDSQVAEGPSVDTR Unmodified 2806.3482 0.34817719 200 Q96MG2;K7EKG1 JSRP1 Junctional sarcoplasmic reticulum protein 1 yes no 0 0 1 By matching By matching By matching By MS/MS 1 67.104 67.304 4 0.0047828 16912 YJC_D_20141124_01 34.041 16.611 4933600 0 0 0 4933600 125 200 122 291 183 183 1 ASGADSKGDDLSTAILK Acetyl (Protein N-term) 1689.8421 0.84210896 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 1 0 1 By MS/MS By MS/MS By matching By matching 1 1 58.564 58.584 2 1.1104E-11 12149 YJC_B_20141124_01 86.453 64.062 2386500 1421000 965470 0 0 126 326 123 292;293 184;185 185 2 ASGADSKGDDLSTAILKQK Acetyl (Protein N-term) 1945.9956 0.99564949 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 1 0 2 By matching By MS/MS By matching By matching 1 1 54.873 54.943 3 0.0087022 11241 YJC_B_20141124_01 44.662 26.906 5613600 4480300 1133300 0 0 127 326 124 294;295 186 186 1 ASGVAVSDGVIK Acetyl (Protein N-term) 1143.6136 0.61355299 281 P23528;E9PP50;E9PS23 CFL1 Cofilin-1 yes no 1 0 0 By MS/MS By matching By matching By matching 1 1 1 1 56.153 56.2 2 0.0040226 11191 YJC_A_20141124_01 60.364 34.472 5344000 3576900 1334800 177570 254730 128 281 125 296;297;298;299 187 187 1 ASGVSKATEVSKTPEAR Unmodified 1716.9006 0.90062689 428 Q9UNF1 MAGED2 Melanoma-associated antigen D2 yes yes 0 0 2 By MS/MS By matching By matching By matching 1 1 32.364 32.435 3 0.027123 4519 YJC_A_20141124_01 52.172 39.971 353450 195530 157920 0 0 129 428 126 300;301 188 188 1 ASITPGTILIILTGR Unmodified 1524.9239 0.92392852 359 Q02878;F8VR69;F8VZ45;U3KQR5 RPL6 60S ribosomal protein L6 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 94.364 94.334 2 0.0035386 38008 YJC_A_20141124_01 67.102 41.774 1436500 973090 463370 0 0 130 359 127 302;303 189 189 1 ASLSLAPVNIFK Acetyl (Protein N-term) 1300.7391 0.73908786 351 P78371;F8VQ14;F5GWF6 CCT2 T-complex protein 1 subunit beta yes no 1 0 0 By MS/MS By matching By matching By matching 1 1 85.237 85.257 2 0.0003235 30610 YJC_A_20141124_01 74.611 46.929 1837800 1598300 239450 0 0 131 351 128 304;305 190 190 1 ASMGTLAFDEYGRPFLIIK Acetyl (Protein N-term) 2170.1133 0.1132622 310 P48643;E7ENZ3;D6RIZ7 CCT5 T-complex protein 1 subunit epsilon yes no 1 0 1 By MS/MS By matching By matching By matching 1 88.339 88.339 2 1.3646E-12 33157 YJC_A_20141124_01 87.24 60.828 737880 737880 0 0 0 132 310 129 306 191 191 1 ASNGDAWVEAHGK Unmodified 1340.6109 0.61092723 307 P38646;D6RJI2 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 0 By matching By matching By matching By MS/MS 1 40.675 40.874 2 3.6842E-63 6873 YJC_D_20141124_01 119.17 98.964 3034100 0 0 0 3034100 133 307 130 307 192 192 1 ASTVVAVGLTIAAAGFAGR Acetyl (Protein N-term) 1772.9785 0.97848328 135 Q96DA6;G5E9V2;F2Z3A7 DNAJC19 Mitochondrial import inner membrane translocase subunit TIM14 yes no 1 0 0 By MS/MS By matching By MS/MS By MS/MS 1 1 1 1 94.832 94.804 2 6.7536E-168 38587 YJC_A_20141124_01 139.39 118.15 10380000 5297300 2972300 1212000 898780 134 135 131 308;309;310;311 193;194;195 193 3 ATAEVLNIGK Acetyl (Protein N-term) 1056.5815 0.58152458 117 P22234;E9PBS1;P22234-2 PAICS Multifunctional protein ADE2;Phosphoribosylaminoimidazole-succinocarboxamide synthase;Phosphoribosylaminoimidazole carboxylase yes no 1 0 0 By MS/MS By matching By matching By matching 1 64.431 64.431 2 0.0091551 14405 YJC_A_20141124_01 60.641 36.611 1059300 1059300 0 0 0 135 117 132 312 196 196 1 ATAVMPDGQFK Oxidation (M) 1179.5594 0.55940893 364 Q06830 PRDX1 Peroxiredoxin-1 yes yes 0 1 0 By MS/MS By matching By matching By matching 1 41.551 41.551 2 0.0041221 6883 YJC_A_20141124_01 70.728 50.522 493860 493860 0 0 0 136 364 133 313 197 197 52 1 ATEEFIIR Acetyl (Protein N-term) 1019.5288 0.52876073 375 Q14764;H3BUK7;H3BNF6;H3BRL2;H3BQK6;H3BP76;H3BPZ2;H3BNF2;H3BUP3;H3BQE7 MVP Major vault protein yes no 1 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 68.457 68.507 2 0.0024298 17714 YJC_D_20141124_01 66.692 41.133 2687600 213010 0 529270 1945300 137 375 134 314;315;316 198;199 199 2 ATENDIYNFFSPLNPVR Unmodified 1995.969 0.96904081 118 P31943;E9PCY7;G8JLB6;H0YB39;P52597;F5GZT4;H0YBG7;H0YBD7 HNRNPH1;HNRNPF Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 83.676 83.696 3 4.2131E-38 29505 YJC_A_20141124_01 101.42 83.856 1874700 1372900 501840 0 0 138 118 135 317;318 200 200 1 ATGPPVSELITK Unmodified 1211.6762 0.67615325 271 P16401 HIST1H1B Histone H1.5 yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 56.881 56.951 2 0.012379 11677 YJC_B_20141124_01 48.115 29.925 1943300 867280 1076000 0 0 139 271 136 319;320 201 201 1 ATNFLAHEK Acetyl (Protein N-term) 1071.5349 0.53490874 120 P29692;E9PN91;E9PMW7;E9PPR1;E9PL12;E9PL71;E9PQ49;E9PI39;E9PK01;P29692-3;E9PJD0;E9PNW6;E9PKK3;E9PK72;E9PK06;E9PQZ1;P29692-4 EEF1D Elongation factor 1-delta yes no 1 0 0 By MS/MS By matching By matching By matching 1 1 55.344 55.414 2 9.2159E-05 10963 YJC_A_20141124_01 89.561 54.383 2213100 1642000 571090 0 0 140 120 137 321;322 202 202 1 AVAASKER Unmodified 830.46102 0.46101552 257;272;271 P16401;P10412;P16402;P16403 HIST1H1B;HIST1H1E;HIST1H1D;HIST1H1C Histone H1.5;Histone H1.4;Histone H1.3;Histone H1.2 no no 0 0 1 By matching By MS/MS By matching By MS/MS 1 1 1 16.891 16.871 2 9.3583E-27 2102 YJC_D_20141124_01 114.89 41.635 877440 234530 217490 0 425420 141 271;257;272 139 323;324;325 203;204 204 2 AVCMLSNTTAIAEAWAR Unmodified 1863.8971 0.89713819 349 P68363;P68366;A8MUB1 TUBA1B;TUBA4A Tubulin alpha-1B chain;Tubulin alpha-4A chain no no 0 0 0 By MS/MS By matching By matching By matching 2 1 77.282 77.296 2;3 0.0016438 24146 YJC_A_20141124_01 74.783 55.849 2749000 2426600 322390 0 0 142 349 140 326;327;328 205;206 205 2 AVEDISSSR Unmodified 962.46689 0.46688876 126 Q13490;E9PMH5;Q13490-2;H0YDY3 BIRC2 Baculoviral IAP repeat-containing protein 2 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 34.185 34.255 2 0.02544 6230 YJC_B_20141124_01 58.246 39.464 219350 101830 117520 0 0 143 126 141 329;330 207 207 1 AVFVDLEPTVIDEVR Unmodified 1700.8985 0.89850163 349;150 Q9BQE3;F5H5D3;F8VVB9;F8VQQ4;F8VRZ4;F8VS66;F8VRK0;F8VX09;F8VWV9;P68363 TUBA1C;KLK9;TUBA1A;TUBA1B Tubulin alpha-1C chain;Tubulin alpha-1B chain no no 0 0 0 By MS/MS By matching By MS/MS By matching 1 1 1 1 76.109 76.156 2 0.0030739 19706 YJC_C_20141124_01 66.246 49.25 21073000 14411000 5039900 672900 949370 144 150;349 142 331;332;333;334 208;209 209 2 AVLGASER Unmodified 801.43447 0.43446642 435 yes yes 0 0 0 By matching By MS/MS By matching By matching 1 2 38.605 38.698 2 0.0074951 7141 YJC_B_20141124_01 81.191 8.4013 1113100 687320 425760 0 0 + + 145 435 143 335;336;337 210 210 1 AVTEVLAR Unmodified 857.49707 0.49706667 207 Q99961;M0R2K6;M0QYE0;M0R0I3;Q99961-3;Q99961-2 SH3GL1 Endophilin-A2 yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 40.866 40.949 2 0.0050155 6913 YJC_D_20141124_01 77.923 8.7247 2279700 62460 0 498580 1718600 146 207 144 338;339;340 211;212 212 2 AVVQSPQVTEVL Unmodified 1268.6976 0.69761697 385 Q3KQU3;Q3KQU3-2;Q3KQU3-4;Q3KQU3-3 MAP7D1 MAP7 domain-containing protein 1 yes no 0 0 0 By matching By matching By matching By MS/MS 1 64.888 65.088 2 0.0029341 15403 YJC_D_20141124_01 62.298 44.632 0 0 0 0 0 147 385 145 341 213 213 1 AWNDTTKAPTADTQTQNVNQAK Unmodified 2402.1462 0.1462299 433 Q9Y5V3;Q9Y5V3-2 MAGED1 Melanoma-associated antigen D1 yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 42.399 42.469 3 0.0061013 8108 YJC_B_20141124_01 60.669 46.722 436440 276420 160030 0 0 148 433 146 342;343 214 214 1 AYIVQLQIEDLTR Unmodified 1560.8512 0.8511575 47 Q15637-2;Q15637-6;Q15637-5;Q15637-4;C9J792;Q15637-7;Q15637-3;Q15637 SF1 Splicing factor 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 76.059 76.059 2 0.005261 23015 YJC_A_20141124_01 69.258 45.801 341050 341050 0 0 0 149 47 147 344 215 215 1 AYLLGKEDAAR Unmodified 1205.6404 0.64043645 101 Q13501;E7EMC7;D6RBF1;C9J6J8;E3W990 SQSTM1 Sequestosome-1 yes no 0 0 1 By MS/MS By matching By matching By matching 1 44.08 44.08 3 0.0092157 7716 YJC_A_20141124_01 64.103 36.849 2019200 2019200 0 0 0 150 101 148 345 216 216 1 AYLSIWTELQAYIK Unmodified 1697.9029 0.90285872 357 Q01518;Q5T0R4;Q5T0R3;Q5T0R2;Q5T0R1;Q5T0R9;Q01518-2 CAP1 Adenylyl cyclase-associated protein 1;Adenylyl cyclase-associated protein yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 94.299 94.262 2 1.7241E-274 37952 YJC_A_20141124_01 165.51 133.84 2357600 1404900 727540 225220 0 151 357 149 346;347;348 217;218 218 2 AYSSWPTYPQLYVSGELIGGLDIIK Unmodified 2769.4265 0.42653408 226 O76003 GLRX3 Glutaredoxin-3 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 92.897 92.897 3 0.0035523 37103 YJC_A_20141124_01 54.306 34.895 708730 708730 0 0 0 152 226 150 349 219 219 1 CDRWMVLGAISLLYNQEEAPDDR Unmodified 2750.2792 0.27923469 401 Q8N2C9 C21orf128 Uncharacterized protein C21orf128 yes yes 0 0 1 By MS/MS By matching By matching By MS/MS 2 1 2 64.292 64.361 4;5 0.015891 14723 YJC_D_20141124_01 24.851 13.626 248130000 86194000 0 11319000 150620000 153 401 151 350;351;352;353;354 220;221 221 2 CGAHYKLVPQQLAH Unmodified 1620.8195 0.81948022 259 P10606 COX5B Cytochrome c oxidase subunit 5B, mitochondrial yes yes 0 0 1 By MS/MS By matching By matching By matching 1 1 48.121 48.141 4 0.012294 8869 YJC_A_20141124_01 34.264 12.608 580980 417280 163690 0 0 154 259 152 355;356 222 222 0 DAASVEK Unmodified 718.34973 0.34973373 87 Q99729-3;D6R9P3;D6RD18;D6RBZ0;Q99729-2;Q99729;Q99729-4 HNRNPAB Heterogeneous nuclear ribonucleoprotein A/B yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 1 22.233 22.282 2 2.9577E-09 2776 YJC_D_20141124_01 104.75 25.296 1946500 11329 0 70978 1864200 155 87 153 357;358;359 223 223 1 DAEAWFNEK Unmodified 1108.4825 0.48253882 76 P13645;CON__P13645;Q7Z3Z0;Q7Z3Y8;Q7Z3Y7;CON__Q7Z3Z0;CON__Q7Z3Y8;CON__Q148H6;CON__Q7Z3Y7 KRT10;KRT25;KRT27;KRT28 Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 25;Keratin, type I cytoskeletal 27;Keratin, type I cytoskeletal 28 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 1 60.146 60.168 2 7.3017E-13 12632 YJC_B_20141124_01 102.52 69.435 3020400 563770 1452200 433370 571010 + 156 76 154 360;361;362;363 224 224 1 DAFDRNPELQNLLLDDFFK Unmodified 2309.1328 0.13281167 320 P52209;F5H7U0;B4DQJ8 PGD 6-phosphogluconate dehydrogenase, decarboxylating yes no 0 0 1 By matching By MS/MS By matching By matching 1 89.99 89.931 3 0.001299 30843 YJC_B_20141124_01 52.365 40.232 341940 0 341940 0 0 157 320 155 364 225 225 0 DAFLGSFLYEYSR Unmodified 1566.7355 0.73545904 72 CON__P02769 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 1 1 1 1 84.033 84.13 2 3.5039E-22 29683 YJC_A_20141124_01 80.746 57.278 5218600 1861600 827940 674640 1854500 + 158 72 156 365;366;367;368 226;227;228;229 226 4 DAGQISGLNVLR Unmodified 1241.6728 0.67279921 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 0 By MS/MS By matching By MS/MS By MS/MS 1 1 1 1 62.293 62.34 2 2.1078E-85 10788 YJC_C_20141124_01 130.69 82.973 19734000 2388000 833550 3272100 13241000 159 307 157 369;370;371;372 230;231;232 231 3 DAGTIAGLNVLR Unmodified 1198.667 0.66698555 262 P11142;E9PKE3;P11142-2;E9PN89;E9PLF4;E9PI65;E9PQQ4;E9PQK7;E9PK54 HSPA8 Heat shock cognate 71 kDa protein yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 65.879 65.959 2 7.4303E-120 15505 YJC_A_20141124_01 125.82 84.576 9488900 6664400 1902100 0 922480 160 262 158 373;374;375 233;234 233 0 DAGTIAGLNVMR Oxidation (M) 1232.6183 0.6183208 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 1 0 By MS/MS By MS/MS By matching By matching 1 1 1 53.576 53.606 2 5.6536E-06 10899 YJC_B_20141124_01 52.79 29.114 930430 638970 249150 42311 0 161 261 159 376;377;378 235;236 236 34 1 DAGTIAGLNVMR Unmodified 1216.6234 0.62340617 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 61.929 61.949 2 1.325E-07 13164 YJC_A_20141124_01 86.288 63.17 2734500 2001500 733080 0 0 162 261 159 379;380 237 237 1 DAGVIAGLNVLR Unmodified 1196.6877 0.68772099 249 P08107;P08107-2;E7EP94 HSPA1A Heat shock 70 kDa protein 1A/1B no no 0 0 0 By MS/MS By matching By matching By matching 1 1 70.26 70.281 2 2.1694E-05 18382 YJC_A_20141124_01 80.871 53.317 3377500 2903500 473920 0 0 163 249 160 381;382 238 238 1 DAQGLVLFDVTGQVR Unmodified 1616.8522 0.85222014 375 Q14764;H3BUK7;H3BNF6;H3BRL2;H3BQK6;H3BP76 MVP Major vault protein yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 76.975 77.025 2 2.0109E-05 24919 YJC_D_20141124_01 81.606 52.667 2929000 390690 0 480240 2058000 164 375 161 383;384;385 239;240 240 2 DATNVGDEGGFAPNILENK Unmodified 1959.9174 0.91739917 242 P06733;P06733-2 ENO1 Alpha-enolase yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 65.248 65.268 2 2.3114E-13 14706 YJC_B_20141124_01 89.604 68.295 2448700 1470700 978020 0 0 165 242 162 386;387 241;242;243 242 3 DAVLLVFANK Unmodified 1088.623 0.62299547 353 P84077;P61204;P84085;B7ZB63;C9J1Z8;F5H423 ARF1;ARF3;ARF5 ADP-ribosylation factor 1;ADP-ribosylation factor 3;ADP-ribosylation factor 5 yes no 0 0 0 By MS/MS By matching By matching By matching 1 71.657 71.657 2 1.1844E-06 19289 YJC_A_20141124_01 90.149 61.351 1146400 1146400 0 0 0 166 353 163 388 244 244 1 DAVVYPILVEFTR Unmodified 1520.8239 0.82388012 44 Q9Y4L1;E9PJ21;E9PL22;B7Z909 HYOU1 Hypoxia up-regulated protein 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 87.111 87.111 2 0.016333 32157 YJC_A_20141124_01 44.367 27.232 329330 329330 0 0 0 167 44 164 389 245 245 0 DDIENMVK Unmodified 962.4379 0.43789681 307 P38646;H0Y8S0 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 50.776 50.899 2 0.00051495 9678 YJC_D_20141124_01 90.709 55.271 524110 0 0 133070 391050 168 307 165 390;391 246 246 1 DDQVTVIGAGVTLHEALAAAELLK Unmodified 2433.3115 0.31150432 33 P29401;B4E022;P29401-2 TKT Transketolase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 91.963 91.933 3 0.0060234 36260 YJC_A_20141124_01 52.769 38.915 2189300 1797000 392370 0 0 169 33 166 392;393 247 247 1 DEEPSGWEEPSPQSISR Unmodified 1928.8388 0.8388145 173 Q9UPQ9;Q9UPQ9-1;H0Y720 TNRC6B Trinucleotide repeat-containing gene 6B protein yes no 0 0 0 By matching By matching By matching By MS/MS 1 56.393 56.492 2 1.2968E-11 11253 YJC_D_20141124_01 85.362 64.607 546970 0 0 0 546970 170 173 167 394 248 248 1 DEILPTTPISEQK Unmodified 1469.7613 0.76133944 279 P23396;P23396-2;E9PPU1;H0YEU2;E9PL09;E9PSF4 RPS3 40S ribosomal protein S3 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 1 56.807 56.854 2 0.0038398 11779 YJC_B_20141124_01 62.035 25.714 3187700 1906000 935670 49414 296640 171 279 168 395;396;397;398 249;250 250 2 DELLQQAR Unmodified 971.50361 0.50360861 426 Q9UKV5;R4GNG2 AMFR E3 ubiquitin-protein ligase AMFR yes no 0 0 0 By MS/MS By matching By matching By matching 1 43.645 43.645 2 7.8279E-07 7533 YJC_A_20141124_01 97.431 53.113 580810 580810 0 0 0 172 426 169 399 251 251 1 DFELDVLEEAYTTEHWLVR Unmodified 2364.1274 0.12739194 128 P46977;E9PNQ1 STT3A Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 94.301 94.271 3 0.0085959 37990 YJC_A_20141124_01 62.055 26.026 2048900 1040900 1008000 0 0 173 128 170 400;401 252 252 1 DFLAGGIAAAISK Unmodified 1232.6765 0.6764876 189 P12236;I7HJJ0 SLC25A6 ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 74.147 74.168 2 0.0041741 21437 YJC_A_20141124_01 67.136 35.378 1164000 840370 323670 0 0 174 189 171 402;403 253 253 1 DFLLQQTMLR Oxidation (M) 1279.6595 0.65945733 362 Q04760;Q04760-2 GLO1 Lactoylglutathione lyase yes no 0 1 0 By MS/MS By matching By matching By matching 1 65.487 65.487 2 0.0043683 15193 YJC_A_20141124_01 69.672 45.995 364630 364630 0 0 0 175 362 172 404 254 254 51 1 DFNHINVELSLLGK Unmodified 1597.8464 0.84640648 89 P32969;D6RAN4;H0Y9V9;E7ESE0 RPL9 60S ribosomal protein L9 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 74.07 74.091 3 0.0002299 21323 YJC_A_20141124_01 79.614 63.257 1426400 1089100 337310 0 0 176 89 173 405;406 255;256 255 2 DGAGFLINLIDSPGHVDFSSEVTAALR Unmodified 2800.4032 0.40317287 265 P13639 EEF2 Elongation factor 2 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 93.74 93.736 3 1.5828E-48 37968 YJC_A_20141124_01 97.825 65.368 11270000 6463300 2565300 2241600 0 177 265 174 407;408;409 257;258;259 257 3 DGDGTITTK Unmodified 906.42944 0.42944062 174 P62158;H0Y7A7;E7ETZ0;E7EMB3;F8WBR5;M0QZ52;G3V479 CALM1;CALM2;CALM3 Calmodulin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 27.149 27.229 2 2.053E-147 3506 YJC_A_20141124_01 148.91 76.684 654540 475040 87159 0 92341 178 174 175 410;411;412 260 260 1 DGDVDQGFR Unmodified 1007.4308 0.4308376 187 Q9BQG0;I3L311;I3L1L3;Q9BQG0-2 MYBBP1A Myb-binding protein 1A yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 40.407 40.49 2 6.9984E-06 5615 YJC_C_20141124_01 94.309 57.549 1203600 554470 0 286240 362920 179 187 176 413;414;415 261;262 261 2 DGGAWGTEQR Unmodified 1075.4683 0.46828574 253 P09382 LGALS1 Galectin-1 yes yes 0 0 0 By MS/MS By matching By matching By MS/MS 1 1 1 39.971 40.085 2 0.022921 6404 YJC_A_20141124_01 47.228 37.834 1261300 747510 372620 0 141200 180 253 177 416;417;418 263;264 263 1 DGKYSQVLANGLDNKLR Unmodified 1889.9959 0.99592426 336 P62269;J3JS69 RPS18 40S ribosomal protein S18 yes no 0 0 2 By MS/MS By matching By matching By matching 1 57.428 57.428 4 0.023356 11554 YJC_A_20141124_01 31.089 15.487 559550 559550 0 0 0 181 336 178 419 265 265 0 DGQVINETSQHHDDLE Unmodified 1835.7922 0.79219865 251 P08670 VIM Vimentin yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 2 42.693 42.828 2;3 0.0096944 7518 YJC_D_20141124_01 61.444 54.153 6926500 1366500 192860 0 5367200 182 251 179 420;421;422;423 266;267 267 2 DGVFLYFEDNAGVIVNNK Unmodified 2012.9844 0.98435652 194 P62829;J3KTJ3;J3KT29 RPL23 60S ribosomal protein L23 yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 81.277 81.307 2 0.0016267 27508 YJC_A_20141124_01 66.606 41.688 2520900 1081100 947260 492540 0 183 194 180 424;425;426 268;269;270 268 3 DHFEEAMR Unmodified 1033.4287 0.42872911 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 0 0 0 By MS/MS By matching By matching By matching 1 39.884 39.884 3 0.0086226 6378 YJC_A_20141124_01 49.097 35.094 188310 188310 0 0 0 184 326 181 427 271 271 0 DHQYQFLEDAVR Unmodified 1519.7056 0.7055559 371 Q13263;Q13263-2;M0R2I3;M0R3C0 TRIM28 Transcription intermediary factor 1-beta yes no 0 0 0 By MS/MS By matching By matching By matching 1 62.597 62.597 3 0.017552 13511 YJC_A_20141124_01 37.144 25.086 269980 269980 0 0 0 185 371 182 428 272 272 0 DICNDVLSLLEK Unmodified 1417.7123 0.71228076 114 P63104;E7EX29;B0AZS6;E7ESK7 YWHAZ 14-3-3 protein zeta/delta yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 88.181 88.177 2 0.020251 29648 YJC_B_20141124_01 45.614 14.885 1637000 1238600 252370 146110 0 186 114 183 429;430;431 273 273 1 DIDEVSSLLR Unmodified 1145.5928 0.59281755 317 P50990;P50990-3;P50990-2;H7C4C8 CCT8 T-complex protein 1 subunit theta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 68.16 68.181 2 0.0077938 16845 YJC_A_20141124_01 64.103 39.265 1019800 749720 270080 0 0 187 317 184 432;433 274 274 1 DIDPQNDLTFLR Unmodified 1445.7151 0.71505795 17 Q9NP97;Q8TF09;B4DFR2;H3BQI1;B1AKR6 DYNLRB1;DYNLRB2 Dynein light chain roadblock-type 1;Dynein light chain roadblock-type 2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 71.284 71.364 2 0.019747 19175 YJC_A_20141124_01 41.684 21.841 1603400 609330 640510 0 353610 188 17 185 434;435;436 275 275 0 DIKNVPFKIVR Unmodified 1327.7976 0.79760579 307 P38646;D6RJI2 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 1 1 55.471 55.519 3 3.1255E-21 10970 YJC_D_20141124_01 100.69 65.992 12622000 350300 44026 536600 11691000 189 307 186 437;438;439;440 276 276 1 DKAPVQPQQSPAAAPGGTDEKPSGK Unmodified 2460.2245 0.22448023 370 Q13200;F8WBS8;C9JPC0 PSMD2 26S proteasome non-ATPase regulatory subunit 2 yes no 0 0 2 By MS/MS By MS/MS By matching By matching 1 1 35.347 35.417 4 0.0086371 5213 YJC_A_20141124_01 34.254 26.329 851500 391050 460450 0 0 190 370 187 441;442 277;278 277 2 DLADELALVDVIEDK Unmodified 1656.8458 0.84579735 229 P00338;P00338-3;P00338-2;P00338-5;F5GYU2;F5GXY2;P00338-4;F5GXH2;F5GZQ4;F5H5J4;F5H6W8 LDHA L-lactate dehydrogenase A chain yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 88.245 88.241 2 0.017532 33037 YJC_A_20141124_01 49.223 32.337 1539500 1249100 194390 95971 0 191 229 188 443;444;445 279 279 1 DLAVAGPEMQVK Unmodified 1256.6435 0.64347291 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 54.868 54.892 2 0.0055912 8762 YJC_C_20141124_01 61.03 26.643 859920 0 0 187030 672890 192 375 189 446;447 280;281 280 2 DLDCSDGSDEEECR Unmodified 1685.5781 0.57810806 420 Q9NPF0 CD320 CD320 antigen yes yes 0 0 0 By MS/MS By matching By matching By matching 1 36.75 36.75 2 0.011551 5550 YJC_A_20141124_01 51.771 51.771 280310 280310 0 0 0 193 420 190 448 282 282 1 DLDVAILVGSMPR Unmodified 1384.7384 0.73843593 53 P40925;C9JLV6;C9JRL4;C9JF79;P40925-3 MDH1 Malate dehydrogenase, cytoplasmic;Malate dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 81.713 81.713 2 0.0028311 27876 YJC_A_20141124_01 63.662 42.603 528170 528170 0 0 0 194 53 191 449 283 283 1 DLEEALEMGVDWSLR Unmodified 1761.8244 0.82435041 430 Q9Y3I0 RTCB tRNA-splicing ligase RtcB homolog yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 92.002 91.972 2 0.0025156 36367 YJC_A_20141124_01 65.219 43.552 382740 322350 60397 0 0 195 430 192 450;451 284 284 1 DLLAVVFYGTEK Unmodified 1353.718 0.71801807 11 P12956;B1AHC9 XRCC6 X-ray repair cross-complementing protein 6 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 84.867 84.887 2 0.0042409 30308 YJC_A_20141124_01 67.019 49.354 467420 366560 100860 0 0 196 11 193 452;453 285 285 1 DLLEVADVLEK Unmodified 1242.6707 0.67073352 418 Q9HAV7 GRPEL1 GrpE protein homolog 1, mitochondrial yes yes 0 0 0 By matching By matching By matching By MS/MS 1 78.265 78.464 2 0.001072 26306 YJC_D_20141124_01 73.435 32.708 415820 0 0 0 415820 197 418 194 454 286 286 1 DLVILLYETALLSSGFSLEDPQTHANR Unmodified 3001.5397 0.53966635 247 P07900;P07900-2 HSP90AA1 Heat shock protein HSP 90-alpha yes no 0 0 0 By matching By matching By MS/MS By matching 1 94.548 94.497 3 5.6445E-28 32441 YJC_C_20141124_01 85.062 75.331 35651000 0 0 35651000 0 198 247 195 455 287 287 1 DLVVLLFETALLSSGFSLEDPQTHSNR Unmodified 2987.524 0.52401629 250 P08238 HSP90AB1 Heat shock protein HSP 90-beta yes yes 0 0 0 By MS/MS By matching By matching By MS/MS 6 2 95.283 95.283 3;4 6.7097E-241 38167 YJC_D_20141124_01 146.19 127.27 650000000 532000000 0 0 117990000 199 250 196 456;457;458;459;460;461;462;463 288;289;290;291;292;293;294;295;296;297 297 8 DLYANTVLSGGTTMYPGIADR Oxidation (M) 2230.0576 0.057597819 327 P60709;P63261 ACTB;ACTG1 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed yes no 0 1 0 By MS/MS By MS/MS By matching By matching 2 1 2 67.929 67.916 2;3 0.0022822 16651 YJC_A_20141124_01 45.885 30.692 8808300 7410800 692650 704850 0 200 327 197 464;465;466;467;468 298;299 298 40 2 DLYANTVLSGGTTMYPGIADR Unmodified 2214.0627 0.062683196 327 P60709;P63261 ACTB;ACTG1 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed yes no 0 0 0 By MS/MS By MS/MS By matching By matching 2 2 1 72.306 72.312 2;3 0.007371 18704 YJC_B_20141124_01 54.225 36.984 10980000 9223700 1388800 366970 0 201 327 197 469;470;471;472;473 300;301 301 2 DLYFEGGVSSVYLWDLDHGFAGVILIK Unmodified 3012.5273 0.52731075 12 P47756;P47756-2;F6Q0E3;F6USW4;B1AK87;B1AK85;B1AK88 CAPZB F-actin-capping protein subunit beta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 94.318 94.281 3 0.00010758 37950 YJC_A_20141124_01 55.02 45.457 5103200 1336800 2735800 1030600 0 202 12 198 474;475;476 302 302 1 DLYLASVFHATAFELDTDGNPFDQDIYGR Unmodified 3289.5204 0.52038748 123 P50454;E9PKH2 SERPINH1 Serpin H1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 93.255 93.251 3 0.0092679 37202 YJC_A_20141124_01 36.864 27.934 3321700 1685600 915260 720860 0 203 123 199 477;478;479 303 303 1 DMAEMQRVWKEK Oxidation (M) 1565.733 0.73303298 377 Q15058 KIF14 Kinesin-like protein KIF14 yes yes 0 1 2 By MS/MS By MS/MS By MS/MS By MS/MS 1 1 1 2 55.937 55.995 2 5.2551E-07 8969 YJC_C_20141124_01 87.667 17.804 150330000 25337000 11170000 22052000 91769000 204 377 200 480;481;482;483;484 304;305;306;307 306 55 4 DMAIATGGAVFGEEGLTLNLEDVQPHDLGK Unmodified 3096.5074 0.50737995 260 P10809 HSPD1 60 kDa heat shock protein, mitochondrial yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By matching 3 3 2 1 80.736 80.794 3;4 7.302E-14 24636 YJC_B_20141124_01 72.082 58.419 49610000 29028000 9153700 7515500 3912800 205 260 201 485;486;487;488;489;490;491;492;493 308;309;310;311 310 4 DNLEFFLAGIGR Unmodified 1350.6932 0.6932003 313 P49327 FASN Fatty acid synthase;[Acyl-carrier-protein] S-acetyltransferase;[Acyl-carrier-protein] S-malonyltransferase;3-oxoacyl-[acyl-carrier-protein] synthase;3-oxoacyl-[acyl-carrier-protein] reductase;3-hydroxyacyl-[acyl-carrier-protein] dehydratase;Enoyl-[acyl-carrier-protein] reductase;Oleoyl-[acyl-carrier-protein] hydrolase yes yes 0 0 0 By MS/MS By matching By matching By matching 1 85.157 85.157 2 0.0024837 30621 YJC_A_20141124_01 52.891 39.614 2266000 2266000 0 0 0 206 313 202 494 312 312 0 DQAVFPQNGLVVSSVDVQSVEPVDQR Unmodified 2811.4039 0.40390115 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By matching By MS/MS 1 71.602 71.802 3 0.00012994 20249 YJC_D_20141124_01 48.286 29.681 5230000 0 0 0 5230000 207 375 203 495 313 313 1 DQEVNFQEYVTFLGALALIYNEALKG Unmodified 2944.4858 0.48583987 241 P06703 S100A6 Protein S100-A6 yes yes 0 0 1 By matching By MS/MS By matching By matching 1 94.601 94.542 3 1.3202E-199 33862 YJC_B_20141124_01 142.32 120.7 71769000 0 71769000 0 0 208 241 204 496 314 314 1 DQLIYNLLK Unmodified 1118.6336 0.63356015 229 P00338;P00338-3;P00338-2;P00338-5;F5GYU2;F5GXY2;P00338-4;F5GXH2;F5GZQ4;F5H5J4;F5H6W8;F5H8H6;F5GXC7;F5GWW2;F5GXU1 LDHA L-lactate dehydrogenase A chain yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 74.467 74.464 2 0.0016635 21635 YJC_A_20141124_01 83.869 42.469 2651600 2021800 392190 237610 0 209 229 205 497;498;499 315 315 1 DQVANSAFVER Unmodified 1234.5942 0.59421454 247 P07900;P07900-2;Q86U12 HSP90AA1 Heat shock protein HSP 90-alpha yes no 0 0 0 By MS/MS By matching By matching By matching 1 46.462 46.462 2 5.7595E-05 8375 YJC_A_20141124_01 63.292 33.365 488130 488130 0 0 0 210 247 206 500 316 316 0 DRDYSDHPSGGSYRDSYESYGNSR Unmodified 2769.1287 0.12874194 306 P38159;P38159-2;Q96E39;B3KRG5;H3BUY5 RBMX;RBMXL1 RNA-binding motif protein, X chromosome;RNA-binding motif protein, X chromosome, N-terminally processed;RNA binding motif protein, X-linked-like-1 yes no 0 0 2 By matching By matching By matching By MS/MS 1 42.827 43.027 4 0.02587 7568 YJC_D_20141124_01 26.719 26.18 675540 0 0 0 675540 211 306 207 501 317 317 1 DRPFFAGLVK Unmodified 1148.6342 0.63422886 98 P22392-2;P15531;E5RHP0;E7ERL0;J3KPD9;Q32Q12;P15531-2 NME1;NME2;NME1-NME2 Nucleoside diphosphate kinase A;Nucleoside diphosphate kinase yes no 0 0 1 By MS/MS By matching By matching By matching 1 65.954 65.954 3 0.013982 15487 YJC_A_20141124_01 54.784 33.388 0 0 0 0 0 212 98 208 502 318 318 1 DSAVAISGADSR Unmodified 1147.5469 0.54692999 172 Q7Z6Z7;H0Y5W0;Q7Z6Z7-2;Q7Z6Z7-3 HUWE1 E3 ubiquitin-protein ligase HUWE1 yes no 0 0 0 By matching By MS/MS By matching By matching 1 38.855 38.996 2 0.0084238 7179 YJC_B_20141124_01 55.899 38.305 187990 0 187990 0 0 213 172 209 503 319 319 1 DSCQGDSGGPVVCNGQLQGIVSWGYGCAQK Unmodified 3183.3808 0.380816 67;405 CON__P00761;Q8NHM4 PRSS3P2 Putative trypsin-6 no no 0 0 0 By matching By matching By matching By MS/MS 1 1 1 1 74.242 74.289 3 0.00078009 22485 YJC_D_20141124_01 40.849 34.105 14345000 2945000 2232900 2828800 6338100 + 214 67;405 210 504;505;506;507 320;321 320 2 DSELDKHLESR Unmodified 1327.6368 0.63680763 224 O75688;O75688-2;C9JIR6;O75688-4;B8ZZF0;O75688-3;O75688-5 PPM1B Protein phosphatase 1B yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 38.501 38.571 3 1.1324E-83 6052 YJC_A_20141124_01 127.51 98.611 5786600 4123000 1663600 0 0 215 224 211 508;509 322 322 1 DSETGENIR Unmodified 1019.452 0.45196697 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 1 30.883 30.932 2 0.0024738 4311 YJC_D_20141124_01 77.192 44.974 1936500 48203 0 115050 1773300 216 307 212 510;511;512 323 323 1 DSLLQDGEFSMDLR Oxidation (M) 1640.7352 0.73520105 246 P07737;K7EJ44 PFN1 Profilin-1 yes no 0 1 0 By MS/MS By matching By matching By matching 1 1 67.489 67.51 2 0.0065045 16376 YJC_A_20141124_01 71.08 56.092 2739800 2297400 442360 0 0 217 246 213 513;514 324 324 22 1 DSLLQDGEFSMDLR Unmodified 1624.7403 0.74028642 246 P07737;K7EJ44 PFN1 Profilin-1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 74.512 74.532 2 1.2341E-160 21840 YJC_A_20141124_01 146.27 106.54 5328000 4111900 1216200 0 0 218 246 213 515;516 325 325 1 DSPSVWAAVPGK Unmodified 1212.6139 0.61388734 246 P07737;CON__P02584;I3L3D5 PFN1 Profilin-1 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 58.967 58.987 2 0.00049762 12238 YJC_B_20141124_01 74.611 49.758 3117000 1609300 1507600 0 0 219 246 214 517;518 326;327 327 2 DSTLIMQLLR Oxidation (M) 1204.6486 0.64855829 114;334;286 P62258;K7EM20;P62258-2;P61981;P31947;Q04917;P31947-2;P63104;E7EX29;B0AZS6;B7Z2E6;H0YB80;P63104-2;P31946;P31946-2;P27348 YWHAE;YWHAG;SFN;YWHAH;YWHAZ;YWHAB;YWHAQ 14-3-3 protein epsilon;14-3-3 protein gamma;14-3-3 protein gamma, N-terminally processed;14-3-3 protein sigma;14-3-3 protein eta;14-3-3 protein zeta/delta;14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed;14-3-3 protein theta no no 0 1 0 By MS/MS By MS/MS By matching By matching 2 2 1 78.497 78.503 2 2.5339E-24 24761 YJC_A_20141124_01 110.53 70.685 5941400 4830100 873430 237830 0 220 334;114;286 215 519;520;521;522;523 328;329;330 328 7 3 DSTLIMQLLR Unmodified 1188.6536 0.65364367 114;334;286 P62258;K7EM20;P62258-2;P61981;P31947;Q04917;P31947-2;P63104;E7EX29;B0AZS6;B7Z2E6;H0YB80;P63104-2;P31946;P31946-2;P27348 YWHAE;YWHAG;SFN;YWHAH;YWHAZ;YWHAB;YWHAQ 14-3-3 protein epsilon;14-3-3 protein gamma;14-3-3 protein gamma, N-terminally processed;14-3-3 protein sigma;14-3-3 protein eta;14-3-3 protein zeta/delta;14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed;14-3-3 protein theta no no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 83.005 83.025 2 5.2805E-60 26276 YJC_B_20141124_01 126.39 57.541 3837700 2260700 1577000 0 0 221 334;114;286 215 524;525 331;332 332 2 DSVSGELTLEGGALVLADQGVCCIDEFDK Unmodified 3096.4267 0.42674637 298 P33993;P33993-3 MCM7 DNA replication licensing factor MCM7 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 91.499 91.469 3 0.014899 31752 YJC_B_20141124_01 24.837 5.1717 2029700 1494200 535550 0 0 222 298 216 526;527 333 333 0 DSYVGDEAQSK Unmodified 1197.515 0.51496116 327 P60709;P63261;I3L3I0;I3L1U9;P63267;P68133;P62736;P68032;E7EVS6;I3L3R2;Q5T8M8;A6NL76;Q5T8M7;G5E9R0;K7EM38;J3KT65;C9JTX5;C9JUM1;C9JZR7;F8WB63;B8ZZJ2;C9JFL5;F6UVQ4;F6QUT6 ACTB;ACTG1;ACTG2;ACTA1;ACTA2;ACTC1 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed;Actin, gamma-enteric smooth muscle;Actin, alpha skeletal muscle;Actin, aortic smooth muscle;Actin, alpha cardiac muscle 1 yes no 0 0 0 By MS/MS By matching By matching By MS/MS 1 1 1 35.022 35.102 2 3.2133E-07 5146 YJC_A_20141124_01 88.021 73.341 1481800 590660 695430 0 195760 223 327 217 528;529;530 334;335 334 2 DSYVGDEAQSKR Unmodified 1353.6161 0.61607219 327 P60709;P63261;I3L3I0;I3L1U9;P63267;P68133;P62736;P68032;E7EVS6;I3L3R2;Q5T8M8;A6NL76;Q5T8M7;G5E9R0;K7EM38;J3KT65;C9JTX5;C9JUM1;C9JZR7;F8WB63;B8ZZJ2;C9JFL5;F6UVQ4;F6QUT6 ACTB;ACTG1;ACTG2;ACTA1;ACTA2;ACTC1 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed;Actin, gamma-enteric smooth muscle;Actin, alpha skeletal muscle;Actin, aortic smooth muscle;Actin, alpha cardiac muscle 1 yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 33.692 33.762 2 0.00038866 6129 YJC_B_20141124_01 76.24 65.315 603950 328930 275020 0 0 224 327 218 531;532 336;337 337 2 DTEVLFCFEQFDELTLLHLR Unmodified 2524.2308 0.23081116 151 Q12931;I3L0K7;F5H897 TRAP1 Heat shock protein 75 kDa, mitochondrial yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 94.303 94.273 3 0.017543 33571 YJC_B_20141124_01 53.565 40.198 1738100 486280 1251900 0 0 225 151 219 533;534 338 338 1 DTGKTPVEPEVAIHR Unmodified 1647.858 0.8580338 329 P60866;P60866-2;E5RIP1;E5RJX2 RPS20 40S ribosomal protein S20 yes no 0 0 1 By matching By MS/MS By matching By matching 1 43.883 43.923 4 0.019769 8510 YJC_B_20141124_01 36.519 21.728 187290 0 187290 0 0 226 329 220 535 339 339 1 DTHKSEIAHRFK Unmodified 1467.7583 0.75826017 72 CON__P02769 yes yes 0 0 2 By matching By matching By matching By MS/MS 1 1 1 1 30.122 30.194 4 0.014985 4153 YJC_D_20141124_01 42.21 30.628 2936300 1091700 479500 172340 1192800 + 227 72 221 536;537;538;539 340 340 1 DTLTISGTPEVTCVVVDVGHDDPEVK Unmodified 2781.3379 0.337855 65;64 CON__ENSEMBL:ENSBTAP00000024466;CON__ENSEMBL:ENSBTAP00000024462 no no 0 0 0 By matching By matching By MS/MS By matching 1 1 70.827 70.901 3 0.00015745 15680 YJC_C_20141124_01 47.931 35.253 25600000 0 0 3362800 22238000 + 228 65;64 222 540;541 341 341 1 DTNVMLVALAAK Oxidation (M) 1260.6748 0.67477304 373 Q14008;Q14008-2;Q14008-3 CKAP5 Cytoskeleton-associated protein 5 yes no 0 1 0 By MS/MS By matching By matching By matching 1 1 67.752 67.772 2 0.0077578 16655 YJC_A_20141124_01 43.604 8.5676 1207000 937000 269950 0 0 229 373 223 542;543 342 342 53 0 DVDLEFLAK Unmodified 1048.5441 0.54407645 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 69.783 69.803 2 0.0024738 17974 YJC_A_20141124_01 77.192 46.505 2640500 1716600 923930 0 0 230 326 224 544;545 343 343 1 DVNAAIATIK Unmodified 1014.571 0.5709599 349;150 Q9BQE3;F5H5D3;P68363 TUBA1C;TUBA1B Tubulin alpha-1C chain;Tubulin alpha-1B chain no no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 53.902 53.932 2 6.8662E-75 10459 YJC_A_20141124_01 128.08 64.897 4049800 2852600 1032800 164380 0 231 150;349 225 546;547;548 344 344 1 DYFEEYGK Unmodified 1049.4342 0.43419164 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 54.469 54.493 2 7.8279E-07 10693 YJC_D_20141124_01 97.431 81.053 2713400 0 0 580580 2132800 232 278 226 549;550 345 345 1 DYFEQYGK Unmodified 1048.4502 0.45017606 255 P09651;F8W6I7;P09651-3;P09651-2;F8VZ49;Q32P51;F8VTQ5;F8VYN5 HNRNPA1;HNRNPA1L2 Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2 yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 1 53.271 53.287 2 0.0073046 10349 YJC_D_20141124_01 80.688 72.225 3272000 629730 0 917010 1725200 233 255 227 551;552;553 346 346 1 DYFGAHTYELLAK Unmodified 1526.7405 0.74054442 320 P52209;F5H7U0;B4DQJ8 PGD 6-phosphogluconate dehydrogenase, decarboxylating yes no 0 0 0 By MS/MS By matching By matching By matching 1 66.94 66.94 2 0.005001 15976 YJC_A_20141124_01 60.161 35.648 911660 911660 0 0 0 234 320 228 554 347 347 1 DYGVLLEGSGLALR Unmodified 1461.7827 0.78274359 292 P30048;P30048-2 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 75.481 75.501 2 0.0040738 22554 YJC_A_20141124_01 60.55 33.545 1452600 1183900 268700 0 0 235 292 229 555;556 348 348 1 DYIAPWER Unmodified 1048.4978 0.49779495 205 Q9H0W8;M0QZH1;M0QX70;M0QYR7;M0R2N0;M0QZC7;Q9H0W8-2 SMG9 Protein SMG9 yes no 0 0 0 By MS/MS By matching By matching By matching 1 62.051 62.051 2 0.012497 13281 YJC_A_20141124_01 50.04 32.82 245550 245550 0 0 0 236 205 230 557 349 349 0 EAAQKAVNSATGVPTV Unmodified 1541.8049 0.80493559 107 P11940;E7EQV3;E7ERJ7;P11940-2;H0YC10;H0YAS7;H0YAS6;H0YB75 PABPC1 Polyadenylate-binding protein 1 yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 48.887 48.987 2 0.025534 9045 YJC_A_20141124_01 67.685 46.878 2321700 1250400 0 0 1071300 237 107 231 558;559 350 350 1 EAEAAIYHLQLFEELR Unmodified 1930.9789 0.97887721 268 P14618;P14618-3 PKM Pyruvate kinase PKM yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 77.459 77.455 3 0.026825 24217 YJC_A_20141124_01 53.3 40.808 3876500 2762100 800170 314250 0 238 268 232 560;561;562 351 351 1 EAESCDCLQGFQLTHSLGGGTGSGMGTLLLSK Oxidation (M) 3326.5217 0.52172616 146 Q3ZCM7;F5H0I4;Q5SQY0 TUBB8 Tubulin beta-8 chain yes no 0 1 0 By MS/MS By matching By matching By matching 1 69.76 69.76 3 1.0701E-08 17941 YJC_A_20141124_01 46.412 42.356 3189400 3189400 0 0 0 239 146 233 563 352 352 8 1 EAESCDCLQGFQLTHSLGGGTGSGMGTLLLSK Unmodified 3310.5268 0.52681154 146 Q3ZCM7;F5H0I4;Q5SQY0 TUBB8 Tubulin beta-8 chain yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 74.179 74.199 3 0.014547 21493 YJC_A_20141124_01 33.487 26.998 4970900 3822600 1148300 0 0 240 146 233 564;565 353 353 1 EAFRVFDKDGNGYISAAELR Unmodified 2257.1127 0.11274493 174 P62158;H0Y7A7;E7ETZ0;E7EMB3;G3V361;Q96HY3 CALM1;CALM2;CALM3 Calmodulin yes no 0 0 2 By MS/MS By matching By matching By matching 1 64.133 64.133 3 0.013261 14244 YJC_A_20141124_01 49.773 36.839 1948700 1948700 0 0 0 241 174 234 566 354 354 1 EAMSLKGHLQSVTAPMGITMK Unmodified 2229.132 0.13196551 121 Q7Z3Z3;E9PIP6 PIWIL3 Piwi-like protein 3;Piwi-like protein yes no 0 0 1 By MS/MS By matching By matching By matching 1 55.311 55.311 4 0.017517 11056 YJC_A_20141124_01 39.387 39.387 444390 444390 0 0 0 242 121 235 567 355 355 0 EAPATQASSTTQLTDTQVLAAENK Unmodified 2474.2136 0.21364077 428 Q9UNF1;Q5H909;Q9UNF1-2 MAGED2 Melanoma-associated antigen D2 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 55.782 55.853 3 0.0066666 11470 YJC_B_20141124_01 53.304 39.588 1209200 691400 517810 0 0 243 428 236 568;569 356 356 1 EAVFPFQPGSVAEVCITFDQANLTVK Unmodified 2866.4211 0.42113112 253 P09382 LGALS1 Galectin-1 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 86.811 86.808 3 8.4994E-41 31896 YJC_A_20141124_01 98.015 86.62 11972000 10452000 1024500 495510 0 244 253 237 570;571;572 357;358 357 2 EAVLNGLVATEVLMWFYVGEIIGK Unmodified 2650.408 0.40804724 225 O75964 ATP5L ATP synthase subunit g, mitochondrial yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 94.747 94.691 3 0.00088334 34025 YJC_B_20141124_01 48.5 37.945 5643700 0 2629700 3014000 0 245 225 238 573;574 359 359 1 ECLPLIIFLR Unmodified 1272.7264 0.72641468 341 P62701;A6NH36 RPS4X 40S ribosomal protein S4, X isoform yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 89.333 89.33 2 2.9159E-33 34193 YJC_A_20141124_01 112.11 86.765 1243900 1043200 167620 33086 0 246 341 239 575;576;577 360 360 1 EDSQRPGAHLTVKK Unmodified 1564.8322 0.8321534 255 P09651;F8W6I7;P09651-3;P09651-2;F8W646;F8VZ49;Q32P51;F8VYN5 HNRNPA1;HNRNPA1L2 Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2 yes no 0 0 2 By matching By matching By MS/MS By matching 1 1 29.766 29.84 3 0.003865 3824 YJC_C_20141124_01 64.224 43.436 2318900 0 0 462290 1856600 247 255 240 578;579 361 361 1 EDSVKPGAHLTVKK Unmodified 1507.8358 0.83584179 319 P51991;P51991-2 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 32.008 32.082 3 0.0075609 4533 YJC_D_20141124_01 59.796 44.807 2116600 0 0 439590 1677000 248 319 241 580;581 362 362 1 EDTEEYNLR Unmodified 1167.5044 0.50439647 319 P51991;P51991-2 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 43.111 43.235 2 0.00023882 7623 YJC_D_20141124_01 89.029 74.335 4772400 0 0 852550 3919800 249 319 242 582;583 363;364 364 2 EDVGTVVGIDLGTTYSCVGVFKNGR Unmodified 2642.301 0.30101599 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 1 By matching By matching By matching By MS/MS 1 1 74.93 75.03 3 0.0049613 23186 YJC_D_20141124_01 42.908 29.3 6177700 3790000 0 0 2387700 250 261 243 584;585 365 365 1 EDYDLAKEKK Unmodified 1237.619 0.6190323 221 O60308;Q5SR26;O60308-3 CEP104 Centrosomal protein of 104 kDa yes no 0 0 2 By MS/MS By matching By matching By matching 1 1 1 1 68.967 69.014 2 0.015066 17413 YJC_A_20141124_01 43.635 29.498 2976200 752150 598010 656140 969870 251 221 244 586;587;588;589 366 366 0 EEADEYIDIGALNGIFVLGR Unmodified 2193.0954 0.095363533 323 P53396;P53396-2;B4E3P0 ACLY ATP-citrate synthase yes no 0 0 0 By MS/MS By matching By matching By matching 1 90.235 90.235 2 0.022412 34803 YJC_A_20141124_01 40.968 26.078 778370 778370 0 0 0 252 323 245 590 367 367 1 EEAENTLQSFR Unmodified 1322.6103 0.61025853 251 P08670;B0YJC4;B0YJC5;Q5JVS8 VIM Vimentin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 52.459 52.456 2 1.5139E-40 10068 YJC_A_20141124_01 112.64 84.467 2640100 1899000 681360 59758 0 253 251 246 591;592;593 368 368 1 EEEDEFIVEGLLNISWGLRRPIR Unmodified 2769.445 0.44497811 316 P50749 RASSF2 Ras association domain-containing protein 2 yes yes 0 0 2 By matching By matching By matching By MS/MS 1 1 1 1 77.084 77.131 4 0.011865 25039 YJC_D_20141124_01 32.781 27.983 6095500 2858800 980210 692390 1564100 254 316 247 594;595;596;597 369 369 1 EEFQQYAAALQAGMEIGWLKPVIGSQYPLEK Unmodified 3493.7592 0.75917796 367 Q08257;Q08257-2;Q08257-3 CRYZ Quinone oxidoreductase yes no 0 0 1 By MS/MS By matching By matching By matching 1 91.8 91.8 3 0.00097495 36205 YJC_A_20141124_01 28.789 21.289 1589400 1589400 0 0 0 255 367 248 598 370 370 0 EEIEAQIK Unmodified 958.49713 0.49712625 141 O00233;F5H7X1;F5H5V4;F5GX23;F8W7V8;J3KN29;O00233-2;O00233-3 PSMD9 26S proteasome non-ATPase regulatory subunit 9 yes no 0 0 0 By MS/MS By matching By matching By matching 1 42.137 42.137 2 0.012834 7060 YJC_A_20141124_01 68.224 16.878 191780 191780 0 0 0 256 141 249 599 371 371 1 EELNLTANR Unmodified 1058.5356 0.53563702 228 O95816;B4DXE2 BAG2 BAG family molecular chaperone regulator 2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 46.249 46.249 2 0.0027236 8303 YJC_A_20141124_01 77.533 51.959 973620 973620 0 0 0 257 228 250 600 372 372 1 EELSNVLAAMR Unmodified 1231.6231 0.62307182 431 Q9Y3U8 RPL36 60S ribosomal protein L36 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 71.189 71.189 2 0.0099034 19006 YJC_A_20141124_01 52.247 38.554 483530 483530 0 0 0 258 431 251 601 373 373 1 EESGKPGAHVTVKK Unmodified 1465.7889 0.7888916 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 24.246 24.32 3 0.0095965 3073 YJC_D_20141124_01 58.04 34.923 3134400 0 0 163120 2971200 259 278 252 602;603 374 374 1 EFFNGKEPSR Unmodified 1209.5778 0.57783619 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 1 By matching By MS/MS By matching By matching 1 43.035 43.075 2 0.026594 8286 YJC_B_20141124_01 45.764 22.62 0 0 0 0 0 260 261 253 604 375 375 1 EGEEAGPGDPLLEAVPK Unmodified 1706.8363 0.8362953 202 Q16543;K7EL68 CDC37 Hsp90 co-chaperone Cdc37;Hsp90 co-chaperone Cdc37, N-terminally processed yes no 0 0 0 By MS/MS By matching By matching By matching 1 65.54 65.54 2 0.012489 15120 YJC_A_20141124_01 54.768 34.489 886850 886850 0 0 0 261 202 254 605 376 376 1 EGIPPDQQR Unmodified 1038.5094 0.50942227 29 P0CG47;P62979;P62987;J3QS39;J3QTR3;F5H6Q2;F5GYU3;F5H2Z3;F5H265;B4DV12;F5H388;F5H747;F5GXK7;J3QKN0;Q96C32;F5H041;P0CG48;M0R1V7;F5GZ39;J3QSA3;J3QLP7;J3QRK5;M0R1M6;M0R2S1;K7EMA8 UBB;RPS27A;UBA52;UBC;UBBP4 Polyubiquitin-B;Ubiquitin;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Polyubiquitin-C;Ubiquitin yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 31.92 31.991 2 2.3984E-84 4352 YJC_A_20141124_01 133.99 84.457 29625000 17062000 12563000 0 0 262 29 255 606;607 377;378;379;380;381;382;383;384;385;386 377 10 EGLTGTGTGPSR Unmodified 1131.552 0.55201537 57 P25686;C9JRD2;C9JXB9;P25686-2;C9J1G2;E7ETU0;C9JX00 DNAJB2 DnaJ homolog subfamily B member 2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 35.452 35.452 2 0.010094 5244 YJC_A_20141124_01 51.463 25.418 179970 179970 0 0 0 263 57 256 608 387 387 1 EGMNIVEAMER Unmodified 1277.5744 0.57440707 346 P62937;Q567Q0 PPIA Peptidyl-prolyl cis-trans isomerase A;Peptidyl-prolyl cis-trans isomerase A, N-terminally processed yes no 0 0 0 By MS/MS By matching By matching By matching 1 66.363 66.363 2 0.0098702 15712 YJC_A_20141124_01 53.034 34.898 1027900 1027900 0 0 0 264 346 257 609 388 388 1 EGNDLYHEMIESGVINLK Unmodified 2059.9885 0.98845562 239 P06576;F8VPV9;H0YH81;F8W0P7;F8W079;H0YI37 ATP5B ATP synthase subunit beta, mitochondrial;ATP synthase subunit beta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 75.699 75.719 3 0.02299 22790 YJC_A_20141124_01 54.281 39.118 1186800 1070100 116760 0 0 265 239 258 610;611 389 389 1 EGSGSSGTGEQK Unmodified 1122.4789 0.47891001 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 0 By matching By matching By matching By MS/MS 1 16.749 16.748 2 0.025967 2036 YJC_D_20141124_01 43.798 11.067 3463400 0 0 0 3463400 266 307 259 612 390 390 1 EGTIGDMAILGITESFQVK Unmodified 2008.0187 0.018693117 351 P78371;P78371-2 CCT2 T-complex protein 1 subunit beta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 88.953 88.923 3 0.020444 33645 YJC_A_20141124_01 53.255 39.742 899430 593990 305440 0 0 267 351 260 613;614 391 391 1 EHALLAYTLGVK Unmodified 1313.7343 0.73433683 348 P68104;Q5VTE0;Q05639 EEF1A1;EEF1A1P5;EEF1A2 Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2 yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 62.648 62.644 3 0.0038491 13681 YJC_A_20141124_01 49.081 40.681 6138500 4794000 1017000 327550 0 268 348 261 615;616;617 392;393;394 392 2 EHKATTIQKHVR Unmodified 1446.8055 0.80554471 417 Q9H6Y6 MYO5B Unconventional myosin-Vb yes yes 0 0 2 By MS/MS By matching By matching By matching 1 1 33.396 33.466 3 0.01643 4773 YJC_A_20141124_01 52.247 37.801 337470 115350 222120 0 0 269 417 262 618;619 395 395 1 EIIDLVLDR Unmodified 1084.6128 0.61282471 349;150 Q9BQE3;F5H5D3;F8VVB9;F8VQQ4;F8VRZ4;F8VS66;P68363 TUBA1C;KLK9;TUBA1A;TUBA1B Tubulin alpha-1C chain;Tubulin alpha-1B chain no no 0 0 0 By matching By MS/MS By MS/MS By matching 1 1 1 73.082 73.078 2 2.0502E-05 19265 YJC_B_20141124_01 92.239 53.936 9034900 7002400 1490400 542090 0 270 150;349 263 620;621;622 396;397 396 2 EILGTAQSVGCNVDGR Unmodified 1674.7995 0.79953264 293 P30050;P30050-2 RPL12 60S ribosomal protein L12 yes no 0 0 0 By MS/MS By matching By matching By matching 1 52.129 52.129 2 0.0034111 9926 YJC_A_20141124_01 66.939 35.724 682060 682060 0 0 0 271 293 264 623 398 398 1 EILVGDVGQTVDDPYATFVK Unmodified 2165.0892 0.089215523 281 P23528;G3V1A4;E9PP50;E9PK25;E9PQB7;E9PLJ3;E9PS23 CFL1 Cofilin-1 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 2 2 1 74.42 74.426 2;3 2.7283E-92 20265 YJC_B_20141124_01 118.19 106.64 7360000 5894200 1206100 259780 0 272 281 265 624;625;626;627;628 399;400;401;402 402 4 EIQTAVRLLLPGELAK Unmodified 1750.0353 0.035269879 280 P33778;Q99880;Q93079;Q16778;Q99879;Q99877;Q5QNW6;P58876;P62807;P23527;Q96A08;U3KQK0;Q5QNW6-2;O60814;P57053;P06899;B4DR52 HIST1H2BB;HIST1H2BL;HIST1H2BH;HIST2H2BE;HIST1H2BM;HIST1H2BN;HIST2H2BF;HIST1H2BD;HIST1H2BC;HIST1H2BO;HIST1H2BA;HIST1H2BK;H2BFS;HIST1H2BJ Histone H2B type 1-B;Histone H2B type 1-L;Histone H2B type 1-H;Histone H2B type 2-E;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 2-F;Histone H2B type 1-D;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-O;Histone H2B type 1-A;Histone H2B;Histone H2B type 1-K;Histone H2B type F-S;Histone H2B type 1-J yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 72.261 72.361 3 1.493E-09 20900 YJC_D_20141124_01 87.863 84.091 1942400 123810 0 0 1818600 273 280 266 629;630 403 403 1 EITALAPSTMK Oxidation (M) 1176.606 0.60602477 327 P60709;P63261;P63267;P68133;P62736;P68032;Q5T8M8;A6NL76;Q5T8M7;P63267-2 ACTB;ACTG1;ACTG2;ACTA1;ACTA2;ACTC1 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed;Actin, gamma-enteric smooth muscle;Actin, alpha skeletal muscle;Actin, aortic smooth muscle;Actin, alpha cardiac muscle 1 yes no 0 1 0 By MS/MS By matching By matching By matching 1 45.143 45.143 2 9.7891E-05 7999 YJC_A_20141124_01 79.23 34.477 1226400 1226400 0 0 0 274 327 267 631 404 404 41 1 EITALAPSTMK Unmodified 1160.6111 0.61111015 327 P60709;P63261;P63267;P68133;P62736;P68032;Q5T8M8;A6NL76;Q5T8M7;P63267-2 ACTB;ACTG1;ACTG2;ACTA1;ACTA2;ACTC1 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed;Actin, gamma-enteric smooth muscle;Actin, alpha skeletal muscle;Actin, aortic smooth muscle;Actin, alpha cardiac muscle 1 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 52.076 52.096 2 2.3457E-05 9916 YJC_A_20141124_01 81.525 47.138 3382800 2648200 734680 0 0 275 327 267 632;633 405;406 405 2 EIVHLQAGQCGNQIGAK Unmodified 1821.9156 0.91556545 350 P68371;P04350;M0R042;M0R2D3;M0QYM7;M0QY85;M0QZL7;M0R278;M0R0X0;M0R2T4;M0QY37;M0QX14 TUBB4B;TUBB4A Tubulin beta-4B chain;Tubulin beta-4A chain yes no 0 0 0 By MS/MS By matching By matching By matching 2 1 46.727 46.743 2;3 1.7044E-83 8428 YJC_A_20141124_01 120.21 90.85 4993000 4618000 0 375000 0 276 350 268 634;635;636 407;408 407 2 EIVTNFLAGFEA Unmodified 1309.6554 0.65541781 284 P25705;P25705-2;P25705-3 ATP5A1 ATP synthase subunit alpha, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 88.712 88.708 2 0.0063727 33320 YJC_A_20141124_01 60.157 47.149 1967100 1433000 334700 199470 0 277 284 269 637;638;639 409 409 1 EKAQAEQEEQER Unmodified 1473.6696 0.66956432 385 Q3KQU3;Q3KQU3-2;Q3KQU3-4;Q3KQU3-3;H0YF21 MAP7D1 MAP7 domain-containing protein 1 yes no 0 0 1 By matching By matching By matching By MS/MS 1 24.935 25.035 3 1.1877E-84 3197 YJC_D_20141124_01 129.74 98.02 548190 0 0 0 548190 278 385 270 640 410 410 1 ELEEIVQPIISK Unmodified 1396.7813 0.7813466 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 65.234 65.314 2 7.5493E-54 15100 YJC_A_20141124_01 119.25 96.162 4199900 2075500 1029900 0 1094500 279 261 271 641;642;643 411 411 1 ELEFLSMANVELSSLAR Unmodified 1907.9663 0.96626362 125 Q9BTT0;Q5TB19;E9PLC4;Q9BTT0-2 ANP32E Acidic leucine-rich nuclear phosphoprotein 32 family member E yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 91.415 91.385 2 2.5504E-51 35796 YJC_A_20141124_01 105.9 65.884 941350 777280 164060 0 0 280 125 272 644;645 412;413 413 2 ELEFYLR Unmodified 968.49673 0.49673232 333 P62241;Q5JR95 RPS8 40S ribosomal protein S8 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 66.314 66.335 2 0.024878 15788 YJC_A_20141124_01 69.998 25.306 857550 615060 242480 0 0 281 333 273 646;647 414 414 0 ELGYLNKMDLPYRCMVR Oxidation (M) 2173.0482 0.048235881 408 Q96CG3 TIFA TRAF-interacting protein with FHA domain-containing protein A yes yes 0 1 2 By matching By MS/MS By matching By matching 1 1 1 66.128 66.191 3 0.0045283 15184 YJC_B_20141124_01 57.414 57.414 157880000 0 35320000 43130000 79427000 282 408 274 648;649;650 415 415 57 1 ELISNASDALDK Unmodified 1274.6354 0.63541065 250;269 P08238;Q5T9W8;P14625;F8W026 HSP90AB1;HSP90B1 Heat shock protein HSP 90-beta;Endoplasmin no no 0 0 0 By MS/MS By matching By matching By matching 1 1 52.223 52.243 2 9.6112E-290 9979 YJC_A_20141124_01 171.62 130.45 2480200 2002400 477790 0 0 283 250;269 275 651;652 416 416 1 ELPPGVEELLNK Unmodified 1336.7238 0.72383172 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 73.594 73.668 2 0.015693 22047 YJC_D_20141124_01 47.062 20.355 2235000 0 0 546190 1688800 284 375 276 653;654 417 417 1 ELSDFISYLQR Unmodified 1369.6878 0.68778057 166 P30101;G5EA52 PDIA3 Protein disulfide-isomerase A3 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 78.57 78.566 2 3.8913E-15 25373 YJC_A_20141124_01 95.618 66.085 1355500 997330 282160 76036 0 285 166 277 655;656;657 418 418 1 EMEENFAVEAANYQDTIGR Unmodified 2185.9586 0.95861206 251 P08670;B0YJC4;B0YJC5 VIM Vimentin yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 68.59 68.611 2 0.021458 16518 YJC_B_20141124_01 42.123 24.228 1370600 1119900 250690 0 0 286 251 278 658;659 419 419 1 ENAGEDPGLAR Unmodified 1127.5207 0.52071524 352 P81605;P81605-2 DCD Dermcidin;Survival-promoting peptide;DCD-1 yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 1 35.507 35.579 2 2.0342E-07 6435 YJC_B_20141124_01 88.803 59.74 19473000 3328400 9266500 4330400 2547300 287 352 279 660;661;662;663 420;421;422 421 3 ENQGVARVETSIMDAK Unmodified 1746.857 0.85704752 389 Q5JV73 FRMPD3 FERM and PDZ domain-containing protein 3 yes yes 0 0 1 By MS/MS By matching By matching By matching 1 42.645 42.645 4 0.0075179 7242 YJC_A_20141124_01 43.305 34.023 382070 382070 0 0 0 288 389 280 664 423 423 1 EPQVYVLAPPQEELSK Unmodified 1825.9462 0.9461801 65;64 CON__ENSEMBL:ENSBTAP00000024466;CON__ENSEMBL:ENSBTAP00000024462 no no 0 0 0 By matching By matching By MS/MS By matching 2 2 64.176 64.25 2;3 0.0095794 11620 YJC_C_20141124_01 69.431 48.465 30914000 0 0 11232000 19682000 + 289 65;64 281 665;666;667;668 424;425 425 2 EQCEQLEK Unmodified 1062.4652 0.4651742 248 P07919 UQCRH Cytochrome b-c1 complex subunit 6, mitochondrial yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 30.411 30.46 2 1.2604E-06 4098 YJC_A_20141124_01 95.502 60.206 255350 163880 0 0 91477 290 248 282 669;670 426 426 1 EQQIVIQSSGGLSK Unmodified 1472.7835 0.78347187 307 P38646;H0Y8S0 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 1 1 48.87 48.942 2 4.8637E-155 9183 YJC_D_20141124_01 118.71 73.351 3618000 636930 370250 500870 2109900 291 307 283 671;672;673;674 427 427 0 EQVANSAFVER Unmodified 1248.6099 0.6098646 250 P08238;Q58FF7 HSP90AB1;HSP90AB3P Heat shock protein HSP 90-beta;Putative heat shock protein HSP 90-beta-3 yes no 0 0 0 By MS/MS By matching By matching By matching 1 45.561 45.561 2 8.5435E-16 8115 YJC_A_20141124_01 99.5 56.192 1004100 1004100 0 0 0 292 250 284 675 428 428 1 ERHPGSFDVVHVK Unmodified 1505.7739 0.77391024 341 P62701;P22090;C9JEH7 RPS4X;RPS4Y1 40S ribosomal protein S4, X isoform;40S ribosomal protein S4, Y isoform 1 yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 42.298 42.368 4 0.018482 8073 YJC_B_20141124_01 37.793 22.456 631540 415680 215860 0 0 293 341 285 676;677 429 429 1 ESDGASDEAEESGSQGK Unmodified 1681.6551 0.65509605 224 O75688;O75688-3 PPM1B Protein phosphatase 1B yes no 0 0 0 By MS/MS By matching By matching By matching 1 27.949 27.949 2 0.020774 3649 YJC_A_20141124_01 45.347 42.379 65927 65927 0 0 0 294 224 286 678 430 430 1 ESEIIDFFLGASLK Unmodified 1567.8134 0.81337501 127 P15880;H3BNG3;E9PPT0;E9PMM9;E9PQD7;I3L404 RPS2 40S ribosomal protein S2 yes no 0 0 0 By MS/MS By matching By MS/MS By matching 1 1 2 92.824 92.833 2 9.1432E-15 36937 YJC_A_20141124_01 90.229 67.086 1646600 1286400 200000 160250 0 295 127 287 679;680;681;682 431;432 431 2 ESGPSLVKPSQTLSLTCTASGFSLSDK Unmodified 2796.3851 0.38513955 66 CON__ENSEMBL:ENSBTAP00000033053 yes yes 0 0 1 By matching By matching By MS/MS By matching 1 1 68.174 68.248 3 6.7769E-05 13978 YJC_C_20141124_01 57.477 42.928 4487100 0 0 1552300 2934800 + 296 66 288 683;684 433 433 1 ESGPSLVKPSQTLSLTCTVSGFSLSDNSVGWVR Unmodified 3494.7351 0.73514805 62 CON__ENSEMBL:ENSBTAP00000011227 yes yes 0 0 1 By matching By matching By matching By MS/MS 1 78.102 78.301 3 0.018647 25969 YJC_D_20141124_01 33.194 23.568 3638300 0 0 0 3638300 + 297 62 289 685 434 434 1 ESIESEIR Unmodified 961.47164 0.47163978 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 0 0 0 By MS/MS By matching By matching By matching 1 46.78 46.78 2 0.0085236 8492 YJC_A_20141124_01 70.816 24.844 1126100 1126100 0 0 0 298 326 290 686 435 435 1 ESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGRR Unmodified 3682.7684 0.76839053 395 Q6PKG0 LARP1 La-related protein 1 yes yes 0 0 2 By MS/MS By matching By matching By matching 1 56.138 56.138 4 0.0039134 11204 YJC_A_20141124_01 25.997 20.231 710900 710900 0 0 0 299 395 291 687 436 436 1 ESTLHLVLR Unmodified 1066.6135 0.61349341 29 P0CG47;P62979;P62987;J3QS39;J3QTR3;F5H6Q2;F5GYU3;F5H2Z3;F5H265;B4DV12;F5H388;F5H747;F5GXK7;J3QKN0;Q96C32;F5H041;P0CG48;J3QLP7;J3QRK5;M0R1M6;M0R2S1;K7EMA8;J3KSM4 UBB;RPS27A;UBA52;UBC;UBBP4 Polyubiquitin-B;Ubiquitin;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Polyubiquitin-C;Ubiquitin yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 54.974 55.044 2 4.8262E-52 11230 YJC_B_20141124_01 123.21 58.497 40836000 15953000 24883000 0 0 300 29 292 688;689 437;438 438 2 ESVSKAGMPVSADAAK Unmodified 1546.7661 0.76610725 103 O95359;E7EMZ9;E9PBC6;O95359-3 TACC2 Transforming acidic coiled-coil-containing protein 2 yes no 0 0 1 By matching By MS/MS By matching By matching 1 60.535 60.575 2 7.6237E-06 12721 YJC_B_20141124_01 67.299 30.852 351790 0 351790 0 0 301 103 293 690 439 439 0 ETDLLLDDSLVSIFGNR Unmodified 1905.9684 0.96837211 291 P30044;P30044-4;P30044-2;P30044-3 PRDX5 Peroxiredoxin-5, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 90.275 90.275 2 0.004071 34898 YJC_A_20141124_01 68.845 46.964 588810 588810 0 0 0 302 291 294 691 440 440 1 ETNLDSLPLVDTHSKR Unmodified 1823.9377 0.93774068 251 P08670 VIM Vimentin yes yes 0 0 1 By matching By matching By matching By MS/MS 1 1 55.034 55.154 4 0.018645 10872 YJC_D_20141124_01 27.133 9.2667 1217200 0 564580 0 652660 303 251 295 692;693 441 441 1 ETSGNLEQLLLAVVK Unmodified 1612.9036 0.903587 90 P08758;D6RBE9;D6RBL5 ANXA5 Annexin A5;Annexin yes no 0 0 0 By MS/MS By matching By matching By matching 2 1 1 91.526 91.523 2;3 0.0024568 35829 YJC_A_20141124_01 75.998 38.646 3606500 2811300 555250 239930 0 304 90 296 694;695;696;697 442;443 442 2 ETYGDMADCCEK Oxidation (M) 1493.5109 0.51088012 72 CON__P02769 yes yes 0 1 0 By matching By matching By matching By MS/MS 1 33.874 33.973 2 0.025895 4995 YJC_D_20141124_01 46.378 31.932 99378 0 0 0 99378 + 305 72 297 698 444 444 3 1 EVAEATCNCLLAQAEQADKK Unmodified 2248.0464 0.046381205 393 Q6MZP7;Q6MZP7-4;Q6MZP7-3;Q6MZP7-2 LIN54 Protein lin-54 homolog yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 1 1 64.981 65.028 4 0.0095686 14447 YJC_B_20141124_01 58.246 35.22 204720000 59587000 36749000 52576000 55810000 306 393 298 699;700;701;702 445;446 446 0 EVDEQMLNVQNK Unmodified 1445.682 0.68204326 245;350 P68371;P07437;Q5JP53;Q5ST81;Q9BVA1;Q13885 TUBB4B;TUBB;TUBB2B;TUBB2A Tubulin beta-4B chain;Tubulin beta chain;Tubulin beta-2B chain;Tubulin beta-2A chain no no 0 0 0 By MS/MS By matching By matching By matching 1 1 50.335 50.355 2 1.2729E-85 9462 YJC_A_20141124_01 131.17 88.455 628830 458480 170350 0 0 307 350;245 299 703;704 447 447 1 EVPNYKLITPAVVSER Unmodified 1813.9938 0.993799 343 P62851 RPS25 40S ribosomal protein S25 yes yes 0 0 1 By matching By matching By matching By MS/MS 1 1 1 61.712 61.792 3 3.816E-05 13274 YJC_D_20141124_01 80.102 51.956 1697700 621990 152100 0 923620 308 343 300 705;706;707 448 448 1 EVVDPTKCNLLAEK Unmodified 1614.8287 0.8287075 75 CON__P12763 yes yes 0 0 1 By MS/MS By matching By matching By matching 1 1 53.852 53.922 3 0.010092 10499 YJC_A_20141124_01 39.394 29.595 840120 488650 351470 0 0 + 309 75 301 708;709 449 449 0 EVVEAVTIVETPPMVVVGIVGYVETPR Unmodified 2881.5511 0.55108266 37 P39023;H7C422;F8WCR1;H7C3M2;B5MCW2;G5E9G0 RPL3 60S ribosomal protein L3 yes no 0 0 0 By matching By matching By MS/MS By matching 1 1 1 94.489 94.451 3 0.013545 32320 YJC_C_20141124_01 37.118 23.474 20342000 14480000 3101600 2759900 0 310 37 302 710;711;712 450 450 1 EVYQQQQYGSGGR Unmodified 1498.6801 0.68006943 87 Q99729-3;D6R9P3;D6RD18;D6RBZ0;Q99729-2;Q99729;Q99729-4 HNRNPAB Heterogeneous nuclear ribonucleoprotein A/B yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 37.706 37.78 2 0 5910 YJC_D_20141124_01 179.65 161.98 2744300 0 0 505160 2239100 311 87 303 713;714 451;452 452 2 EVYQQQQYGSGGRGNR Unmodified 1825.8456 0.84557163 87 Q99729-3;D6R9P3;D6RD18;D6RBZ0;Q99729-2;Q99729;Q99729-4 HNRNPAB Heterogeneous nuclear ribonucleoprotein A/B yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 1 34.588 34.637 3 0.0029033 5147 YJC_D_20141124_01 77.279 54.93 12989000 129390 0 931460 11928000 312 87 304 715;716;717 453 453 1 FAAATGATPIAGR Unmodified 1202.6408 0.6407708 50 P08865;C9J9K3;A6NE09 RPSA;RPSAP58 40S ribosomal protein SA yes no 0 0 0 By MS/MS By matching By matching By matching 1 46.015 46.015 2 0.00037598 8222 YJC_A_20141124_01 78.814 57.775 773250 773250 0 0 0 313 50 305 718 454 454 1 FAAYFQQGDMESNGK Unmodified 1691.725 0.72497071 203 P06744;P06744-2;K7EQ48;CON__Q3ZBD7 GPI Glucose-6-phosphate isomerase yes no 0 0 0 By MS/MS By matching By matching By matching 1 57.552 57.552 2 0.0031312 11620 YJC_A_20141124_01 74.966 49.518 497710 497710 0 0 0 + 314 203 306 719 455 455 1 FADDTYTESYISTIGVDFK Unmodified 2170.9946 0.99464644 43 P62820;Q9H0U4;E7ETK2;E9PLD0;B7Z8M7;P62820-3 RAB1A;RAB1B Ras-related protein Rab-1A;Ras-related protein Rab-1B yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 77.924 77.944 2 0.01065 24825 YJC_A_20141124_01 51.524 38.635 1423000 1218800 204220 0 0 315 43 307 720;721 456 456 1 FAEAFEAIPR Unmodified 1149.5819 0.58185893 317 P50990;P50990-3;P50990-2 CCT8 T-complex protein 1 subunit theta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 62.917 62.938 2 0.0036583 13687 YJC_A_20141124_01 68.786 44.696 1091300 809870 281480 0 0 316 317 308 722;723 457 457 1 FAEEDKK Unmodified 865.41815 0.41814765 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 1 By matching By matching By matching By MS/MS 1 23.653 23.752 2 0.024788 2993 YJC_D_20141124_01 84.916 13.62 204640 0 0 0 204640 317 261 309 724 458 458 1 FASENDLPEWK Unmodified 1334.6143 0.61428128 52 P43487;C9JJ34;C9JDM3;C9JIC6;C9JXG8;C9JGV6 RANBP1 Ran-specific GTPase-activating protein yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 60.909 60.929 2 0.0038457 12777 YJC_A_20141124_01 63.473 42.465 1879100 1341300 537740 0 0 318 52 310 725;726 459 459 1 FDASFFGVHPK Unmodified 1250.6084 0.60840804 313 P49327 FASN Fatty acid synthase;[Acyl-carrier-protein] S-acetyltransferase;[Acyl-carrier-protein] S-malonyltransferase;3-oxoacyl-[acyl-carrier-protein] synthase;3-oxoacyl-[acyl-carrier-protein] reductase;3-hydroxyacyl-[acyl-carrier-protein] dehydratase;Enoyl-[acyl-carrier-protein] reductase;Oleoyl-[acyl-carrier-protein] hydrolase yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 64.493 64.513 3 0.0071923 14467 YJC_A_20141124_01 63.624 40.48 561050 370510 190550 0 0 319 313 311 727;728 460 460 1 FDDGAGGDNEVQR Unmodified 1378.5749 0.57493566 303 P35998;B7Z5E2 PSMC2 26S protease regulatory subunit 7 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 37.555 37.625 2 0.0078212 5778 YJC_A_20141124_01 55.724 43.148 357190 212020 145170 0 0 320 303 312 729;730 461 461 1 FDFVHDLVLYLYR Unmodified 1698.877 0.87697832 354 Q00610;Q00610-2 CLTC Clathrin heavy chain 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 94.353 94.323 3 0.0020958 38061 YJC_A_20141124_01 77.062 41.406 1148000 673010 475020 0 0 321 354 313 731;732 462 462 1 FDGALNVDLTEFQTNLVPYPR Unmodified 2408.2012 0.20122559 349;150 Q9BQE3;F5H5D3;F8VVB9;C9JDS9;P68363;P68366;A8MUB1 TUBA1C;KLK9;TUBA4A;TUBA1B Tubulin alpha-1C chain;Tubulin alpha-1B chain;Tubulin alpha-4A chain no no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 84.291 84.321 2 5.2805E-05 29776 YJC_A_20141124_01 68.676 48.548 8934800 6663900 1864200 406690 0 322 150;349 314 733;734;735 463;464 463 2 FEDENFILK Unmodified 1153.5655 0.56554017 346 P62937;F8WE65;C9J5S7;Q567Q0 PPIA Peptidyl-prolyl cis-trans isomerase A;Peptidyl-prolyl cis-trans isomerase A, N-terminally processed;Peptidyl-prolyl cis-trans isomerase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 63.73 63.777 2 3.5098E-173 14074 YJC_A_20141124_01 154.01 97.753 6828400 4502700 1641400 264390 419930 323 346 315 736;737;738;739 465 465 1 FEELNMDLFR Unmodified 1312.6122 0.61217279 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 76.21 76.23 2 0.012796 23212 YJC_A_20141124_01 61.344 42.387 1343300 987410 355930 0 0 324 261 316 740;741 466;467 467 2 FEELNMDLFRSTMKPVQK Unmodified 2212.102 0.10204559 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 2 By matching By matching By matching By MS/MS 1 87.125 87.425 3 0.021663 33521 YJC_D_20141124_01 45.084 2.5042 0 0 0 0 0 325 261 317 742 468 468 1 FEGGVVIAADMLGSYGSLAR Unmodified 2012.0037 0.0037117545 289 P28070 PSMB4 Proteasome subunit beta type-4 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 85.264 85.284 2 0.00015189 30644 YJC_A_20141124_01 64.761 44.174 1245600 1085500 160060 0 0 326 289 318 743;744 469 469 1 FEVGDIMLIR Unmodified 1191.6322 0.63217995 164 P00491;G3V393;G3V5M2 PNP Purine nucleoside phosphorylase yes no 0 0 0 By MS/MS By matching By matching By matching 1 78.249 78.249 2 0.016993 25027 YJC_A_20141124_01 52.167 27.291 504800 504800 0 0 0 327 164 319 745 470 470 1 FFEVILIDPFHK Unmodified 1503.8126 0.81258715 108 P61313;E7EQV9;E7ENU7 RPL15 60S ribosomal protein L15;Ribosomal protein L15 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 84.247 84.267 3 0.00077353 29812 YJC_A_20141124_01 75.819 56.72 2402200 1961900 440310 0 0 328 108 320 746;747 471 471 1 FFHLAFEEEFGR Unmodified 1527.7147 0.71466402 372 Q13347 EIF3I Eukaryotic translation initiation factor 3 subunit I yes yes 0 0 0 By MS/MS By matching By matching By matching 1 74.665 74.665 3 0.0077202 21850 YJC_A_20141124_01 44.847 25.748 680920 680920 0 0 0 329 372 321 748 472 472 0 FFLEEIQLGEELLAQGEYEK Unmodified 2384.1788 0.17875881 380 Q15388 TOMM20 Mitochondrial import receptor subunit TOM20 homolog yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 94.45 94.419 3 0.016393 33684 YJC_B_20141124_01 51.166 34.135 1764500 0 1306500 0 458010 330 380 322 749;750 473 473 1 FFVAPFPEVFGK Unmodified 1383.7227 0.72270951 69 CON__P02662 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 2 1 1 83.686 83.772 2 0.00049762 29369 YJC_A_20141124_01 74.611 61.98 6912100 4507800 1002600 888550 513080 + 331 69 323 751;752;753;754;755 474;475;476;477 474 4 FGANAILGVSLAVCK Unmodified 1518.8228 0.82283426 242 P06733;P06733-2;K7EM90;P13929;P09104;E5RI09;E5RG95;K7EPM1;K7EKN2;E5RGZ4;P13929-3;B7Z2X9;P13929-2 ENO1;ENO3;ENO2 Alpha-enolase;Enolase;Beta-enolase;Gamma-enolase yes no 0 0 0 By MS/MS By matching By matching By matching 1 74.797 74.797 2 0.017532 21996 YJC_A_20141124_01 49.223 22.691 516020 516020 0 0 0 332 242 324 756 478 478 1 FGFIVIDGSGALFGTLQGNTR Unmodified 2169.1219 0.12185306 42 P62495;I3L492;B7Z7P8;Q96CG1 ETF1 Eukaryotic peptide chain release factor subunit 1 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 88.73 88.7 2 0.0049872 33435 YJC_A_20141124_01 59.618 46.344 1115100 710140 404970 0 0 333 42 325 757;758 479;480 479 2 FGGSGSQVDSAR Unmodified 1166.5316 0.53161428 370 Q13200;E9PCS3;E7EW34 PSMD2 26S proteasome non-ATPase regulatory subunit 2 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 34.744 34.814 2 2.1511E-05 6333 YJC_B_20141124_01 80.905 59.873 199620 105070 94549 0 0 334 370 326 759;760 481 481 1 FGLALAVAGGVVNSALYNVDAGHR Unmodified 2370.2444 0.24442781 58 P35232;D6RBK0;C9JZ20;E7ESE2;E9PCW0;C9JW96;P35232-2 PHB Prohibitin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 87.927 87.897 3 0.0034668 32625 YJC_A_20141124_01 43.696 31.73 2568500 1416600 1151900 0 0 335 58 327 761;762 482 482 1 FGVESDKR Unmodified 936.46649 0.46649483 95 Q15154;E5RGQ4;E9PGW9;E7EV93;E7EV56;E7ETA6;Q15154-3;Q15154-2 PCM1 Pericentriolar material 1 protein yes no 0 0 1 By MS/MS By matching By matching By matching 1 32.447 32.447 3 0.004932 4510 YJC_A_20141124_01 77.282 48.112 395740 395740 0 0 0 336 95 328 763 483 483 1 FGYVDFESAEDLEK Unmodified 1647.7304 0.73043325 275 P19338 NCL Nucleolin yes yes 0 0 0 By MS/MS By matching By matching By matching 1 70.312 70.312 2 0.0038013 18402 YJC_A_20141124_01 67.326 43.392 1359200 1359200 0 0 0 337 275 329 764 484 484 1 FHDLLSQLDDQYSR Unmodified 1735.8166 0.81656291 191 P42224;J3KPM9;P42224-2;E7ENM1;E7EPD2;D2KFR9 STAT1 Signal transducer and activator of transcription 1-alpha/beta;Signal transducer and activator of transcription yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 68.086 68.106 3 0.0069718 16820 YJC_A_20141124_01 61.657 50.425 1390600 1169200 221420 0 0 338 191 330 765;766 485 485 1 FHHTFSTEIAK Unmodified 1316.6513 0.65133548 266 P13667 PDIA4 Protein disulfide-isomerase A4 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 42.615 42.615 3 0.01722 7214 YJC_A_20141124_01 60.641 46.832 413220 413220 0 0 0 339 266 331 767 486 486 1 FHPIQGHR Unmodified 990.51478 0.51478242 369 Q13151 HNRNPA0 Heterogeneous nuclear ribonucleoprotein A0 yes yes 0 0 0 By matching By matching By MS/MS By matching 1 1 1 29.429 29.478 3 0.024649 3760 YJC_C_20141124_01 42.914 22.215 197140 47466 0 39853 109820 340 369 332 768;769;770 487 487 0 FHVEEEGKGK Unmodified 1158.5669 0.56693715 41 P00558;B7Z7A9 PGK1 Phosphoglycerate kinase 1 yes no 0 0 1 By matching By MS/MS By matching By matching 1 30.05 30.19 3 0.018994 5464 YJC_B_20141124_01 62.463 33.507 0 0 0 0 0 341 41 333 771 488 488 1 FIAVGYVDDTQFVR Unmodified 1628.8199 0.81985737 231 P01892;P30455;P04439;P18462;P16189;P05534;Q5SRN7;Q5SRN5;Q29960-2;Q29940;P30685;P30498;P30495;P30493;P30492;P30491;P30490;P30484;P30464;P18465;P18464;P10319;P30512;P30459;P30457;P30456;P30453;P30450;P30447;P30443;P16190;P16188;P13746;P10316;P10314;P01891;Q29960;P30510;P30508;P30504;P13746-2;Q95604 HLA-A;HLA-C;HLA-B HLA class I histocompatibility antigen, A-2 alpha chain;HLA class I histocompatibility antigen, A-36 alpha chain;HLA class I histocompatibility antigen, A-3 alpha chain;HLA class I histocompatibility antigen, A-25 alpha chain;HLA class I histocompatibility antigen, A-31 alpha chain;HLA class I histocompatibility antigen, A-24 alpha chain;HLA class I histocompatibility antigen, Cw-16 alpha chain;HLA class I histocompatibility antigen, B-59 alpha chain;HLA class I histocompatibility antigen, B-35 alpha chain;HLA class I histocompatibility antigen, B-78 alpha chain;HLA class I histocompatibility antigen, B-56 alpha chain;HLA class I histocompatibility antigen, B-55 alpha chain;HLA class I histocompatibility antigen, B-54 alpha chain;HLA class I histocompatibility antigen, B-53 alpha chain;HLA class I histocompatibility antigen, B-52 alpha chain;HLA class I histocompatibility antigen, B-46 alpha chain;HLA class I histocompatibility antigen, B-15 alpha chain;HLA class I histocompatibility antigen, B-57 alpha chain;HLA class I histocompatibility antigen, B-51 alpha chain;HLA class I histocompatibility antigen, B-58 alpha chain;HLA class I histocompatibility antigen, A-29 alpha chain;HLA class I histocompatibility antigen, A-74 alpha chain;HLA class I histocompatibility antigen, A-66 alpha chain;HLA class I histocompatibility antigen, A-43 alpha chain;HLA class I histocompatibility antigen, A-34 alpha chain;HLA class I histocompatibility antigen, A-26 alpha chain;HLA class I histocompatibility antigen, A-23 alpha chain;HLA class I histocompatibility antigen, A-1 alpha chain;HLA class I histocompatibility antigen, A-33 alpha chain;HLA class I histocompatibility antigen, A-30 alpha chain;HLA class I histocompatibility antigen, A-11 alpha chain;HLA class I histocompatibility antigen, A-69 alpha chain;HLA class I histocompatibility antigen, A-32 alpha chain;HLA class I histocompatibility antigen, A-68 alpha chain;HLA class I histocompatibility antigen, Cw-14 alpha chain;HLA class I histocompatibility antigen, Cw-12 alpha chain;HLA class I histocompatibility antigen, Cw-4 alpha chain;HLA class I histocompatibility antigen, Cw-17 alpha chain yes no 0 0 0 By MS/MS By matching By matching By matching 1 70.049 70.049 2 0.0042579 18090 YJC_A_20141124_01 68.262 47.522 597900 597900 0 0 0 342 231 334 772 489 489 1 FIGAGAATVGVAGSGAGIGTVFGSLIIGYAR Unmodified 2809.5127 0.51266374 85 Q06055-2;P05496;Q06055-3;D6R9H7;E7EQ97;E7EPU7;Q06055;P48201 ATP5G2;ATP5G1;ATP5G3 ATP synthase F(0) complex subunit C2, mitochondrial;ATP synthase F(0) complex subunit C1, mitochondrial;ATP synthase F(0) complex subunit C3, mitochondrial yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 94.427 94.407 3 7.0168E-20 38204 YJC_A_20141124_01 70.771 54.603 34033000 26749000 4635800 0 2648000 343 85 335 773;774;775 490;491 490 2 FIIPNVVK Unmodified 928.57459 0.57458871 229 P00338;P00338-3;P00338-2;P00338-5;F5GYU2;F5GXY2 LDHA L-lactate dehydrogenase A chain yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 65.476 65.496 2 0.0243 14818 YJC_B_20141124_01 46.426 2.618 3457800 2976000 481790 0 0 344 229 336 776;777 492 492 0 FIIPQIVK Unmodified 956.60589 0.60588884 9 P07195;A8MW50;C9J7H8 LDHB L-lactate dehydrogenase B chain;L-lactate dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 69.691 69.687 2 0.022094 17822 YJC_A_20141124_01 62.659 34.44 3258800 2700800 414350 143670 0 345 9 337 778;779;780 493 493 1 FLAVIVEASGGGAFLVLPLSK Unmodified 2087.2031 0.20306349 112 Q9BR76;F5H0D2;F5H390;E7EW44 CORO1B Coronin-1B;Coronin yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 91.846 91.816 3 0.014561 31957 YJC_B_20141124_01 45.844 30.682 853070 680110 172960 0 0 346 112 338 781;782 494 494 1 FLDGIYVSEK Unmodified 1169.5968 0.5968403 89 P32969;D6RAN4;H0Y9V9;H0Y9R4 RPL9 60S ribosomal protein L9 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 62.5 62.52 2 0.024596 13490 YJC_A_20141124_01 45.829 21.799 1104500 857060 247420 0 0 347 89 339 783;784 495 495 0 FLETVELQISLK Unmodified 1418.8021 0.80208205 344 P62906 RPL10A 60S ribosomal protein L10a yes yes 0 0 0 By MS/MS By matching By matching By matching 1 74.206 74.206 2 0.012379 21352 YJC_A_20141124_01 48.115 22.666 703670 703670 0 0 0 348 344 340 785 496 496 1 FMNAVFFLLPK Unmodified 1325.7206 0.72060102 111 P78527;E7EUY0;P78527-2 PRKDC DNA-dependent protein kinase catalytic subunit yes no 0 0 0 By MS/MS By matching By matching By matching 1 90.499 90.499 2 0.0029374 34986 YJC_A_20141124_01 64.374 39.864 316980 316980 0 0 0 349 111 341 786 497 497 1 FNASQLITQR Unmodified 1176.6251 0.62512073 138 Q99623;F5H3X6;F5GWA7;F5GY37;J3KPX7;Q99623-2 PHB2 Prohibitin-2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 59.351 59.351 2 0.0011121 12220 YJC_A_20141124_01 67.214 40.521 507830 507830 0 0 0 350 138 342 787 498 498 0 FNQAQSGNIQSTVMLDK Unmodified 1879.9098 0.90981137 191 P42224;J3KPM9;P42224-2;E7ENM1;E7EPD2;D2KFR9 STAT1 Signal transducer and activator of transcription 1-alpha/beta;Signal transducer and activator of transcription yes no 0 0 0 By MS/MS By matching By matching By matching 1 56.572 56.572 2 0.007559 11330 YJC_A_20141124_01 60.062 29.887 295550 295550 0 0 0 351 191 343 788 499 499 1 FNQAQSGNIQSTVMLDK Oxidation (M) 1895.9047 0.90472599 191 P42224;J3KPM9;P42224-2;E7ENM1;E7EPD2;D2KFR9 STAT1 Signal transducer and activator of transcription 1-alpha/beta;Signal transducer and activator of transcription yes no 0 1 0 By MS/MS By matching By matching By matching 1 52.443 52.443 2 1.0653E-74 10071 YJC_A_20141124_01 113.81 79.545 0 0 0 0 0 352 191 343 789 500 500 14 1 FQDGDLTLYQSNTILR Unmodified 1882.9425 0.94249171 252 P09211;A8MX94 GSTP1 Glutathione S-transferase P yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 69.245 69.266 2 0.010613 17537 YJC_A_20141124_01 56.039 39.866 1919900 1715300 204640 0 0 353 252 344 790;791 501 501 1 FQSSHHPTDITSLDQYVER Unmodified 2259.0556 0.055623984 269 P14625 HSP90B1 Endoplasmin yes yes 0 0 0 By MS/MS By matching By matching By matching 1 58.457 58.457 3 3.4094E-08 11930 YJC_A_20141124_01 84.436 67.512 838680 838680 0 0 0 354 269 345 792 502;503 503 2 FSDDAFNTTFISTIGIDFK Unmodified 2138.0208 0.020801607 330 P61026 RAB10 Ras-related protein Rab-10 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 88.418 88.418 2 0.015716 33251 YJC_A_20141124_01 44.788 4.3564 632430 632430 0 0 0 355 330 346 793 504 504 1 FSGSGSGTDFTLK Unmodified 1302.6092 0.6091959 230 P01617;P01614;P06309;P06310 Ig kappa chain V-II region TEW;Ig kappa chain V-II region Cum;Ig kappa chain V-II region GM607;Ig kappa chain V-II region RPMI 6410 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 53.89 53.96 2 0.0037024 10968 YJC_B_20141124_01 66.215 23.351 1899400 668460 1231000 0 0 356 230 347 794;795 505 505 1 FSHEEIAMATVTALR Unmodified 1674.8399 0.83994089 183 P04075;H3BQN4;J3KPS3;P04075-2;H3BU78;H3BR68 ALDOA Fructose-bisphosphate aldolase A yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 65.66 65.68 3 0.0036166 15277 YJC_A_20141124_01 55.176 55.176 2284100 1857200 426930 0 0 357 183 348 796;797 506 506 0 FSSCGGGGGSFGAGGGFGSR Unmodified 1764.7274 0.72743033 73 CON__P04264;P04264 KRT1 Keratin, type II cytoskeletal 1 yes no 0 0 0 By matching By MS/MS By MS/MS By matching 1 1 1 53.29 53.353 2 3.0992E-75 8404 YJC_C_20141124_01 115.88 97.489 2146900 0 1506800 441590 198520 + 358 73 349 798;799;800 507;508 508 2 FSSSGGGGGGGRFSSSSGYGGGSSR Unmodified 2197.9373 0.93729976 301 P35527 KRT9 Keratin, type I cytoskeletal 9 yes yes 0 0 1 By matching By matching By MS/MS By matching 1 1 1 1 40.328 40.426 3 0.0089886 5588 YJC_C_20141124_01 42.254 34.773 1550500 244320 433020 518170 355030 + 359 301 350 801;802;803;804 509 509 1 FSSSSGYGGGSSR Unmodified 1234.5214 0.52144352 301 P35527;CON__P35527 KRT9 Keratin, type I cytoskeletal 9 yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 1 34.449 34.521 2 0.0016511 6262 YJC_B_20141124_01 75.483 45.091 1448500 129640 922440 198580 197800 + 360 301 351 805;806;807;808 510;511;512 511 3 FSWFVDDVEVNTATTKPR Unmodified 2111.0324 0.032369346 65;64 CON__ENSEMBL:ENSBTAP00000024466;CON__ENSEMBL:ENSBTAP00000024462 no no 0 0 1 By matching By matching By MS/MS By MS/MS 1 1 71.897 71.971 3 0.016172 20713 YJC_D_20141124_01 61.649 42.387 36004000 0 0 11393000 24611000 + 361 65;64 352 809;810 513;514;515 515 3 FTASAGIQVVGDDLTVTNPK Unmodified 2032.0477 0.047685059 242 P06733;P06733-2 ENO1 Alpha-enolase yes no 0 0 0 By MS/MS By MS/MS By matching By matching 2 2 2 67.877 67.874 2;3 1.7504E-92 16627 YJC_A_20141124_01 119.37 98.927 10460000 8084500 1702900 672570 0 362 242 353 811;812;813;814;815;816 516;517;518;519 517 4 FTPGTFTNQIQAAFR Unmodified 1697.8526 0.85255449 50 P08865;C9J9K3 RPSA 40S ribosomal protein SA yes no 0 0 0 By MS/MS By matching By matching By matching 1 75.881 75.881 2 3.5093E-46 22940 YJC_A_20141124_01 106.6 87.615 2052200 2052200 0 0 0 363 50 354 817 520 520 1 FTQAGSEVSALLGR Unmodified 1434.7467 0.74669243 239 P06576;H0YH81;F8W0P7 ATP5B ATP synthase subunit beta, mitochondrial;ATP synthase subunit beta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 67.399 67.42 2 3.2211E-39 16339 YJC_A_20141124_01 108.58 72.902 2578100 2196900 381190 0 0 364 239 355 818;819 521 521 1 FVFSLVDAMNGK Unmodified 1326.6642 0.66420836 119 P40926;G3XAL0;E9PDB2 MDH2 Malate dehydrogenase, mitochondrial;Malate dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 78.416 78.416 2 0.0063727 25151 YJC_A_20141124_01 60.157 42.492 993070 993070 0 0 0 365 119 356 820 522 522 1 FVNVVPTFGK Unmodified 1106.6124 0.61243078 131 P62861;E9PR30 FAU 40S ribosomal protein S30 yes no 0 0 0 By matching By matching By MS/MS By matching 1 1 1 1 64.346 64.393 2 0.0082985 11679 YJC_C_20141124_01 53.751 11.541 4018800 1358100 1616200 521300 523180 366 131 357 821;822;823;824 523 523 0 FVNVVPTFGKK Unmodified 1234.7074 0.7073938 131 P62861;E9PR30 FAU 40S ribosomal protein S30 yes no 0 0 1 By matching By MS/MS By MS/MS By matching 2 2 1 1 57.787 57.809 2;3 5.4451E-10 12016 YJC_B_20141124_01 90.149 76.748 6429900 1124000 3252000 642290 1411700 367 131 358 825;826;827;828;829;830 524;525;526;527 525 2 FVVVCGDGEYIIYTAMALR Unmodified 2176.0697 0.06968283 32 P35606;B4DZI8 COPB2 Coatomer subunit beta' yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 88.617 88.587 3 0.0021393 33440 YJC_A_20141124_01 70.41 57.943 734590 611370 123220 0 0 368 32 359 831;832 528 528 0 FYALSASFEPFSNK Unmodified 1606.7668 0.76675917 287 P27797 CALR Calreticulin yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 74.88 74.9 2 1.9272E-22 22023 YJC_A_20141124_01 98.582 84.354 1984000 1664700 319300 0 0 369 287 360 833;834 529;530 529 2 GADFLVTEVENGGSLGSK Unmodified 1778.8687 0.86865806 268 P14618;P14618-3;P14618-2;H3BTN5;H3BQ34 PKM Pyruvate kinase PKM;Pyruvate kinase yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 70.359 70.355 2 1.2018E-38 17559 YJC_B_20141124_01 101.38 86.544 3270800 2203100 999060 68640 0 370 268 361 835;836;837 531 531 1 GAEAANVTGPGGVPVQGSK Unmodified 1694.8588 0.85876208 169 P67809;H0Y449 YBX1 Nuclease-sensitive element-binding protein 1 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 43.955 44.035 2 0.0006838 7609 YJC_A_20141124_01 68.291 56.686 1095500 809710 233180 0 52658 371 169 362 838;839;840 532;533 532 2 GAGSKTLQQNAESR Unmodified 1445.7223 0.7222686 228 O95816;B4DXE2 BAG2 BAG family molecular chaperone regulator 2 yes no 0 0 1 By MS/MS By matching By matching By matching 1 30.68 30.68 3 0.018616 4135 YJC_A_20141124_01 27.938 9.8645 391090 391090 0 0 0 372 228 363 841 534 534 0 GALQNIIPASTGAAK Unmodified 1410.7831 0.78307794 233 P04406;P04406-2;E7EUT5 GAPDH Glyceraldehyde-3-phosphate dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 59.101 59.123 2 0.016978 11998 YJC_A_20141124_01 49.595 16.735 13678000 9135100 2890600 752450 899570 373 233 364 842;843;844;845 535 535 1 GCIVDANLSVLNLVIVK Unmodified 1826.0336 0.03355532 0 P62753;A2A3R5 RPS6 40S ribosomal protein S6 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 86.446 86.442 2 0.010333 31557 YJC_A_20141124_01 57.708 45.305 2766600 2003400 525410 237860 0 374 0 365 846;847;848 536;537 536 2 GDATVSYEDPPTAK Unmodified 1449.6624 0.66235368 10 Q01844;H7BY36;C9JGE3;B0QYK0;Q01844-2;Q01844-6;Q01844-3;Q01844-5 EWSR1 RNA-binding protein EWS yes no 0 0 0 By matching By matching By MS/MS By matching 1 1 42.994 43.118 2 0.0046533 6202 YJC_C_20141124_01 69.92 43.388 1174600 0 0 387180 787410 375 10 366 849;850 538 538 1 GDDLSTAILK Unmodified 1031.5499 0.5498901 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 56.779 56.849 2 0.016966 11738 YJC_B_20141124_01 52.247 18.357 830190 532020 298170 0 0 376 326 367 851;852 539;540 540 2 GEATVSFDDPPSAK Unmodified 1419.6518 0.65178899 182 P35637;H3BPE7;P35637-2;Q92804;K7EPT6;Q92804-2 FUS;TAF15 RNA-binding protein FUS;TATA-binding protein-associated factor 2N yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 49.05 49.174 2 5.8885E-30 9246 YJC_D_20141124_01 101.2 77.492 739490 0 0 261830 477660 377 182 368 853;854 541;542 542 2 GETITGLLQEFDVQEQDIETLHGSVHVTLCGTPK Unmodified 3750.8411 0.84106969 94 Q92597;E5RI76;E5RH82;E5RIR1;E5RGM5;E5RK17;E5RIV1;E5RIM2;E9PDL6 NDRG1 Protein NDRG1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 85.209 85.209 4 0.0049788 30639 YJC_A_20141124_01 24.436 10.724 4531500 4531500 0 0 0 378 94 369 855 543 543 0 GFEVVYMTEPIDEYCVQQLK Unmodified 2447.1389 0.13888461 250 P08238 HSP90AB1 Heat shock protein HSP 90-beta yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 78.117 78.137 2 0.011574 24852 YJC_A_20141124_01 45.357 12.641 1543100 1284100 259080 0 0 379 250 370 856;857 544 544 1 GFGDGYNGYGGGPGGGNFGGSPGYGGGR Unmodified 2494.0323 0.03226278 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 59.886 59.91 2 8.9195E-09 10033 YJC_C_20141124_01 68.835 59.628 3436400 0 0 560130 2876300 380 278 371 858;859 545;546 545 1 GFGFILFK Unmodified 927.52182 0.52182486 87 Q99729-3;D6R9P3;D6RD18;D6RBZ0;Q99729-2;Q99729;Q99729-4 HNRNPAB Heterogeneous nuclear ribonucleoprotein A/B yes no 0 0 0 By MS/MS By matching By matching By MS/MS 1 1 1 81.198 81.315 2 0.0075353 28418 YJC_D_20141124_01 81.297 55.738 8228800 331620 0 749170 7148000 381 87 372 860;861;862 547;548 548 2 GFGFVDFNSEEDAK Unmodified 1560.6733 0.67325272 275 P19338;H7BY16 NCL Nucleolin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 69.296 69.316 2 0.0063578 17613 YJC_A_20141124_01 57.267 39.681 2110300 1700600 409780 0 0 382 275 373 863;864 549 549 1 GFGFVSFER Unmodified 1044.5029 0.50288033 107 P11940;E7EQV3;E7ERJ7;P11940-2;H0YAR2;Q9H361;H0YAP2 PABPC1;PABPC3 Polyadenylate-binding protein 1;Polyadenylate-binding protein 3 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 69.881 69.902 2 0.023419 18157 YJC_A_20141124_01 50.194 27.856 845140 592480 252660 0 0 383 107 374 865;866 550 550 0 GFGFVTFDDHDPVDKIVLQK Unmodified 2276.1477 0.14773345 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 73.255 73.329 4 0.021419 21569 YJC_D_20141124_01 34.395 13.799 6468000 0 0 1498200 4969800 384 278 375 867;868 551 551 1 GFGFVTYATVEEVDAAMNAR Unmodified 2146.9994 0.99935466 255 P09651;F8W6I7;P09651-3;P09651-2;F8W646;F8VZ49;F8VYN5 HNRNPA1 Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed yes no 0 0 0 By MS/MS By MS/MS By matching By matching 2 2 1 88.639 88.625 2;3 0.00020137 33227 YJC_A_20141124_01 67.902 60.572 5644400 4154000 914850 575470 0 385 255 376 869;870;871;872;873 552;553;554 552 2 GFSSGSAVVSGGSR Unmodified 1253.6 0.60002819 78 P35908;CON__P35908;CON__Q3TTY5 KRT2 Keratin, type II cytoskeletal 2 epidermal yes no 0 0 0 By matching By MS/MS By MS/MS By matching 1 1 41.842 41.937 2 0.0033435 7956 YJC_B_20141124_01 66.387 45.61 358940 0 191440 167500 0 + 386 78 377 874;875 555;556 555 2 GFVFITFK Unmodified 957.53239 0.53238955 87 Q99729-3;D6R9P3;D6RD18;D6RBZ0;Q99729-2;Q99729;Q99729-4 HNRNPAB Heterogeneous nuclear ribonucleoprotein A/B yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 76.293 76.342 2 0.00022135 24135 YJC_D_20141124_01 93.374 75.554 3009600 242140 0 550570 2216900 387 87 378 876;877;878 557;558 558 2 GGGGNFGPGPGSNFR Unmodified 1376.6222 0.62216062 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 1 49.792 49.865 2 1.8106E-260 7669 YJC_C_20141124_01 162.67 91.759 34293000 918260 546290 5004600 27824000 388 278 379 879;880;881;882 559;560 559 2 GGGGNFGPGPGSNFRGGSDGYGSGR Unmodified 2269.9849 0.98491866 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 48.853 48.976 3 0.014886 9119 YJC_D_20141124_01 41.296 32.36 19207000 0 0 1718300 17489000 389 278 380 883;884 561 561 1 GGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSR Unmodified 2873.1298 0.12980457 255 P09651 HNRNPA1 Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 55.164 55.188 3 0.0093457 10851 YJC_D_20141124_01 34.166 33.767 1721300 0 0 387850 1333500 390 255 381 885;886 562 562 1 GGGSVCPVCR Unmodified 1047.459 0.45898338 145 P19474;F5H012;P19474-2 TRIM21 E3 ubiquitin-protein ligase TRIM21 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 33.135 33.206 2 0.012025 6020 YJC_B_20141124_01 61.765 38.041 303020 132770 170250 0 0 391 145 382 887;888 563 563 1 GGNFGFGDSR Unmodified 1012.4363 0.43625733 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 0 By MS/MS By matching By MS/MS By MS/MS 1 1 1 49.546 49.67 2 3.3454E-33 7613 YJC_C_20141124_01 111.5 73.948 21726000 0 0 3867000 17859000 392 278 383 889;890;891 564;565;566 565 3 GGSDGYGSGR Unmodified 911.37332 0.37332272 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 25.48 25.576 2 0.017051 3285 YJC_D_20141124_01 51.998 26.377 3005000 0 115350 381050 2508600 393 278 384 892;893;894 567;568 568 2 GGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGR Unmodified 3387.395 0.39502082 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 1 By matching By matching By matching By MS/MS 1 57.597 57.696 3 1.1641E-32 11722 YJC_D_20141124_01 74.57 70.951 2283000 0 0 0 2283000 394 278 385 895 569 569 1 GGSGGSYGGGGSGGGYGGGSGSR Unmodified 1790.7204 0.72043069 301 P35527;CON__P35527;K7EQQ3 KRT9 Keratin, type I cytoskeletal 9 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 1 33.621 33.693 2 0.0043816 6101 YJC_B_20141124_01 54.559 30.352 960450 127810 487260 162400 182980 + 395 301 386 896;897;898;899 570 570 1 GGYFDEFGIIR Unmodified 1272.6139 0.61388734 100 P11413;P11413-3;E7EM57;E7EUI8;P11413-2 G6PD Glucose-6-phosphate 1-dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 74.686 74.706 2 0.011454 21835 YJC_A_20141124_01 58.274 38.07 1216700 1028300 188390 0 0 396 100 387 900;901 571 571 1 GHQQLYWSHPR Unmodified 1407.6796 0.67961592 337 P62273;P62273-2 RPS29 40S ribosomal protein S29 yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 1 42.65 42.733 3 0.00064375 7478 YJC_D_20141124_01 75.416 61.826 1701100 1014900 0 123120 563090 397 337 388 902;903;904 572 572 1 GHYTEGAELVDSVLDVVR Unmodified 1957.9745 0.97452012 245;350 P68371;Q13509-2;G3V2A3;P07437;Q5JP53;Q5ST81;Q9BVA1;Q13885;E9PBJ4 TUBB4B;TUBB3;TUBB;TUBB2B;TUBB2A Tubulin beta-4B chain;Tubulin beta chain;Tubulin beta-2B chain;Tubulin beta-2A chain no no 0 0 0 By MS/MS By matching By MS/MS By matching 2 1 1 82.208 82.23 2;3 0.0038241 24357 YJC_C_20141124_01 70.784 49.835 17923000 13571000 2328800 2023400 0 398 350;245 389 905;906;907;908 573;574 574 2 GHYTEGAELVDSVLDVVRK Unmodified 2086.0695 0.069483134 245;350 P68371;Q13509-2;G3V2A3;P07437;Q5JP53;Q5ST81;Q9BVA1;Q13885;E9PBJ4 TUBB4B;TUBB3;TUBB;TUBB2B;TUBB2A Tubulin beta-4B chain;Tubulin beta chain;Tubulin beta-2B chain;Tubulin beta-2A chain no no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 78.317 78.338 4 0.0075741 23137 YJC_B_20141124_01 35.473 16.175 1648200 1048600 599630 0 0 399 350;245 390 909;910 575;576 576 2 GIDVQQVSLVINYDLPTNR Unmodified 2143.1273 0.12733236 328 P60842;Q14240;E7EQG2;Q14240-2;Q9NZE6 EIF4A1;EIF4A2 Eukaryotic initiation factor 4A-I;Eukaryotic initiation factor 4A-II yes no 0 0 0 By MS/MS By matching By matching By matching 1 77.839 77.839 2 4.6267E-05 24592 YJC_A_20141124_01 77.959 53.552 1006000 1006000 0 0 0 400 328 391 911 577;578 578 2 GIHPTIISESFQK Unmodified 1455.7722 0.7721789 318 P50991;P50991-2;B7Z9L0 CCT4 T-complex protein 1 subunit delta yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 55.695 55.765 3 0.009774 11468 YJC_B_20141124_01 68.515 48.279 1295500 1010400 285150 0 0 401 318 392 912;913 579 579 1 GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK Unmodified 4035.8875 0.88750261 233 P04406;P04406-2;E7EUT5 GAPDH Glyceraldehyde-3-phosphate dehydrogenase yes no 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 2 1 2 2 70.726 70.774 4;5 1.2663E-12 18716 YJC_A_20141124_01 52.377 49.847 53552000 39219000 2427700 6539100 5366300 402 233 393 914;915;916;917;918;919;920 580;581;582;583 580 4 GKNIQVVVR Unmodified 1011.6189 0.61891314 322 P52732 KIF11 Kinesin-like protein KIF11 yes yes 0 0 1 By MS/MS By matching By matching By matching 1 1 37.592 37.662 3 0.004738 5804 YJC_A_20141124_01 78.516 47.904 1605700 1119900 485810 0 0 403 322 394 921;922 584 584 0 GLCAIAQAESLR Unmodified 1287.6605 0.66051996 279 P23396;P23396-2;F2Z2S8;H0YF32;H0YCJ7 RPS3 40S ribosomal protein S3 yes no 0 0 0 By MS/MS By matching By matching By matching 1 60.499 60.499 2 9.33E-06 12604 YJC_A_20141124_01 83.204 50.874 1065700 1065700 0 0 0 404 279 395 923 585 585 1 GLEGERPARLTR Unmodified 1353.7477 0.74769548 153 P46783;F6U211;S4R435 RPS10;RPS10-NUDT3 40S ribosomal protein S10 yes no 0 0 2 By matching By MS/MS By matching By matching 1 1 1 37.335 37.415 3 0.027661 6832 YJC_B_20141124_01 46.844 26.01 1113200 578600 211810 0 322780 405 153 396 924;925;926 586 586 1 GLFIIDDK Unmodified 919.50148 0.50148335 364 Q06830;Q13162;H7C3T4 PRDX1;PRDX4 Peroxiredoxin-1;Peroxiredoxin-4 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 65.492 65.512 2 0.0018478 15142 YJC_A_20141124_01 89.355 72.124 2929000 2439000 490020 0 0 406 364 397 927;928 587 587 1 GLGEEDIRR Unmodified 1043.536 0.53597137 210 Q96D53;M0R2F4;M0R307;M0R0F4;M0R340;M0R0L2;M0QZZ2;M0R3F7;M0R011;Q96D53-2 ADCK4 AarF domain-containing protein kinase 4 yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 90.589 90.559 1 0.017513 31108 YJC_B_20141124_01 32.61 11.911 1618400 472450 1146000 0 0 407 210 398 929;930 588 588 0 GLGLDDALEPR Unmodified 1154.5932 0.5931519 212 Q9Y230;M0R0Z0;X6R2L4 RUVBL2 RuvB-like 2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 61.066 61.086 2 0.014865 12875 YJC_A_20141124_01 35.677 14.84 363070 260190 102880 0 0 408 212 399 931;932 589 589 0 GLIAEAAQLGPVGGVFNLAVVLR Unmodified 2263.3052 0.30523715 313 P49327 FASN Fatty acid synthase;[Acyl-carrier-protein] S-acetyltransferase;[Acyl-carrier-protein] S-malonyltransferase;3-oxoacyl-[acyl-carrier-protein] synthase;3-oxoacyl-[acyl-carrier-protein] reductase;3-hydroxyacyl-[acyl-carrier-protein] dehydratase;Enoyl-[acyl-carrier-protein] reductase;Oleoyl-[acyl-carrier-protein] hydrolase yes yes 0 0 0 By matching By MS/MS By matching By matching 1 94.467 94.408 3 5.3427E-145 33697 YJC_B_20141124_01 128.74 117.98 1571100 0 1571100 0 0 409 313 400 933 590 590 1 GLKAELAER Unmodified 985.55564 0.55564418 413 Q9BUJ2;Q9BUJ2-2;Q9BUJ2-3;M0R247 HNRNPUL1 Heterogeneous nuclear ribonucleoprotein U-like protein 1 yes no 0 0 1 By matching By matching By matching By MS/MS 1 41.075 41.274 3 0.0085206 7004 YJC_D_20141124_01 82.287 37.969 1118600 0 0 0 1118600 410 413 401 934 591 591 1 GLLLYGPPGTGK Unmodified 1171.6601 0.66010926 198 Q8IYT4;K7EM02;K7EIJ8;Q8IYT4-2 KATNAL2 Katanin p60 ATPase-containing subunit A-like 2 yes no 0 0 0 By matching By MS/MS By matching By matching 1 60.743 60.784 2 0.0091001 12794 YJC_B_20141124_01 53.6 41.964 744360 0 744360 0 0 411 198 402 935 592 592 1 GLSQSALPYR Unmodified 1090.5771 0.57710791 132 P62277;E9PS50;J3KMX5 RPS13 40S ribosomal protein S13 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 50.712 50.732 2 0.016631 9541 YJC_A_20141124_01 54.343 28.28 885410 744300 141110 0 0 412 132 403 936;937 593 593 1 GLTDLPVR Unmodified 869.49707 0.49706667 437 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 50.111 50.111 2 0.012144 9395 YJC_A_20141124_01 68.787 2.3576 12352000 12352000 0 0 0 + 413 437 404 938 594 594 1 GNPTVEVDLFTSK Unmodified 1405.7089 0.70890994 242 P06733;K7EM90 ENO1 Alpha-enolase;Enolase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 65.293 65.289 2 0.008963 15129 YJC_A_20141124_01 53.946 18.289 7067100 5348600 1418700 299760 0 414 242 405 939;940;941 595 595 1 GNYDAAKRGPGGAWAAEVITDAR Unmodified 2345.1513 0.1512557 129 E9PQD6 SAA1 Serum amyloid A protein yes yes 0 0 2 By matching By matching By matching By MS/MS 1 1 65.697 65.797 4 0.017644 15816 YJC_D_20141124_01 28.411 1.0346 6949900 2829800 0 0 4120100 415 129 406 942;943 596 596 0 GPCIIYNEDNGIIK Unmodified 1604.7868 0.78684269 181 P36578;H3BM89 RPL4 60S ribosomal protein L4 yes no 0 0 0 By MS/MS By matching By matching By matching 1 60.578 60.578 2 0.009133 12642 YJC_A_20141124_01 54.09 31.205 427790 427790 0 0 0 416 181 407 944 597 597 1 GSAITGPVAK Unmodified 899.50763 0.50763136 194 P62829;J3KTJ3 RPL23 60S ribosomal protein L23 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 36.151 36.221 2 0.02465 6621 YJC_B_20141124_01 46.796 13.797 351820 189950 161870 0 0 417 194 408 945;946 598 598 1 GSFSEQGINEFLR Unmodified 1482.7103 0.71030693 35 Q15084;Q15084-3;F8WA83;B5MCQ5;Q15084-2 PDIA6 Protein disulfide-isomerase A6 yes no 0 0 0 By MS/MS By matching By matching By matching 1 70.233 70.233 2 0.0096931 18304 YJC_A_20141124_01 52.966 36.346 1132400 1132400 0 0 0 418 35 409 947 599 599 1 GSGGGSSGGSIGGR Unmodified 1091.4956 0.49556312 73 CON__P04264;P04264 KRT1 Keratin, type II cytoskeletal 1 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 1 25.164 25.236 2 2.2229E-05 4620 YJC_B_20141124_01 82.202 82.202 2743100 166270 1798500 522520 255780 + 419 73 410 948;949;950;951 600 600 1 GSLGGGFSSGGFSGGSFSR Unmodified 1706.7649 0.76486169 76 P13645;CON__P13645 KRT10 Keratin, type I cytoskeletal 10 yes no 0 0 0 By matching By MS/MS By MS/MS By matching 1 1 1 62.299 62.295 2 1.7936E-39 10802 YJC_C_20141124_01 103.41 87.615 2075800 306970 1271200 497670 0 + 420 76 411 952;953;954 601;602 602 2 GSSGGGCFGGSSGGYGGLGGFGGGSFR Unmodified 2341.9771 0.97705609 76 P13645;CON__P13645 KRT10 Keratin, type I cytoskeletal 10 yes no 0 0 0 By matching By MS/MS By matching By matching 1 67.087 67.127 2 1.6767E-05 15716 YJC_B_20141124_01 48.634 35.885 524440 0 524440 0 0 + 421 76 412 955 603 603 1 GSTHPQPGVSPPAAPAAPGPK Unmodified 1919.9854 0.98535957 227 O94925;O94925-3;O94925-2 GLS Glutaminase kidney isoform, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 42.872 42.942 3 0.017294 7296 YJC_A_20141124_01 42.118 19.207 377110 292230 84875 0 0 422 227 413 956;957 604 604 0 GSYGDLGGPIITTQVTIPK Unmodified 1916.0255 0.025493054 332 P61978;P61978-2;Q5T6W2;Q5T6W5;P61978-3;S4R359 HNRNPK Heterogeneous nuclear ribonucleoprotein K yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 69.296 69.316 2 0.010947 17012 YJC_B_20141124_01 50.358 25.44 1465800 934710 531080 0 0 423 332 414 958;959 605 605 1 GSYSCEVTHEGSTVTK Unmodified 1740.7625 0.76247843 82 CON__Q1RMN8 yes yes 0 0 0 By matching By matching By MS/MS By matching 1 1 39.681 39.805 2 0.025238 5509 YJC_C_20141124_01 42.059 26.866 378200 0 0 154050 224150 + 424 82 415 960;961 606 606 1 GTIEILSDVQLIK Unmodified 1427.8235 0.82354577 158 P05388;F8VW21;Q8NHW5;F8VPE8;F8VU65 RPLP0;RPLP0P6 60S acidic ribosomal protein P0;60S acidic ribosomal protein P0-like yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 77.095 77.091 2 0.002841 23928 YJC_A_20141124_01 64.534 34.99 1894600 1478500 332950 83206 0 425 158 416 962;963;964 607 607 1 GTLDPVEK Unmodified 857.44945 0.44944778 262 P11142;E9PKE3;P11142-2;E9PN89;E9PNE6;A8K7Q2 HSPA8 Heat shock cognate 71 kDa protein yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 38.671 38.741 2 0.0020823 7133 YJC_B_20141124_01 76.478 40.984 2165500 1487900 677570 0 0 426 262 417 965;966 608;609 609 2 GTVTDFPGFDER Unmodified 1339.6044 0.60444487 90 P08758;D6RBE9;D6RCN3;E9PHT9 ANXA5 Annexin A5;Annexin yes no 0 0 0 By MS/MS By matching By matching By matching 1 62.211 62.211 2 0.00015552 13350 YJC_A_20141124_01 78.324 41.907 1443600 1443600 0 0 0 427 90 418 967 610 610 1 GTVVTGTLER Unmodified 1031.5611 0.56112349 314 P49411 TUFM Elongation factor Tu, mitochondrial yes yes 0 0 0 By matching By MS/MS By matching By matching 1 43.352 43.392 2 0.016869 8362 YJC_B_20141124_01 55.721 30.483 196040 0 196040 0 0 428 314 419 968 611 611 1 GTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVK Unmodified 4147.9844 0.98436311 287 P27797;K7EL50 CALR Calreticulin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 93.689 93.659 4 0.00062099 37677 YJC_A_20141124_01 35.734 30.359 4988000 3792200 1195800 0 0 429 287 420 969;970 612 612 1 GVDEVTIVNILTNR Unmodified 1541.8413 0.8413211 244 P07355;P07355-2;H0YN42;H0YKL9;H0YKZ7;H0YLV6;H0YMT9;H0YKX9;H0YMW4;H0YMM1;H0YKS4;H0YMD0;H0YMU9;H0YMD9;H0YKV8 ANXA2 Annexin A2;Annexin yes no 0 0 0 By MS/MS By MS/MS By matching By matching 2 1 81.433 81.447 2;3 2.9425E-15 27775 YJC_A_20141124_01 93.716 65.092 3372300 2896400 475860 0 0 430 244 421 971;972;973 613;614;615 613 2 GVMLAVDAVIAELK Oxidation (M) 1443.8007 0.80070184 260 P10809;E7ESH4;E7EXB4 HSPD1 60 kDa heat shock protein, mitochondrial yes no 0 1 0 By MS/MS By MS/MS By matching By matching 3 1 85.342 85.352 2;3 8.072E-79 30586 YJC_A_20141124_01 122.97 101.02 4139300 3936000 203300 0 0 431 260 422 974;975;976;977 616;617;618;619 616 32 4 GVMLAVDAVIAELK Unmodified 1427.8058 0.80578722 260 P10809;E7ESH4;E7EXB4 HSPD1 60 kDa heat shock protein, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 93.294 93.265 2 0.0046045 37287 YJC_A_20141124_01 68.972 40.588 1001700 852790 148870 0 0 432 260 422 978;979 620 620 1 GVNIGGAGSYIYEKPLAEGPQVTGPIEVPAAR Unmodified 3209.6721 0.67207751 176 P52943;H0YFA4;P52943-2 CRIP2 Cysteine-rich protein 2 yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 69.69 69.71 3 1.1074E-07 17164 YJC_B_20141124_01 44.264 33.843 2453000 1352100 1100800 0 0 433 176 423 980;981 621;622 622 1 GVNLPGAAVDLPAVSEK Unmodified 1635.8832 0.88318591 268 P14618;P14618-3;P14618-2;H3BTN5;H3BQ34;Q504U3 PKM;PKM2 Pyruvate kinase PKM;Pyruvate kinase yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 65.676 65.697 2 0.023238 14837 YJC_B_20141124_01 42.149 26.305 2486900 1622700 864170 0 0 434 268 424 982;983 623 623 1 GVPQIEVTFDIDANGILNVSAVDK Unmodified 2513.3013 0.30133356 262 P11142;E9PKE3;E9PNE6;A8K7Q2;E9PM13;E9PS65 HSPA8 Heat shock cognate 71 kDa protein yes no 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 9 9 6 1 89.688 89.678 2;3 3.5907E-24 37799 YJC_D_20141124_01 91.416 75.357 45687000 26257000 11329000 8101000 0 435 262 425 984;985;986;987;988;989;990;991;992;993;994;995;996;997;998;999;1000;1001;1002;1003;1004;1005;1006;1007;1008 624;625;626;627;628;629;630;631;632;633;634;635;636;637 637 13 GVPQIEVTFDIDANGILNVTATDK Unmodified 2529.2962 0.29624819 249 P08107;P08107-2;E7EP94;V9GZ37 HSPA1A Heat shock 70 kDa protein 1A/1B no no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 6 5 6 1 90.307 90.298 2;3 1.8717E-06 31916 YJC_A_20141124_01 65.278 47.105 28618000 17442000 5698400 4763100 714050 436 249 426 1009;1010;1011;1012;1013;1014;1015;1016;1017;1018;1019;1020;1021;1022;1023;1024;1025;1026 638;639;640;641;642;643;644;645 639 7 GVPQIEVTFEIDVNGILR Unmodified 1998.0786 0.078591257 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By MS/MS By MS/MS By matching By MS/MS 3 3 2 1 93.142 93.122 2;3 1.1722E-38 37931 YJC_A_20141124_01 101.49 79.678 14846000 5538000 6080500 1623400 1604200 437 261 427 1027;1028;1029;1030;1031;1032;1033;1034;1035 646;647;648;649;650;651 647 6 GVVDSEDLPLNISR Unmodified 1512.7784 0.77838649 250;247 P08238;P07900;P07900-2;Q86U12 HSP90AB1;HSP90AA1 Heat shock protein HSP 90-beta;Heat shock protein HSP 90-alpha no no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 63.973 63.993 2 2.8116E-96 14167 YJC_A_20141124_01 128.85 96.407 8377300 7172100 1205200 0 0 438 250;247 428 1036;1037 652;653;654 653 2 GVVQELQQAISK Unmodified 1298.7194 0.71941505 120 P29692;E9PN91;E9PMW7;E9PPR1;E9PL12;E9PL71;E9PQ49;E9PI39;E9PK01;P29692-3;P29692-2;E9PIZ1;H0YCK7;E9PRY8 EEF1D Elongation factor 1-delta yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 72.598 72.618 2 0.0059246 20080 YJC_A_20141124_01 60.657 37.54 1948900 1612300 336580 0 0 439 120 429 1038;1039 655;656 655 2 GYAFIEFASFEDAK Unmodified 1593.7351 0.73512469 275 P19338;H7BY16 NCL Nucleolin yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 79.897 79.926 2 0.0035815 26459 YJC_A_20141124_01 75.02 64.3 1885500 1388700 361490 135360 0 440 275 430 1040;1041;1042 657;658 657 2 GYDVIAQAQSGTGK Unmodified 1393.6838 0.68375782 328 P60842;Q14240;E7EQG2;Q14240-2;J3QLN6;J3QR64;J3KTB5;J3QL43;J3QS69;J3KT12;P60842-2;J3QKZ9;J3KS25;J3KS93;B4E102;J3KT04;E7EMV8;J3KSN7 EIF4A1;EIF4A2 Eukaryotic initiation factor 4A-I;Eukaryotic initiation factor 4A-II yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 49.633 49.653 2 5.1983E-05 9233 YJC_A_20141124_01 66.068 42.95 815980 498530 317450 0 0 441 328 431 1043;1044 659 659 0 GYISPYFINTSK Unmodified 1388.6976 0.69761697 260 P10809;E7ESH4 HSPD1 60 kDa heat shock protein, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 64.498 64.518 2 0.025967 14450 YJC_A_20141124_01 43.798 29.118 2140000 1708900 431130 0 0 442 260 432 1045;1046 660 660 1 GYKHTLNQIDSVKVWPR Unmodified 2040.0905 0.090493347 75 CON__P12763 yes yes 0 0 2 By MS/MS By MS/MS By matching By matching 1 2 55.841 55.935 4 0.0076752 11131 YJC_A_20141124_01 51.771 37.785 2414000 1970000 444020 0 0 + 443 75 433 1047;1048;1049 661;662 661 2 GYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIR Unmodified 3826.8546 0.85461126 339 P62306 SNRPF Small nuclear ribonucleoprotein F yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 94.487 94.457 3 0.0026586 33734 YJC_B_20141124_01 35.147 25.052 16024000 0 7742900 0 8280700 444 339 434 1050;1051 663 663 1 GYSFTTTAER Unmodified 1131.5197 0.51965261 327 P60709;P63261;I3L3I0;I3L1U9;I3L4N8 ACTB;ACTG1 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 1 47.927 47.999 2 0.001023 9499 YJC_B_20141124_01 64.224 33.66 8052900 5127600 2056500 465020 403800 445 327 435 1052;1053;1054;1055 664 664 1 GYWASLDASTQTTHELTIPNNLIGCIIGR Unmodified 3200.5924 0.59244698 378 Q15365 PCBP1 Poly(rC)-binding protein 1 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 85.937 85.937 3 0.016394 31191 YJC_A_20141124_01 34.369 23.782 0 0 0 0 0 446 378 436 1056 665 665 1 HADLEIR Unmodified 852.44537 0.44536545 375 Q14764;H3BUK7;H3BNF6;H3BRL2;H3BQK6;H3BP76 MVP Major vault protein yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 37.595 37.669 2 2.9577E-09 5026 YJC_C_20141124_01 104.75 45.965 1599700 0 0 452660 1147100 447 375 437 1057;1058 666;667 666 2 HAVSEGTK Unmodified 827.41373 0.41373097 280 P33778;Q99880;Q93079;Q16778;Q99879;Q99877;Q5QNW6;P58876;P62807;P23527;Q96A08;U3KQK0;Q5QNW6-2;O60814;Q8N257;P57053;P06899;B4DR52 HIST1H2BB;HIST1H2BL;HIST1H2BH;HIST2H2BE;HIST1H2BM;HIST1H2BN;HIST2H2BF;HIST1H2BD;HIST1H2BC;HIST1H2BO;HIST1H2BA;HIST1H2BK;HIST3H2BB;H2BFS;HIST1H2BJ Histone H2B type 1-B;Histone H2B type 1-L;Histone H2B type 1-H;Histone H2B type 2-E;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 2-F;Histone H2B type 1-D;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-O;Histone H2B type 1-A;Histone H2B;Histone H2B type 1-K;Histone H2B type 3-B;Histone H2B type F-S;Histone H2B type 1-J yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 16.78 16.76 2 0.0080867 3501 YJC_B_20141124_01 82.75 18.486 1488100 192620 1110200 0 185290 448 280 438 1059;1060;1061 668 668 1 HAVSEGTKAVTKYTSSK Unmodified 1792.9319 0.93192702 280 P33778;Q99880;Q93079;Q16778;Q99879;Q99877;Q5QNW6;P58876;P62807;P23527;Q96A08;U3KQK0;Q5QNW6-2;Q8N257 HIST1H2BB;HIST1H2BL;HIST1H2BH;HIST2H2BE;HIST1H2BM;HIST1H2BN;HIST2H2BF;HIST1H2BD;HIST1H2BC;HIST1H2BO;HIST1H2BA;HIST3H2BB Histone H2B type 1-B;Histone H2B type 1-L;Histone H2B type 1-H;Histone H2B type 2-E;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 2-F;Histone H2B type 1-D;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-O;Histone H2B type 1-A;Histone H2B;Histone H2B type 3-B yes no 0 0 2 By MS/MS By matching By matching By MS/MS 2 2 2 35.999 36.079 3;4 0.0096099 5480 YJC_D_20141124_01 49.535 33.295 8441200 3338100 1011100 0 4092000 449 280 439 1062;1063;1064;1065;1066;1067 669;670 670 2 HELQANCYEEVKDR Unmodified 1789.8053 0.8053463 281 P23528;G3V1A4;E9PP50;E9PK25 CFL1 Cofilin-1 yes no 0 0 1 By MS/MS By matching By matching By matching 1 40.31 40.31 3 6.9447E-09 6532 YJC_A_20141124_01 88.108 70.906 304220 304220 0 0 0 450 281 440 1068 671 671 1 HFSVEGQLEFR Unmodified 1347.6571 0.65714914 250;247 P08238;Q14568;Q58FF7;Q58FG1;P07900;P07900-2;Q86U12 HSP90AB1;HSP90AA2;HSP90AB3P;HSP90AA4P;HSP90AA1 Heat shock protein HSP 90-beta;Putative heat shock protein HSP 90-alpha A2;Putative heat shock protein HSP 90-beta-3;Putative heat shock protein HSP 90-alpha A4;Heat shock protein HSP 90-alpha no no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 59.477 59.473 3 0.020067 12402 YJC_B_20141124_01 49.466 33.116 4906200 3779600 816190 310370 0 451 250;247 441 1069;1070;1071 672 672 1 HGEIDYEAIVK Unmodified 1272.635 0.63501672 340 P62333 PSMC6 26S protease regulatory subunit 10B yes yes 0 0 0 By matching By MS/MS By matching By matching 1 54.407 54.547 2 0.0006958 11153 YJC_B_20141124_01 69.261 39.494 0 0 0 0 0 452 340 442 1072 673 673 1 HGGGGGGFGGGGFGSR Unmodified 1319.5755 0.57554478 78 P35908;CON__P35908 KRT2 Keratin, type II cytoskeletal 2 epidermal yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 1 42.191 42.289 3 6.1222E-24 8041 YJC_B_20141124_01 96.135 88.456 1959900 648390 594140 374970 342400 + 453 78 443 1073;1074;1075;1076 674;675;676 675 3 HGSGSGHSSSYGQHGSGSGWSSSSGR Unmodified 2476.0137 0.013652602 83 Q86YZ3;CON__Q86YZ3 HRNR Hornerin yes no 0 0 0 By matching By MS/MS By matching By matching 1 30.62 30.76 4 0.0075031 5559 YJC_B_20141124_01 38.679 32.261 139730 0 139730 0 0 + 454 83 444 1077 677 677 1 HIADLAGNSEVILPVPAFNVINGGSHAGNK Unmodified 3010.5625 0.56246748 242 P06733;P06733-2;K7EM90 ENO1 Alpha-enolase;Enolase yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 74.126 74.122 4 4.2925E-06 21290 YJC_A_20141124_01 45.941 24.592 15553000 9658500 5152000 742960 0 455 242 445 1078;1079;1080 678;679;680 678 3 HIVKEFKR Unmodified 1055.624 0.62399852 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 2 By matching By matching By matching By MS/MS 1 1 1 1 30.276 30.348 3 1.3774E-18 4177 YJC_D_20141124_01 110.12 34.931 5665600 190680 104230 517410 4853300 456 307 446 1081;1082;1083;1084 681 681 1 HLEGLSEEAIMELNLPTGIPIVYELDK Unmodified 3022.5573 0.55729025 274 P18669 PGAM1 Phosphoglycerate mutase 1 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 90.125 90.121 3 0.0092165 34633 YJC_A_20141124_01 37.938 28.036 4330900 3632200 456960 241670 0 457 274 447 1085;1086;1087 682 682 1 HLEINPDHPIVETLR Unmodified 1781.9424 0.94243213 250 P08238 HSP90AB1 Heat shock protein HSP 90-beta yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 56.852 56.899 3 1.5944E-23 11457 YJC_A_20141124_01 96.135 76.463 7904200 5798600 1321200 388170 396320 458 250 448 1088;1089;1090;1091 683 683 1 HLEINPDHSIIETLR Unmodified 1785.9373 0.93734675 247 P07900;P07900-2 HSP90AA1 Heat shock protein HSP 90-alpha yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 61.061 61.081 3 1.3898E-23 12847 YJC_A_20141124_01 96.707 78.242 4242200 3513600 728560 0 0 459 247 449 1092;1093 684 684 1 HLNDDVVK Unmodified 938.48214 0.48214489 360 Q03135;E9PCT5;C9JKI3;Q03135-2 CAV1 Caveolin-1;Caveolin yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 32.523 32.593 2 0.0043877 5885 YJC_B_20141124_01 72.928 31.48 590200 160260 429940 0 0 460 360 450 1094;1095 685 685 1 HLVYESDQNKDGKLTK Unmodified 1873.9534 0.95339074 220 O43852;O43852-4;O43852-9;O43852-5;O43852-2;O43852-3;O43852-15;H0Y875 CALU Calumenin yes no 0 0 2 By MS/MS By MS/MS By matching By matching 1 1 35.096 35.166 4 0.00022628 5169 YJC_A_20141124_01 78.401 66.758 1524900 1316800 208090 0 0 461 220 451 1096;1097 686;687 686 2 HLYTLDGGDIINALCFSPNR Unmodified 2275.1056 0.10555106 86 P63244;D6RF23;H0Y8R5;H0YAF8;D6R9Z1;H0YAM7;D6RAC2;J3KPE3;H0Y8W2;D6R9L0;D6REE5 GNB2L1 Guanine nucleotide-binding protein subunit beta-2-like 1;Guanine nucleotide-binding protein subunit beta-2-like 1, N-terminally processed yes no 0 0 0 By MS/MS By matching By matching By matching 1 78.449 78.449 3 0.017829 25221 YJC_A_20141124_01 58.01 45.12 1145400 1145400 0 0 0 462 86 452 1098 688 688 1 HNAHGAGNGLR Unmodified 1102.538 0.53803706 224 O75688;O75688-2;C9JIR6;O75688-4;B8ZZF0;O75688-5 PPM1B Protein phosphatase 1B yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 20.811 20.832 3 0.0058824 2564 YJC_A_20141124_01 64.374 32.019 220960 100710 120250 0 0 463 224 453 1099;1100 689;690 689 2 HNDDEQYAWESSAGGSFTVR Unmodified 2254.9516 0.95155284 250;247 P08238;Q14568;Q5T9W8;P07900;P07900-2 HSP90AB1;HSP90AA2;HSP90AA1 Heat shock protein HSP 90-beta;Putative heat shock protein HSP 90-alpha A2;Heat shock protein HSP 90-alpha no no 0 0 0 By MS/MS By matching By matching By matching 1 1 61.06 61.08 3 0.017726 12797 YJC_A_20141124_01 56.304 50.834 1518000 1134900 383060 0 0 464 250;247 454 1101;1102 691 691 1 HRAQVIYTR Unmodified 1142.6309 0.63087481 343 P62851 RPS25 40S ribosomal protein S25 yes yes 0 0 1 By MS/MS By matching By matching By MS/MS 1 1 1 31.922 32.002 3 6.3891E-19 4427 YJC_A_20141124_01 106.88 81.754 1116600 390930 298220 0 427500 465 343 455 1103;1104;1105 692;693 692 2 HSQFIGYPITLFVEK Unmodified 1777.9403 0.94030686 247 P07900;P07900-2;Q86U12;Q58FG0;G3V2J8 HSP90AA1;HSP90AA5P Heat shock protein HSP 90-alpha;Putative heat shock protein HSP 90-alpha A5 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 77.935 77.955 3 0.01275 24520 YJC_A_20141124_01 50.102 28.856 1038000 721000 316960 0 0 466 247 456 1106;1107 694 694 0 HSQFLGYPITLYLEK Unmodified 1807.9509 0.95087155 387 Q58FF8 HSP90AB2P Putative heat shock protein HSP 90-beta 2 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 75.749 75.745 3 0.0094317 22644 YJC_A_20141124_01 69.258 54.288 4326700 3428200 588990 309470 0 467 387 457 1108;1109;1110 695;696 695 2 HTGPNSPDTANDGFVR Unmodified 1683.7601 0.76011066 118 P31943;E9PCY7;G8JLB6;P55795;E5RGH4;E5RGV0;D6RIU0;D6RBM0;E7EQJ0;D6RAM1;H0YAQ2;D6R9T0;D6RFM3;D6RIT2;D6RDU3;D6RJ04;D6RIH9 HNRNPH1;HNRNPH2 Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H2;Heterogeneous nuclear ribonucleoprotein H2, N-terminally processed yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 41.532 41.602 3 0.022954 7887 YJC_B_20141124_01 55.097 30.672 475470 273560 201910 0 0 468 118 458 1111;1112 697 697 1 HVDAHATLNDGVVVQVMGLLSNNNQALR Unmodified 2984.525 0.52503612 96 Q13283;E5RIF8;E5RH42;E5RIZ6;E5RJU8;Q5HYE9 G3BP1 Ras GTPase-activating protein-binding protein 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 84.13 84.13 4 1.7345E-05 29743 YJC_A_20141124_01 46.46 39.173 1146600 1146600 0 0 0 469 96 459 1113 698 698 1 HYCTVANPVSR Unmodified 1302.6139 0.61390412 375 Q14764;H3BUK7;H3BNF6;H3BRL2;H3BQK6;H3BP76 MVP Major vault protein yes no 0 0 0 By matching By matching By MS/MS By MS/MS 2 2 38.497 38.571 2;3 0.0051533 6127 YJC_D_20141124_01 62.694 41.662 2702300 0 0 743470 1958900 470 375 460 1114;1115;1116;1117 699;700;701 700 3 HYWEVDVTGK Unmodified 1232.5826 0.58258722 145 P19474;F5H012;P19474-2 TRIM21 E3 ubiquitin-protein ligase TRIM21 yes no 0 0 0 By matching By MS/MS By matching By matching 1 53.605 53.746 2 0.0025841 10899 YJC_B_20141124_01 43.502 28.685 273720 0 273720 0 0 471 145 461 1118 702 702 0 IADGYEQAAR Unmodified 1092.52 0.51998696 310 P48643;E7ENZ3;B7ZAR1;E9PCA1;P48643-2 CCT5 T-complex protein 1 subunit epsilon yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 37.921 37.992 2 0.000907 6973 YJC_B_20141124_01 65.695 28.186 290100 136560 153540 0 0 472 310 462 1119;1120 703 703 0 IAEFTTNLTEEEEK Unmodified 1652.7781 0.77811172 302 P35579 MYH9 Myosin-9 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 57.733 57.733 2 1.7541E-06 11974 YJC_B_20141124_01 86.539 54.109 788050 788050 0 0 0 473 302 463 1121;1122 704;705 705 2 IAIIVDDIIDDVESFVAAAEILK Unmodified 2471.3411 0.34107311 25 Q14558;C9J168;B4DP31;Q14558-2 PRPSAP1 Phosphoribosyl pyrophosphate synthase-associated protein 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 94.939 94.939 3 0.0049447 38700 YJC_A_20141124_01 43.823 31.534 761620 761620 0 0 0 474 25 464 1123 706 706 1 IAIYELLFK Unmodified 1108.6532 0.65323296 153 P46783;F6U211;S4R435 RPS10;RPS10-NUDT3 40S ribosomal protein S10 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 85.729 85.749 2 0.017386 27890 YJC_B_20141124_01 63.816 35.992 2888400 2062200 826150 0 0 475 153 465 1124;1125 707 707 1 IALLNVELELK Unmodified 1253.7595 0.75948895 38 Q99832;B7Z1C9;F5GZK5;Q99832-4;Q99832-3;Q99832-2 CCT7 T-complex protein 1 subunit eta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 77.251 77.271 2 0.010993 24138 YJC_A_20141124_01 56.936 35.937 969220 832140 137070 0 0 476 38 466 1126;1127 708 708 1 IATSLDGFDVASVQQQR Unmodified 1833.9221 0.92209062 204 O60664;K7ERZ3;O60664-2;O60664-4;O60664-3 PLIN3 Perilipin-3 yes no 0 0 0 By MS/MS By matching By matching By matching 1 64.772 64.772 2 0.013742 14593 YJC_A_20141124_01 53.395 22.82 870910 870910 0 0 0 477 204 467 1128 709 709 1 IDFYFDENPYFENK Unmodified 1839.7992 0.79918151 356 Q01105;Q01105-2;Q01105-3;Q01105-4;P0DME0 SET;SETSIP Protein SET;Protein SETSIP yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 77.063 77.083 2 0.011551 23922 YJC_A_20141124_01 51.771 38.148 1251300 900310 351030 0 0 478 356 468 1129;1130 710 710 1 IDTIEIITDR Unmodified 1187.6398 0.63976774 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 0 By matching By matching By matching By MS/MS 1 64.337 64.536 2 1.1687E-159 14912 YJC_D_20141124_01 152.64 95.089 3984600 0 0 0 3984600 479 278 469 1131 711 711 1 IEDLSQQAQLAAAEK Unmodified 1613.8261 0.82606496 115 E9PAV3;F8W1N5;F8VZJ2;F8VNW4;F8W0W4;H0YHX9;Q13765;E9PAV3-2 NACA Nascent polypeptide-associated complex subunit alpha, muscle-specific form;Nascent polypeptide-associated complex subunit alpha yes no 0 0 0 By MS/MS By matching By matching By matching 1 53.879 53.879 2 2.594E-12 10483 YJC_A_20141124_01 91.657 47.146 0 0 0 0 0 480 115 470 1132 712 712 1 IEDVTPIPSDSTR Unmodified 1428.7096 0.70963822 335 P62263 RPS14 40S ribosomal protein S14 yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 49.19 49.21 2 0.0030608 9844 YJC_B_20141124_01 63.292 35.325 1304800 851040 453780 0 0 481 335 471 1133;1134 713 713 1 IEDVTPIPSDSTRR Unmodified 1584.8107 0.81074925 335 P62263 RPS14 40S ribosomal protein S14 yes yes 0 0 1 By matching By MS/MS By matching By matching 1 46.124 46.164 3 0.0083016 9069 YJC_B_20141124_01 56.205 44.946 595280 0 595280 0 0 482 335 472 1135 714 714 1 IEEELGSK Unmodified 903.45493 0.45492709 242 P06733;P06733-2 ENO1 Alpha-enolase yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 35.621 35.701 2 0.0036809 6484 YJC_B_20141124_01 76.679 4.5405 778410 341200 312760 0 124450 483 242 473 1136;1137;1138 715 715 1 IEEIKDFLLTAR Unmodified 1446.8082 0.80823006 192 P63173;J3KT73;J3QL01;J3KSP2 RPL38 60S ribosomal protein L38 yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 70.309 70.329 3 0.017599 18367 YJC_A_20141124_01 61.11 23.497 2097800 1350400 747410 0 0 484 192 474 1139;1140 716 716 1 IEGEGSVLQAK Unmodified 1129.5979 0.59790293 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By MS/MS By matching 1 1 1 44.096 44.179 2 0.0098896 6417 YJC_C_20141124_01 52.576 19.96 9365300 118670 0 1393300 7853400 485 375 475 1141;1142;1143 717 717 1 IEGVYAR Unmodified 806.42865 0.42865276 61 P18077;F8WBS5;F8WB72;C9K025 RPL35A 60S ribosomal protein L35a yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 38.889 38.959 2 0.010547 7168 YJC_B_20141124_01 75.189 30.497 964030 430220 533800 0 0 486 61 476 1144;1145 718 718 1 IEIESFYEGEDFSETLTR Unmodified 2163.9848 0.98481003 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 1 1 76.213 76.26 2 0.017186 21571 YJC_B_20141124_01 48.371 35.531 8577800 5564000 1198900 429650 1385200 487 261 477 1146;1147;1148;1149 719;720 719 2 IETIEVMEDR Unmodified 1233.5911 0.59110299 319 P51991;P51991-2 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 yes no 0 0 0 By matching By matching By matching By MS/MS 1 56.826 56.925 2 0.016324 11423 YJC_D_20141124_01 59.418 24.663 821710 0 0 0 821710 488 319 478 1150 721 721 1 IEVIEIMTDR Unmodified 1217.6326 0.63257388 255 P09651;F8W6I7;P09651-3;P09651-2;F8VZ49;Q32P51;F8VTQ5;F8VYN5;H0YH80 HNRNPA1;HNRNPA1L2 Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2 yes no 0 0 0 By MS/MS By matching By matching By MS/MS 1 1 1 1 69.492 69.539 2 6.3515E-14 17765 YJC_A_20141124_01 92.866 53.562 3044200 1727800 264960 380140 671290 489 255 479 1151;1152;1153;1154 722;723 722 0 IEWLESHQDADIEDFKAK Unmodified 2173.0328 0.032763276 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 1 By matching By MS/MS By matching By MS/MS 1 1 1 62.136 62.216 3 0.0011559 13243 YJC_B_20141124_01 75.877 60.997 4848600 2165300 590800 0 2092600 490 261 480 1155;1156;1157 724;725 724 2 IFTSIGEDYDER Unmodified 1443.6518 0.65178899 58 P35232;D6RBK0;C9JZ20;E7ESE2;E9PCW0;C9JW96;P35232-2 PHB Prohibitin yes no 0 0 0 By MS/MS By matching By matching By matching 1 57.898 57.898 2 0.0086024 11744 YJC_A_20141124_01 55.291 41.545 527810 527810 0 0 0 491 58 481 1158 726 726 1 IFVGGIKEDTEEYNLR Unmodified 1881.9472 0.94724273 319 P51991;P51991-2 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 yes no 0 0 1 By matching By matching By MS/MS By MS/MS 1 1 2 60.005 60.041 2;3 7.0774E-46 12544 YJC_D_20141124_01 107.5 91.425 11899000 522720 0 1533600 9842600 492 319 482 1159;1160;1161;1162 727;728;729 729 3 IFVGGLNPEATEEK Unmodified 1502.7617 0.76167379 87 Q99729-3;D6R9P3;D6RD18;D6RBZ0;Q99729-2 HNRNPAB Heterogeneous nuclear ribonucleoprotein A/B yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 59.059 59.075 2 0 9746 YJC_C_20141124_01 203.85 151.03 12821000 383920 0 1375400 11061000 493 87 483 1163;1164;1165 730;731 730 2 IGAEVYHNLK Unmodified 1142.6084 0.60840804 242 P06733;P06733-2;K7EM90 ENO1 Alpha-enolase;Enolase yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 43.733 43.753 2 0.00071272 7554 YJC_A_20141124_01 82.831 50.08 442660 238340 204320 0 0 494 242 484 1166;1167 732;733 732 2 IGEHTPSALAIMENANVLAR Oxidation (M) 2122.0841 0.084087341 183 P04075;H3BQN4;J3KPS3;P04075-2;H3BU78;H3BR04;H3BPS8 ALDOA Fructose-bisphosphate aldolase A yes no 0 1 0 By MS/MS By matching By matching By matching 1 1 61.031 61.131 3 0.0027922 12729 YJC_A_20141124_01 56.121 42.419 2018300 1296000 0 0 722340 495 183 485 1168;1169 734 734 12 1 IGEHTPSALAIMENANVLAR Unmodified 2106.0892 0.089172718 183 P04075;H3BQN4;J3KPS3;P04075-2;H3BU78;H3BR04;H3BPS8 ALDOA Fructose-bisphosphate aldolase A yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 73.802 73.798 3 0.01749 19794 YJC_B_20141124_01 53.453 26.182 5565900 4287400 755200 523290 0 496 183 485 1170;1171;1172 735 735 1 IGGIGTVPVGR Unmodified 1024.6029 0.60292873 348 P68104;Q5VTE0;Q05639 EEF1A1;EEF1A1P5;EEF1A2 Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 51.327 51.399 2 1.0244E-15 9707 YJC_A_20141124_01 99.283 71.418 12536000 9033100 2056500 568370 877720 497 348 486 1173;1174;1175;1176 736 736 1 IGHRYIEIFR Unmodified 1302.7197 0.71968982 296 P31942;P31942-2;P31942-3 HNRNPH3 Heterogeneous nuclear ribonucleoprotein H3 yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 56.246 56.366 3 0.017899 11299 YJC_D_20141124_01 43.651 27.644 2428000 0 117720 0 2310200 498 296 487 1177;1178 737 737 0 IGLFGGAGVGK Unmodified 974.55492 0.5549159 239 P06576;F8VPV9;H0YH81;F8W079 ATP5B ATP synthase subunit beta, mitochondrial;ATP synthase subunit beta yes no 0 0 0 By MS/MS By matching By matching By matching 1 61.134 61.134 2 0.010167 12835 YJC_A_20141124_01 54.539 13.657 783260 783260 0 0 0 499 239 488 1179 738 738 1 IGLIQFCLSAPK Unmodified 1345.7428 0.74279303 318 P50991;P50991-2;B7Z9L0;B7Z2F4 CCT4 T-complex protein 1 subunit delta yes no 0 0 0 By MS/MS By matching By matching By matching 1 74.916 74.916 2 0.0044685 22047 YJC_A_20141124_01 67.519 53.221 449140 449140 0 0 0 500 318 489 1180 739 739 1 IGPLGLSPK Unmodified 880.5382 0.53820321 293 P30050 RPL12 60S ribosomal protein L12 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 55.162 55.162 2 0.028017 10815 YJC_A_20141124_01 55.461 27.69 1369900 1369900 0 0 0 501 293 490 1181 740 740 1 IGWSLTTSGMLLGEEEFSYGYSLK Unmodified 2667.2778 0.27782093 355 Q00839;Q00839-2;Q5RI18 HNRNPU Heterogeneous nuclear ribonucleoprotein U yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 90.088 90.084 3 0.0061782 34706 YJC_A_20141124_01 52.898 39.033 2276800 1208200 678810 389710 0 502 355 491 1182;1183;1184 741 741 1 IHAEFVQQK Unmodified 1098.5822 0.58219329 145 P19474;F5H012 TRIM21 E3 ubiquitin-protein ligase TRIM21 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 39.151 39.221 3 0.0047588 7247 YJC_B_20141124_01 82.75 42.692 1023500 490530 532970 0 0 503 145 492 1185;1186 742 742 1 IHFGGLIEEDDVILLAAALR Unmodified 2164.1892 0.18920434 168 Q6UB35;H0Y327 MTHFD1L Monofunctional C1-tetrahydrofolate synthase, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 92.829 92.799 3 0.0079405 36986 YJC_A_20141124_01 44.998 27.791 600830 469410 131420 0 0 504 168 493 1187;1188 743 743 0 IHFPLATYAPVISAEK Unmodified 1755.956 0.95595693 349;150 Q9BQE3;F5H5D3;F8VVB9;C9JDS9;P68363;P68366;A8MUB1 TUBA1C;KLK9;TUBA4A;TUBA1B Tubulin alpha-1C chain;Tubulin alpha-1B chain;Tubulin alpha-4A chain no no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 70.953 70.949 3 0.006806 19038 YJC_A_20141124_01 64.374 19.935 6778500 4939100 1401800 437550 0 505 150;349 494 1189;1190;1191 744 744 0 IIDVVYNASNNELVR Unmodified 1717.8999 0.89989861 333 P62241;Q5JR95 RPS8 40S ribosomal protein S8 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 63.811 63.832 2 0.0043398 13914 YJC_B_20141124_01 68.576 40.027 1653100 1334200 318900 0 0 506 333 495 1192;1193 745;746 746 2 IIELLNVTELTQNALINDELVEWK Unmodified 2809.5113 0.51132634 191 P42224;J3KPM9;P42224-2 STAT1 Signal transducer and activator of transcription 1-alpha/beta;Signal transducer and activator of transcription yes no 0 0 0 By matching By matching By MS/MS By matching 1 94.393 94.342 3 5.8675E-08 32265 YJC_C_20141124_01 69.704 46.58 6832200 0 0 6832200 0 507 191 496 1194 747 747 1 IILDLISESPIK Unmodified 1339.7963 0.79626839 332 P61978;P61978-2;Q5T6W2;Q5T6W5;P61978-3;Q5T6W1 HNRNPK Heterogeneous nuclear ribonucleoprotein K yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 77.135 77.155 2 0.0079757 23941 YJC_A_20141124_01 57.425 35.754 2239600 1801000 438570 0 0 508 332 497 1195;1196 748 748 1 IILVILDAISNIFQAAEK Unmodified 1970.1452 0.14521426 321 P52292 KPNA2 Importin subunit alpha-1 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 94.738 94.701 3 8.4863E-12 38501 YJC_A_20141124_01 87.388 73.429 5103100 2532300 1742700 828110 0 509 321 498 1197;1198;1199 749 749 1 IINADSEDPK Unmodified 1100.535 0.53496832 303 P35998;C9JLS9 PSMC2 26S protease regulatory subunit 7 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 35.12 35.191 2 0.016629 6392 YJC_B_20141124_01 53.237 30.596 294330 131380 162950 0 0 510 303 499 1200;1201 750 750 1 IINEPTAAAIAYGLDK Unmodified 1658.8879 0.88793694 261;262 P11021;P11142;E9PKE3;P11142-2;E9PN89;E9PLF4;E9PI65;P54652 HSPA5;HSPA8;HSPA2 78 kDa glucose-regulated protein;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2 no no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 2 2 1 1 68.801 68.84 2;3 2.7308E-10 16649 YJC_B_20141124_01 89.484 73.665 10117000 6666200 2315600 447150 688200 511 261;262 500 1202;1203;1204;1205;1206;1207 751;752;753;754;755 754 5 IINEPTAAAIAYGLDKR Unmodified 1814.989 0.98904797 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 1 1 65.39 65.438 3 0.0036217 15079 YJC_A_20141124_01 67.326 47.201 27490000 16378000 5611800 571700 4928800 512 261 501 1208;1209;1210;1211 756;757 756 2 IINEPTAAAIAYGLDR Unmodified 1686.8941 0.89408495 249;273 P17066;P08107;P08107-2;E7EP94 HSPA6;HSPA1A Heat shock 70 kDa protein 6;Heat shock 70 kDa protein 1A/1B no no 0 0 0 By MS/MS By MS/MS By matching By matching 2 2 70.118 70.138 2;3 0.0065773 18342 YJC_A_20141124_01 66.738 51.899 4702300 3977800 724420 0 0 513 273;249 502 1212;1213;1214;1215 758;759 758 2 IISKIENHEGVR Unmodified 1393.7678 0.76776222 268 P14618;P14618-3;P14618-2;H3BTN5;H3BQ34;Q504U3 PKM;PKM2 Pyruvate kinase PKM;Pyruvate kinase yes no 0 0 1 By MS/MS By matching By matching By matching 1 36.337 36.337 4 0.018581 5464 YJC_A_20141124_01 38.714 22.622 332750 332750 0 0 0 514 268 503 1216 760 760 1 IISNASCTTNCLAPLAK Unmodified 1832.9125 0.91245391 233 P04406;P04406-2;E7EUT5 GAPDH Glyceraldehyde-3-phosphate dehydrogenase yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 1 55.266 55.313 2 0.019248 10893 YJC_A_20141124_01 50.493 40.118 5553000 4382000 723310 276100 171580 515 233 504 1217;1218;1219;1220 761;762;763 761 3 IITHPNFNGNTLDNDIMLIK Unmodified 2282.1729 0.17290235 67 CON__P00761 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 3 2 2 2 71.925 71.967 2;3;4 2.6227E-23 19496 YJC_A_20141124_01 93.029 54.612 1644400000 1131200000 68893000 86661000 357650000 + 516 67 505 1221;1222;1223;1224;1225;1226;1227;1228;1229 764;765;766;767;768;769;770 764 7 IITHPNFNGNTLDNDIMLIK Oxidation (M) 2298.1678 0.16781697 67 CON__P00761 yes yes 0 1 0 By MS/MS By matching By MS/MS By MS/MS 1 1 1 1 69.277 69.324 3 9.3961E-239 14609 YJC_C_20141124_01 149.24 117.94 1662400000 378640000 243730000 558990000 481060000 + 517 67 505 1230;1231;1232;1233 771;772;773;774 772 2 3 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation (M) 3324.7136 0.71362475 67 CON__P00761 yes yes 0 1 1 By MS/MS By matching By matching By MS/MS 1 1 1 1 75.293 75.34 4 3.0845E-06 22309 YJC_A_20141124_01 46.771 39.945 30101000 5218100 3379200 8975400 12529000 + 518 67 506 1234;1235;1236;1237 775;776 775 2 1 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Unmodified 3308.7187 0.71871013 67 CON__P00761 yes yes 0 0 1 By matching By matching By MS/MS By MS/MS 1 1 1 1 77.535 77.582 5 0.001188 25275 YJC_D_20141124_01 35.221 26.364 8709000 989630 457070 1070300 6192000 + 519 67 506 1238;1239;1240;1241 777;778;779 779 3 IITLAGPTNAIFK Unmodified 1357.7969 0.79693709 23 Q15366;Q15366-4;Q15366-5;F8W0G4;F8VXH9;B4DLC0;F8VZX2;B4DXP5;Q15366-7;Q15366-6;Q15366-3;Q15366-2;F8W1G6;H3BRU6 PCBP2 Poly(rC)-binding protein 2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 71.214 71.235 2 3.4898E-05 19053 YJC_A_20141124_01 65.043 50.252 1200800 963960 236890 0 0 520 23 507 1242;1243 780 780 0 IITLTGPTNAIFK Unmodified 1387.8075 0.80750177 378 Q15365 PCBP1 Poly(rC)-binding protein 1 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 70.886 70.907 2 3.1912E-05 18795 YJC_A_20141124_01 79.886 46.125 1812700 1479100 333520 0 0 521 378 508 1244;1245 781 781 1 IKAIPQLQGYLR Unmodified 1398.8347 0.83471958 359 Q02878 RPL6 60S ribosomal protein L6 yes yes 0 0 1 By MS/MS By matching By matching By matching 1 1 62.847 62.868 3 0.0049609 13667 YJC_A_20141124_01 48.188 37.242 1156900 683350 473520 0 0 522 359 509 1246;1247 782 782 0 ILAQATSDLVNAIK Unmodified 1455.8297 0.82969378 391 Q9Y490;Q5TCU6 TLN1 Talin-1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 70.12 70.12 2 0.0088603 18162 YJC_A_20141124_01 54.402 41.607 320880 320880 0 0 0 523 391 510 1248 783 783 1 ILDSVGIEADDDR Unmodified 1416.6733 0.67325272 238 P05387 RPLP2 60S acidic ribosomal protein P2 yes yes 0 0 0 By MS/MS By matching By matching By MS/MS 1 1 53.746 53.796 2 1.4143E-14 10442 YJC_A_20141124_01 93.243 71.893 720970 426180 0 0 294780 524 238 511 1249;1250 784;785 784 2 ILFSSLILISK Unmodified 1232.7744 0.77441073 325 P55060;P55060-4;P55060-3 CSE1L Exportin-2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 83.914 83.914 2 0.0033386 29587 YJC_A_20141124_01 66.663 36.92 285790 285790 0 0 0 525 325 512 1251 786 786 1 ILGADTSVDLEETGR Unmodified 1574.7788 0.77878042 284 P25705;P25705-2;P25705-3;K7EK77;K7ESA0;K7EQH4;K7EJP1;K7ERX7 ATP5A1 ATP synthase subunit alpha, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 57.687 57.707 2 0.021081 11636 YJC_A_20141124_01 45.084 32.292 1384800 1060900 323890 0 0 526 284 513 1252;1253 787 787 1 ILGGSVLHLVLALR Unmodified 1459.9239 0.92386894 384 Q15843 NEDD8 NEDD8 yes yes 0 0 0 By MS/MS By matching By matching By matching 2 1 94.396 94.377 2;3 0.0036062 38132 YJC_A_20141124_01 74.987 65.985 3120500 2904300 216160 0 0 527 384 514 1254;1255;1256 788;789 789 2 ILIIGGSIANFTNVAATFK Unmodified 1949.0986 0.098598418 323 P53396;P53396-2;K7EIE7 ACLY ATP-citrate synthase yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 86.565 86.559 2 0.024167 31800 YJC_A_20141124_01 59.792 23.155 1096100 0 675110 420950 0 528 323 515 1257;1258;1259 790;791 790 2 ILLAELEQLK Unmodified 1168.7067 0.7067251 251 P08670;B0YJC4 VIM Vimentin yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 2 1 1 1 74.778 74.816 2 5.1895E-11 20453 YJC_B_20141124_01 99.283 52.464 11980000 8145100 1957300 810660 1066700 529 251 516 1260;1261;1262;1263;1264 792;793;794;795 794 3 ILQLSVAK Unmodified 870.55385 0.55385327 256 P0DJG4 THEGL Testicular haploid expressed gene protein-like yes yes 0 0 0 By matching By matching By matching By MS/MS 1 57.369 57.468 2 0.0085451 11623 YJC_D_20141124_01 85.161 4.7062 3586500 0 0 0 3586500 530 256 517 1265 796 796 1 ILSAENIPNLPPGGGLAGKR Unmodified 1973.1058 0.10580906 224 O75688;O75688-2;C9JIR6;O75688-4;B8ZZF0;O75688-3 PPM1B Protein phosphatase 1B yes no 0 0 1 By MS/MS By matching By matching By matching 1 60.997 60.997 3 3.2008E-23 13084 YJC_A_20141124_01 90.348 58.434 5259000 5259000 0 0 0 531 224 518 1266 797 797 1 ILSISADIETIGEILK Unmodified 1713.9764 0.9764176 332 P61978;P61978-2;Q5T6W2;Q5T6W5;P61978-3;Q5T6W1 HNRNPK Heterogeneous nuclear ribonucleoprotein K yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 94.448 94.428 2 1.9641E-175 38186 YJC_A_20141124_01 146.2 117.56 13740000 9937700 3352400 0 450000 532 332 519 1267;1268;1269 798;799 798 2 ILVATNLFGR Unmodified 1102.6499 0.64987892 26 Q13838;B4DP52;Q5STU3;F8VQ10;Q13838-2;O00148;H0Y400 DDX39B;hCG_2005638;DDX39A Spliceosome RNA helicase DDX39B;ATP-dependent RNA helicase DDX39A yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 69.082 69.102 2 1.7648E-16 16812 YJC_B_20141124_01 104.05 66.499 1541000 1229200 311810 0 0 533 26 520 1270;1271 800;801 801 2 IMGPNYTPGK Unmodified 1076.5325 0.5324659 265 P13639 EEF2 Elongation factor 2 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 44.742 44.742 2 0.01507 7848 YJC_A_20141124_01 60.102 36.73 329970 329970 0 0 0 534 265 521 1272 802 802 1 IMNTFSVVPSPK Oxidation (M) 1334.6904 0.69042311 245;350 P68371;P04350;Q13509-2;M0R042;M0R2D3;M0QYM7;G3V2A3;P07437;Q5JP53;Q5ST81 TUBB4B;TUBB4A;TUBB3;TUBB Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta chain no no 0 1 0 By MS/MS By matching By matching By matching 1 1 56.326 56.397 2 4.9568E-11 11314 YJC_A_20141124_01 90.793 58.226 1739900 1615000 124880 0 0 535 350;245 522 1273;1274 803 803 21 1 INALTAASEAACLIVSVDETIK Unmodified 2288.1934 0.19336302 38 Q99832;B7Z1C9;F5GZK5;Q99832-4;Q99832-3;Q99832-2 CCT7 T-complex protein 1 subunit eta yes no 0 0 0 By matching By matching By MS/MS By matching 1 94.519 94.468 3 5.4934E-20 32390 YJC_C_20141124_01 83.251 53.209 2696700 0 0 2696700 0 536 38 523 1275 804 804 0 INVNEIFYDLVR Unmodified 1493.7878 0.78782897 4 P61224;P62834;A6NIZ1;F5H823;B7ZB78;F5GZG1;P61224-2;P61224-4;P61224-3 RAP1B;RAP1A Ras-related protein Rap-1b;Ras-related protein Rap-1A;Ras-related protein Rap-1b-like protein yes no 0 0 0 By MS/MS By matching By matching By matching 1 90.058 90.058 2 0.0019646 34695 YJC_A_20141124_01 72.891 46.779 658670 658670 0 0 0 537 4 524 1276 805 805 1 IPALDLLIK Unmodified 994.64267 0.64266828 111 P78527;E7EUY0;P78527-2;F5GX40 PRKDC DNA-dependent protein kinase catalytic subunit yes no 0 0 0 By MS/MS By matching By matching By matching 1 76.475 76.475 2 0.021625 23512 YJC_A_20141124_01 54.722 38.716 352940 352940 0 0 0 538 111 525 1277 806 806 0 IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR Unmodified 3724.8526 0.85256107 356 Q01105;Q01105-2;Q01105-3;Q01105-4 SET Protein SET yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 91.564 91.534 4 0.00060989 35991 YJC_A_20141124_01 28.445 20.461 2465600 2005600 459920 0 0 539 356 526 1278;1279 807;808 807 0 IPNPDFFEDLEPFR Unmodified 1734.8253 0.82533668 19 P27824;B4E2T8;B4DGP8 CANX Calnexin yes no 0 0 0 By MS/MS By matching By matching By matching 1 85.294 85.294 2 0.017427 30893 YJC_A_20141124_01 38.995 26.503 451110 451110 0 0 0 540 19 527 1280 809 809 0 IQEIIEQLDVTTSEYEK Unmodified 2037.0154 0.015381878 260 P10809 HSPD1 60 kDa heat shock protein, mitochondrial yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 72.215 72.235 2 4.6718E-39 19785 YJC_A_20141124_01 104.84 88.822 2380600 1930600 450060 0 0 541 260 528 1281;1282 810 810 1 IQHQDWTGGK Unmodified 1168.5625 0.56252048 65;64 CON__ENSEMBL:ENSBTAP00000024466;CON__ENSEMBL:ENSBTAP00000024462 no no 0 0 0 By matching By matching By MS/MS By MS/MS 2 2 35.699 35.773 2;3 2.3773E-10 4708 YJC_C_20141124_01 97.597 26.781 10287000 0 0 5190400 5096400 + 542 65;64 529 1283;1284;1285;1286 811;812;813;814 811 4 IQHQDWTGGKEFK Unmodified 1572.7685 0.76849051 65;64 CON__ENSEMBL:ENSBTAP00000024466;CON__ENSEMBL:ENSBTAP00000024462 no no 0 0 1 By matching By matching By matching By MS/MS 1 2 43.674 43.823 3;4 9.0195E-09 7764 YJC_D_20141124_01 88.803 69.993 20617000 0 0 7980500 12636000 + 543 65;64 530 1287;1288;1289 815;816 816 2 IQTQPGYANTLR Unmodified 1360.7099 0.709913 157 Q00325;Q00325-2;F8VVM2 SLC25A3 Phosphate carrier protein, mitochondrial yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 46.458 46.478 2 1.9741E-05 8396 YJC_A_20141124_01 81.239 11.589 1246600 901010 345560 0 0 544 157 531 1290;1291 817;818 817 2 IQVRLGEHNIDVLEGNEQFINAAK Unmodified 2706.4089 0.40892695 67 CON__P00761 yes yes 0 0 1 By MS/MS By matching By matching By MS/MS 2 1 2 68.438 68.507 3;4 4.2198E-06 17179 YJC_A_20141124_01 66.467 52.583 28992000 5337700 0 1222300 22432000 + 545 67 532 1292;1293;1294;1295;1296 819;820;821 819 3 ISAVESQPSR Unmodified 1072.5513 0.55128709 106 Q9Y520;E7EPN9;Q9Y520-2;Q9Y520-3;Q9Y520-6;Q9Y520-4;Q9Y520-5;Q9Y520-7 PRRC2C Protein PRRC2C yes no 0 0 0 By MS/MS By matching By matching By MS/MS 1 1 43.449 43.549 2 0.012339 7709 YJC_D_20141124_01 61.593 10.066 78814000 23048000 0 0 55765000 546 106 533 1297;1298 822;823 823 2 ISEQFTAMFR Unmodified 1228.591 0.59104341 245;350 P68371;P04350;Q13509-2;P07437;Q5JP53;Q5ST81;Q9BVA1;Q13885;E9PBJ4 TUBB4B;TUBB4A;TUBB;TUBB2B;TUBB2A Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta chain;Tubulin beta-2B chain;Tubulin beta-2A chain no no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 68.659 68.655 2 0.0006367 17087 YJC_A_20141124_01 75.739 56.283 6826700 5355600 1065900 405210 0 547 350;245 534 1299;1300;1301 824 824 1 ISGLIYEETR Unmodified 1179.6136 0.61355299 342 P62805 HIST1H4A Histone H4 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 55.622 55.702 2 0.0077778 11108 YJC_A_20141124_01 64.121 40.749 1440200 731620 385600 0 322940 548 342 535 1302;1303;1304 825 825 1 ISIGGGSCAISGGYGSR Unmodified 1597.7519 0.75185416 68 P02538;CON__P02538;P48668;CON__P48668;CON__P04259 KRT6A;KRT6C Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C no no 0 0 0 By matching By matching By MS/MS By matching 1 1 53.584 53.628 2 0.0018745 8462 YJC_C_20141124_01 65.105 43.851 303390 0 188230 115160 0 + 549 68 536 1305;1306 826;827 826 2 ISLPLPNFSSLNLR Unmodified 1569.8879 0.88787736 251 P08670;B0YJC4 VIM Vimentin yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 83.178 83.208 2 3.0869E-50 29027 YJC_A_20141124_01 112.02 91.743 9606100 6989700 2197100 419280 0 550 251 537 1307;1308;1309 828;829 828 2 ISSERSGTPK Unmodified 1060.5513 0.55128709 102 Q9P0K7;E7EMX7;Q9P0K7-3;Q9P0K7-2 RAI14 Ankycorbin yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 1 1 33.681 33.753 2 0.011998 6155 YJC_B_20141124_01 53.124 14.556 1327900 186380 290240 220720 630590 551 102 538 1310;1311;1312;1313 830 830 0 ISSSSFSR Unmodified 869.4243 0.42429566 74 P05787;CON__P05787;P05787-2;F8VUG2;F8W1U3;F8VRG4;F8VQY3 KRT8 Keratin, type II cytoskeletal 8 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 38.496 38.576 2 0.0085236 6046 YJC_A_20141124_01 70.816 5.3508 1624900 731940 590380 0 302590 + 552 74 539 1314;1315;1316 831 831 1 ISVYYNEATGGK Unmodified 1300.6299 0.62993134 245 P07437;Q5JP53;E9PBJ4 TUBB Tubulin beta chain yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 49.344 49.364 2 0.0051958 9128 YJC_A_20141124_01 69.345 47.949 4306800 3438400 868330 0 0 553 245 540 1317;1318 832;833 832 2 ITAFVPNDGCLNFIEENDEVLVAGFGR Unmodified 2995.4386 0.4385721 91 P62266;D6RD47 RPS23 40S ribosomal protein S23 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 89.504 89.5 3 4.8893E-05 34161 YJC_A_20141124_01 57.238 47.161 7043200 4313800 1629800 1099600 0 554 91 541 1319;1320;1321 834 834 1 ITESEEVVSR Unmodified 1147.5721 0.57208211 232 P02545;P02545-3;P02545-2;P02545-6 LMNA Prelamin-A/C;Lamin-A/C yes no 0 0 0 By MS/MS By matching By matching By matching 1 39.083 39.083 2 0.022051 6184 YJC_A_20141124_01 59.265 36.579 0 0 0 0 0 555 232 542 1322 835 835 1 ITPSYVAFTPEGER Unmodified 1565.7726 0.77257283 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 1 1 60.923 60.97 2 0.0040345 12871 YJC_D_20141124_01 74.133 57.514 13922000 7462000 3959700 380350 2120100 556 261 543 1323;1324;1325;1326 836 836 1 ITRYQGVNLYVK Unmodified 1452.8089 0.80889876 107 P11940;E7EQV3;E7ERJ7;P11940-2;H0YAR2;H0YAP2 PABPC1 Polyadenylate-binding protein 1 yes no 0 0 1 By MS/MS By matching By matching By MS/MS 1 1 1 52.872 52.919 3 0.0091798 10202 YJC_A_20141124_01 71.888 52.644 2318200 1289200 402380 0 626600 557 107 544 1327;1328;1329 837;838 837 2 ITVVGVGAVGMACAISILMK Oxidation (M) 2005.0774 0.077410745 229 P00338;P00338-3;P00338-2;P00338-5;F5GYU2;F5GXY2;P00338-4;F5GXH2;F5GZQ4;F5H5J4;F5H6W8;F5H8H6;F5GXC7;F5GWW2 LDHA L-lactate dehydrogenase A chain yes no 0 1 0 By MS/MS By matching By matching By matching 1 1 91.847 91.817 3 4.445E-07 36190 YJC_A_20141124_01 75.743 49.921 1158600 962620 196030 0 0 558 229 545 1330;1331 839 839 16 1 ITVVGVGAVGMACAISILMK Unmodified 1989.0825 0.082496122 229 P00338;P00338-3;P00338-2;P00338-5;F5GYU2;F5GXY2;P00338-4;F5GXH2;F5GZQ4;F5H5J4;F5H6W8;F5H8H6;F5GXC7;F5GWW2 LDHA L-lactate dehydrogenase A chain yes no 0 0 0 By matching By matching By MS/MS By matching 1 1 1 94.516 94.479 2 0.0077602 32387 YJC_C_20141124_01 54.058 32.382 12016000 2921100 4082900 5012300 0 559 229 545 1332;1333;1334 840 840 0 ITVVGVGQVGMACAISILGK Unmodified 1972.0849 0.084938963 9 P07195;A8MW50;C9J7H8;F5H793 LDHB L-lactate dehydrogenase B chain;L-lactate dehydrogenase yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 2 2 2 88.604 88.601 2;3 0.01712 28365 YJC_C_20141124_01 47.618 40.346 11274000 7836100 1793400 1644100 0 560 9 546 1335;1336;1337;1338;1339;1340 841;842;843 843 2 IVATKPLYVALAQR Unmodified 1541.9293 0.92934824 107 P11940;E7EQV3;E7ERJ7;P11940-2;H0YAR2;Q9H361;H0YB86 PABPC1;PABPC3 Polyadenylate-binding protein 1;Polyadenylate-binding protein 3 yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 1 60.642 60.638 3 0.003764 12690 YJC_B_20141124_01 55.291 40.782 1345100 849220 418890 77010 0 561 107 547 1341;1342;1343 844 844 0 IVAVIGAVVDVQFDEGLPPILNALEVQGR Unmodified 3030.6754 0.67537197 239 P06576;F8VPV9;F8W0P7 ATP5B ATP synthase subunit beta, mitochondrial yes no 0 0 0 By matching By matching By MS/MS By matching 1 94.421 94.37 3 3.0177E-05 32279 YJC_C_20141124_01 61.429 47.005 0 0 0 0 0 562 239 548 1344 845 845 1 IVLELFADIVPK Unmodified 1355.8064 0.80643914 368 Q08752 PPID Peptidyl-prolyl cis-trans isomerase D yes yes 0 0 0 By MS/MS By matching By matching By matching 1 88.864 88.864 2 0.0075774 33542 YJC_A_20141124_01 58.781 48.938 339430 339430 0 0 0 563 368 549 1345 846 846 1 IVLQKYHTINGHNAEVR Unmodified 1991.0701 0.070092256 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 42.815 42.939 5 0.027061 7549 YJC_D_20141124_01 27.255 27.255 1876600 0 0 213810 1662800 564 278 550 1346;1347 847 847 0 IVSQLLTLMDGLK Unmodified 1429.8214 0.82143728 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 87.482 87.452 2 0.0015437 29191 YJC_B_20141124_01 75.764 58.099 1396800 974080 422770 0 0 565 326 551 1348;1349 848;849 849 2 IYVDDGLISLQVK Unmodified 1461.8079 0.80789571 268 P14618;P14618-3;P14618-2;H3BTN5;H3BQ34 PKM Pyruvate kinase PKM;Pyruvate kinase yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 71.794 71.814 2 1.1019E-78 19528 YJC_A_20141124_01 125.03 92.603 3799500 3279800 519690 0 0 566 268 552 1350;1351 850;851 850 2 KAGPPPEKR Unmodified 978.56106 0.56106391 413 Q9BUJ2;Q9BUJ2-2;Q9BUJ2-3;B7Z4B8;Q9BUJ2-4;M0R3F1;Q9BUJ2-5 HNRNPUL1 Heterogeneous nuclear ribonucleoprotein U-like protein 1 yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 1 1 16.951 16.923 3 7.8861E-09 2116 YJC_D_20141124_01 100.25 65.993 2755700 100020 320930 120990 2213700 567 413 553 1352;1353;1354;1355 852 852 1 KAIVICPTDEDLK Unmodified 1500.7858 0.78578005 413 Q9BUJ2;Q9BUJ2-2;Q9BUJ2-3;B7Z4B8;Q9BUJ2-4;M0R3F1 HNRNPUL1 Heterogeneous nuclear ribonucleoprotein U-like protein 1 yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 1 50.476 50.573 3 0.010982 9577 YJC_D_20141124_01 53.034 23.03 2262600 0 285320 308720 1668500 568 413 554 1356;1357;1358 853 853 1 KAIVICPTDEDLKDR Unmodified 1771.9138 0.91383411 413 Q9BUJ2;Q9BUJ2-2;Q9BUJ2-3;B7Z4B8;Q9BUJ2-4;M0R3F1 HNRNPUL1 Heterogeneous nuclear ribonucleoprotein U-like protein 1 yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 47.49 47.61 3 9.9415E-109 8775 YJC_D_20141124_01 130.47 109.22 4076000 0 333010 0 3743000 569 413 555 1359;1360 854 854 1 KALAAAGYDVEK Unmodified 1234.6558 0.65575216 257;272 P10412;P16402;Q02539;P22492;P16403 HIST1H1E;HIST1H1D;HIST1H1A;HIST1H1T;HIST1H1C Histone H1.4;Histone H1.3;Histone H1.1;Histone H1t;Histone H1.2 no no 0 0 1 By matching By MS/MS By matching By matching 1 40.988 41.129 2 0.00057072 7752 YJC_B_20141124_01 69.92 37.061 0 0 0 0 0 570 257;272 556 1361 855 855 1 KALAAAGYDVEKNNSR Unmodified 1705.8747 0.87474649 257;272 P10412;P16402;Q02539;P22492;P16403 HIST1H1E;HIST1H1D;HIST1H1A;HIST1H1T;HIST1H1C Histone H1.4;Histone H1.3;Histone H1.1;Histone H1t;Histone H1.2 no no 0 0 2 By matching By MS/MS By matching By matching 1 1 1 1 38.251 38.323 3 0.012593 7028 YJC_B_20141124_01 59.345 45.48 2397400 568990 721370 198220 908800 571 257;272 557 1362;1363;1364;1365 856 856 1 KASGPPKGPSR Unmodified 1080.604 0.60399136 176 P52943;H0YFA4;P52943-2 CRIP2 Cysteine-rich protein 2 yes no 0 0 2 By matching By MS/MS By matching By matching 1 21.986 22.027 3 0.0087026 4177 YJC_B_20141124_01 62.694 32.007 160290 0 160290 0 0 572 176 558 1366 857 857 1 KASGPPVSELITK Unmodified 1325.7555 0.7554662 257;272 P10412;P16402;P16403 HIST1H1E;HIST1H1D;HIST1H1C Histone H1.4;Histone H1.3;Histone H1.2 no no 0 0 1 By matching By MS/MS By matching By matching 1 2 2 2 50.158 50.241 2;3 8.3233E-63 10033 YJC_B_20141124_01 116.9 80.902 10353000 693460 5762100 1151200 2745900 573 257;272 559 1367;1368;1369;1370;1371;1372;1373 858;859 858 2 KATGPPVSELITK Unmodified 1339.7711 0.77111627 271 P16401 HIST1H1B Histone H1.5 yes yes 0 0 1 By matching By matching By MS/MS By matching 1 1 50.814 50.938 3 0.025449 7906 YJC_C_20141124_01 44.968 25.724 1179500 0 0 456820 722640 574 271 560 1374;1375 860 860 1 KAVPKEDIYSGGGGGGSR Unmodified 1733.8697 0.86966111 369 Q13151 HNRNPA0 Heterogeneous nuclear ribonucleoprotein A0 yes yes 0 0 2 By matching By matching By matching By MS/MS 1 34.898 34.998 4 0.023691 5260 YJC_D_20141124_01 36.469 25.029 144620 0 0 0 144620 575 369 561 1376 861 861 1 KDGNASGTTLLEALDCILPPTRPTDK Unmodified 2782.4171 0.41710838 348 P68104;Q5VTE0 EEF1A1;EEF1A1P5 Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3 yes no 0 0 2 By MS/MS By matching By matching By matching 1 1 81.338 81.359 4 0.0086795 27610 YJC_A_20141124_01 33.224 22.415 1673300 1274900 398390 0 0 576 348 562 1377;1378 862 862 1 KDLYANTVLSGGTTMYPGIADR Oxidation (M) 2358.1526 0.15256084 327 P60709;P63261 ACTB;ACTG1 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed yes no 0 1 1 By MS/MS By matching By matching By matching 1 1 61.393 61.413 3 0.00070781 12935 YJC_A_20141124_01 51.777 37.259 1136300 803320 332930 0 0 577 327 563 1379;1380 863 863 40 1 KDLYANTVLSGGTTMYPGIADR Unmodified 2342.1576 0.15764621 327 P60709;P63261 ACTB;ACTG1 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed yes no 0 0 1 By MS/MS By matching By matching By matching 1 65.347 65.347 3 2.0271E-29 15064 YJC_A_20141124_01 88.627 64.345 1364000 1364000 0 0 0 578 327 563 1381 864 864 0 KDSETGENIR Unmodified 1147.5469 0.54692999 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 1 By matching By matching By matching By MS/MS 1 1 2 26.493 26.589 2;3 3.3168E-05 3495 YJC_D_20141124_01 89.356 56.942 2020000 0 73821 89984 1856200 579 307 564 1382;1383;1384;1385 865;866 866 2 KEDLVFIFWAPESAPLK Unmodified 1989.0612 0.061150279 281 P23528;G3V1A4;E9PP50;E9PK25;E9PQB7;Q9Y281;Q9Y281-3 CFL1;CFL2 Cofilin-1;Cofilin-2 yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 83.954 83.975 3 0.02392 26740 YJC_B_20141124_01 45.618 29.627 2087600 1339800 747830 0 0 580 281 565 1386;1387 867;868 868 2 KEDVGTVVGIDLGTTYSCVGVFKNGR Unmodified 2770.396 0.39597901 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 2 By MS/MS By matching By matching By MS/MS 1 1 70.147 70.247 4 0.003395 18313 YJC_A_20141124_01 37.688 28.667 3924800 2920700 0 0 1004100 581 261 566 1388;1389 869;870 869 2 KEEIIKTLSK Unmodified 1187.7125 0.71253876 193 P84098;J3QR09;J3KTE4 RPL19 60S ribosomal protein L19;Ribosomal protein L19 yes no 0 0 2 By MS/MS By matching By matching By matching 1 1 1 40.024 40.138 3 0.02804 6492 YJC_A_20141124_01 59.265 27.011 979300 365270 462000 0 152030 582 193 567 1390;1391;1392 871 871 1 KEELVSGELPR Unmodified 1255.6772 0.67721588 397 Q702N8;Q702N8-2 XIRP1 Xin actin-binding repeat-containing protein 1 yes no 0 0 1 By MS/MS By matching By matching By matching 1 49.125 49.125 2 0.00134 9119 YJC_A_20141124_01 53.237 10.44 262720 262720 0 0 0 583 397 568 1393 872 872 0 KFESEILEAISQNSVVIIR Unmodified 2174.1947 0.19468365 366 Q08211 DHX9 ATP-dependent RNA helicase A yes yes 0 0 1 By MS/MS By matching By matching By matching 1 83.253 83.253 3 0.011742 29108 YJC_A_20141124_01 55.437 38.352 595270 595270 0 0 0 584 366 569 1394 873 873 1 KGESGQSWPR Unmodified 1130.5469 0.54687041 16 Q15185;B4DP11;B4DDC6;B4DP21 PTGES3 Prostaglandin E synthase 3 yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 35.498 35.568 3 0.023303 6458 YJC_B_20141124_01 47.844 34.752 514310 249030 265280 0 0 585 16 570 1395;1396 874 874 1 KGFAELQTDMTDLTKELNR Unmodified 2209.1049 0.10488236 432 Q9Y4D7;Q9Y4D7-2 PLXND1 Plexin-D1 yes no 0 0 2 By matching By matching By MS/MS By matching 1 1 64.909 64.982 3 0.0024549 12659 YJC_C_20141124_01 53.255 24.639 13300000000 0 0 1715600000 11585000000 586 432 571 1397;1398 875 875 0 KGLDPYNVLAPK Unmodified 1313.7343 0.73433683 259 P10606 COX5B Cytochrome c oxidase subunit 5B, mitochondrial yes yes 0 0 1 By matching By MS/MS By matching By matching 1 1 58.103 58.124 3 0.0059733 12050 YJC_B_20141124_01 61.419 45.917 492840 234780 258060 0 0 587 259 572 1399;1400 876 876 1 KGVNLPGAAVDLPAVSEK Unmodified 1763.9781 0.97814893 268 P14618;P14618-3;P14618-2;H3BTN5;H3BQ34;Q504U3 PKM;PKM2 Pyruvate kinase PKM;Pyruvate kinase yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 60.715 60.735 3 2.2182E-07 12792 YJC_B_20141124_01 83.37 68.796 1789900 1083600 706360 0 0 588 268 573 1401;1402 877;878 878 2 KIFVGGIKEDTEEYNLR Unmodified 2010.0422 0.042205751 319 P51991;P51991-2 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 56.273 56.296 3 2.1073E-27 11229 YJC_D_20141124_01 97.823 66.047 4820500 0 0 529930 4290500 589 319 574 1403;1404 879 879 1 KISQAVRQQQEQQLAR Unmodified 1910.0446 0.044605787 173 Q9UPQ9;Q9UPQ9-1;H0Y720;Q9UPQ9-2 TNRC6B Trinucleotide repeat-containing gene 6B protein yes no 0 0 2 By matching By matching By matching By MS/MS 1 36.551 36.65 4 0.019105 5642 YJC_D_20141124_01 38.199 27.385 547990 0 0 0 547990 590 173 575 1405 880 880 1 KKLLADQAEAR Unmodified 1241.7092 0.70918471 193 P84098;J3QR09;J3KTE4 RPL19 60S ribosomal protein L19;Ribosomal protein L19 yes no 0 0 2 By MS/MS By MS/MS By matching By matching 1 1 31.285 31.355 3 0.00032122 4297 YJC_A_20141124_01 77.387 32.823 947180 589440 357750 0 0 591 193 576 1406;1407 881;882 881 2 KLDRLAYIAHPK Unmodified 1423.83 0.82996855 309 P47914 RPL29 60S ribosomal protein L29 yes yes 0 0 2 By MS/MS By MS/MS By matching By matching 1 2 1 44.469 44.539 3 0.0067441 7874 YJC_A_20141124_01 48.044 31.952 1054600 459380 336890 0 258350 592 309 577 1408;1409;1410;1411 883;884 883 0 KLELSDNIISGGLEVLAEK Unmodified 2027.115 0.11503634 125 Q9BTT0;Q5TB19;E9PLC4;Q9BTT0-3 ANP32E Acidic leucine-rich nuclear phosphoprotein 32 family member E yes no 0 0 1 By MS/MS By matching By matching By matching 1 80.622 80.622 3 0.024679 27127 YJC_A_20141124_01 42.068 19.242 502570 502570 0 0 0 593 125 578 1412 885 885 1 KLEVNEAELLR Unmodified 1312.7351 0.73506511 394 Q6NZI2 PTRF Polymerase I and transcript release factor yes yes 0 0 1 By matching By MS/MS By matching By matching 1 56.59 56.731 3 1.2495E-10 11724 YJC_B_20141124_01 92.247 43.058 664260 0 664260 0 0 594 394 579 1413 886 886 1 KLFIGGLSFETTDDSLR Unmodified 1897.9785 0.97854286 319 P51991;P51991-2 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 yes no 0 0 1 By matching By matching By MS/MS By MS/MS 1 1 72.249 72.323 3 0.0023329 20737 YJC_D_20141124_01 63.546 48.666 6744200 0 0 734200 6010000 595 319 580 1414;1415 887;888 888 2 KLFIGGLSFETTEESLR Unmodified 1926.0098 0.0098429899 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 1 72.848 72.897 3 0.0027803 21204 YJC_D_20141124_01 66.068 27.035 3243200 427800 0 663700 2151700 596 278 581 1416;1417;1418 889 889 1 KLFVGGIKEDTEEHHLR Unmodified 2007.0538 0.05377349 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 2 By matching By matching By matching By MS/MS 2 2 45.917 46.041 4 0.0047739 8545 YJC_D_20141124_01 57.53 39.296 5178700 0 0 1532900 3645900 597 278 582 1419;1420;1421;1422 890;891 891 2 KLNVTEQEK Unmodified 1087.5873 0.58733824 242 P06733;K7EM90 ENO1 Alpha-enolase;Enolase yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 29.974 30.044 2 0.010184 5429 YJC_B_20141124_01 67.207 15.258 244510 118870 125640 0 0 598 242 583 1423;1424 892 892 1 KLTFGSLAGTTVALIILALGFVLSAQVSPR Unmodified 3042.7845 0.78452849 411 Q96QE2 SLC2A13 Proton myo-inositol cotransporter yes yes 0 0 1 By MS/MS By matching By matching By matching 1 93.696 93.696 3 0.0014687 37693 YJC_A_20141124_01 36.483 30.732 0 0 0 0 0 599 411 584 1425 893 893 1 KPANDITSQLEINFGDLGR Unmodified 2087.0647 0.064732107 402 Q8NC51;Q8NC51-3;Q8NC51-4;Q8NC51-2 SERBP1 Plasminogen activator inhibitor 1 RNA-binding protein yes no 0 0 1 By MS/MS By matching By matching By matching 1 74.017 74.017 3 0.00014714 21291 YJC_A_20141124_01 74.812 60.421 1088100 1088100 0 0 0 600 402 585 1426 894 894 1 KPLVIIAEDVDGEALSTLVLNR Unmodified 2364.3264 0.3264261 260 P10809 HSPD1 60 kDa heat shock protein, mitochondrial yes yes 0 0 1 By MS/MS By MS/MS By MS/MS By MS/MS 2 2 1 1 83.271 83.369 3 9.3339E-17 25071 YJC_C_20141124_01 88.471 62.11 50660000 33658000 9769900 5825600 1406700 601 260 586 1427;1428;1429;1430;1431;1432 895;896;897;898 897 4 KQTALVELLK Unmodified 1141.7071 0.70705945 72 CON__P02769 yes yes 0 0 1 By MS/MS By matching By matching By MS/MS 1 1 59.539 59.589 3 0.018919 12342 YJC_D_20141124_01 59.265 36.703 1363400 511710 0 0 851720 + 602 72 587 1433;1434 899;900 900 2 KSDIDEIVLVGGSTR Unmodified 1587.8468 0.84680041 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 1 By matching By MS/MS By matching By matching 1 1 1 1 59.912 59.934 3 0.01424 12502 YJC_B_20141124_01 52.599 38.734 5148800 2516800 1787500 301260 543180 603 261 588 1435;1436;1437;1438 901 901 1 KTGQAPGFSYTDANK Unmodified 1583.758 0.7579854 79 CON__P62894 yes yes 0 0 1 By MS/MS By matching By matching By matching 1 1 42.885 42.955 3 0.024684 7381 YJC_A_20141124_01 44.246 31.451 1641600 890060 751500 0 0 + 604 79 589 1439;1440 902 902 1 KTSPLNFK Unmodified 933.52837 0.5283668 363 Q06187;Q5JY90;Q06187-2 BTK Tyrosine-protein kinase BTK yes no 0 0 1 By matching By MS/MS By matching By matching 1 25.748 25.889 2 0.014685 4731 YJC_B_20141124_01 67.981 10.122 4786600 0 4786600 0 0 605 363 590 1441 903 903 1 KVESLQEEIAFLK Unmodified 1532.845 0.84500949 251 P08670;B0YJC4;B0YJC5;Q5JVS8 VIM Vimentin yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 1 69.247 69.243 3 0.0031803 16831 YJC_B_20141124_01 63.727 38.184 5799300 4306200 977760 515390 0 606 251 591 1442;1443;1444 904;905 905 2 KVPQVSTPTLVEVSR Unmodified 1638.9305 0.93047046 72;71 CON__P02769;P02768;CON__P02768-1;C9JKR2;H0YA55;D6RHD5;B7WNR0;P02768-2 ALB Serum albumin no no 0 0 1 By MS/MS By MS/MS By MS/MS By MS/MS 2 2 2 2 55.058 55.105 2;3 5.0305E-07 10911 YJC_A_20141124_01 72.428 55.226 33851000 10596000 4766400 2356100 16132000 + 607 72;71 592 1445;1446;1447;1448;1449;1450;1451;1452 906;907;908;909;910;911 906 4 KYEMFAQTLQQSR Oxidation (M) 1644.793 0.7929907 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 0 1 1 By MS/MS By matching By matching By matching 1 49.955 49.955 3 0.0011981 9308 YJC_A_20141124_01 54.951 31.807 743440 743440 0 0 0 608 326 593 1453 912 912 39 1 KYTLPPGVDPTQVSSSLSPEGTLTVEAPMPK Unmodified 3225.6479 0.64789617 234 P04792 HSPB1 Heat shock protein beta-1 yes yes 0 0 1 By MS/MS By matching By matching By matching 1 70.281 70.281 3 0.0088053 18395 YJC_A_20141124_01 34.166 23.688 1530000 1530000 0 0 0 609 234 594 1454 913 913 1 LAAAFAVSR Unmodified 904.51305 0.51305109 143 P55084;F5GZQ3;P55084-2 HADHB Trifunctional enzyme subunit beta, mitochondrial;3-ketoacyl-CoA thiolase yes no 0 0 0 By MS/MS By matching By matching By matching 1 50.917 50.917 2 0.024541 9604 YJC_A_20141124_01 59.067 18.964 214370 214370 0 0 0 610 143 595 1455 914 914 1 LAALNPESNTAGLDIFAK Unmodified 1843.968 0.96797818 217 O00299 CLIC1 Chloride intracellular channel protein 1 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 73.3 73.296 2 0.00011478 20734 YJC_A_20141124_01 78.501 57.187 3422500 2637100 592530 192790 0 611 217 596 1456;1457;1458 915 915 1 LAATNALLNSLEFTK Unmodified 1604.8774 0.87737225 376 Q14974;F5H4R7;J3KTM9;Q14974-2 KPNB1 Importin subunit beta-1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 77.232 77.252 2 2.7336E-05 24184 YJC_A_20141124_01 80.411 32.195 1722100 1379400 342660 0 0 612 376 597 1459;1460 916 916 1 LADILSPR Unmodified 883.51272 0.51271674 410 Q96PE2 ARHGEF17 Rho guanine nucleotide exchange factor 17 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 50.933 50.953 2 0.010851 9578 YJC_A_20141124_01 69.628 26.545 2620800 1754200 866650 0 0 613 410 598 1461;1462 917 917 1 LADQCTGLQGFLVFHSFGGGTGSGFTSLLMER Unmodified 3389.6173 0.61728152 349;150 Q9BQE3;F5H5D3;F8VQQ4;P68363 TUBA1C;TUBA1A;TUBA1B Tubulin alpha-1C chain;Tubulin alpha-1B chain no no 0 0 0 By MS/MS By matching By matching By matching 1 1 90.044 90.014 4 0.01072 34718 YJC_A_20141124_01 32.796 20.184 3897900 3382900 515050 0 0 614 150;349 599 1463;1464 918 918 1 LAEQAER Unmodified 815.41373 0.41373097 114;334;286 P62258;P61981;P31947;Q04917;P31947-2;P63104;E7EX29;P31946;E7ESK7;P31946-2;E5RGE1;E5RIR4;E9PD24;E7EVZ2;I3L0W5;F8WEB6;A2IDB1;Q4VY20;B4DJF2;Q4VY19;I3L3T1;E9PG15;P27348 YWHAE;YWHAG;SFN;YWHAH;YWHAZ;YWHAB;YWHAQ 14-3-3 protein epsilon;14-3-3 protein gamma;14-3-3 protein gamma, N-terminally processed;14-3-3 protein sigma;14-3-3 protein eta;14-3-3 protein zeta/delta;14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed;14-3-3 protein theta no no 0 0 0 By MS/MS By matching By matching By matching 1 1 26.105 26.176 2 0.014983 3318 YJC_A_20141124_01 69.198 5.8915 689130 507920 181210 0 0 615 334;114;286 600 1465;1466 919 919 1 LAGESESNLR Unmodified 1074.5306 0.53055165 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 36.805 36.876 2 0.01129 6751 YJC_B_20141124_01 62.166 31.554 957460 470080 487380 0 0 616 326 601 1467;1468 920 920 1 LALVTGGEIASTFDHPELVK Unmodified 2096.1154 0.11537069 351 P78371;F8VQ14;F5GWF6;P78371-2 CCT2 T-complex protein 1 subunit beta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 73.311 73.331 3 0.02248 20805 YJC_A_20141124_01 45.618 34.503 3058500 2563000 495430 0 0 617 351 602 1469;1470 921 921 1 LAMQEFMILPVGAANFR Unmodified 1906.9797 0.97974561 242 P06733;P06733-2;K7EM90 ENO1 Alpha-enolase;Enolase yes no 0 0 0 By MS/MS By MS/MS By matching By matching 2 2 2 86.811 86.807 2;3 3.2628E-83 31951 YJC_A_20141124_01 116.61 90.787 12792000 10455000 1714100 621980 0 618 242 603 1471;1472;1473;1474;1475;1476 922;923;924 923 3 LAPDYDALDVANK Unmodified 1403.6933 0.69325988 8 P62750;H7BY10;K7EJV9;K7ERT8;A8MUS3;K7EMA7 RPL23A 60S ribosomal protein L23a yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 57.919 57.965 2 0.0051851 12024 YJC_B_20141124_01 59.864 45.923 3168100 1544300 874490 0 749240 619 8 604 1477;1478;1479 925 925 1 LAQDPFPLYPGEVLEK Unmodified 1814.9455 0.94545182 375 Q14764;H3BUK7;H3BNF6;H3BRL2;H3BQK6 MVP Major vault protein yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 75.891 75.965 2 0.0030115 23918 YJC_D_20141124_01 72.583 39.881 3669500 0 0 971730 2697700 620 375 605 1480;1481 926;927 927 2 LASNVAKR Unmodified 857.5083 0.50830006 30 Q13422;Q9UKT9;Q9UKT9-5;B4DVV5;Q9UKT9-11;Q9UKT9-10;Q9UKT9-9;Q13422-2;Q9UKT9-8;Q9UKT9-2;Q9UKT9-3;Q9UKT9-7;Q13422-7 IKZF1;IKZF3 DNA-binding protein Ikaros;Zinc finger protein Aiolos yes no 0 0 1 By matching By MS/MS By matching By matching 1 48.392 48.433 2 0.0099626 9618 YJC_B_20141124_01 84.916 19.112 72293000 0 72293000 0 0 621 30 606 1482 928 928 1 LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK Unmodified 2773.4246 0.4246366 238 P05387;H0YDD8 RPLP2 60S acidic ribosomal protein P2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 54.659 54.659 3 3.2551E-20 10722 YJC_A_20141124_01 71.37 56.132 2187500 2187500 0 0 0 622 238 607 1483 929 929 1 LASYLDK Unmodified 808.43307 0.43306943 76;301 P35527;CON__P35527;P08727;Q04695;P08779;P02533;P19012;Q99456;C9JM50;K7EPJ9;CON__P08727;CON__P19001;CON__P05784;CON__Q04695;CON__Q9QWL7;CON__P08730-1;CON__P19012;CON__A2A4G1;CON__P02533;CON__P08779;CON__Q99456;P13645;CON__P13645 KRT9;KRT19;KRT17;KRT16;KRT14;KRT15;KRT12;KRT10 Keratin, type I cytoskeletal 9;Keratin, type I cytoskeletal 19;Keratin, type I cytoskeletal 17;Keratin, type I cytoskeletal 16;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 15;Keratin, type I cytoskeletal 12;Keratin, type I cytoskeletal 10 no no 0 0 0 By matching By matching By MS/MS By matching 1 1 1 1 43.188 43.26 2 0.0051354 6276 YJC_C_20141124_01 80.229 55.335 2268700 301910 1041200 545430 380130 + 623 301;76 608 1484;1485;1486;1487 930 930 1 LAVAEALTNLVFALVTDLR Unmodified 2028.1619 0.16192696 140 O15067;F5GWT9 PFAS Phosphoribosylformylglycinamidine synthase yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 94.957 94.92 3 4.8532E-19 38710 YJC_A_20141124_01 90.422 69.594 3090500 1850600 754560 485380 0 624 140 609 1488;1489;1490 931;932 931 2 LAVHPSGVALQDR Unmodified 1361.7415 0.74154747 235 P05161 ISG15 Ubiquitin-like protein ISG15 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 46.28 46.28 3 8.5973E-05 8287 YJC_A_20141124_01 58.098 41.479 2696900 2696900 0 0 0 625 235 610 1491 933 933 0 LAVNMVPFPR Unmodified 1142.627 0.62703499 245;350;146 P68371;P04350;Q13509-2;Q9BUF5;K7ESM5;I3L2F9;A6NNZ2;Q9H4B7;CON__ENSEMBL:ENSBTAP00000025008;P07437;Q5JP53;Q5ST81;Q9BVA1;Q13885;Q3ZCM7;F5H0I4;Q5SQY0 TUBB4B;TUBB4A;TUBB6;TUBB1;TUBB;TUBB2B;TUBB2A;TUBB8 Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-6 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-1 chain;Tubulin beta chain;Tubulin beta-2B chain;Tubulin beta-2A chain;Tubulin beta-8 chain no no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 67.672 67.669 2 0.00011858 16025 YJC_B_20141124_01 86.882 86.882 7516900 5786900 1352400 377630 0 626 350;245;146 611 1492;1493;1494 934;935 935 2 LAVNMVPFPR Oxidation (M) 1158.6219 0.62194961 245;350;146 P68371;P04350;Q13509-2;Q9BUF5;K7ESM5;I3L2F9;A6NNZ2;Q9H4B7;CON__ENSEMBL:ENSBTAP00000025008;P07437;Q5JP53;Q5ST81;Q9BVA1;Q13885;Q3ZCM7;F5H0I4;Q5SQY0 TUBB4B;TUBB4A;TUBB6;TUBB1;TUBB;TUBB2B;TUBB2A;TUBB8 Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-6 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-1 chain;Tubulin beta chain;Tubulin beta-2B chain;Tubulin beta-2A chain;Tubulin beta-8 chain no no 0 1 0 By MS/MS By MS/MS By matching By matching 1 1 1 60.614 60.61 2 0.014259 12700 YJC_A_20141124_01 43.77 21.431 1908700 1558700 273950 76050 0 627 350;245;146 611 1495;1496;1497 936;937 936 9 0 LAYIAHPK Unmodified 911.52289 0.52288749 309 P47914 RPL29 60S ribosomal protein L29 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 37.597 37.677 2 0.0062964 6904 YJC_B_20141124_01 79.116 52.32 704080 307910 227960 0 168200 628 309 612 1498;1499;1500 938;939 939 2 LAYINPDLALEEK Unmodified 1487.7872 0.78716026 165 P31948;G3XAD8;F5H0T1 STIP1 Stress-induced-phosphoprotein 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 66.4 66.42 2 0.0097523 15726 YJC_A_20141124_01 52.891 29.8 1779000 1383200 395860 0 0 629 165 613 1501;1502 940 940 1 LCYVALDFEQEMATAASSSSLEK Unmodified 2549.1666 0.16655592 327 P60709;P63261;I3L4N8;Q6S8J3 ACTB;ACTG1;POTEE Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed;POTE ankyrin domain family member E yes no 0 0 0 By MS/MS By matching By MS/MS By matching 2 2 1 84.241 84.267 2;3 4.7401E-06 29742 YJC_A_20141124_01 65.833 46.435 12983000 9689500 2428400 865590 0 630 327 614 1503;1504;1505;1506;1507 941;942;943;944 942 4 LDHYAIIK Unmodified 971.54402 0.54401687 8 P62750;H7BY10;K7EJV9;K7ERT8;A8MUS3 RPL23A 60S ribosomal protein L23a yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 46.184 46.205 3 0.025681 8317 YJC_A_20141124_01 42.599 24.751 530500 456910 73597 0 0 631 8 615 1508;1509 945 945 0 LDLLAQAGVDVVVLDSSQGNSIFQINMIK Unmodified 3086.6322 0.63218653 170 P12268;H0Y4R1;E7ETK5 IMPDH2 Inosine-5'-monophosphate dehydrogenase 2 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 94.441 94.411 3 0.0030014 33671 YJC_B_20141124_01 39.388 33.145 5947300 0 3612800 0 2334400 632 170 616 1510;1511 946 946 1 LEGLTDEINFLR Unmodified 1418.7405 0.74054442 74 P05787;CON__P05787;P05787-2;F8VUG2;F8W1U3;CON__H-INV:HIT000292931;H0YIB2;F8VP67 KRT8 Keratin, type II cytoskeletal 8 yes no 0 0 0 By MS/MS By matching By matching By matching 1 75.915 75.915 2 0.015766 23043 YJC_A_20141124_01 47.039 30.125 550300 550300 0 0 0 + 633 74 617 1512 947 947 1 LEQTSEDSSK Unmodified 1122.5041 0.50406212 277 P21589;Q96B60;P21589-2 NT5E 5'-nucleotidase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 23.396 23.416 2 0.0077938 2884 YJC_A_20141124_01 64.103 5.8569 230760 80630 150130 0 0 634 277 618 1513;1514 948 948 1 LEREKHFQQQEQER Unmodified 1883.9238 0.92382195 385 Q3KQU3;Q3KQU3-2;Q3KQU3-4;Q3KQU3-3 MAP7D1 MAP7 domain-containing protein 1 yes no 0 0 2 By matching By matching By matching By MS/MS 1 30.004 30.103 4 0.0087289 4145 YJC_D_20141124_01 46.206 31.013 292230 0 0 0 292230 635 385 619 1515 949 949 1 LFDQAFGLPR Unmodified 1162.6135 0.61349341 234 P04792;F8WE04 HSPB1 Heat shock protein beta-1 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 1 69.68 69.727 2 1.6742E-59 17939 YJC_A_20141124_01 125.72 93.391 5765300 4453400 682760 257890 371280 636 234 620 1516;1517;1518;1519 950;951 950 2 LFEGNALLR Unmodified 1031.5764 0.57637963 36 P46781;B5MCT8;C9JM19 RPS9 40S ribosomal protein S9 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 61.677 61.697 2 0.0036487 13061 YJC_A_20141124_01 80.755 16.101 1521500 1260200 261340 0 0 637 36 621 1520;1521 952 952 1 LFIGGLNVQTSESGLR Unmodified 1689.905 0.90498399 369 Q13151 HNRNPA0 Heterogeneous nuclear ribonucleoprotein A0 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 70.21 70.23 2 0.021253 18422 YJC_A_20141124_01 49.223 27.556 1014800 895330 119480 0 0 638 369 622 1522;1523 953 953 1 LFIGGLSFETTDDSLR Unmodified 1769.8836 0.88357984 319 P51991;P51991-2 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 yes no 0 0 0 By MS/MS By matching By matching By MS/MS 1 1 1 1 78.081 78.128 2 0.0051619 25693 YJC_D_20141124_01 61.186 46.422 18656000 1230000 348010 1559800 15518000 639 319 623 1524;1525;1526;1527 954;955 955 2 LFIGGLSFETTDDSLREHFEK Unmodified 2440.1911 0.19105483 319 P51991;P51991-2 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 1 74.215 74.265 4 0.01679 22385 YJC_D_20141124_01 34.262 26.337 9020000 871160 0 326510 7822400 640 319 624 1528;1529;1530 956 956 1 LFIGGLSFETTDESLR Unmodified 1783.8992 0.89922991 255 P09651;F8W6I7;P09651-3;P09651-2;F8W646;F8VZ49;Q32P51;F8VTQ5 HNRNPA1;HNRNPA1L2 Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2 yes no 0 0 0 By MS/MS By matching By matching By MS/MS 1 1 77.632 77.831 2 4.3397E-127 24760 YJC_A_20141124_01 133.23 97.703 15491000 0 0 0 15491000 641 255 625 1531;1532 957;958 957 2 LFIGGLSFETTEESLR Unmodified 1797.9149 0.91487997 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 1 1 1 1 78.736 78.783 2 0.016873 26325 YJC_D_20141124_01 51.495 39.577 6399800 1813600 579730 813050 3193400 642 278 626 1533;1534;1535;1536 959;960;961;962 962 4 LFQVEYAIEAIK Unmodified 1422.7759 0.7758673 288 P28066 PSMA5 Proteasome subunit alpha type-5 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 77.938 77.938 2 1.6736E-07 24826 YJC_A_20141124_01 85.271 43.791 960330 960330 0 0 0 643 288 627 1537 963 963 1 LFSVPDFVGDACK Unmodified 1453.6912 0.69115139 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 73.916 73.99 2 0.0050037 18173 YJC_C_20141124_01 60.157 29.673 2917400 0 0 782660 2134700 644 375 628 1538;1539 964;965 964 2 LFVGGIKEDTEEHHLR Unmodified 1878.9588 0.95881047 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 1 By matching By matching By MS/MS By MS/MS 2 2 49.069 49.193 4;5 0.0099327 7540 YJC_C_20141124_01 41.621 26.233 7512200 0 0 1949800 5562300 645 278 629 1540;1541;1542;1543 966;967 966 2 LFVGGLK Unmodified 732.45341 0.45341094 369 Q13151 HNRNPA0 Heterogeneous nuclear ribonucleoprotein A0 yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 1 1 51.049 51.121 2 0.0056739 9689 YJC_D_20141124_01 80.377 80.377 7441100 1060800 188470 1588800 4603000 646 369 630 1544;1545;1546;1547 968 968 1 LFVLFGAEILK Unmodified 1248.7482 0.74819598 134 P37837;F2Z393 TALDO1 Transaldolase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 87.301 87.272 2 3.6025E-53 32247 YJC_A_20141124_01 119.22 101.09 1138900 928230 210680 0 0 647 134 631 1548;1549 969 969 1 LGADVTAVEFLGHVGGVGIDMEISK Unmodified 2513.2836 0.28357501 20 P09622;E9PEX6;B4DHG0;B4DT69 DLD Dihydrolipoyl dehydrogenase, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 83.538 83.538 3 0.0077502 29314 YJC_A_20141124_01 47.472 35.024 0 0 0 0 0 648 20 632 1550 970 970 1 LGAETLPR Unmodified 855.48142 0.48141661 424 Q9UBD9;Q9UBD9-2 CLCF1 Cardiotrophin-like cytokine factor 1 yes no 0 0 0 By MS/MS By matching By matching By MS/MS 1 1 47.152 47.252 2 0.0034648 8652 YJC_D_20141124_01 76.478 6.85 20328000 6986500 0 0 13342000 649 424 633 1551;1552 971;972 972 2 LGDTQQSIPGNEER Unmodified 1542.7274 0.72741355 145 P19474;F5H012;P19474-2;H0YDP8 TRIM21 E3 ubiquitin-protein ligase TRIM21 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 41.758 41.828 2 1.096E-30 6956 YJC_A_20141124_01 104.95 75.969 1417000 849750 567280 0 0 650 145 634 1553;1554 973;974 973 2 LGDVYVNDAFGTAHR Unmodified 1633.7849 0.78486885 41 P00558;B7Z7A9;P07205 PGK1;PGK2 Phosphoglycerate kinase 1;Phosphoglycerate kinase 2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 58.396 58.392 3 0.0091459 11865 YJC_A_20141124_01 69.878 55.409 5110700 3843200 994380 273150 0 651 41 635 1555;1556;1557 975 975 1 LGEHNIDVLEGNEQFINAAK Unmodified 2210.0968 0.096760517 67 CON__P00761 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 31 30 33 45 79.116 79.181 2;3 0 39958 YJC_A_20141124_01 177.44 152.93 15768000000 1117600000 552810000 5624700000 8472500000 + 652 67 636 1558;1559;1560;1561;1562;1563;1564;1565;1566;1567;1568;1569;1570;1571;1572;1573;1574;1575;1576;1577;1578;1579;1580;1581;1582;1583;1584;1585;1586;1587;1588;1589;1590;1591;1592;1593;1594;1595;1596;1597;1598;1599;1600;1601;1602;1603;1604;1605;1606;1607;1608;1609;1610;1611;1612;1613;1614;1615;1616;1617;1618;1619;1620;1621;1622;1623;1624;1625;1626;1627;1628;1629;1630;1631;1632;1633;1634;1635;1636;1637;1638;1639;1640;1641;1642;1643;1644;1645;1646;1647;1648;1649;1650;1651;1652;1653;1654;1655;1656;1657;1658;1659;1660;1661;1662;1663;1664;1665;1666;1667;1668;1669;1670;1671;1672;1673;1674;1675;1676;1677;1678;1679;1680;1681;1682;1683;1684;1685;1686;1687;1688;1689;1690;1691;1692;1693;1694;1695;1696 976;977;978;979;980;981;982;983;984;985;986;987;988;989;990;991;992;993;994;995;996;997;998;999;1000;1001;1002;1003;1004;1005;1006;1007;1008;1009;1010;1011;1012;1013;1014;1015;1016;1017;1018;1019;1020;1021;1022;1023;1024;1025;1026;1027;1028;1029;1030;1031;1032;1033;1034;1035;1036;1037;1038;1039;1040;1041;1042;1043;1044;1045;1046;1047;1048;1049;1050;1051;1052;1053;1054;1055;1056;1057;1058;1059;1060;1061;1062;1063;1064;1065;1066;1067;1068;1069;1070;1071;1072;1073;1074;1075;1076;1077;1078;1079;1080;1081;1082;1083;1084;1085;1086;1087;1088;1089;1090;1091;1092;1093;1094;1095;1096;1097;1098 999 107 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Unmodified 4474.2591 0.25909818 67 CON__P00761 yes yes 0 0 1 By matching By MS/MS By matching By MS/MS 2 2 1 2 84.486 84.59 4;5 2.6011E-13 31176 YJC_D_20141124_01 50.493 47.419 232380000 58728000 11115000 3921400 158620000 + 653 67 637 1697;1698;1699;1700;1701;1702;1703 1099;1100;1101 1101 3 LGEHNIEVLEGNEQFINAAK Unmodified 2224.1124 0.11241058 405 Q8NHM4;P07477;P07478;H0Y8D1;CON__P07477;E7EQ64 PRSS3P2;PRSS1;PRSS2 Putative trypsin-6;Trypsin-1;Alpha-trypsin chain 1;Alpha-trypsin chain 2;Trypsin-2 yes no 0 0 0 By MS/MS By matching By MS/MS By MS/MS 3 1 1 2 67.062 67.127 3 0 15351 YJC_D_20141124_01 172.96 126.06 2125800000 7075000 1494900 1611100 2115600000 + 654 405 638 1704;1705;1706;1707;1708;1709;1710 1102;1103;1104 1104 2 LGEYGFQNALIVR Unmodified 1478.7882 0.78816332 72 CON__P02769 yes yes 0 0 0 By MS/MS By MS/MS By matching By MS/MS 1 1 1 69.818 69.898 2 8.369E-243 18753 YJC_D_20141124_01 162.31 122.74 21554000 7147700 3387300 0 11019000 + 655 72 639 1711;1712;1713 1105;1106;1107 1107 3 LGGSAVISLEGKPL Unmodified 1339.7711 0.77111627 281 P23528;G3V1A4;E9PK25 CFL1 Cofilin-1 yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 1 1 66.618 66.665 2 3.4128E-29 15904 YJC_A_20141124_01 101.75 86.367 13611000 8928000 3002200 151240 1529600 656 281 640 1714;1715;1716;1717 1108;1109 1108 2 LGHPDTLNQGEFK Unmodified 1454.7154 0.7153923 240 P06702 S100A9 Protein S100-A9 yes yes 0 0 0 By matching By matching By MS/MS By matching 1 1 1 45.977 46.074 3 0.011174 6843 YJC_C_20141124_01 59.227 34.298 770420 0 554900 131160 84362 657 240 641 1718;1719;1720 1110 1110 1 LGLALNFSVFYYEILNSPDR Unmodified 2330.1947 0.19468365 334 P62258;K7EM20;P62258-2 YWHAE 14-3-3 protein epsilon yes no 0 0 0 By matching By MS/MS By MS/MS By MS/MS 2 1 1 94.491 94.448 2;3 0 33756 YJC_B_20141124_01 186.89 149.03 38483000 0 27226000 4355800 6900900 658 334 642 1721;1722;1723;1724 1111;1112;1113;1114 1111 4 LGLALNFSVFYYEILNSPEK Unmodified 2316.2042 0.2041857 114 P63104;E7EX29;B0AZS6;B7Z2E6;H0YB80;P63104-2;P31946;P31946-2 YWHAZ;YWHAB 14-3-3 protein zeta/delta;14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed yes no 0 0 0 By matching By MS/MS By MS/MS By MS/MS 2 2 2 94.473 94.436 2;3 2.2567E-177 32303 YJC_C_20141124_01 131.3 103.23 90342000 0 42289000 25627000 22425000 659 114 643 1725;1726;1727;1728;1729;1730 1115;1116;1117;1118;1119;1120 1118 5 LGSSGLGSASSIQAAVR Unmodified 1559.8267 0.82673367 172 Q7Z6Z7;H0Y5W0;Q7Z6Z7-2;Q7Z6Z7-3;H0Y659 HUWE1 E3 ubiquitin-protein ligase HUWE1 yes no 0 0 0 By matching By MS/MS By matching By matching 1 56.242 56.382 2 0.02133 11645 YJC_B_20141124_01 49.395 34.886 180130 0 180130 0 0 660 172 644 1731 1121 1121 1 LGSTAPQVLSTSSPAQQAENEAK Unmodified 2313.1448 0.14483292 195 Q9UNZ2;J3QK90;Q9UNZ2-6;Q9UNZ2-4;Q9UNZ2-5 NSFL1C NSFL1 cofactor p47 yes no 0 0 0 By MS/MS By matching By matching By matching 2 54.131 54.131 2;3 0.00075546 10582 YJC_A_20141124_01 62.325 41.016 1938300 1938300 0 0 0 661 195 645 1732;1733 1122;1123 1123 2 LGTPSIVR Unmodified 841.50215 0.50215205 436 yes yes 0 0 0 By MS/MS By matching By matching By matching 2 1 1 1 97.236 97.214 2 0.015466 39240 YJC_A_20141124_01 66.073 24.644 3845900 633380 270260 515990 2426200 + 662 436 646 1734;1735;1736;1737;1738 1124 1124 1 LHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALR Unmodified 3922.0072 0.0072238131 251 P08670;B0YJC4;B0YJC5;Q5JVS8 VIM Vimentin yes no 0 0 1 By MS/MS By matching By matching By matching 1 74.981 74.981 5 0.025828 22086 YJC_A_20141124_01 16.026 13.793 10914000 10914000 0 0 0 663 251 647 1739 1125 1125 1 LHFFMPGFAPLTSR Oxidation (M) 1635.8232 0.82316861 245;350;146 P68371;P04350;Q9BUF5;K7ESM5;I3L2F9;A6NNZ2;P07437;Q5JP53;Q5ST81;Q9BVA1;Q13885;Q3ZCM7;F5H0I4;Q5SQY0 TUBB4B;TUBB4A;TUBB6;TUBB;TUBB2B;TUBB2A;TUBB8 Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-6 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta chain;Tubulin beta-2B chain;Tubulin beta-2A chain;Tubulin beta-8 chain no no 0 1 0 By MS/MS By MS/MS By matching By matching 1 1 1 71.032 71.028 3 0.0013093 17898 YJC_B_20141124_01 73.36 40.882 6615100 5068000 1050900 496250 0 664 350;245;146 648 1740;1741;1742 1126;1127 1127 10 2 LHFFMPGFAPLTSR Unmodified 1619.8283 0.82825399 245;350;146 P68371;P04350;Q9BUF5;K7ESM5;I3L2F9;A6NNZ2;P07437;Q5JP53;Q5ST81;Q9BVA1;Q13885;Q3ZCM7;F5H0I4;Q5SQY0 TUBB4B;TUBB4A;TUBB6;TUBB;TUBB2B;TUBB2A;TUBB8 Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-6 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta chain;Tubulin beta-2B chain;Tubulin beta-2A chain;Tubulin beta-8 chain no no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 78.169 78.165 3 4.376E-09 24833 YJC_A_20141124_01 88.101 64.645 12597000 9464200 2057000 1075500 0 665 350;245;146 648 1743;1744;1745 1128;1129;1130 1128 3 LIALLEVLSQK Unmodified 1225.7646 0.76457433 223 O75369;O75369-8;O75369-5;O75369-4;O75369-6;O75369-3;O75369-2;O75369-9;P21333;Q14315;F8WE98;Q5HY54;P21333-2;Q14315-2 FLNB;FLNA;FLNC Filamin-B;Filamin-A;Filamin-C yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 86.132 86.152 2 0.00073465 31257 YJC_A_20141124_01 73.951 58.087 1651700 1372700 278990 0 0 666 223 649 1746;1747 1131 1131 1 LIAPVAEEEATVPNNK Unmodified 1693.8887 0.88866522 9 P07195;A8MW50;C9J7H8;F5H793 LDHB L-lactate dehydrogenase B chain;L-lactate dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 54.291 54.361 2 7.4784E-10 10621 YJC_A_20141124_01 86.497 48.883 1265100 1019900 245200 0 0 667 9 650 1748;1749 1132 1132 1 LIDLHSPSEIVK Unmodified 1349.7555 0.7554662 329 P60866;P60866-2;G3XAN0 RPS20 40S ribosomal protein S20 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 56.666 56.695 3 0.020378 11339 YJC_A_20141124_01 51.286 14.701 2044400 1364600 521030 158750 0 668 329 651 1750;1751;1752 1133 1133 1 LIFAGKQLEDGR Unmodified 1345.7354 0.73539946 29 P0CG47;P62979;P62987;J3QS39;J3QTR3;F5H6Q2;F5GYU3;F5H2Z3;F5H265;B4DV12;F5H388;F5H747;F5GXK7;J3QKN0;Q96C32;F5H041;P0CG48;M0R1V7;F5GZ39;J3QLP7;J3QRK5;M0R1M6;M0R2S1 UBB;RPS27A;UBA52;UBC;UBBP4 Polyubiquitin-B;Ubiquitin;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Polyubiquitin-C;Ubiquitin yes no 0 0 1 By MS/MS By matching By matching By matching 2 2 53.957 54.027 2;3 3.188E-124 10490 YJC_A_20141124_01 142.12 111.24 71243000 68002000 3240600 0 0 669 29 652 1753;1754;1755;1756 1134;1135 1134 2 LIGDAAKNQLTSNPENTVFDAK Unmodified 2345.1863 0.18630381 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 1 By matching By matching By matching By MS/MS 1 1 59.933 59.983 3 0.00062171 12557 YJC_D_20141124_01 47.75 22.131 2044800 1202600 0 0 842140 670 261 653 1757;1758 1136 1136 0 LIINSLYK Unmodified 962.58007 0.58006802 269 P14625;F8W026 HSP90B1 Endoplasmin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 60.958 60.978 2 0.02243 12794 YJC_A_20141124_01 62.546 29.796 1329200 1139500 189640 0 0 671 269 654 1759;1760 1137 1137 1 LINRNTTIPTKK Unmodified 1397.8354 0.83544786 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 2 By matching By matching By MS/MS By MS/MS 1 1 2 2 34.877 34.95 3;4 4.3378E-06 5245 YJC_D_20141124_01 84.479 38.127 3364400 56718 75323 661750 2570600 672 307 655 1761;1762;1763;1764;1765;1766 1138;1139;1140 1140 3 LISLTDENALSGNEELTVK Unmodified 2045.0528 0.052830017 269 P14625 HSP90B1 Endoplasmin yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 67.536 67.532 2 0.00045017 16443 YJC_A_20141124_01 71.853 50.177 2639000 1948700 412530 277800 0 673 269 656 1767;1768;1769 1141;1142 1142 2 LISQIVSSITASLR Unmodified 1486.8719 0.87189295 349;150 Q9BQE3;F5H5D3;F8VVB9;C9JDS9;Q9H853;P68363;P68366;A8MUB1 TUBA1C;KLK9;TUBA4A;TUBA4B;TUBA1B Tubulin alpha-1C chain;Putative tubulin-like protein alpha-4B;Tubulin alpha-1B chain;Tubulin alpha-4A chain no no 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 2 2 2 1 90.061 90.057 2;3 8.2073E-26 35073 YJC_D_20141124_01 99.747 77.426 30175000 26818000 1398400 1958900 0 674 150;349 657 1770;1771;1772;1773;1774;1775;1776 1143;1144;1145;1146 1146 4 LISRTGHLMK Oxidation (M) 1170.6543 0.65431237 5 A6NMS7;A6NM11;E9PP10;A8MUI5 LRRC37A;LRRC37A2 Leucine-rich repeat-containing protein 37A;Leucine-rich repeat-containing protein 37A2 yes no 0 1 1 By matching By matching By matching By MS/MS 1 73.038 73.238 2 0.02653 21550 YJC_D_20141124_01 41.704 6.1629 1509400 0 0 0 1509400 675 5 658 1777 1147 1147 0 0 LISWYDNEFGYSNR Unmodified 1762.7951 0.79509919 233 P04406;P04406-2;E7EUT5 GAPDH Glyceraldehyde-3-phosphate dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 71.778 71.774 2 4.3911E-39 19498 YJC_A_20141124_01 107.69 83.754 6253100 4087500 1560300 605310 0 676 233 659 1778;1779;1780 1148 1148 1 LIVDEAINEDNSVVSLSQPK Unmodified 2169.1165 0.11649291 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 67.369 67.389 2 0.0084892 15838 YJC_B_20141124_01 52.432 38.449 3005100 2072900 932210 0 0 677 326 660 1781;1782 1149;1150 1150 2 LKAQALAIETEAELQR Unmodified 1782.984 0.98396259 375 Q14764 MVP Major vault protein yes yes 0 0 1 By matching By matching By matching By MS/MS 1 1 62.981 63.055 3 0.021617 13946 YJC_D_20141124_01 44.691 24.607 6061600 0 0 1383100 4678500 678 375 661 1783;1784 1151 1151 0 LKECCDKPLLEK Unmodified 1531.7738 0.77383516 72 CON__P02769 yes yes 0 0 2 By matching By MS/MS By matching By MS/MS 2 2 2 2 38.292 38.364 3;4 0.0091312 7036 YJC_B_20141124_01 61.235 43.032 6578600 2075900 1270600 377770 2854400 + 679 72 662 1785;1786;1787;1788;1789;1790;1791;1792 1152;1153;1154 1152 3 LKGEATVSFDDPPSAK Unmodified 1660.8308 0.83081599 182 P35637;H3BPE7;P35637-2 FUS RNA-binding protein FUS yes no 0 0 1 By matching By matching By MS/MS By matching 1 1 47.82 47.944 3 0.015146 7251 YJC_C_20141124_01 69.069 40.787 4316000 0 0 1413900 2902100 680 182 663 1793;1794 1155 1155 1 LKQQSELQSQVR Unmodified 1442.7841 0.78414057 51 Q14847;C9J9W2;Q14847-2 LASP1 LIM and SH3 domain protein 1 yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 37.014 37.085 3 5.501E-05 6759 YJC_B_20141124_01 81.709 40.545 1351700 718870 632830 0 0 681 51 664 1795;1796 1156 1156 1 LLDAVDTYIPVPAR Unmodified 1541.8453 0.84534384 314 P49411 TUFM Elongation factor Tu, mitochondrial yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 70.688 70.708 2 2.4659E-05 18647 YJC_A_20141124_01 81.904 65.639 1293500 1007800 285680 0 0 682 314 665 1797;1798 1157 1157 1 LLEGEESR Unmodified 931.46108 0.4610751 251;74 P08670;B0YJC4;B0YJC5;P17661;P41219;H7C5W5;P41219-2;P08729;Q9NSB2;CON__Q9DCV7;CON__Q3KNV1;CON__P08729;CON__Q9H552;CON__Q9NSB2;CON__Q6ISB0;P05787;CON__P05787;P05787-2 VIM;DES;PRPH;KRT7;KRT84;KRT8 Vimentin;Desmin;Peripherin;Keratin, type II cytoskeletal 7;Keratin, type II cuticular Hb4;Keratin, type II cytoskeletal 8 no no 0 0 0 By matching By MS/MS By matching By matching 1 1 35.037 35.157 2 0.013727 6394 YJC_B_20141124_01 67.494 36.807 232450 0 141660 0 90794 + 683 251;74 666 1799;1800 1158 1158 1 LLEPVLLLGK Unmodified 1093.7111 0.71108219 214 P62249;M0R210;M0QX76;M0R1M5;M0R3H0;Q6IPX4 RPS16 40S ribosomal protein S16 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 77.032 77.052 2 0.016884 23794 YJC_A_20141124_01 52.49 30.497 2452400 1801900 650540 0 0 684 214 667 1801;1802 1159;1160 1159 2 LLESLDQLELR Unmodified 1327.7347 0.73473076 228 O95816 BAG2 BAG family molecular chaperone regulator 2 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 70.927 70.948 2 1.4926E-31 17866 YJC_B_20141124_01 110.93 53.046 4445400 3244500 1200900 0 0 685 228 668 1803;1804 1161;1162 1162 2 LLGALAAR Unmodified 783.49667 0.49667274 414 Q9H1Z9 TSPAN10 Tetraspanin-10 yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 1 46.567 46.663 2 0.0048204 8530 YJC_D_20141124_01 77.741 8.565 983870 0 173900 318480 491490 686 414 669 1805;1806;1807 1163 1163 1 LLGQFTLIGIPPAPR Unmodified 1591.945 0.94499831 307 P38646;H0Y8S0 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 1 79.645 79.761 2 0.0047562 27257 YJC_D_20141124_01 60.55 52.235 3057900 938660 0 535430 1583800 687 307 670 1808;1809;1810 1164 1164 1 LLIHQSLAGGIIGVK Unmodified 1517.9293 0.92934824 332 P61978;P61978-2;Q5T6W2;Q5T6W5;P61978-3;Q5T6W1 HNRNPK Heterogeneous nuclear ribonucleoprotein K yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 64.33 64.35 3 4.2727E-10 14377 YJC_A_20141124_01 89.747 79.394 3531800 2879400 652440 0 0 688 332 671 1811;1812 1165;1166;1167 1165 3 LLLEFTDTSYEEK Unmodified 1586.7716 0.77156978 276 P21266 GSTM3 Glutathione S-transferase Mu 3 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 69.697 69.697 2 0.012576 17894 YJC_A_20141124_01 49.356 35.01 865010 865010 0 0 0 689 276 672 1813 1168;1169 1168 2 LLQDFFNGK Unmodified 1080.5604 0.56039521 262;273 P11142;E9PKE3;P11142-2;E9PN89;E9PNE6;A8K7Q2;P54652;P17066 HSPA8;HSPA2;HSPA6 Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2;Heat shock 70 kDa protein 6 no no 0 0 0 By MS/MS By matching By matching By matching 1 1 67.403 67.423 2 0.0038778 16309 YJC_A_20141124_01 69.346 32.964 6278900 4678700 1600100 0 0 690 262;273 673 1814;1815 1170 1170 1 LLQDFFNGR Unmodified 1108.5665 0.56654322 249 P08107;P08107-2;E7EP94;V9GZ37 HSPA1A Heat shock 70 kDa protein 1A/1B yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 68.229 68.249 2 0.0055423 16827 YJC_A_20141124_01 68.626 38.062 3066700 2564900 501790 0 0 691 249 674 1816;1817 1171 1171 1 LLQDSVDFSLADAINTEFK Unmodified 2125.0579 0.057915395 251 P08670;B0YJC4 VIM Vimentin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 85.114 85.211 2 0.012278 30355 YJC_A_20141124_01 47.688 22.323 33905000 24771000 4578600 2284900 2270300 692 251 675 1818;1819;1820;1821 1172 1172 1 LLQSLGLK Unmodified 870.55385 0.55385327 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By MS/MS By matching 1 57.46 57.408 2 0.00052684 9351 YJC_C_20141124_01 90.601 5.44 1013800 0 0 1013800 0 693 375 676 1822 1173 1173 1 LLVVTDPR Unmodified 911.54402 0.54401687 50 P08865;C9J9K3;A6NE09 RPSA;RPSAP58 40S ribosomal protein SA yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 50.476 50.496 2 0.0079078 9521 YJC_A_20141124_01 82.279 45.884 1001500 874530 126970 0 0 694 50 677 1823;1824 1174 1174 1 LLYNNVSNFGR Unmodified 1295.6622 0.66223452 354 Q00610;Q00610-2;J3KS13 CLTC Clathrin heavy chain 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 59.247 59.268 2 0.011887 12173 YJC_A_20141124_01 47.712 37.057 1753200 1205400 547840 0 0 695 354 678 1825;1826 1175 1175 1 LMDVGLIAIR Unmodified 1099.6424 0.6423507 165 P31948;G3XAD8;F5H0T1 STIP1 Stress-induced-phosphoprotein 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 72.524 72.524 2 0.00081601 20007 YJC_A_20141124_01 82.417 44.113 1143000 1143000 0 0 0 696 165 679 1827 1176 1176 1 LMLLLEVISGER Oxidation (M) 1387.7745 0.77448709 219 O43707;P12814;P35609;Q08043;G3V5M4;G3V2N5;P12814-2;P35609-2;P12814-3;P12814-4 ACTN4;ACTN1;ACTN2;ACTN3 Alpha-actinin-4;Alpha-actinin-1;Alpha-actinin-2;Alpha-actinin-3 yes no 0 1 0 By MS/MS By matching By matching By matching 2 83.197 83.197 2 3.2712E-22 29062 YJC_A_20141124_01 102.87 67.216 644870 644870 0 0 0 697 219 680 1828;1829 1177;1178 1177 15 2 LMLLLEVISGER Unmodified 1371.7796 0.77957246 219 O43707;P12814;P35609;Q08043;G3V5M4;G3V2N5;P12814-2;P35609-2;P12814-3;P12814-4 ACTN4;ACTN1;ACTN2;ACTN3 Alpha-actinin-4;Alpha-actinin-1;Alpha-actinin-2;Alpha-actinin-3 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 92.006 92.002 2 7.9549E-124 36320 YJC_A_20141124_01 138.42 69.747 1837600 1383900 327610 126040 0 698 219 680 1830;1831;1832 1179 1179 1 LNLEAINYMAADGDFK Unmodified 1783.8451 0.84508585 253 P09382 LGALS1 Galectin-1 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 76.082 76.078 2 0.0027892 23029 YJC_A_20141124_01 65.949 53.171 2897900 2220500 456960 220500 0 699 253 681 1833;1834;1835 1180 1180 1 LNPHRESDGASDEAEESGSQGKLVEALR Unmodified 2980.4122 0.41223401 224 O75688;O75688-3 PPM1B Protein phosphatase 1B yes no 0 0 2 By MS/MS By matching By matching By matching 1 49.451 49.451 4 1.743E-05 9179 YJC_A_20141124_01 51.938 44.173 5169900 5169900 0 0 0 700 224 682 1836 1181 1181 1 LPFPIIDDR Unmodified 1084.5917 0.59169534 290 P30041 PRDX6 Peroxiredoxin-6 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 70.203 70.223 2 0.015371 18253 YJC_A_20141124_01 64.711 42.861 2584300 2287600 296700 0 0 701 290 683 1837;1838 1182 1182 1 LPIDVTEGEVISLGLPFGK Unmodified 1983.0928 0.092844338 285 P26599;P26599-2;P26599-3;K7ELW5;K7EKJ7;K7ES59 PTBP1 Polypyrimidine tract-binding protein 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 87.136 87.136 2 0.0071229 32284 YJC_A_20141124_01 60.618 51.873 486260 486260 0 0 0 702 285 684 1839 1183 1183 1 LPLQDVYK Unmodified 974.54368 0.54368251 348 P68104;Q5VTE0;Q05639 EEF1A1;EEF1A1P5;EEF1A2 Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 54.929 54.976 2 0.0079636 10746 YJC_A_20141124_01 82.426 23.83 7722500 6045300 925410 455890 295860 703 348 685 1840;1841;1842;1843 1184 1184 1 LPNNHIGISFIPR Unmodified 1476.8201 0.82013215 223 O75369;O75369-8;O75369-5;O75369-4;O75369-6;O75369-3;O75369-2;O75369-9;E7EN95;O75369-7 FLNB Filamin-B yes no 0 0 0 By MS/MS By matching By matching By matching 1 63.817 63.817 3 0.023407 14057 YJC_A_20141124_01 50.467 38.546 995500 995500 0 0 0 704 223 686 1844 1185 1185 1 LQAALEAEEPDDER Unmodified 1584.7267 0.72674485 413 Q9BUJ2;Q9BUJ2-2;M0R247 HNRNPUL1 Heterogeneous nuclear ribonucleoprotein U-like protein 1 yes no 0 0 0 By matching By matching By matching By MS/MS 1 47.736 47.936 2 6.5548E-30 8864 YJC_D_20141124_01 100.68 80.598 2528100 0 0 0 2528100 705 413 687 1845 1186 1186 1 LQEVIETLLSLEK Unmodified 1513.8603 0.86032521 216 O00232 PSMD12 26S proteasome non-ATPase regulatory subunit 12 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 86.691 86.661 2 0.0047302 31876 YJC_A_20141124_01 70.134 31.834 1113600 934920 178630 0 0 706 216 688 1846;1847 1187 1187 1 LRAVDFAER Unmodified 1075.5774 0.57744226 124 P62917;E9PKU4;E9PP36;G3V1A1;E9PKZ0 RPL8 60S ribosomal protein L8 yes no 0 0 1 By matching By matching By matching By MS/MS 1 47.689 47.889 3 0.014583 8891 YJC_D_20141124_01 56.404 12.087 0 0 0 0 0 707 124 689 1848 1188 1188 1 LRCASIQK Unmodified 974.53313 0.5331346 72 CON__P02769 yes yes 0 0 1 By MS/MS By matching By matching By MS/MS 1 1 1 1 29.576 29.648 3 0.014297 3945 YJC_A_20141124_01 72.879 29.11 2568600 718030 463150 73371 1314100 + 708 72 690 1849;1850;1851;1852 1189;1190 1189 2 LRCASIQKFGER Unmodified 1463.7667 0.76671637 72 CON__P02769 yes yes 0 0 2 By matching By matching By matching By MS/MS 1 1 42.349 42.448 4 0.02496 7346 YJC_D_20141124_01 37.94 25.309 1459400 631120 0 0 828310 + 709 72 691 1853;1854 1191 1191 1 LRHADLEIR Unmodified 1121.6305 0.63054046 375 Q14764;H3BUK7;H3BNF6;H3BRL2;H3BQK6;H3BP76 MVP Major vault protein yes no 0 0 1 By matching By matching By MS/MS By matching 1 1 1 39.957 40.086 3 0.0042984 5586 YJC_C_20141124_01 75.652 31.882 1852800 0 96985 291630 1464200 710 375 692 1855;1856;1857 1192 1192 1 LSASSLTMESFAFLWAGGR Unmodified 2029.9931 0.99314707 355 Q00839;Q00839-2;Q5RI18 HNRNPU Heterogeneous nuclear ribonucleoprotein U yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 94.227 94.198 3 0.028005 37947 YJC_A_20141124_01 46.249 15.597 698830 451710 247120 0 0 711 355 693 1858;1859 1193 1193 1 LSASSLTMESFAFLWAGGR Oxidation (M) 2045.9881 0.98806169 355 Q00839;Q00839-2;Q5RI18 HNRNPU Heterogeneous nuclear ribonucleoprotein U yes no 0 1 0 By MS/MS By matching By matching By matching 1 88.753 88.753 2 0.010525 33546 YJC_A_20141124_01 59.252 31.315 0 0 0 0 0 712 355 693 1860 1194 1194 50 1 LSCFAQTVSPAEK Unmodified 1436.697 0.69696505 190 Q16658;J3KNT0 FSCN1 Fascin yes no 0 0 0 By MS/MS By matching By matching By matching 1 50.443 50.443 2 0.024821 9503 YJC_A_20141124_01 32.152 32.152 315090 315090 0 0 0 713 190 694 1861 1195 1195 0 LSDGVAVLK Unmodified 900.52803 0.52803245 260 P10809 HSPD1 60 kDa heat shock protein, mitochondrial yes yes 0 0 0 By MS/MS By matching By matching By matching 1 48.996 48.996 2 0.014252 9042 YJC_A_20141124_01 65.157 22.293 1080100 1080100 0 0 0 714 260 695 1862 1196 1196 1 LSGSNPYTTVTPQIINSK Unmodified 1919 6.5851E-06 219 O43707;H7C144;F5GXS2;O43707-3;O43707-2 ACTN4 Alpha-actinin-4 yes no 0 0 0 By MS/MS By matching By matching By matching 1 59.811 59.811 2 0.0021733 12361 YJC_A_20141124_01 70.094 48.042 359970 359970 0 0 0 715 219 696 1863 1197;1198 1197 2 LSHNDHILIENR Unmodified 1459.7532 0.75317479 388 Q5JQC4 CT47A1 Cancer/testis antigen 47A yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 41.42 41.491 3 0.011988 7843 YJC_B_20141124_01 40.767 25.223 1083000 923290 159660 0 0 716 388 697 1864;1865 1199 1199 0 LSITKDNSK Unmodified 1004.5502 0.55022446 66;62 CON__ENSEMBL:ENSBTAP00000011227;CON__Q1RMK2;CON__ENSEMBL:ENSBTAP00000033053 no no 0 0 1 By matching By matching By matching By MS/MS 1 1 29.914 29.988 2 2.4647E-07 4140 YJC_D_20141124_01 97.813 38.746 1145400 0 0 362090 783280 + 717 62;66 698 1866;1867 1200 1200 1 LSLDGQNIYNACCTLR Unmodified 1896.8822 0.88221641 285 P26599;P26599-2;P26599-3;K7EK45 PTBP1 Polypyrimidine tract-binding protein 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 64.058 64.058 2 0.022621 14293 YJC_A_20141124_01 47.855 34.69 506520 506520 0 0 0 718 285 699 1868 1201 1201 1 LSQKFPK Unmodified 846.49634 0.49633839 72 CON__P02769 yes yes 0 0 1 By matching By MS/MS By matching By MS/MS 1 1 1 1 34.209 34.281 2 1.837E-32 5071 YJC_D_20141124_01 116.9 52.696 3794500 983520 568500 218920 2023600 + 719 72 700 1869;1870;1871;1872 1202;1203 1203 2 LSSPATLNSR Unmodified 1044.5564 0.55637247 67 CON__P00761 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 4 3 7 5 93.436 93.432 2;3 3.2438E-182 7785 YJC_B_20141124_01 147.28 93.684 1952800 729960 653140 569710 0 + 720 67 701 1873;1874;1875;1876;1877;1878;1879;1880;1881;1882;1883;1884;1885;1886;1887;1888;1889;1890;1891 1204;1205;1206;1207;1208;1209;1210;1211;1212;1213;1214;1215;1216;1217;1218;1219;1220 1207 17 LSSTTSDLVR Unmodified 1077.5666 0.5666028 434 yes no 0 0 0 By matching By matching By MS/MS By matching 2 1 46.824 46.923 2 0.01507 7003 YJC_C_20141124_01 60.102 0.083241 7680600 0 0 4682600 2997900 + 721 434 702 1892;1893;1894 1221 1221 1 LSWLDTR Unmodified 889.46577 0.46576654 386 Q401N2-2;Q401N2 ZACN Zinc-activated ligand-gated ion channel yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 42.861 42.924 2 0.0091822 7227 YJC_A_20141124_01 76.035 23.632 27158000 16572000 10557000 29618 0 722 386 703 1895;1896;1897 1222;1223 1222 2 LTRAQFEGIVTDLIRR Unmodified 1887.069 0.069029624 307 P38646;H0YBG6 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 2 By matching By matching By matching By MS/MS 1 78.97 79.169 4 0.014085 26751 YJC_D_20141124_01 40.751 32.26 1200800 0 0 0 1200800 723 307 704 1898 1224 1224 1 LTSFIGAIAIGDLVK Unmodified 1516.8865 0.88648038 351 P78371;F8VQ14;F5GWF6 CCT2 T-complex protein 1 subunit beta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 86.472 86.442 2 0.01514 31542 YJC_A_20141124_01 50.827 37.726 1269700 931440 338280 0 0 724 351 705 1899;1900 1225 1225 1 LTTDFNVIVEALSK Unmodified 1548.8399 0.83992412 109 P05455;E9PGX9;E9PFL9;E7ERC4 SSB Lupus La protein yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 87.076 87.072 2 3.8498E-09 32119 YJC_A_20141124_01 86.539 57.727 2117100 1597900 345320 173920 0 725 109 706 1901;1902;1903 1226 1226 1 LVAIVDVIDQNR Unmodified 1353.7616 0.76161421 105 P50914;E7EPB3 RPL14 60S ribosomal protein L14 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 70.69 70.71 2 2.1794E-22 18625 YJC_A_20141124_01 102.97 86.308 2781300 2171000 610390 0 0 726 105 707 1904;1905 1227;1228 1227 2 LVGMPAKR Unmodified 870.51094 0.5109426 307 P38646;D6RJI2;D6RA73 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 1 By matching By matching By matching By MS/MS 1 36.209 36.308 2 0.0033434 5514 YJC_D_20141124_01 76.035 32.968 1329700 0 0 0 1329700 727 307 708 1906 1229 1229 1 LVIITAGAR Unmodified 912.57565 0.57565135 229 P00338;P00338-3;P00338-2;P00338-5;F5GYU2;F5GXY2;F5GXH2 LDHA L-lactate dehydrogenase A chain yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 52.258 52.278 2 7.6916E-20 10028 YJC_A_20141124_01 109.44 28.143 3432700 2888400 544250 0 0 728 229 709 1907;1908 1230 1230 1 LVINGNPITIFQER Unmodified 1612.8937 0.89369102 233 P04406;P04406-2 GAPDH Glyceraldehyde-3-phosphate dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 76.234 76.281 2 0.0044966 23572 YJC_A_20141124_01 68.751 58.021 17312000 12820000 2600400 1108200 783420 729 233 710 1909;1910;1911;1912 1231 1231 1 LVNELTEFAK Unmodified 1162.6234 0.6233894 72 CON__P02769 yes yes 0 0 0 By matching By MS/MS By matching By MS/MS 1 1 1 1 62.516 62.564 2 0.00059935 13363 YJC_B_20141124_01 75.566 43.246 3728600 695650 852440 749260 1431300 + 730 72 711 1913;1914;1915;1916 1232;1233 1232 2 LVNEVTEFAK Unmodified 1148.6077 0.60773933 71 P02768;CON__P02768-1;H7C013 ALB Serum albumin yes no 0 0 0 By matching By matching By MS/MS By matching 1 1 55.654 55.699 2 0.021137 8957 YJC_C_20141124_01 46.955 25.209 552420 0 243380 309040 0 + 731 71 712 1917;1918 1234 1234 0 LVPLLDTGDIIIDGGNSEYR Unmodified 2159.111 0.1110136 320 P52209;B4DQJ8;K7EMN2;K7EM49 PGD 6-phosphogluconate dehydrogenase, decarboxylating yes no 0 0 0 By MS/MS By matching By matching By matching 1 80.46 80.46 2 0.018742 26809 YJC_A_20141124_01 41.988 28.286 1327700 1327700 0 0 0 732 320 713 1919 1235 1235 1 LVQAFQFTDK Unmodified 1195.6237 0.62372375 364 Q06830 PRDX1 Peroxiredoxin-1 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 61.073 61.069 2 4.5558E-13 12796 YJC_A_20141124_01 83.226 61.656 7934300 6601900 937360 395010 0 733 364 714 1920;1921;1922 1236;1237 1236 0 LVQDVANNTNEEAGDGTTTATVLAR Unmodified 2559.2413 0.2412525 260 P10809;E7ESH4;E7EXB4;C9JL25;B7Z712 HSPD1 60 kDa heat shock protein, mitochondrial yes no 0 0 0 By MS/MS By matching By MS/MS By MS/MS 2 2 1 1 54.111 54.166 2;3 0.00022996 10552 YJC_A_20141124_01 48.286 43.872 11402000 8991700 1518000 307540 584760 734 260 715 1923;1924;1925;1926;1927;1928 1238;1239;1240;1241;1242;1243 1241 5 LVSDEMVVELIEK Unmodified 1502.7902 0.79019673 160 P54819;G3V213;F8VZG5;F8W1A4;P54819-4;P54819-6;P54819-3;P54819-5;P54819-2 AK2 Adenylate kinase 2, mitochondrial;Adenylate kinase 2, mitochondrial, N-terminally processed;Adenylate kinase 2, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 79.386 79.386 2 0.0047026 26076 YJC_A_20141124_01 68.168 43.238 292040 292040 0 0 0 735 160 716 1929 1244 1244 1 LVVSTQTALA Unmodified 1001.5757 0.57571092 72 CON__P02769 yes yes 0 0 0 By MS/MS By MS/MS By matching By MS/MS 1 1 1 56.284 56.364 2 1.1939E-45 11630 YJC_B_20141124_01 120.27 92.969 6157600 1926500 1690400 0 2540700 + 736 72 717 1930;1931;1932 1245;1246;1247 1246 3 LYCIYVAIGQK Unmodified 1326.7006 0.70059386 284 P25705;P25705-2;P25705-3;K7EK77;K7ENJ4 ATP5A1 ATP synthase subunit alpha, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 66.483 66.483 2 0.018788 15783 YJC_A_20141124_01 45.158 28.539 368730 368730 0 0 0 737 284 718 1933 1248 1248 1 LYGSAGPPPTGEEDTAEK Unmodified 1817.8319 0.8319382 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By MS/MS By matching By matching By MS/MS 1 1 1 43.789 43.868 2 3.6068E-19 7782 YJC_D_20141124_01 93.342 71.455 1418400 714290 127550 0 576530 738 261 719 1934;1935;1936 1249;1250 1250 2 LYNLDVFQYELYNPMALYGSVPVLLAHNPHR Unmodified 3645.8442 0.84424499 374 Q14697;Q14697-2;F5H6X6;E9PKU7 GANAB Neutral alpha-glucosidase AB yes no 0 0 0 By MS/MS By matching By matching By matching 1 91.814 91.814 4 4.3034E-14 36204 YJC_A_20141124_01 65.741 59.109 1969700 1969700 0 0 0 739 374 720 1937 1251 1251 1 LYSLNDPTLNDKKAK Unmodified 1718.9203 0.9202997 404 Q8NE79 BVES Blood vessel epicardial substance yes yes 0 0 2 By MS/MS By matching By matching By matching 1 75.369 75.369 2 0.015787 22511 YJC_A_20141124_01 37.657 14.201 300010 300010 0 0 0 740 404 721 1938 1252 1252 0 LYSPSQIGAFVLMK Unmodified 1552.8323 0.83233632 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 1 1 80.207 80.304 2 8.5849E-06 27643 YJC_D_20141124_01 83.877 71.958 3006700 645610 268990 437460 1654700 741 307 722 1939;1940;1941;1942 1253 1253 1 LYTLVTYVPVTTFK Unmodified 1643.9174 0.91744615 39 P62899;P62899-3;P62899-2;H7C2W9;C9JU56;B7Z4E3;B7Z4C8 RPL31 60S ribosomal protein L31 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 77.034 77.008 2 0.0037088 23899 YJC_A_20141124_01 67.136 56.19 1723700 1538400 0 185320 0 742 39 723 1943;1944 1254 1254 1 MALDIEIATYR Unmodified 1294.6591 0.65912298 251 P08670;B0YJC4;B0YJC5;P41219;H7C5W5;P41219-2 VIM;PRPH Vimentin;Peripherin yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 1 70.129 70.176 2 6.394E-05 17443 YJC_B_20141124_01 79.283 43.76 7674400 6332300 754860 392130 195090 743 251 724 1945;1946;1947;1948 1255;1256 1256 2 MALDIEIATYR Oxidation (M) 1310.654 0.6540376 251 P08670;B0YJC4;B0YJC5;P41219;H7C5W5;P41219-2 VIM;PRPH Vimentin;Peripherin yes no 0 1 0 By MS/MS By matching By matching By matching 1 1 64.639 64.66 2 0.0035424 14577 YJC_A_20141124_01 48.948 22.162 1789900 1354400 435490 0 0 744 251 724 1949;1950 1257 1257 28 0 MDELQLFR Unmodified 1050.5168 0.51681584 326 P55072;C9JUP7;C9IZA5 VCP Transitional endoplasmic reticulum ATPase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 68.462 68.482 2 0.00856 17116 YJC_A_20141124_01 83.998 44.352 1008200 654260 353920 0 0 745 326 725 1951;1952 1258 1258 1 MDTGVIEGGLNVTLTIR Acetyl (Protein N-term) 1829.9557 0.95569893 23 Q15366;Q15366-4;Q15366-5;F8W0G4;F8VXH9;B4DLC0;F8VZX2;B4DXP5;Q15366-7;Q15366-6;Q15366-3;Q15366-2;H3BSP4;F8VTZ0 PCBP2 Poly(rC)-binding protein 2 yes no 1 0 0 By MS/MS By matching By matching By matching 1 94.476 94.476 2 0.0064613 38163 YJC_A_20141124_01 58.246 22.589 5536800 5536800 0 0 0 746 23 726 1953 1259 1259 1 MELITILEK Acetyl (Protein N-term);Oxidation (M) 1146.6206 0.62061221 376 Q14974;J3QR48 KPNB1 Importin subunit beta-1 yes no 1 1 0 By MS/MS By matching By matching By matching 1 87.343 87.343 2 0.014003 32363 YJC_A_20141124_01 50.194 22.423 0 0 0 0 0 747 376 727 1954 1260 1260 54 1 MERDMEKSEVLLK Oxidation (M) 1622.8008 0.80077819 400 Q8IYK2 CCDC105 Coiled-coil domain-containing protein 105 yes yes 0 1 2 By matching By matching By MS/MS By matching 1 1 1 69.19 69.253 2 0.022678 14690 YJC_C_20141124_01 62.298 26.641 1832800 0 370660 667480 794650 748 400 728 1955;1956;1957 1261 1261 56 1 MFGGPGTASR Oxidation (M) 995.44946 0.44946455 251 P08670;B0YJC4 VIM Vimentin yes no 0 1 0 By MS/MS By matching By matching By matching 1 35.899 35.899 2 0.018697 5379 YJC_A_20141124_01 40.727 20.207 0 0 0 0 0 749 251 729 1958 1262 1262 29 1 MFVLDEADEMLSR Unmodified 1554.7058 0.70581517 328 P60842;Q14240;E7EQG2;Q14240-2;Q9NZE6;J3QLN6;J3QR64;J3KTB5;J3QL43;J3QS69;J3KT12;P60842-2;J3KSZ0;J3KTN0 EIF4A1;EIF4A2 Eukaryotic initiation factor 4A-I;Eukaryotic initiation factor 4A-II yes no 0 0 0 By MS/MS By matching By matching By matching 1 79.053 79.053 2 0.00090954 25752 YJC_A_20141124_01 77.42 53.195 1065700 1065700 0 0 0 750 328 730 1959 1263 1263 1 MIFAGIK Oxidation (M) 794.43605 0.43604632 79 CON__P62894 yes yes 0 1 0 By matching By matching By MS/MS By matching 1 1 1 1 53.012 53.034 2 0.023574 8360 YJC_C_20141124_01 83.287 42.715 3536900 978590 877080 806170 875020 + 751 79 731 1960;1961;1962;1963 1264 1264 4 1 MIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLR Unmodified 3959.9835 0.98351694 317 P50990;P50990-3;P50990-2;H7C4C8 CCT8 T-complex protein 1 subunit theta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 95.065 95.035 4 1.5586E-11 38780 YJC_A_20141124_01 46.671 32.493 3624800 2530400 1094500 0 0 752 317 732 1964;1965 1265 1265 1 MKDTDSEEEIR Unmodified 1351.5926 0.59255956 174 P62158;H0Y7A7;E7ETZ0;E7EMB3;G3V361;Q96HY3;G3V226 CALM1;CALM2;CALM3 Calmodulin yes no 0 0 1 By matching By MS/MS By matching By matching 1 33.969 34.11 3 0.0004885 6207 YJC_B_20141124_01 70.728 57.771 0 0 0 0 0 753 174 733 1966 1266 1266 1 MKEIAEAYLGK Unmodified 1251.6533 0.65330932 262 P11142;E9PKE3;P11142-2;E9PN89;E9PLF4;E9PI65;E9PQQ4;E9PQK7;E9PK54;E9PPY6 HSPA8 Heat shock cognate 71 kDa protein yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 1 52.286 52.332 3 0.0017474 10023 YJC_A_20141124_01 74.237 37.709 2094500 1362800 580490 0 151160 754 262 734 1967;1968;1969 1267;1268 1267 2 MKETAEAYLGKK Unmodified 1367.7119 0.71188683 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 2 By MS/MS By MS/MS By matching By MS/MS 2 2 2 2 40.192 40.289 3;4 0.00064133 6714 YJC_D_20141124_01 75.89 38.71 10238000 6248600 2310700 205770 1473400 755 261 735 1970;1971;1972;1973;1974;1975;1976;1977 1269;1270;1271;1272 1272 4 MKETAENYLGHTAK Unmodified 1591.7664 0.7664416 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 1 By matching By matching By MS/MS By MS/MS 2 2 40.805 40.929 3;4 2.3167E-22 5778 YJC_C_20141124_01 99.834 74.507 17526000 0 0 2815000 14711000 756 307 736 1978;1979;1980;1981 1273;1274;1275;1276 1275 3 MLQQQEQLR Unmodified 1172.5972 0.59719142 95 Q15154;E5RGQ4;E9PGW9;E7EV93;E7EV56;E7ETA6;Q15154-3;Q15154-2 PCM1 Pericentriolar material 1 protein yes no 0 0 0 By MS/MS By matching By matching By matching 1 40.689 40.689 2 2.0686E-07 6663 YJC_A_20141124_01 77.533 6.9817 0 0 0 0 0 757 95 737 1982 1277 1277 1 MLVVLLQANR Unmodified 1155.6798 0.67979884 90 P08758;D6RBE9;D6RBL5 ANXA5 Annexin A5;Annexin yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 67.769 67.789 2 1.0777E-59 16670 YJC_A_20141124_01 126.07 94.574 1521000 1328500 192500 0 0 758 90 738 1983;1984 1278;1279 1278 2 MQIFVKTLTGK Unmodified 1264.7213 0.7213293 29 P0CG47;P62979;P62987;J3QS39;J3QTR3;F5H6Q2;F5GYU3;F5H2Z3;F5H265;B4DV12;F5H388;F5H747;F5GXK7;J3QKN0;Q96C32;F5H041;P0CG48;M0R1V7;F5GZ39;J3QSA3 UBB;RPS27A;UBA52;UBC Polyubiquitin-B;Ubiquitin;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Polyubiquitin-C;Ubiquitin yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 59.199 59.219 2 1.5984E-225 12183 YJC_A_20141124_01 158.34 79.821 6678900 6277900 401000 0 0 759 29 739 1985;1986 1280 1280 1 MQIFVKTLTGKTITLEVEPSDTIENVK Unmodified 3033.6308 0.63078955 29 P0CG47;P62979;P62987;J3QS39;J3QTR3;F5H6Q2;F5GYU3;F5H2Z3;F5H265;B4DV12;F5H388;F5H747;F5GXK7;J3QKN0;Q96C32;F5H041;P0CG48;M0R1V7;F5GZ39;J3QSA3 UBB;RPS27A;UBA52;UBC Polyubiquitin-B;Ubiquitin;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Polyubiquitin-C;Ubiquitin yes no 0 0 2 By MS/MS By matching By matching By matching 2 2 76.884 76.904 3;4 9.9321E-49 23824 YJC_A_20141124_01 98.533 82.57 56996000 53296000 3700000 0 0 760 29 740 1987;1988;1989;1990 1281;1282 1282 2 MQQQLDEYQELLDIK Unmodified 1892.919 0.91897907 232 P02545;P02545-3;P02545-2;P02545-5;P02545-4;P02545-6;Q5TCI8 LMNA Prelamin-A/C;Lamin-A/C yes no 0 0 0 By MS/MS By matching By matching By matching 1 74.851 74.851 2 0.0032036 22051 YJC_A_20141124_01 62.438 38.911 1042100 1042100 0 0 0 761 232 741 1991 1283 1283 1 MSVQPTVSLGGFEITPPVVLR Oxidation (M) 2242.2031 0.20313984 243 P06748;P06748-2;P06748-3;E5RI98 NPM1 Nucleophosmin yes no 0 1 0 By MS/MS By matching By matching By matching 1 82.139 82.139 3 0.0015011 28347 YJC_A_20141124_01 48.376 39.529 666940 666940 0 0 0 762 243 742 1992 1284 1284 19 1 MTDDELVYNIHLAVNFLVSLLK Oxidation (M) 2562.3404 0.34036161 344 P62906 RPL10A 60S ribosomal protein L10a yes yes 0 1 0 By matching By MS/MS By MS/MS By matching 1 1 94.714 94.659 3 0.00026757 33971 YJC_B_20141124_01 62.589 45.559 5626100 0 3236800 2389300 0 763 344 743 1993;1994 1285;1286 1285 46 2 MTDDELVYNIHLAVNFLVSLLK Unmodified 2546.3454 0.34544698 344 P62906 RPL10A 60S ribosomal protein L10a yes yes 0 0 0 By matching By matching By MS/MS By matching 1 1 94.747 94.691 3 6.4349E-59 32614 YJC_C_20141124_01 107.02 96.668 12333000 0 7794100 4539300 0 764 344 743 1995;1996 1287 1287 1 MTDQEAIQDLWQWR Unmodified 1818.8359 0.83591814 243 P06748;P06748-2 NPM1 Nucleophosmin yes no 0 0 0 By MS/MS By matching By matching By matching 1 83.695 83.695 2 0.017058 29497 YJC_A_20141124_01 42.52 17.398 370120 370120 0 0 0 765 243 744 1997 1288 1288 0 MTEAQEDGQSTSELIGQFGVGFYSAFLVADK Oxidation (M) 3340.5446 0.54455332 269 P14625 HSP90B1 Endoplasmin yes yes 0 1 0 By matching By MS/MS By matching By matching 1 1 94.384 94.354 3 5.6994E-21 33608 YJC_B_20141124_01 72.573 61.468 5183200 0 3675500 0 1507800 766 269 745 1998;1999 1289 1289 36 1 MTEAQEDGQSTSELIGQFGVGFYSAFLVADK Unmodified 3324.5496 0.54963869 269 P14625 HSP90B1 Endoplasmin yes yes 0 0 0 By matching By MS/MS By MS/MS By MS/MS 1 1 1 94.434 94.397 3 1.6489E-20 32269 YJC_C_20141124_01 73.616 53.118 24663000 0 9496900 10682000 4484700 767 269 745 2000;2001;2002 1290;1291;1292 1291 3 MTQIMFETFNTPAMYVAIQAVLSLYASGR 2 Oxidation (M) 3284.592 0.59197798 327 P60709;P63261;I3L3I0;I3L1U9;I3L4N8;E7EVS6;I3L3R2 ACTB;ACTG1 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed yes no 0 2 0 By matching By matching By matching By MS/MS 1 94.515 94.514 3 6.3639E-15 38106 YJC_D_20141124_01 73.519 62.263 21066000 0 0 0 21066000 768 327 746 2003 1293 1293 42;43 1 MTTMLQKSDSNASFLR Acetyl (Protein N-term);Oxidation (M) 1886.8866 0.88663309 40 B7Z651;D6RHE1;Q01484-5 ANK2 yes no 1 1 1 By matching By MS/MS By MS/MS By matching 2 1 94.738 94.681 2 0.014881 32610 YJC_C_20141124_01 51.495 34.609 5334000 0 4153000 1181000 0 769 40 747 2004;2005;2006 1294;1295 1295 1 2 MVMISLEGEDGLDEIYSFSESLR Unmodified 2619.2084 0.20842074 264 P13010 XRCC5 X-ray repair cross-complementing protein 5 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 93.711 93.681 3 4.5174E-52 37661 YJC_A_20141124_01 101.17 87.883 3768000 2727200 1040800 0 0 770 264 748 2007;2008 1296;1297;1298 1296 3 MVNDAEKFAEEDKK Unmodified 1652.7716 0.77158655 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 2 By MS/MS By matching By matching By matching 1 1 1 42.13 42.243 4 0.0069643 7086 YJC_A_20141124_01 39.006 26.948 1610200 1166700 152160 0 291380 771 261 749 2009;2010;2011 1299 1299 0 MVNHFIAEFK Unmodified 1234.6169 0.61686423 262 P11142;E9PKE3;P11142-2;E9PN89;A8K7Q2 HSPA8 Heat shock cognate 71 kDa protein yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 59.445 59.441 3 9.7281E-07 12226 YJC_A_20141124_01 93.096 69.723 3851200 2926500 682570 242190 0 772 262 750 2012;2013;2014 1300;1301 1300 2 NALESYAFNMK Oxidation (M) 1302.5914 0.59143734 249 P08107;P08107-2;E7EP94;V9GZ37 HSPA1A Heat shock 70 kDa protein 1A/1B no no 0 1 0 By MS/MS By matching By matching By matching 1 57.63 57.63 2 0.014869 11610 YJC_A_20141124_01 54.772 48.06 802670 802670 0 0 0 773 249 751 2015 1302 1302 26 1 NATGLILR Unmodified 856.51305 0.51305109 93 O14514;E5RG74 BAI1 Brain-specific angiogenesis inhibitor 1 yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 48.11 48.193 2 0.0064453 8899 YJC_D_20141124_01 71.877 16.347 909890000 331530000 0 235970000 342380000 774 93 752 2016;2017;2018 1303;1304 1304 1 NAVITVPAYFNDSQR Unmodified 1693.8424 0.84238373 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 1 1 66.129 66.176 2 0.0047635 15979 YJC_D_20141124_01 60.541 39.703 34094000 2000100 1264500 3795300 27034000 775 307 753 2019;2020;2021;2022 1305 1305 1 NCAVEFNFGQR Unmodified 1340.5932 0.59316868 413 Q9BUJ2;Q9BUJ2-2;Q9BUJ2-3;B7Z4B8;Q9BUJ2-4;M0R3F1;M0QYZ0 HNRNPUL1 Heterogeneous nuclear ribonucleoprotein U-like protein 1 yes no 0 0 0 By matching By matching By MS/MS By matching 1 1 60.491 60.565 2 0.013851 10162 YJC_C_20141124_01 46.985 29.512 1062600 0 0 302860 759750 776 413 754 2023;2024 1306 1306 1 NDFQLIGIQDGYLSLLQDSGEVR Unmodified 2579.2867 0.28674613 347 P63241;P63241-2;I3L397;I3L504 EIF5A Eukaryotic translation initiation factor 5A-1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 89.5 89.496 3 0.010056 34143 YJC_A_20141124_01 53.718 43.38 4964200 3080700 1208900 674570 0 777 347 755 2025;2026;2027 1307 1307 1 NECFLSHKDDSPDLPK Unmodified 1900.8625 0.86252683 72 CON__P02769 yes yes 0 0 1 By matching By matching By matching By MS/MS 1 1 1 1 48.642 48.714 4 0.00795 9107 YJC_D_20141124_01 45.873 25.288 3728100 1368600 432600 320930 1605900 + 778 72 756 2028;2029;2030;2031 1308 1308 1 NELESYAYSLK Unmodified 1315.6296 0.62959699 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 1 62.762 62.809 2 0.00036377 13482 YJC_B_20141124_01 74.78 43.712 4683500 2136300 1473300 279650 794300 779 261 757 2032;2033;2034;2035 1309;1310 1310 2 NFATSLYSMIK Oxidation (M) 1289.6326 0.63257388 90 P08758;D6RBE9;D6RBL5 ANXA5 Annexin A5;Annexin yes no 0 1 0 By MS/MS By matching By matching By matching 1 70.319 70.319 2 0.0043298 18444 YJC_A_20141124_01 64.64 33.911 426380 426380 0 0 0 780 90 758 2036 1311 1311 5 1 NFATSLYSMIK Unmodified 1273.6377 0.63765925 90 P08758;D6RBE9;D6RBL5 ANXA5 Annexin A5;Annexin yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 81.195 81.219 2 0.00021182 27444 YJC_A_20141124_01 77.062 50.945 1709000 1563800 0 145160 0 781 90 758 2037;2038;2039 1312;1313 1312 2 NFILDQTNVSAAAQR Unmodified 1646.8376 0.8376327 355 Q00839;Q00839-2 HNRNPU Heterogeneous nuclear ribonucleoprotein U yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 60.778 60.858 2 1.4617E-128 12708 YJC_A_20141124_01 133.28 105.6 2066200 1307500 316150 0 442470 782 355 759 2040;2041;2042 1314 1314 1 NGGLGHMNIALLSDLTK Unmodified 1752.9193 0.91925384 292 P30048;P30048-2 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 75.301 75.301 3 6.1892E-12 22482 YJC_A_20141124_01 82.651 50.977 651310 651310 0 0 0 783 292 760 2043 1315 1315 0 NGQPESEDK Unmodified 1002.4254 0.42541787 65;64 CON__ENSEMBL:ENSBTAP00000024466;CON__ENSEMBL:ENSBTAP00000024462 no no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 19.922 19.896 2 2.4569E-67 2523 YJC_C_20141124_01 129.88 113.5 15717000 0 0 2049700 13667000 + 784 65;64 761 2044;2045 1316;1317;1318 1316 3 NHIQLVK Unmodified 850.50249 0.5024864 421 Q9NR28;Q9NR28-2;Q9NR28-3;F5GXT8;F5H796;F5GYH3;F5GX50 DIABLO Diablo homolog, mitochondrial yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 36.216 36.286 2 0.00011256 6591 YJC_B_20141124_01 95.793 45.161 1083500 419470 664040 0 0 785 421 762 2046;2047 1319 1319 1 NHIQLVKLQVEEVHQLSR Unmodified 2169.2018 0.20183471 421 Q9NR28;Q9NR28-2;Q9NR28-3;F5GXT8;F5H796 DIABLO Diablo homolog, mitochondrial yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 58.33 58.35 4 0.0073571 11889 YJC_A_20141124_01 42.708 30.076 2083800 1710400 373370 0 0 786 421 763 2048;2049 1320;1321 1321 2 NIEDVIAQGIGK Unmodified 1255.6772 0.67721588 238 P05387;H0YDD8 RPLP2 60S acidic ribosomal protein P2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 70.02 70.1 2 1.6824E-05 18190 YJC_A_20141124_01 81.789 47.919 2115200 1542100 272440 0 300650 787 238 764 2050;2051;2052 1322 1322 1 NIILEEGKEILVGDVGQTVDDPYATFVK Unmodified 3061.5859 0.58594784 281 P23528;G3V1A4;E9PP50;E9PK25;E9PQB7;E9PLJ3;E9PS23 CFL1 Cofilin-1 yes no 0 0 1 By MS/MS By MS/MS By matching By matching 2 1 82.405 82.425 3 1.7104E-05 28576 YJC_A_20141124_01 52.97 39.948 2313200 1673300 639960 0 0 788 281 765 2053;2054;2055 1323;1324 1323 2 NILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQR Unmodified 4566.2191 0.21906708 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 1 1 94.491 94.463 4 4.8285E-44 33762 YJC_B_20141124_01 75.179 63.259 95031000 40978000 14246000 18127000 21680000 789 261 766 2056;2057;2058;2059 1325 1325 1 NKITITNDQNR Unmodified 1315.6844 0.68442653 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 1 By MS/MS By matching By matching By matching 1 1 33.34 33.41 3 0.00099327 4751 YJC_A_20141124_01 75.566 51.889 472190 315640 156550 0 0 790 261 767 2060;2061 1326 1326 1 NKPGVYTKVCNYVNWIQQTIAAN Unmodified 2680.3432 0.34315557 67 CON__P00761 yes yes 0 0 2 By matching By matching By matching By MS/MS 1 1 1 83.343 83.459 3 6.1352E-53 29943 YJC_D_20141124_01 105.06 92.836 49307000 13962000 0 3675200 31670000 + 791 67 768 2062;2063;2064 1327 1327 1 NKQTYSTEPNNLK Unmodified 1535.758 0.7579854 179 P46779;H0YLP6;H0YMF4;H0YKD8;P46779-4;P46779-5;P46779-2;P46779-3 RPL28 60S ribosomal protein L28 yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 1 34.987 35.067 3 1.2341E-11 6387 YJC_B_20141124_01 74.987 47.306 518260 209240 208230 0 100800 792 179 769 2065;2066;2067 1328;1329 1329 0 NKQTYSTEPNNLKAR Unmodified 1762.8962 0.89621022 179 P46779;H0YLP6;H0YMF4;H0YKD8;P46779-4;P46779-5;P46779-2;P46779-3 RPL28 60S ribosomal protein L28 yes no 0 0 2 By MS/MS By matching By matching By matching 1 1 1 33.972 34.052 3 0.0064695 4929 YJC_A_20141124_01 72.898 54.075 1215700 550700 276100 0 388870 793 179 770 2068;2069;2070 1330 1330 1 NKSTESLQANVQR Unmodified 1473.7536 0.75356872 196 P26373;J3QSB4 RPL13 60S ribosomal protein L13 yes no 0 0 1 By matching By MS/MS By matching By MS/MS 1 1 1 35.722 35.802 3 3.4867E-38 5425 YJC_D_20141124_01 109.16 50.885 2106300 902180 461600 0 742570 794 196 771 2071;2072;2073 1331;1332 1332 2 NKTGAAPIIDVVR Unmodified 1352.7776 0.77759863 122 P46776;E9PJD9;E9PLL6;E9PLX7 RPL27A 60S ribosomal protein L27a yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 1 52.653 52.699 3 0.0094536 10657 YJC_B_20141124_01 45.347 31.337 948080 564760 244880 0 138440 795 122 772 2074;2075;2076 1333 1333 0 NLATTVTEEILEK Unmodified 1459.777 0.77698951 27 O43390;E7ETM7;B4DT28;O43390-4;O43390-3;O43390-2 HNRNPR Heterogeneous nuclear ribonucleoprotein R yes no 0 0 0 By MS/MS By matching By matching By matching 1 79.693 79.693 2 0.017827 26257 YJC_A_20141124_01 40.983 21.884 403330 403330 0 0 0 796 27 773 2077 1334 1334 0 NLCYMISRREK Unmodified 1468.7279 0.72788802 406 Q92613 JADE3 Protein Jade-3 yes yes 0 0 2 By matching By matching By MS/MS By matching 1 73.483 73.431 2 0.01386 17713 YJC_C_20141124_01 50.354 28.298 0 0 0 0 0 797 406 774 2078 1335 1335 1 NLDDGIDDER Unmodified 1160.4946 0.49456007 107 P11940;E7EQV3;E7ERJ7;P11940-2;H0YAR2;Q9H361;H0YAP2 PABPC1;PABPC3 Polyadenylate-binding protein 1;Polyadenylate-binding protein 3 yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 1 43.557 43.637 2 0.0029053 7777 YJC_D_20141124_01 69.864 51.239 1619200 974350 159050 0 485850 798 107 775 2079;2080;2081 1336 1336 1 NLLIFENLIDLK Unmodified 1443.8337 0.83371653 111 P78527;E7EUY0;P78527-2 PRKDC DNA-dependent protein kinase catalytic subunit yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 91.399 91.369 2 0.023991 35719 YJC_A_20141124_01 44.426 21.541 857310 690160 167160 0 0 799 111 776 2082;2083 1337 1337 1 NLQNLLILTAIK Unmodified 1352.8391 0.83913625 354 Q00610;Q00610-2;P53675;J3KR87;P53675-2 CLTC;CLTCL1 Clathrin heavy chain 1;Clathrin heavy chain 2 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 83.347 83.368 2 0.0031798 29118 YJC_A_20141124_01 71.558 50.008 2096200 1612200 483920 0 0 800 354 777 2084;2085 1338;1339 1338 2 NLSEAQLR Unmodified 929.49304 0.49304393 423 Q9NZT1 CALML5 Calmodulin-like protein 5 yes yes 0 0 0 By matching By MS/MS By matching By matching 1 41.805 41.945 2 0.019823 7978 YJC_B_20141124_01 63.419 8.0489 143230 0 143230 0 0 801 423 778 2086 1340 1340 1 NLTVDTYVNENGEK Unmodified 1594.7475 0.74748029 312 P49221 TGM4 Protein-glutamine gamma-glutamyltransferase 4 yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 1 58.575 58.59 2 0.011368 12039 YJC_D_20141124_01 51.939 18.899 1184300 368820 0 293550 521970 802 312 779 2087;2088;2089 1341;1342 1341 2 NLWGNLPPLLLPQR Unmodified 1629.9355 0.93549626 388 Q5JQC4 CT47A1 Cancer/testis antigen 47A yes yes 0 0 0 By matching By MS/MS By MS/MS By matching 1 1 1 86.188 86.218 2 0.0056827 26870 YJC_C_20141124_01 58.04 41.467 2150000 1539400 371040 239590 0 803 388 780 2090;2091;2092 1343;1344 1344 2 NMGGPYGGGNYGPGGSGGSGGYGGR Unmodified 2188.8981 0.89807748 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 0 By matching By matching By MS/MS By MS/MS 2 2 50.137 50.261 2;3 1.7468E-52 9495 YJC_D_20141124_01 101.05 95.385 6681300 0 0 850860 5830400 804 278 781 2093;2094;2095;2096 1345;1346;1347 1347 3 NMGGPYGGGNYGPGGSGGSGGYGGR Oxidation (M) 2204.893 0.89299211 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 1 0 By matching By matching By matching By MS/MS 1 46.01 46.209 2 1.3841E-21 8374 YJC_D_20141124_01 87.881 72.688 740050 0 0 0 740050 805 278 781 2097 1348 1348 37 1 NMITGTSQADCAVLIVAAGVGEFEAGISK Unmodified 2908.431 0.43104388 348 P68104;Q5VTE0;Q05639;Q5JR01 EEF1A1;EEF1A1P5;EEF1A2 Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2 yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 1 94.498 94.47 3 8.4011E-77 33780 YJC_B_20141124_01 107.31 92.468 138460000 86440000 27284000 13379000 11359000 806 348 782 2098;2099;2100;2101 1349;1350;1351 1350 3 NMITGTSQADCAVLIVAAGVGEFEAGISK Oxidation (M) 2924.426 0.4259585 348 P68104;Q5VTE0;Q05639;Q5JR01 EEF1A1;EEF1A1P5;EEF1A2 Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2 yes no 0 1 0 By matching By MS/MS By matching By matching 1 1 94.494 94.464 3 0 33735 YJC_B_20141124_01 183.91 157.67 48375000 36878000 11497000 0 0 807 348 782 2102;2103 1352;1353 1353 48 2 NNLAGAEELFAR Unmodified 1303.6521 0.65206377 354 Q00610;Q00610-2 CLTC Clathrin heavy chain 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 65.935 65.935 2 0.011708 15488 YJC_A_20141124_01 46.069 19.283 1783700 1783700 0 0 0 808 354 783 2104 1354 1354 0 NPDDITNEEYGEFYK Unmodified 1832.7741 0.77408897 247 P07900;P07900-2;Q86U12 HSP90AA1 Heat shock protein HSP 90-alpha yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 60.683 60.703 2 0.0083596 12631 YJC_A_20141124_01 56.46 51.556 1169400 912830 256560 0 0 809 247 784 2105;2106 1355 1355 1 NPDDITQEEYGEFYK Unmodified 1846.7897 0.78973904 250 P08238 HSP90AB1 Heat shock protein HSP 90-beta yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 61.526 61.522 2 6.868E-16 12994 YJC_B_20141124_01 92.633 78.887 2946300 2055800 732880 157650 0 810 250 785 2107;2108;2109 1356;1357 1357 2 NQGGYGGSSSSSSYGSGR Unmodified 1693.6928 0.69281896 255 P09651;F8W6I7;P09651-3;P09651-2;H0YH80 HNRNPA1 Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed yes no 0 0 0 By matching By MS/MS By MS/MS By MS/MS 1 1 1 1 34.42 34.492 2 9.8462E-05 6274 YJC_B_20141124_01 78.674 57.36 20026000 68298 146580 1715500 18095000 811 255 786 2110;2111;2112;2113 1358;1359;1360 1358 3 NQLTSNPENTVFDAK Unmodified 1676.8006 0.8005785 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 1 55.876 55.923 2 0 11093 YJC_A_20141124_01 181.51 148.32 16949000 11638000 4771000 372440 167910 812 261 787 2114;2115;2116;2117 1361;1362 1361 2 NQVALNPQNTVFDAK Unmodified 1657.8424 0.84238373 249 P08107;P08107-2 HSPA1A Heat shock 70 kDa protein 1A/1B yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 58.415 58.411 2 0.0022329 11853 YJC_A_20141124_01 76.341 54.455 2428500 1966200 317230 145110 0 813 249 788 2118;2119;2120 1363;1364 1363 2 NQVAMNPTNTVFDAK Oxidation (M) 1664.7828 0.78281994 262 P11142;E9PKE3;P11142-2;E9PNE6;E9PLF4;E9PQQ4;E9PQK7;E9PK54;E9PPY6;E9PN25 HSPA8 Heat shock cognate 71 kDa protein yes no 0 1 0 By MS/MS By MS/MS By matching By matching 1 1 51.171 51.191 2 7.178E-24 9634 YJC_A_20141124_01 97.823 77.016 1755100 1490200 264940 0 0 814 262 789 2121;2122 1365;1366 1365 35 2 NQVAMNPTNTVFDAK Unmodified 1648.7879 0.78790532 262 P11142;E9PKE3;P11142-2;E9PNE6;E9PLF4;E9PQQ4;E9PQK7;E9PK54;E9PPY6;E9PN25 HSPA8 Heat shock cognate 71 kDa protein yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 57.129 57.199 2 1.8467E-60 11484 YJC_A_20141124_01 113.52 99.051 1141900 746400 395530 0 0 815 262 789 2123;2124 1367 1367 1 NRPPFGQGYTQPGPGYR Unmodified 1890.9125 0.91252898 407 Q92734;Q92734-2 TFG Protein TFG yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 49.884 50.008 3 3.1737E-06 9411 YJC_D_20141124_01 80.411 62.516 4224300 0 0 580020 3644300 816 407 790 2125;2126 1368 1368 1 NSGSCLCLPRFMR Unmodified 1596.7323 0.73232147 49 O60266;C9J969;C9JLX3 ADCY3 Adenylate cyclase type 3 yes no 0 0 1 By matching By matching By matching By MS/MS 1 87.63 87.93 1 0.017735 33865 YJC_D_20141124_01 26.889 12.953 5579600 0 0 0 5579600 817 49 791 2127 1369 1369 1 NSNLVGAAHEELQQSR Unmodified 1751.8551 0.85507368 232 P02545;P02545-3;P02545-2;P02545-5;P02545-4;P02545-6;Q5TCI8 LMNA Prelamin-A/C;Lamin-A/C yes no 0 0 0 By MS/MS By matching By matching By matching 1 50.944 50.944 2 1.1168E-75 9602 YJC_A_20141124_01 121.03 99.143 415740 415740 0 0 0 818 232 792 2128 1370 1370 1 NSWQEGDTYTCVVMHEALHNHYTQK Unmodified 3047.329 0.32903843 65;64 CON__ENSEMBL:ENSBTAP00000024466;CON__ENSEMBL:ENSBTAP00000024462 no no 0 0 0 By matching By matching By matching By MS/MS 1 1 65.299 65.373 5 0.023555 15635 YJC_D_20141124_01 17.84 10.554 4577200 0 0 1152400 3424900 + 819 65;64 793 2129;2130 1371 1371 1 NSYVAGQYDDAASYQR Unmodified 1806.7809 0.78090569 100 P11413;P11413-3;E7EM57;E7EUI8;P11413-2;E9PD92 G6PD Glucose-6-phosphate 1-dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 50.055 50.055 2 2.6421E-16 9332 YJC_A_20141124_01 92.633 66.655 528070 528070 0 0 0 820 100 794 2131 1372 1372 1 NVIEAVYSR Unmodified 1049.5506 0.55055881 224 O75688;O75688-2;C9JIR6;O75688-4;B8ZZF0;O75688-3 PPM1B Protein phosphatase 1B yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 54.103 54.173 2 0.00031777 10586 YJC_A_20141124_01 88.596 51.252 13731000 10328000 3403700 0 0 821 224 795 2132;2133 1373 1373 1 NVIGLQMGTNR Unmodified 1201.6237 0.62374052 305 P37802;X6RJP6 TAGLN2 Transgelin-2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 55.178 55.178 2 0.0098929 10865 YJC_A_20141124_01 52.495 36.631 295080 295080 0 0 0 822 305 796 2134 1374 1374 1 NVLIFDLGGGTFDVSILTIDDGIFEVK Unmodified 2896.511 0.51099199 249 P08107;P08107-2;E7EP94;V9GZ37 HSPA1A Heat shock 70 kDa protein 1A/1B yes no 0 0 0 By MS/MS By matching By MS/MS By matching 1 1 1 94.547 94.491 3 0 32423 YJC_C_20141124_01 173.32 119.88 31572000 0 2316400 29256000 0 823 249 797 2135;2136;2137 1375;1376 1376 2 NVLIFDLGGGTFDVSILTIEDGIFEVK Unmodified 2910.5266 0.52664205 262 P11142;E9PKE3;P11142-2;E9PN89;P54652 HSPA8;HSPA2 Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2 yes no 0 0 0 By MS/MS By matching By MS/MS By MS/MS 1 1 1 94.543 94.517 3 0 38082 YJC_D_20141124_01 211.68 185.18 101530000 0 0 88558000 12972000 824 262 798 2138;2139;2140 1377;1378;1379 1379 1 NVQFVFDAVTDVIIK Unmodified 1706.9243 0.92432245 142 P04899;P08754;P63096;F5GZL8;P63096-2;P04899-6;P04899-3;P04899-5;P04899-2 GNAI2;GNAI3;GNAI1 Guanine nucleotide-binding protein G(i) subunit alpha-2;Guanine nucleotide-binding protein G(k) subunit alpha;Guanine nucleotide-binding protein G(i) subunit alpha-1 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 2 2 1 90.35 90.336 2;3 2.2423E-35 31104 YJC_B_20141124_01 105.58 70.482 1761000 1219100 360550 181360 0 825 142 799 2141;2142;2143;2144;2145 1380;1381;1382 1382 3 NVTFHGVLLDAFFNESSADWR Unmodified 2424.1499 0.14985872 313 P49327 FASN Fatty acid synthase;[Acyl-carrier-protein] S-acetyltransferase;[Acyl-carrier-protein] S-malonyltransferase;3-oxoacyl-[acyl-carrier-protein] synthase;3-oxoacyl-[acyl-carrier-protein] reductase;3-hydroxyacyl-[acyl-carrier-protein] dehydratase;Enoyl-[acyl-carrier-protein] reductase;Oleoyl-[acyl-carrier-protein] hydrolase yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 87.476 87.446 3 0.023247 29194 YJC_B_20141124_01 42.705 31.504 1180900 673620 507310 0 0 826 313 800 2146;2147 1383 1383 1 NWRQKEDHQTWR Unmodified 1682.8026 0.8025846 416 Q9H2X9;Q9H2X9-2 SLC12A5 Solute carrier family 12 member 5 yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 1 1 53.747 53.794 2 0.016845 10469 YJC_D_20141124_01 36.417 22.844 1377000 325580 389020 256650 405740 827 416 801 2148;2149;2150;2151 1384 1384 0 NWYIQATCATSGDGLYEGLDWLSNQLR Unmodified 3130.4454 0.44544839 353 P84077 ARF1 ADP-ribosylation factor 1 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 94.48 94.48 3 0.00010675 38155 YJC_A_20141124_01 55.051 43 8069600 8069600 0 0 0 828 353 802 2152 1385 1385 1 NYILDQTNVYGSAQR Unmodified 1740.8431 0.84311201 413 Q9BUJ2;Q9BUJ2-2;Q9BUJ2-3;B7Z4B8;Q9BUJ2-4;M0R3F1 HNRNPUL1 Heterogeneous nuclear ribonucleoprotein U-like protein 1 yes no 0 0 0 By matching By MS/MS By MS/MS By MS/MS 1 1 1 2 58.589 58.627 2;3 2.1996E-90 12178 YJC_B_20141124_01 122.46 98.529 4504700 447530 579510 627050 2850700 829 413 803 2153;2154;2155;2156;2157 1386;1387;1388;1389 1386 3 PATEGKR Unmodified 757.40825 0.40825167 390 Q5T9A4;Q5T2N8;Q5T9A4-3 ATAD3B;ATAD3C ATPase family AAA domain-containing protein 3B;ATPase family AAA domain-containing protein 3C yes no 0 0 1 By matching By matching By matching By MS/MS 1 26.858 26.957 2 0.017779 3576 YJC_D_20141124_01 71.296 7.9894 339270 0 0 0 339270 830 390 804 2158 1390 1390 0 PDFRDISKWNNR Unmodified 1546.7641 0.76407383 56 O75915;F8WF90;C9JQU6;F8WF33 ARL6IP5 PRA1 family protein 3 yes no 0 0 2 By MS/MS By matching By MS/MS By matching 1 1 1 60.613 60.662 2 0.0061264 12646 YJC_A_20141124_01 45.764 7.3888 1793400 435260 0 631740 726380 831 56 805 2159;2160;2161 1391;1392 1391 0 PDYLGADQRK Unmodified 1161.5778 0.57783619 303 P35998;C9JLS9 PSMC2 26S protease regulatory subunit 7 yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 37.862 37.932 3 0.019519 5846 YJC_A_20141124_01 51.762 33.929 1164400 908320 256060 0 0 832 303 806 2162;2163 1393;1394 1393 2 PEQPEKLR Unmodified 995.53999 0.53999412 159 Q9UMZ3;F8VW52;F8W122 PTPRQ Phosphatidylinositol phosphatase PTPRQ yes no 0 0 1 By matching By matching By matching By MS/MS 1 31.323 31.422 3 0.013924 4407 YJC_D_20141124_01 77.318 32.94 518470 0 0 0 518470 833 159 807 2164 1395 1395 1 PGVTVKDVNQQEFVR Unmodified 1714.9002 0.90023296 206 P39019;M0R2L9;M0QXK4;M0QYF7;M0R140 RPS19 40S ribosomal protein S19 yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 51.504 51.604 3 0.0065594 9853 YJC_D_20141124_01 64.374 50.956 2376200 859630 0 0 1516600 834 206 808 2165;2166 1396 1396 1 PKTVSEEERK Unmodified 1201.6303 0.63026569 383 Q15746;Q15746-11;Q15746-7;Q15746-4;Q15746-5;Q15746-2;Q15746-3;Q15746-6 MYLK Myosin light chain kinase, smooth muscle;Myosin light chain kinase, smooth muscle, deglutamylated form yes no 0 0 2 By matching By matching By matching By MS/MS 1 24.284 24.383 2 0.017288 3099 YJC_D_20141124_01 43.77 0.3513 0 0 0 0 0 835 383 809 2167 1397 1397 1 PSPCDCCPPPELPGGPSVFIFPPKPK Unmodified 2876.37 0.36996395 65 CON__ENSEMBL:ENSBTAP00000024466 yes yes 0 0 1 By matching By matching By matching By MS/MS 1 71.851 72.05 3 6.5362E-30 20666 YJC_D_20141124_01 90.378 79.378 10998000 0 0 0 10998000 + 836 65 810 2168 1398 1398 1 QAAPCVLFFDELDSIAK Unmodified 1922.9448 0.94479989 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 92.531 92.501 2 0.02045 32338 YJC_B_20141124_01 42.818 27.938 1189900 856730 333180 0 0 837 326 811 2169;2170 1399 1399 1 QAASSLQQASLK Unmodified 1230.6568 0.65681479 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 41.248 41.378 2 9.1191E-06 7039 YJC_D_20141124_01 83.243 53.998 5481800 0 205350 898120 4378400 838 307 812 2171;2172;2173 1400;1401 1401 2 QAGLVSK Unmodified 701.40719 0.40718903 294 P30084 ECHS1 Enoyl-CoA hydratase, mitochondrial yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 16.631 16.601 2 0.017938 1979 YJC_A_20141124_01 83.753 0.54644 3214700 1185000 2029700 0 0 839 294 813 2174;2175 1402 1402 1 QAIPLDENEGIYVQDVK Unmodified 1929.9684 0.96837211 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 63.211 63.285 2 0.022796 14140 YJC_D_20141124_01 48.623 26.736 6878400 0 0 975160 5903200 840 375 814 2176;2177 1403;1404 1404 2 QAKVLENAEGAR Unmodified 1284.6786 0.67861287 307 P38646;D6RJI2;D6RA73 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 1 35.872 35.921 3 0.014584 5444 YJC_D_20141124_01 67.749 37.181 17986000 359850 0 174850 17451000 841 307 815 2178;2179;2180 1405 1405 1 QAPGKALEWLGGIDTGGSTGYNPGLK Unmodified 2586.3078 0.30781592 66 CON__ENSEMBL:ENSBTAP00000033053 yes yes 0 0 1 By matching By matching By matching By MS/MS 1 1 71.168 71.242 3 0.00058677 19860 YJC_D_20141124_01 45.205 21.912 3294400 0 0 533960 2760400 + 842 66 816 2181;2182 1406 1406 1 QAPGKALEWLGVIYSGGSTGYNPALK Unmodified 2676.3912 0.39115162 62 CON__ENSEMBL:ENSBTAP00000011227 yes yes 0 0 1 By matching By matching By matching By MS/MS 1 79.977 80.276 3 0.00027498 27638 YJC_D_20141124_01 59.539 47.091 1271700 0 0 0 1271700 + 843 62 817 2183 1407 1407 1 QAQIEVVPSASALIIK Unmodified 1665.9665 0.96652161 293 P30050 RPL12 60S ribosomal protein L12 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 70.084 70.164 2 0.021347 18200 YJC_A_20141124_01 45.083 27.389 1529700 801390 268580 0 459720 844 293 818 2184;2185;2186 1408 1408 1 QAVTNPNNTFYATK Unmodified 1567.7631 0.76307078 307 P38646;D6RJI2;D6RA73 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 1 1 1 1 47.192 47.264 2 0 9368 YJC_B_20141124_01 188.63 140.78 33690000 1061200 778150 2583200 29267000 845 307 819 2187;2188;2189;2190 1409;1410;1411;1412 1410 4 QAVTNPNNTFYATKR Unmodified 1723.8642 0.86418181 307 P38646;D6RJI2;D6RA73 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 1 By MS/MS By matching By matching By MS/MS 1 1 1 43.634 43.716 2;3 8.6216E-260 7740 YJC_D_20141124_01 160.8 124.46 4189800 1790800 0 93795 2305100 846 307 820 2191;2192;2193 1413;1414 1414 2 QEMQEVQSSR Oxidation (M) 1236.5405 0.54046441 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 1 0 By matching By matching By matching By MS/MS 1 25.361 25.46 2 0.0015285 3275 YJC_D_20141124_01 77.674 59.002 948270 0 0 0 948270 847 278 821 2194 1415 1415 38 1 QEMQEVQSSR Unmodified 1220.5455 0.54554978 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 32.681 32.755 2 7.4747E-59 4716 YJC_D_20141124_01 122.34 93.386 4096800 0 0 218900 3877900 848 278 821 2195;2196 1416 1416 1 QENESGYER Unmodified 1110.4578 0.45778063 413 Q9BUJ2;Q9BUJ2-2;Q9BUJ2-3;B7Z4B8;Q9BUJ2-4;M0QYZ0;M0R203;M0QZV6;M0R0K8 HNRNPUL1 Heterogeneous nuclear ribonucleoprotein U-like protein 1 yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 1 28.932 29.028 2 0.026272 3934 YJC_D_20141124_01 57.347 39.451 357820 0 77408 64745 215660 849 413 822 2197;2198;2199 1417 1417 1 QEYDESGPSIVHR Unmodified 1515.6954 0.69538514 327 P60709;P63261;Q6S8J3;A5A3E0;P0CG38;P0CG39;Q9BYX7 ACTB;ACTG1;POTEE;POTEF;POTEI;POTEJ;POTEKP Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed;POTE ankyrin domain family member E;POTE ankyrin domain family member F;POTE ankyrin domain family member I;POTE ankyrin domain family member J;Putative beta-actin-like protein 3 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 43.503 43.524 3 0.01173 8349 YJC_B_20141124_01 58.781 46.426 902160 126940 775230 0 0 850 327 823 2200;2201 1418 1418 1 QFAALVASK Unmodified 933.52837 0.5283668 412 Q99460;Q99460-2;C9J9M4 PSMD1 26S proteasome non-ATPase regulatory subunit 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 25.876 25.926 2 0.02728 3250 YJC_A_20141124_01 56.258 9.7961 26715000 4143400 0 3216000 19356000 851 412 824 2202;2203;2204 1419 1419 1 QHCCPAGYTCNVK Unmodified 1593.6487 0.64865142 201 P28799;K7EQI0;K7EKL3;K7EQ05;P28799-3 GRN Granulins;Acrogranin;Paragranulin;Granulin-1;Granulin-2;Granulin-3;Granulin-4;Granulin-5;Granulin-6;Granulin-7 yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 35.379 35.453 3 4.8391E-29 5351 YJC_D_20141124_01 101.56 96.651 70085000 0 0 28747000 41338000 852 201 825 2205;2206 1420;1421 1421 2 QHCCPAGYTCNVKAR Unmodified 1820.7869 0.78687624 201 P28799;K7EQI0;K7EKL3;K7EQ05;P28799-3 GRN Granulins;Acrogranin;Paragranulin;Granulin-1;Granulin-2;Granulin-3;Granulin-4;Granulin-5;Granulin-6;Granulin-7 yes no 0 0 1 By matching By matching By matching By MS/MS 2 2 34.244 34.317 3;4 0.0078657 5043 YJC_D_20141124_01 44.511 36.26 28795000 0 0 3572100 25223000 853 201 826 2207;2208;2209;2210 1422;1423 1422 1 QHPVPPPAQNQNQVR Unmodified 1708.8757 0.87574954 167 Q15942;H0Y2Y8;B4DQX7;B4DQR8 ZYX Zyxin yes no 0 0 0 By MS/MS By matching By matching By matching 1 33.371 33.371 3 0.001806 4708 YJC_A_20141124_01 63.181 36.532 140840 140840 0 0 0 854 167 827 2211 1424 1424 0 QRGKGEITPAAIQK Unmodified 1495.8471 0.84707518 139 Q15532;F5GWN1;J3KRP6;J3QS72;X6R3J2;J3QQM2;J3KT74;J3QQW2;Q15532-2 SS18;CD63 Protein SSXT yes no 0 0 2 By matching By matching By MS/MS By matching 1 35.264 35.313 3 0.0050926 4656 YJC_C_20141124_01 62.528 38.817 140810 0 0 140810 0 855 139 828 2212 1425 1425 1 QTLDALNYLHDNK Unmodified 1543.7631 0.76307078 415 Q9H2G2;Q9H2G2-2 SLK STE20-like serine/threonine-protein kinase yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 33.574 33.648 4 0.013795 4896 YJC_D_20141124_01 51.612 37.166 11514000 0 0 1467400 10046000 856 415 829 2213;2214 1426 1426 1 QVLLSAAEAAEVILR Unmodified 1581.909 0.90900673 351 P78371;P78371-2 CCT2 T-complex protein 1 subunit beta yes no 0 0 0 By MS/MS By MS/MS By matching By matching 2 2 84.634 84.654 2;3 4.2189E-05 30113 YJC_A_20141124_01 81.448 48.175 3795200 3272500 522710 0 0 857 351 830 2215;2216;2217;2218 1427;1428;1429 1427 3 QVQSLTCEVDALK Unmodified 1489.7446 0.74464352 251 P08670;B0YJC4;B0YJC5;Q5JVS8 VIM Vimentin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 60.94 60.96 2 8.7983E-50 12820 YJC_A_20141124_01 113.54 83.204 2944400 2561000 383320 0 0 858 251 831 2219;2220 1430 1430 1 QVTITGSAASISLAQYLINAR Unmodified 2176.1852 0.18518159 378 Q15365 PCBP1 Poly(rC)-binding protein 1 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 84.201 84.231 3 0.0074555 29873 YJC_A_20141124_01 60.764 30.189 2317700 1609700 391110 316940 0 859 378 832 2221;2222;2223 1431 1431 1 QVVESAYEVIK Unmodified 1263.6711 0.67106787 229 P00338;P00338-3;P00338-4 LDHA L-lactate dehydrogenase A chain yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 55.916 55.946 2 0.018249 11115 YJC_A_20141124_01 45.357 24.325 1853800 1538200 227020 88568 0 860 229 833 2224;2225;2226 1432 1432 1 RAGELTEDEVER Unmodified 1402.6688 0.66883604 336 P62269 RPS18 40S ribosomal protein S18 yes yes 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 39.203 39.203 3 0.00029681 6207 YJC_A_20141124_01 77.185 52.332 260350 260350 0 0 0 861 336 834 2227;2228 1433;1434 1433 2 RAPFDLFENK Unmodified 1235.6299 0.62987176 250 P08238;Q58FF7 HSP90AB1;HSP90AB3P Heat shock protein HSP 90-beta;Putative heat shock protein HSP 90-beta-3 yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 64.252 64.272 2 0.027621 14656 YJC_A_20141124_01 29.303 6.2908 1193300 982070 211230 0 0 862 250 835 2229;2230 1435 1435 0 RDVAVAIK Unmodified 870.5287 0.52870115 379 Q15375;Q15375-2;Q15375-4 EPHA7 Ephrin type-A receptor 7 yes no 0 0 1 By matching By matching By MS/MS By matching 1 49.791 49.84 2 0.015918 7759 YJC_C_20141124_01 45.335 4.5571 167540000 0 0 167540000 0 863 379 836 2231 1436 1436 0 RFDEILEASDGIMVAR Unmodified 1820.9091 0.90908309 268 P14618;P14618-3;P14618-2;H3BTN5;Q504U3 PKM;PKM2 Pyruvate kinase PKM;Pyruvate kinase yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 70.365 70.385 3 2.3396E-16 17608 YJC_B_20141124_01 93.243 74.772 2101300 1500900 600430 0 0 864 268 837 2232;2233 1437;1438 1438 2 RGDLPFVVPR Unmodified 1154.656 0.65602693 302 P35579;P35579-2 MYH9 Myosin-9 yes no 0 0 1 By MS/MS By matching By matching By matching 1 59.368 59.368 3 0.023303 12263 YJC_A_20141124_01 47.844 30.676 478660 478660 0 0 0 865 302 838 2234 1439 1439 1 RGSSLLR Unmodified 787.46644 0.46643525 396 Q6ZP70 yes yes 0 0 1 By matching By matching By matching By MS/MS 1 29.06 29.16 2 0.026216 3993 YJC_D_20141124_01 47.082 6.8135 146780 0 0 0 146780 866 396 839 2235 1440 1440 0 RHPEYAVSVLLR Unmodified 1438.8045 0.80448208 72 CON__P02769 yes yes 0 0 1 By matching By matching By MS/MS By MS/MS 1 1 1 1 57.347 57.369 3 2.3392E-22 11563 YJC_D_20141124_01 103.14 81.889 4731000 986720 1257800 966070 1520400 + 867 72 840 2236;2237;2238;2239 1441;1442 1442 2 RLETLLR Unmodified 899.55525 0.55525025 228 O95816;B4DXE2 BAG2 BAG family molecular chaperone regulator 2 yes no 0 0 1 By matching By MS/MS By matching By matching 1 47.108 47.149 2 0.002918 9352 YJC_B_20141124_01 75.109 8.0772 0 0 0 0 0 868 228 841 2240 1443 1443 1 RLGDSSLSR Unmodified 989.52541 0.52540669 148 Q14152;F5H335 EIF3A Eukaryotic translation initiation factor 3 subunit A yes no 0 0 1 By MS/MS By matching By matching By matching 1 33.984 33.984 2 0.002576 4884 YJC_A_20141124_01 61.78 11.307 119600 119600 0 0 0 869 148 842 2241 1444 1444 0 RLKVNELR Unmodified 1026.6298 0.62981218 413 Q9BUJ2;Q9BUJ2-2;Q9BUJ2-3;M0R247 HNRNPUL1 Heterogeneous nuclear ribonucleoprotein U-like protein 1 yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 1 1 36.101 36.173 3 0.02428 5485 YJC_D_20141124_01 66.962 31.517 1821600 119590 223980 119380 1358600 870 413 843 2242;2243;2244;2245 1445 1445 1 RLSYNTASNKTR Unmodified 1409.7375 0.73752473 311 P49207 RPL34 60S ribosomal protein L34 yes yes 0 0 2 By MS/MS By matching By matching By matching 1 1 1 29.689 29.769 3 0.0067996 3969 YJC_A_20141124_01 70.628 38.469 478480 252290 153980 0 72206 871 311 844 2246;2247;2248 1446 1446 1 RPFGISALIVGFDFDGTPR Unmodified 2064.0793 0.079259959 171 O14818;H0Y586;O14818-2 PSMA7 Proteasome subunit alpha type-7 yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 86.324 86.305 3 0.01062 31442 YJC_A_20141124_01 59.502 45.878 872640 601710 270920 0 0 872 171 845 2249;2250 1447 1447 1 RPQYSNPPVQGEVMEGADNQGAGEQGR Unmodified 2870.3002 0.30018114 169 P67809;H0Y449;C9J5V9 YBX1 Nuclease-sensitive element-binding protein 1 yes no 0 0 1 By MS/MS By matching By matching By matching 1 48.692 48.692 3 0.0096962 8990 YJC_A_20141124_01 35.464 21.047 0 0 0 0 0 873 169 846 2251 1448 1448 1 RQAVDVSPLRR Unmodified 1295.7422 0.74221618 209 P46782;M0QZN2;M0R0F0;M0R0R2 RPS5 40S ribosomal protein S5;40S ribosomal protein S5, N-terminally processed yes no 0 0 2 By MS/MS By matching By matching By matching 1 1 1 39.006 39.086 3 0.016656 6195 YJC_A_20141124_01 53.211 30.199 434400 240350 152900 0 41157 874 209 847 2252;2253;2254 1449 1449 1 RQAVTNPNNTFYATK Unmodified 1723.8642 0.86418181 307 P38646;D6RJI2;D6RA73 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 1 43.168 43.264 3 6.1247E-16 7588 YJC_D_20141124_01 93.228 64.946 3348700 0 1709200 201130 1438400 875 307 848 2255;2256;2257 1450 1450 1 RQAVTNPNNTFYATKR Unmodified 1879.9653 0.96529283 307 P38646;D6RJI2;D6RA73 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 40.001 40.125 3 0.00024774 6629 YJC_D_20141124_01 79.347 63.826 2443500 0 0 242770 2200700 876 307 849 2258;2259 1451 1451 1 RQVDQLTNDKAR Unmodified 1442.759 0.75898845 251 P08670;B0YJC4 VIM Vimentin yes no 0 0 2 By MS/MS By matching By matching By matching 1 1 1 30.716 30.796 3 0.01802 4194 YJC_A_20141124_01 50.222 34.424 480230 76706 75876 0 327650 877 251 850 2260;2261;2262 1452 1452 1 RSDAEPSVFLFKPSDEQLK Unmodified 2192.1113 0.11134795 80 CON__Q05B55 yes yes 0 0 2 By matching By matching By MS/MS By matching 2 1 63.282 63.314 3;4 0.0071467 11320 YJC_C_20141124_01 44.831 23.472 1672200 0 0 1291400 380830 + 878 80 851 2263;2264;2265 1453;1454 1454 2 RSSGENVENNSQR Unmodified 1475.6713 0.67129566 422 Q9NVW2 RLIM E3 ubiquitin-protein ligase RLIM yes yes 0 0 1 By MS/MS By matching By matching By matching 1 23.37 23.37 3 0.0051028 2887 YJC_A_20141124_01 70.54 55.441 103300 103300 0 0 0 879 422 852 2266 1455 1455 1 RVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR Unmodified 3274.6807 0.68068514 375 Q14764 MVP Major vault protein yes yes 0 0 1 By matching By matching By MS/MS By MS/MS 1 2 55.371 55.42 3;4 9.4631E-39 8886 YJC_C_20141124_01 88.721 78.674 22745000 0 0 1913100 20832000 880 375 853 2267;2268;2269 1456;1457;1458 1456 2 RYDDPEVQK Unmodified 1148.5462 0.54620171 307 P38646;D6RJI2 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 1 By matching By matching By matching By MS/MS 1 32.049 32.148 3 0.020479 4543 YJC_D_20141124_01 63.426 35.945 731850 0 0 0 731850 881 307 854 2270 1459 1459 1 RYDDPEVQKDIK Unmodified 1504.7522 0.75217174 307 P38646;D6RJI2 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 2 By MS/MS By matching By matching By MS/MS 2 2 1 2 38.512 38.587 3;4 0.00058851 6166 YJC_D_20141124_01 73.632 58.47 11505000 445180 337720 216370 10506000 882 307 855 2271;2272;2273;2274;2275;2276;2277 1460;1461;1462;1463 1462 4 SADFVVESIGSEVGSLGFAIEGPSQAK Unmodified 2680.3232 0.32319122 223 O75369;O75369-8;O75369-5;O75369-4;O75369-6;O75369-3;O75369-2;O75369-9;E7EN95;O75369-7 FLNB Filamin-B yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 89.555 89.551 3 0.021339 34142 YJC_A_20141124_01 35.641 21.157 9354800 4798900 3161100 1394900 0 883 223 856 2278;2279;2280 1464 1464 1 SAFKVQNATTKGPNGVYDFSQAHNAK Unmodified 2779.3678 0.36779042 433 Q9Y5V3;Q9Y5V3-2 MAGED1 Melanoma-associated antigen D1 yes no 0 0 2 By MS/MS By MS/MS By matching By matching 1 1 50.479 50.5 4 0.00015263 10163 YJC_B_20141124_01 51.554 11.377 1166200 812890 353280 0 0 884 433 857 2281;2282 1465;1466 1466 2 SAINEVVTR Unmodified 987.53491 0.53490874 39 P62899;P62899-3;P62899-2;H7C2W9;C9JU56;B7Z4E3;B7Z4C8;B8ZZK4 RPL31 60S ribosomal protein L31 yes no 0 0 0 By MS/MS By MS/MS By matching By MS/MS 1 1 1 44.302 44.382 2 1.138E-12 7943 YJC_D_20141124_01 100.69 58.811 4052300 1836900 1091200 0 1124200 885 39 858 2283;2284;2285 1467;1468;1469 1469 3 SALSGHLETVILGLLK Unmodified 1649.9716 0.97160699 244 P07355;P07355-2;H0YN42;A6NMY6;H0YKL9;H0YKZ7;H0YLV6;H0YMT9;H0YKX9;H0YMW4;H0YMM1;H0YKS4;H0YMD0;H0YMU9;H0YM50;H0YNP5 ANXA2;ANXA2P2 Annexin A2;Annexin;Putative annexin A2-like protein yes no 0 0 0 By MS/MS By matching By matching By matching 2 2 90.07 90.04 2;3 1.0273E-24 34602 YJC_A_20141124_01 99.844 96.399 7553600 6638500 915130 0 0 886 244 859 2286;2287;2288;2289 1470;1471;1472 1470 3 SCAAAGTECLISGWGNTK Unmodified 1881.8349 0.83493187 67 CON__P00761 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 2 4 4 5 65.875 65.939 2;3 8.6706E-103 15491 YJC_D_20141124_01 121.51 106.78 3251500000 577090000 403600000 522230000 1748500000 + 887 67 860 2290;2291;2292;2293;2294;2295;2296;2297;2298;2299;2300;2301;2302;2303;2304 1473;1474;1475;1476;1477;1478;1479;1480;1481;1482;1483;1484;1485;1486 1484 13 SDETAAK Unmodified 720.329 0.32899829 234 P04792;C9J3N8 HSPB1 Heat shock protein beta-1 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 16.359 16.329 2 4.0146E-09 1925 YJC_A_20141124_01 104.37 41.218 416080 269930 146150 0 0 888 234 861 2305;2306 1487;1488 1487 2 SDIDEIVLVGGSTR Unmodified 1459.7518 0.75183739 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By matching By MS/MS By matching By matching 1 65.673 65.713 2 0.011293 14942 YJC_B_20141124_01 52.008 16.008 1163100 0 1163100 0 0 889 261 862 2307 1489 1489 1 SDIGEVILVGGMTR Unmodified 1445.7548 0.75481428 307 P38646;H0YBG6 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 0 By MS/MS By matching By MS/MS By MS/MS 1 1 1 71.439 71.489 2 0.0085027 19175 YJC_A_20141124_01 54.812 21.62 3037400 982720 0 618430 1436300 890 307 863 2308;2309;2310 1490;1491;1492 1490 3 SDKGTEGWESAATQTK Unmodified 1694.7748 0.77475768 173 Q9UPQ9;Q9UPQ9-1;H0Y720 TNRC6B Trinucleotide repeat-containing gene 6B protein yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 1 1 43.523 43.595 3 3.4904E-60 7728 YJC_D_20141124_01 112.03 86.584 1970600 205190 99438 125320 1540700 891 173 864 2311;2312;2313;2314 1493 1493 1 SDPMVQCIIEESGEHIIAGAGELHLEICLK Unmodified 3347.62 0.61998364 265 P13639 EEF2 Elongation factor 2 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 91.482 91.452 3 8.6892E-06 35827 YJC_A_20141124_01 43.623 35.16 3537100 3084200 452910 0 0 892 265 865 2315;2316 1494 1494 1 SDVDLYQVR Unmodified 1093.5404 0.54038805 141 O00233;F5H7X1;F5H5V4;F5GX23;F8W7V8;J3KN29;O00233-2;F5H169 PSMD9 26S proteasome non-ATPase regulatory subunit 9 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 51.928 51.975 2 2.6686E-29 9942 YJC_A_20141124_01 115.78 74.787 2203900 1084900 802510 0 316500 893 141 866 2317;2318;2319 1495 1495 1 SEIDLFNIR Unmodified 1105.5768 0.57677356 90 P08758;D6RBE9;D6RBL5 ANXA5 Annexin A5;Annexin yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 72.249 72.246 2 7.7481E-09 19758 YJC_A_20141124_01 97.565 70.676 3264900 2719600 348680 196610 0 894 90 867 2320;2321;2322 1496;1497 1496 2 SELIIHQR Unmodified 994.55598 0.55597854 130 Q6P3V2;Q52M93;E9PQH3 ZNF585A;ZNF585B Zinc finger protein 585A;Zinc finger protein 585B yes no 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 1 1 1 1 52.918 52.94 2 0.00013976 10152 YJC_A_20141124_01 94.114 60.737 108220000 32486000 21997000 16435000 37302000 895 130 868 2323;2324;2325;2326 1498;1499;1500;1501 1498 4 SELVANNVTLPAGEQR Unmodified 1696.8744 0.87441214 1 P42167;P42166;P42167-2;G5E972;A2T926 TMPO Lamina-associated polypeptide 2, isoforms beta/gamma;Thymopoietin;Thymopentin;Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 54.206 54.277 2 1.1809E-60 10614 YJC_A_20141124_01 111.7 84.862 1080700 731480 349200 0 0 896 1 869 2327;2328 1502 1502 1 SEPHSLSSEALMR Unmodified 1442.6824 0.68237762 421 Q9NR28;Q9NR28-2;H7BZK7 DIABLO Diablo homolog, mitochondrial yes no 0 0 0 By matching By MS/MS By matching By matching 1 47.95 47.99 3 0.0055774 9571 YJC_B_20141124_01 73.273 48.079 622550 0 622550 0 0 897 421 870 2329 1503;1504 1504 2 SESPKEPEQLRK Unmodified 1426.7416 0.74160705 255 P09651;F8W6I7;P09651-3;P09651-2;F8W646;F8VTQ5 HNRNPA1 Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed yes no 0 0 2 By matching By matching By MS/MS By MS/MS 2 2 31.418 31.491 3;4 1.7184E-07 4398 YJC_D_20141124_01 87.184 65.129 7208700 0 0 1355000 5853700 898 255 871 2330;2331;2332;2333 1505;1506;1507 1506 3 SESSSKSSQPLASKQEK Acetyl (Protein N-term) 1848.9065 0.90650013 186 P17096;P17096-2;H7BYM6;P17096-3 HMGA1 High mobility group protein HMG-I/HMG-Y yes no 1 0 2 By MS/MS By matching By matching By MS/MS 1 1 1 1 29.257 29.329 3 0.0015491 3974 YJC_D_20141124_01 71.531 46.204 3076500 671110 202270 114380 2088800 899 186 872 2334;2335;2336;2337 1508;1509 1509 2 SETAPAAPAAAPPAEKAPVK Acetyl (Protein N-term) 1915.0051 0.005091963 272 P16403 HIST1H1C Histone H1.2 yes yes 1 0 1 By matching By MS/MS By matching By matching 1 44.684 44.725 2 1.0527E-06 8729 YJC_B_20141124_01 77.037 62.77 148800 0 148800 0 0 900 272 873 2338 1510;1511 1511 2 SETAPAAPAAPAPAEK Acetyl (Protein N-term) 1519.7518 0.75183739 257 P10412 HIST1H1E Histone H1.4 yes yes 1 0 0 By matching By MS/MS By matching By matching 1 1 1 44.09 44.17 2 0.014858 8604 YJC_B_20141124_01 48.391 6.1344 757680 140470 428750 0 188460 901 257 874 2339;2340;2341 1512 1512 1 SETAPAAPAAPAPAEKTPVK Acetyl (Protein N-term) 1945.0157 0.015656649 257 P10412 HIST1H1E Histone H1.4 yes yes 1 0 1 By matching By MS/MS By matching By matching 1 44.868 44.909 2 2.856E-33 8820 YJC_B_20141124_01 98.391 79.456 229190 0 229190 0 0 902 257 875 2342 1513 1513 1 SETAPAETATPAPVEK Acetyl (Protein N-term) 1639.7941 0.79409613 271 P16401 HIST1H1B Histone H1.5 yes yes 1 0 0 By matching By MS/MS By matching By MS/MS 1 1 1 45.164 45.244 2 6.8443E-10 8194 YJC_D_20141124_01 85.006 62.152 1202100 164070 721170 0 316900 903 271 876 2343;2344;2345 1514;1515 1515 2 SFSQSSILIQHR Unmodified 1401.7365 0.7364621 149 Q3SY52;F5H435;Q3SY52-3;Q3SY52-2 ZIK1 Zinc finger protein interacting with ribonucleoprotein K yes no 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 3 3 3 4 52.812 52.847 2;3 9.8527E-227 10139 YJC_A_20141124_01 158.56 124.06 665050000 182730000 148070000 99317000 234930000 904 149 877 2346;2347;2348;2349;2350;2351;2352;2353;2354;2355;2356;2357;2358 1516;1517;1518;1519;1520;1521;1522;1523;1524;1525 1517 10 SFVEVNEEGTEAAAATAAIMMMR Unmodified 2428.1073 0.1072669 300 P35237 SERPINB6 Serpin B6 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 87.953 87.923 3 0.0042522 32858 YJC_A_20141124_01 44.641 35.357 1117100 945620 171480 0 0 905 300 878 2359;2360 1526 1526 1 SGALDVLQMK Acetyl (Protein N-term) 1102.5692 0.56924534 50 P08865;C9J9K3;A6NE09;C9JQR9 RPSA;RPSAP58 40S ribosomal protein SA yes no 1 0 0 By MS/MS By matching By matching By matching 1 1 73.308 73.328 2 0.00059915 20737 YJC_A_20141124_01 77.062 48.858 830330 761720 68604 0 0 906 50 879 2361;2362 1527 1527 1 SGATAGAAGGR Unmodified 874.42569 0.42569264 318 P50991;P50991-2 CCT4 T-complex protein 1 subunit delta yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 21.045 21.066 2 6.2381E-07 4050 YJC_B_20141124_01 86.014 55.829 202540 28322 174220 0 0 907 318 880 2363;2364 1528 1528 1 SGFSSVSVSR Unmodified 1011.4985 0.49852324 68 P02538;CON__P02538 KRT6A Keratin, type II cytoskeletal 6A yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 44.951 44.995 2 0.017566 8793 YJC_B_20141124_01 50.484 27.797 628740 0 518240 110510 0 + 908 68 881 2365;2366 1529 1529 1 SGGGFSSGSAGIINYQR Unmodified 1656.7856 0.78559713 73 CON__P04264;P04264 KRT1 Keratin, type II cytoskeletal 1 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 56.119 56.163 2 1.2681E-11 11547 YJC_B_20141124_01 85.469 73.76 650100 0 352240 297860 0 + 909 73 882 2367;2368 1530 1530 1 SGGGGGGGGCGGGGGVSSLR Unmodified 1548.6699 0.66991545 76 P13645;CON__P13645 KRT10 Keratin, type I cytoskeletal 10 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 37.11 37.173 2 8.579E-06 6780 YJC_B_20141124_01 74.029 50.318 382660 43444 203660 135560 0 + 910 76 883 2369;2370;2371 1531 1531 1 SGGGGGGGLGSGGSIR Unmodified 1231.5905 0.59052614 301 P35527;CON__P35527 KRT9 Keratin, type I cytoskeletal 9 yes no 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 1 1 1 1 37.05 37.122 2 2.4669E-201 5738 YJC_D_20141124_01 147.75 103.11 9497600 1676800 2531400 2426100 2863300 + 911 301 884 2372;2373;2374;2375 1532;1533;1534;1535 1535 4 SGGGGYSQNR Unmodified 981.42642 0.42642093 413 Q9BUJ2;Q9BUJ2-2;Q9BUJ2-3;B7Z4B8;Q9BUJ2-4;M0R3F1;Q9BUJ2-5 HNRNPUL1 Heterogeneous nuclear ribonucleoprotein U-like protein 1 yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 1 1 24.04 24.112 2 0.0062583 3041 YJC_D_20141124_01 65.842 30.164 1854700 123050 878220 155750 697720 912 413 885 2376;2377;2378;2379 1536 1536 1 SGGKYVDSEGHLYTVPIR Acetyl (Protein N-term) 2019.0062 0.0061545955 360 Q03135 CAV1 Caveolin-1 yes yes 1 0 1 By MS/MS By matching By matching By matching 1 1 57.581 57.601 3 8.5729E-08 11657 YJC_A_20141124_01 81.854 71.086 7628000 5335100 2292900 0 0 913 360 886 2380;2381 1537 1537 1 SGNFGGSR Unmodified 780.35147 0.35146507 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 1 26.453 26.549 2 1.9911E-07 3491 YJC_D_20141124_01 99.788 45.001 4409000 0 211590 281720 3915700 914 278 887 2382;2383;2384 1538 1538 1 SGPFGQIFRPDNFVFGQSGAGNNWAK Unmodified 2797.3361 0.33609636 245;350 P68371;P04350;M0QY85;M0QZL7;M0R278;M0R1I1;P07437;Q5JP53;Q5ST81;Q9BVA1;Q13885;E9PBJ4 TUBB4B;TUBB4A;TUBB;TUBB2B;TUBB2A Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta chain;Tubulin beta-2B chain;Tubulin beta-2A chain no no 0 0 1 By MS/MS By matching By matching By matching 1 1 1 79.761 79.791 3 0.0057637 26600 YJC_A_20141124_01 40.533 31.153 10778000 6077900 3875400 824700 0 915 350;245 888 2385;2386;2387 1539 1539 0 SGRGGNFGFGDSRGGGGNFGPGPGSNFR Unmodified 2671.2025 0.20245643 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 2 By matching By matching By MS/MS By MS/MS 1 1 56.602 56.625 4 0.00011652 11300 YJC_D_20141124_01 42.791 32.842 8847700 0 0 799060 8048600 916 278 889 2388;2389 1540;1541 1541 2 SGSALELSVENVK Unmodified 1331.6933 0.69325988 224 O75688;O75688-2;C9JIR6;O75688-4;B8ZZF0;O75688-5 PPM1B Protein phosphatase 1B yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 58.047 58.067 2 0 11804 YJC_A_20141124_01 190.34 137.55 8180800 5586800 2594000 0 0 917 224 890 2390;2391 1542 1542 1 SGVSLAALKK Unmodified 972.59678 0.59678072 257;272 P10412;P16402;P16403 HIST1H1E;HIST1H1D;HIST1H1C Histone H1.4;Histone H1.3;Histone H1.2 no no 0 0 1 By MS/MS By MS/MS By MS/MS By MS/MS 1 2 2 2 46.299 46.382 2;3 1.6545E-23 8409 YJC_D_20141124_01 106.88 71.442 30027000 3085800 9836200 2087300 15017000 918 257;272 891 2392;2393;2394;2395;2396;2397;2398 1543;1544;1545;1546;1547;1548;1549 1548 7 SHFEQWGTLTDCVVMRDPNTKR Unmodified 2676.2537 0.25368864 255 P09651;F8W6I7;P09651-3;P09651-2;F8W646;F8VZ49;Q32P51 HNRNPA1;HNRNPA1L2 Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2 yes no 0 0 2 By matching By matching By matching By MS/MS 1 61.861 62.06 4 0.0010045 13391 YJC_D_20141124_01 48.51 32.285 6949800 0 0 0 6949800 919 255 892 2399 1550 1550 1 SHSAHFFEFLTK Unmodified 1449.7041 0.70409934 3 P30046;A6NHG4;B7Z522;J3KQ18;B5MC82 DDT;DDTL D-dopachrome decarboxylase;D-dopachrome decarboxylase-like protein yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 64.331 64.352 3 0.0098758 14416 YJC_A_20141124_01 68.536 54.963 1699800 1439700 260100 0 0 920 3 893 2400;2401 1551 1551 1 SHTILLVQPTKRPEGR Acetyl (Protein N-term) 1873.0534 0.05337956 163 P84090;G3V279 ERH Enhancer of rudimentary homolog yes no 1 0 2 By MS/MS By matching By matching By matching 1 49.667 49.667 4 0.0019629 9220 YJC_A_20141124_01 54.898 44.617 1718800 1718800 0 0 0 921 163 894 2402 1552;1553 1553 2 SIATLAITTLLK Unmodified 1243.7751 0.77513901 425 Q9Y678;Q9UBF2 COPG1;COPG2 Coatomer subunit gamma-1;Coatomer subunit gamma-2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 86.702 86.702 2 0.0012177 31906 YJC_A_20141124_01 55.291 36.16 615040 615040 0 0 0 922 425 895 2403 1554 1554 0 SILFVPTSAPR Unmodified 1186.671 0.67100829 269 P14625 HSP90B1 Endoplasmin yes yes 0 0 0 By MS/MS By matching By matching By matching 1 64.379 64.379 2 0.00012664 14415 YJC_A_20141124_01 78.342 45.253 1442400 1442400 0 0 0 923 269 896 2404 1555 1555 1 SILKIHAR Acetyl (Protein N-term) 978.59745 0.59744942 242 P06733;K7EM90;K7ERS8 ENO1 Alpha-enolase;Enolase yes no 1 0 1 By MS/MS By matching By matching By matching 1 1 1 50.583 50.663 3 0.015831 9525 YJC_A_20141124_01 47.082 9.5234 4345300 2726400 530260 0 1088600 924 242 897 2405;2406;2407 1556 1556 1 SINPDEAVAYGAAVQAAILSGDK Unmodified 2259.1383 0.13829098 262 P11142;E9PKE3;P11142-2;E9PNE6;A8K7Q2 HSPA8 Heat shock cognate 71 kDa protein yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 85.538 85.558 2 1.9031E-06 30685 YJC_A_20141124_01 66.52 55.893 2334800 1413000 921820 0 0 925 262 898 2408;2409 1557 1557 1 SIQFVDWCPTGFK Unmodified 1583.7442 0.74424959 349 P68363;P68366;A8MUB1 TUBA1B;TUBA4A Tubulin alpha-1B chain;Tubulin alpha-4A chain yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 75.563 75.583 2 0.0063088 22627 YJC_A_20141124_01 58.079 32.096 1619400 1113900 505530 0 0 926 349 899 2410;2411 1558;1559 1558 2 SISISVAR Unmodified 831.48142 0.48141661 73 CON__P04264;P04264 KRT1 Keratin, type II cytoskeletal 1 yes no 0 0 0 By matching By matching By MS/MS By matching 1 47.617 47.665 2 0.0043002 7207 YJC_C_20141124_01 72.23 31.878 0 0 0 0 0 + 927 73 900 2412 1560 1560 1 SIVDYKPNLDLLEQQHQLIQEALIFDNK Unmodified 3323.7402 0.74015708 219 O43707;H7C144;F5GXS2;O43707-3;O43707-2 ACTN4 Alpha-actinin-4 yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 1 83.5 83.529 4 3.5518E-06 29272 YJC_A_20141124_01 58.054 52.646 8361500 7423400 508340 429800 0 928 219 901 2413;2414;2415 1561;1562 1562 2 SIVEEIEDLVAR Unmodified 1371.7246 0.72456001 137 P04844;P04844-2;F2Z3K5;Q5JYR4;Q5JYR7 RPN2 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 91.515 91.515 2 0.0077779 35900 YJC_A_20141124_01 58.098 32.756 477170 477170 0 0 0 929 137 902 2416 1563 1563 1 SIYYITGESK Unmodified 1159.5761 0.57610486 250;387 P08238;Q58FF8 HSP90AB1;HSP90AB2P Heat shock protein HSP 90-beta;Putative heat shock protein HSP 90-beta 2 no no 0 0 0 By MS/MS By matching By MS/MS By matching 1 1 1 52.619 52.615 2 0.017975 8248 YJC_C_20141124_01 49.28 23.217 3726200 2934600 601810 189860 0 930 250;387 903 2417;2418;2419 1564;1565 1565 2 SKDDQVTVIGAGVTLHEALAAAELLK Unmodified 2648.4385 0.43849575 33 P29401;B4E022;P29401-2 TKT Transketolase yes no 0 0 1 By MS/MS By matching By MS/MS By matching 1 1 1 85.939 85.969 4 6.2091E-05 26687 YJC_C_20141124_01 45.579 39.872 3983800 2556900 860100 566750 0 931 33 904 2420;2421;2422 1566;1567 1567 2 SKGPAVGIDLGTTYSCVGVFQHGK Acetyl (Protein N-term) 2519.2479 0.2478582 262 P11142;E9PKE3;P11142-2;E9PNE6;E9PLF4;E9PI65;E9PQQ4;E9PQK7;E9PK54;E9PPY6;E9PN25 HSPA8 Heat shock cognate 71 kDa protein yes no 1 0 1 By matching By MS/MS By matching By matching 1 1 68.405 68.425 3 0.00014897 16441 YJC_B_20141124_01 47.371 32.307 5664600 4306900 1357700 0 0 932 262 905 2423;2424 1568 1568 1 SKGSYSCEVTHEGSTVTK Unmodified 1955.8895 0.88946986 82 CON__Q1RMN8 yes yes 0 0 1 By matching By matching By MS/MS By MS/MS 1 1 36.366 36.44 4 0.0055246 5571 YJC_D_20141124_01 50.376 31.986 12766000 0 0 4285900 8480200 + 933 82 906 2425;2426 1569;1570 1570 2 SKSESPKEPEQLR Acetyl (Protein N-term) 1555.7842 0.78420015 255 P09651;F8W6I7;P09651-3;P09651-2;F8W646;F8VTQ5 HNRNPA1 Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed yes no 1 0 2 By matching By matching By matching By MS/MS 1 1 36.797 36.871 3 1.0838E-29 5668 YJC_D_20141124_01 102.33 80.978 8127100 0 0 720160 7406900 934 255 907 2427;2428 1571 1571 1 SKVEETTEHLVTK Unmodified 1499.7831 0.78313752 322 P52732 KIF11 Kinesin-like protein KIF11 yes yes 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 40.336 40.407 3 0.010866 6502 YJC_A_20141124_01 62.732 31.875 8522000 6786200 1735900 0 0 935 322 908 2429;2430 1572;1573 1572 2 SLADELALVDVLEDK Unmodified 1628.8509 0.85088273 9 P07195;A8MW50;C9J7H8;F5H793 LDHB L-lactate dehydrogenase B chain;L-lactate dehydrogenase yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 87.224 87.194 2 7.6492E-05 28942 YJC_B_20141124_01 72.209 32.815 1520700 1184000 336760 0 0 936 9 909 2431;2432 1574;1575 1575 1 SLDLDSIIAEVK Unmodified 1301.7078 0.70784731 73 CON__P04264;P04264 KRT1 Keratin, type II cytoskeletal 1 no no 0 0 0 By matching By MS/MS By MS/MS By matching 1 1 1 81.279 81.308 2 6.7194E-23 25156 YJC_B_20141124_01 104.94 66.997 2457800 337730 1484200 635880 0 + 937 73 910 2433;2434;2435 1576;1577 1576 2 SLDMDSIIAEVK Unmodified 1319.6643 0.66426794 74 P05787;CON__P05787;P05787-2;F8VUG2;CON__H-INV:HIT000292931 KRT8 Keratin, type II cytoskeletal 8 yes no 0 0 0 By MS/MS By matching By matching By matching 1 75.372 75.372 2 0.026083 22389 YJC_A_20141124_01 43.761 31.606 774040 774040 0 0 0 + 938 74 911 2436 1578 1578 1 SLEEIYLFSLPIK Unmodified 1550.8596 0.85959692 127 P15880;H3BNG3;E9PPT0;E9PMM9;E9PQD7;H0YE27;H0YEN5 RPS2 40S ribosomal protein S2 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 86.936 86.907 2 0.0031373 31946 YJC_A_20141124_01 72.705 32.229 1795100 1479200 315870 0 0 939 127 912 2437;2438 1579;1580 1579 2 SLETENSALQLQVTER Unmodified 1816.9167 0.91667089 116 P20700;E9PBF6 LMNB1 Lamin-B1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 59.538 59.538 2 3.1603E-16 12286 YJC_A_20141124_01 92.096 47.171 261810 261810 0 0 0 940 116 913 2439 1581 1581 1 SLGSVQAPSYGARPVSSAASVYAGAGGSGSR Unmodified 2853.4005 0.40054711 161 P05783;F8VZY9 KRT18 Keratin, type I cytoskeletal 18 yes no 0 0 1 By MS/MS By MS/MS By matching By MS/MS 1 1 1 56.258 56.338 3 1.306E-09 11221 YJC_D_20141124_01 60.172 47.618 4201400 2314100 885330 0 1002000 941 161 914 2440;2441;2442 1582;1583;1584 1584 3 SLGYAYVNFQQPADAER Unmodified 1927.9064 0.90644055 107 P11940;E7EQV3;E7ERJ7;P11940-2;Q13310;Q13310-2;E5RHG7;E5RGH3;E5RH24;E5RJB9;B1ANR1;H0YBN4;B1ANR0;Q13310-3 PABPC1;PABPC4 Polyadenylate-binding protein 1;Polyadenylate-binding protein 4 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 64.171 64.191 2 7.2835E-84 14153 YJC_B_20141124_01 120.39 93.125 1835400 1538500 296970 0 0 942 107 915 2443;2444 1585;1586;1587 1587 3 SLHDALCVVK Unmodified 1140.5961 0.59612879 110 P17987;E7ERF2;F5GZ03;F5H282;E7EQR6 TCP1 T-complex protein 1 subunit alpha yes no 0 0 0 By MS/MS By matching By matching By matching 1 50.185 50.185 3 0.012857 9388 YJC_A_20141124_01 36.318 18.844 399470 399470 0 0 0 943 110 916 2445 1588 1588 0 SLHTLFGDELCK Unmodified 1418.6864 0.68640036 72 CON__P02769 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 1 1 1 1 62.464 62.511 3 1.6652E-53 13636 YJC_D_20141124_01 119.03 78.874 5030200 989620 610390 530210 2900000 + 944 72 917 2446;2447;2448;2449 1589;1590;1591;1592 1592 4 SLKESEALPEK Unmodified 1229.6503 0.65033243 394 Q6NZI2 PTRF Polymerase I and transcript release factor yes yes 0 0 1 By matching By MS/MS By matching By matching 1 1 38.242 38.313 3 0.00015955 7033 YJC_B_20141124_01 79.492 44.8 723630 416020 307610 0 0 945 394 918 2450;2451 1593 1593 1 SLKQTPHSEIIFYKNGVNQGVAYK Unmodified 2720.4286 0.42859976 152 Q9UBL3;H0YBF6;F5H8F7;Q9UBL3-3 ASH2L Set1/Ash2 histone methyltransferase complex subunit ASH2 yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 1 69.21 69.259 4 0.016424 18309 YJC_D_20141124_01 29.807 22.551 4260300 1435800 0 917870 1906700 946 152 919 2452;2453;2454 1594 1594 1 SLLEGEGSSGGGGR Unmodified 1261.5899 0.58985744 76 P13645;CON__P13645 KRT10 Keratin, type I cytoskeletal 10 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 41.425 41.555 2 0.0084275 7831 YJC_B_20141124_01 54.898 45.576 522500 0 360440 119510 42548 + 947 76 920 2455;2456;2457 1595 1595 1 SLQDIIAILGMDELSEEDKLTVSR Oxidation (M) 2690.3684 0.36842685 239 P06576;F8VPV9;F8W079;F8VQY0 ATP5B ATP synthase subunit beta, mitochondrial yes no 0 1 1 By MS/MS By MS/MS By matching By matching 1 1 1 91.997 91.993 3 8.5124E-15 36297 YJC_A_20141124_01 81.89 68.76 3076200 2376400 520850 178950 0 948 239 921 2458;2459;2460 1596;1597 1596 17 2 SLQDIIAILGMDELSEEDKLTVSR Unmodified 2674.3735 0.37351223 239 P06576;F8VPV9;F8W079;F8VQY0 ATP5B ATP synthase subunit beta, mitochondrial yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 1 94.396 94.376 3 1.7535E-39 33590 YJC_B_20141124_01 96.455 67.18 16216000 9614400 5612400 0 989420 949 239 921 2461;2462;2463 1598;1599 1599 2 SLQLSAWESSIVDR Unmodified 1589.8049 0.80493559 385 Q3KQU3;Q3KQU3-2;Q3KQU3-4 MAP7D1 MAP7 domain-containing protein 1 yes no 0 0 0 By matching By matching By matching By MS/MS 1 74.076 74.275 2 1.9831E-64 22528 YJC_D_20141124_01 120.92 72.518 1290600 0 0 0 1290600 950 385 922 2464 1600 1600 1 SLQPLAPR Unmodified 880.51305 0.51305109 375 Q14764 MVP Major vault protein yes yes 0 0 0 By MS/MS By matching By MS/MS By MS/MS 1 1 1 44.412 44.495 2 0.001379 7949 YJC_D_20141124_01 74.464 23.019 10049000 161840 0 1380500 8506300 951 375 923 2465;2466;2467 1601;1602;1603 1603 2 SLQSVAEER Unmodified 1017.5091 0.50908792 108 P61313;E7EQV9;E7EX53;P61313-2 RPL15 60S ribosomal protein L15;Ribosomal protein L15 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 1 42.484 42.581 2 0.022751 8103 YJC_B_20141124_01 60.255 20.951 1022000 529670 257970 20702 213650 952 108 924 2468;2469;2470;2471 1604 1604 1 SLVNLGGSKSISISVAR Unmodified 1686.9628 0.96283322 73 CON__P04264;P04264 KRT1 Keratin, type II cytoskeletal 1 yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 1 61.111 61.16 3 0.011986 12882 YJC_A_20141124_01 70.117 52.652 2152000 662520 0 712110 777380 + 953 73 925 2472;2473;2474 1605 1605 1 SLYASSPGGVYATR Unmodified 1427.7045 0.70449327 251 P08670;B0YJC4 VIM Vimentin yes no 0 0 0 By MS/MS By MS/MS By matching By MS/MS 1 1 1 1 51.052 51.124 2 3.7797E-50 10263 YJC_B_20141124_01 111.07 76.018 14161000 5771700 3166300 363370 4859200 954 251 926 2475;2476;2477;2478 1606;1607;1608 1607 3 SLYYYIQQDTK Unmodified 1420.6874 0.68744622 244 P07355;P07355-2;A6NMY6 ANXA2;ANXA2P2 Annexin A2;Putative annexin A2-like protein yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 62.766 62.786 2 0.0090654 13575 YJC_A_20141124_01 60.364 44.819 1519200 1299500 219690 0 0 955 244 927 2479;2480 1609 1609 1 SNLAYDIVQLPTGLTGIK Unmodified 1902.0462 0.046228496 299 P34932 HSPA4 Heat shock 70 kDa protein 4 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 81.173 81.173 2 0.002771 27510 YJC_A_20141124_01 62.94 46.411 754140 754140 0 0 0 956 299 928 2481 1610 1610 1 SNTQAER Acetyl (Protein N-term) 846.38316 0.38315913 295 Q86SG5;P31151 S100A7A;S100A7 Protein S100-A7A;Protein S100-A7 yes no 1 0 0 By matching By MS/MS By matching By MS/MS 1 1 1 1 24.083 24.155 2 0.012225 3064 YJC_D_20141124_01 72.607 21.904 686520 146380 183030 146490 210620 957 295 929 2482;2483;2484;2485 1611;1612 1612 2 SPAGLQVLNDYLADK Unmodified 1602.8253 0.82533668 60 P24534;F8WF65;F2Z2G2;C9JZW3 EEF1B2 Elongation factor 1-beta yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 75.664 75.684 2 0.0073756 22645 YJC_A_20141124_01 57.525 36.786 1712600 1322800 389850 0 0 958 60 930 2486;2487 1613 1613 1 SPFEVQVGPEAGMQK Unmodified 1602.7712 0.77119262 223 O75369;O75369-8;O75369-5;O75369-4;O75369-6;O75369-3;O75369-2;O75369-9;E7EN95;O75369-7 FLNB Filamin-B yes no 0 0 0 By MS/MS By matching By matching By matching 1 59.566 59.566 2 0.018269 12307 YJC_A_20141124_01 48.729 24.645 235460 235460 0 0 0 959 223 931 2488 1614 1614 1 SPLLSASHSGNVTPTAPPYLQESSPR Unmodified 2692.3457 0.34565799 92 Q8N4L2;E5RJC2;E5RIP9;E5RIY0;E5RFT4 TMEM55A Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase yes no 0 0 0 By matching By MS/MS By matching By matching 1 59.08 59.12 3 0.0014494 12328 YJC_B_20141124_01 46.92 30.546 0 0 0 0 0 960 92 932 2489 1615 1615 1 SPTLSVPR Unmodified 855.48142 0.48141661 197 Q9UH92;K7EID0 MLX Max-like protein X yes no 0 0 0 By matching By matching By MS/MS By matching 1 47.326 47.375 2 0.013727 7134 YJC_C_20141124_01 67.494 0 7062700 0 0 7062700 0 961 197 933 2490 1616 1616 1 SQDDEIGDGTTGVVVLAGALLEEAEQLLDR Unmodified 3112.5412 0.5411825 310 P48643;B7ZAR1;E9PCA1 CCT5 T-complex protein 1 subunit epsilon yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 94.755 94.7 3 5.7387E-06 34038 YJC_B_20141124_01 47.085 32.976 4208600 0 3015300 1193400 0 962 310 934 2491;2492 1617 1617 1 SQIFSTASDNQPTVTIK Unmodified 1835.9265 0.92650729 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 1 1 1 1 57.447 57.469 2 0 11884 YJC_B_20141124_01 196.01 151.27 9398800 5193900 2965600 211840 1027600 963 261 935 2493;2494;2495;2496 1618;1619;1620;1621;1622;1623;1624 1620 7 SQVFSTAADGQTQVEIK Unmodified 1807.8952 0.89520716 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 0 By matching By MS/MS By MS/MS By MS/MS 2 1 2 2 54.667 54.701 2;3 0 10682 YJC_D_20141124_01 230.45 175.5 14916000 1465400 523280 1730900 11196000 964 307 936 2497;2498;2499;2500;2501;2502;2503 1625;1626;1627;1628 1628 4 SRGFGFILFK Unmodified 1170.655 0.6549643 87 Q99729-3;D6R9P3;D6RD18;D6RBZ0;Q99729-2;Q99729;Q99729-4 HNRNPAB Heterogeneous nuclear ribonucleoprotein A/B yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 73.202 73.275 3 0.0034071 21513 YJC_D_20141124_01 77.744 42.203 5679500 0 0 495340 5184200 965 87 937 2504;2505 1629 1629 1 SRLSITKDNSK Unmodified 1247.6834 0.68336389 66;62 CON__ENSEMBL:ENSBTAP00000011227;CON__Q1RMK2;CON__ENSEMBL:ENSBTAP00000033053 no no 0 0 2 By matching By matching By MS/MS By MS/MS 1 1 29.359 29.433 3 0.00045017 3737 YJC_C_20141124_01 76.24 40.744 1498300 0 0 589630 908660 + 966 62;66 938 2506;2507 1630;1631 1630 2 SRTLTAVHDAILEDLVFPSEIVGKR Unmodified 2765.5076 0.50757837 34 P62081;B5MCP9 RPS7 40S ribosomal protein S7 yes no 0 0 2 By MS/MS By matching By matching By MS/MS 1 1 79.751 79.901 4 0.00019325 27221 YJC_D_20141124_01 52.451 50.579 1665200 449390 0 0 1215800 967 34 939 2508;2509 1632;1633;1634 1633 3 SSGGSSSVR Unmodified 822.38316 0.38315913 73 CON__P04264 yes yes 0 0 0 By matching By MS/MS By MS/MS By matching 1 1 17.097 17.042 2 0.00075475 2126 YJC_C_20141124_01 74.841 29.76 313850 0 202650 111200 0 + 968 73 940 2510;2511 1635;1636 1636 2 SSGNSPTPVSR Unmodified 1087.5258 0.52580062 175 O95429;H0YBT1;O95429-2 BAG4 BAG family molecular chaperone regulator 4 yes no 0 0 0 By matching By matching By matching By MS/MS 1 28.252 28.351 2 0.0024883 3799 YJC_D_20141124_01 71.268 40.581 181640 0 0 0 181640 969 175 941 2512 1637 1637 1 SSGPYGGGGQYFAKPR Unmodified 1627.7743 0.77430417 255 P09651;F8W6I7;P09651-3;P09651-2;H0YH80 HNRNPA1 Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed yes no 0 0 1 By matching By matching By MS/MS By MS/MS 2 2 47.413 47.537 2;3 8.8411E-60 7171 YJC_C_20141124_01 111.07 72.067 89119000 0 0 10262000 78857000 970 255 942 2513;2514;2515;2516 1638;1639;1640 1638 3 SSGSPYGGGYGSGGGSGGYGSR Unmodified 1909.7827 0.7826966 319 P51991;P51991-2;H7C1J8 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 43.541 43.665 3 1.111E-23 6335 YJC_C_20141124_01 90.765 82.852 3593800 0 0 396660 3197100 971 319 943 2517;2518 1641;1642 1641 2 SSGSSYPSLLQCLK Unmodified 1525.7446 0.74464352 67 CON__P00761 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 1 1 1 1 68.188 68.235 2 0 17022 YJC_A_20141124_01 175.01 115.59 329720000 65343000 58125000 83474000 122780000 + 972 67 944 2519;2520;2521;2522 1643;1644;1645;1646;1647 1643 5 SSQPLASK Unmodified 816.43413 0.43413207 186 P17096;P17096-2;H7BYM6;P17096-3;E5RIT9 HMGA1;C2orf81 High mobility group protein HMG-I/HMG-Y yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 25.496 25.616 2 0.0023681 4689 YJC_B_20141124_01 89.029 30.799 1033500 0 839330 0 194200 973 186 945 2523;2524 1648 1648 1 SSQPLASKQEK Unmodified 1201.6303 0.63026569 186 P17096;P17096-2;H7BYM6;P17096-3 HMGA1 High mobility group protein HMG-I/HMG-Y yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 1 24.241 24.321 3 0.026956 3106 YJC_D_20141124_01 36.684 1.4155 999980 125400 437060 0 437520 974 186 946 2525;2526;2527 1649 1649 0 SSQSSSQQFSGIGR Unmodified 1454.675 0.67498405 55 Q92841;Q92841-3;C9JMU5;H3BLZ8;Q92841-1;Q92841-2;G5E9L5 DDX17 Probable ATP-dependent RNA helicase DDX17 yes no 0 0 0 By matching By MS/MS By matching By matching 1 44.083 44.123 2 0.0040551 8583 YJC_B_20141124_01 67.846 34.654 169990 0 169990 0 0 975 55 947 2528 1650 1650 1 SSSPVNVKK Acetyl (Protein N-term) 986.53966 0.53965977 355 Q00839;Q00839-2 HNRNPU Heterogeneous nuclear ribonucleoprotein U yes no 1 0 1 By matching By MS/MS By matching By matching 1 1 32.995 33.115 2 0.0071669 5994 YJC_B_20141124_01 51.528 13.979 254630 0 141060 0 113560 976 355 948 2529;2530 1651 1651 1 SSTPLPTISSSAENTR Unmodified 1646.8111 0.81114318 1 P42167;P42166;P42167-2;G5E972;A2T926;H0YJH7 TMPO Lamina-associated polypeptide 2, isoforms beta/gamma;Thymopoietin;Thymopentin;Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 51.335 51.355 2 0.012576 9758 YJC_A_20141124_01 53.861 20.936 859250 383360 475890 0 0 977 1 949 2531;2532 1652 1652 1 SSYDVFQLEFNDGAYNIK Unmodified 2108.9691 0.96910039 190 Q16658;J3KNT0 FSCN1 Fascin yes no 0 0 0 By MS/MS By matching By matching By matching 1 78.247 78.247 2 0.011458 25010 YJC_A_20141124_01 54.355 39.148 701300 701300 0 0 0 978 190 950 2533 1653 1653 1 SSYPGQITGNMICVGFLEGGK Unmodified 2214.0449 0.044924642 67 CON__P00761 yes yes 0 0 0 By matching By matching By matching By MS/MS 1 76.9 77.1 2 0.027988 24908 YJC_D_20141124_01 38.205 18.715 2246400 0 0 0 2246400 + 979 67 951 2534 1654 1654 1 STAISLFYELSENDLNFIK Unmodified 2203.1049 0.10486559 265 P13639 EEF2 Elongation factor 2 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 2 2 2 94.374 94.336 2;3 7.8648E-20 33585 YJC_B_20141124_01 94.569 77.72 14042000 7089000 3939300 3013700 0 980 265 952 2535;2536;2537;2538;2539;2540 1655;1656;1657 1656 3 STFSTNYR Unmodified 974.44576 0.44575938 161 P05783;F8VZY9 KRT18 Keratin, type I cytoskeletal 18 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 42.167 42.28 2 0.016209 7147 YJC_A_20141124_01 65.465 43.937 2047600 1002800 534340 0 510520 981 161 953 2541;2542;2543 1658 1658 1 STGEAFVQFASK Unmodified 1270.6194 0.61936665 296 P31942;P31942-2;P31942-3 HNRNPH3 Heterogeneous nuclear ribonucleoprotein H3 yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 1 1 59.219 59.241 2 7.7247E-23 12270 YJC_D_20141124_01 104.81 80.11 1774500 64059 267130 202200 1241100 982 296 954 2544;2545;2546;2547 1659 1659 1 STGEAFVQFASQEIAEK Unmodified 1840.8843 0.88430813 118 P31943;E9PCY7;G8JLB6;P55795;E5RGH4;E5RGV0;D6RIU0;D6RBM0;H0YB39;E7EN40 HNRNPH1;HNRNPH2 Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H2;Heterogeneous nuclear ribonucleoprotein H2, N-terminally processed yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 74.797 74.817 2 0.0045619 21947 YJC_A_20141124_01 61.957 48.856 2323900 1560500 763390 0 0 983 118 955 2548;2549 1660 1660 1 STGGAPTFNVTVTK Unmodified 1378.7092 0.70924429 246 P07737;K7EJ44 PFN1 Profilin-1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 53.359 53.406 2 3.2431E-50 10324 YJC_A_20141124_01 111.81 81.603 5797400 4127600 1150300 289320 230140 984 246 956 2550;2551;2552;2553 1661 1661 1 STHLVQHQLIHTGVKPYECNECDK Unmodified 2892.3647 0.36469565 22 Q9HBT8;B4DKF9 ZNF286A Zinc finger protein 286A yes no 0 0 1 By matching By matching By matching By MS/MS 1 67.027 67.227 5 0.01053 16916 YJC_D_20141124_01 26.361 17.238 2728000 0 0 0 2728000 985 22 957 2554 1662 1662 1 STNGDTFLGGEDFDQALLR Unmodified 2054.9545 0.95451296 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 0 By MS/MS By matching By MS/MS By MS/MS 1 1 1 1 75.861 75.908 2 4.9943E-29 23778 YJC_D_20141124_01 99.881 68.793 12661000 1769500 554120 2163900 8173600 986 307 958 2555;2556;2557;2558 1663;1664;1665;1666 1666 4 SVDPTLALSVYLR Unmodified 1432.7926 0.79257999 354 Q00610;Q00610-2 CLTC Clathrin heavy chain 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 78.568 78.588 2 0.0044643 25358 YJC_A_20141124_01 70.563 47.095 1498200 1153200 345020 0 0 987 354 959 2559;2560 1667 1667 1 SVFALTNGIYPHKLVF Unmodified 1804.9876 0.98759141 359 Q02878 RPL6 60S ribosomal protein L6 yes yes 0 0 1 By matching By MS/MS By matching By matching 1 1 77.719 77.739 3 0.025494 22672 YJC_B_20141124_01 42.52 24.654 2790200 2167000 623290 0 0 988 359 960 2561;2562 1668 1668 0 SVKKTWAEIR Unmodified 1216.6928 0.69280637 385 Q3KQU3;Q3KQU3-2;Q3KQU3-4;C9JIR3 MAP7D1 MAP7 domain-containing protein 1 yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 41.444 41.568 3 0.0017789 7107 YJC_D_20141124_01 77.674 49.098 1597100 0 0 38179 1558900 989 385 961 2563;2564 1669 1669 1 SVQLAIEITTNSQEAAAK Unmodified 1872.9793 0.97927114 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 63.706 63.78 2 0 14512 YJC_D_20141124_01 199.31 164.21 1083000 0 0 119330 963660 990 375 962 2565;2566 1670 1670 1 SVSDNDIR Unmodified 904.42502 0.42502394 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 31.68 31.75 2 0.0053818 4354 YJC_A_20141124_01 78.264 21.83 1271700 853620 418070 0 0 991 326 963 2567;2568 1671 1671 1 SVSEIFVELQGFLAAEQDIR Acetyl (Protein N-term) 2292.1638 0.16377745 382 Q15631;Q15631-2 TSN Translin yes no 1 0 0 By matching By MS/MS By MS/MS By matching 2 2 94.712 94.656 2;3 5.6259E-269 33968 YJC_B_20141124_01 152.89 140.26 7367000 0 3832000 3534900 0 992 382 964 2569;2570;2571;2572 1672;1673;1674 1672 3 SVSSSSYR Unmodified 871.40356 0.40356022 251 P08670;B0YJC4 VIM Vimentin yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 29.037 29.116 2 0.027561 5254 YJC_B_20141124_01 60.828 26.656 929710 115160 447930 0 366610 993 251 965 2573;2574;2575 1675 1675 1 SVSVVTGSEQK Unmodified 1119.5772 0.57716749 188 Q9UPN4;Q9UPN4-2;I3L2J8;Q9UPN4-3 CEP131 Centrosomal protein of 131 kDa yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 34.904 34.974 2 0.0030565 5127 YJC_A_20141124_01 62.799 38.523 243100 157210 85895 0 0 994 188 966 2576;2577 1676 1676 1 SVTEQGAELSNEER Unmodified 1547.7063 0.70634376 114 P63104;E7EX29;E7ESK7;E5RGE1;E5RIR4;E9PD24;E7EVZ2 YWHAZ 14-3-3 protein zeta/delta yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 41.868 41.939 2 1.5615E-63 7945 YJC_B_20141124_01 117.13 92.877 1013200 747150 266010 0 0 995 114 967 2578;2579 1677;1678 1678 2 SYELPDGQVITIGNER Unmodified 1789.8846 0.88464248 327 P60709;P63261;P63267;P68133;P62736;P68032;Q5T8M8;A6NL76;Q5T8M7;Q6S8J3;A5A3E0;P63267-2;Q9BYX7;Q562R1 ACTB;ACTG1;ACTG2;ACTA1;ACTA2;ACTC1;POTEE;POTEF;POTEKP;ACTBL2 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed;Actin, gamma-enteric smooth muscle;Actin, alpha skeletal muscle;Actin, aortic smooth muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member E;POTE ankyrin domain family member F;Putative beta-actin-like protein 3;Beta-actin-like protein 2 yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 1 1 69.902 69.949 2 0.0020521 18815 YJC_D_20141124_01 63.681 35.398 20426000 13639000 4818000 827320 1141500 996 327 968 2580;2581;2582;2583 1679;1680 1679 2 SYFLYSK Unmodified 906.44872 0.4487195 64 CON__ENSEMBL:ENSBTAP00000024462 yes yes 0 0 0 By matching By matching By matching By MS/MS 1 1 55.985 56.009 2 0.012583 11120 YJC_D_20141124_01 82.279 45.578 1911900 0 0 422960 1488900 + 997 64 969 2584;2585 1681 1681 1 SYKVSTSGPR Unmodified 1080.5564 0.55637247 74 P05787;CON__P05787;P05787-2;F8VUG2;F8W1U3;F8VRG4;F8VQY3 KRT8 Keratin, type II cytoskeletal 8 yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 1 32.736 32.816 3 0.0095147 5927 YJC_B_20141124_01 69.721 44.247 900610 318530 504330 0 77746 + 998 74 970 2586;2587;2588 1682 1682 1 SYSPYDMLESIR Unmodified 1459.6653 0.66533057 244 P07355;P07355-2;H0YN42;A6NMY6;H0YM50;H0YN28;H0YL33 ANXA2;ANXA2P2 Annexin A2;Annexin;Putative annexin A2-like protein yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 76.006 75.98 2 0.0086112 22962 YJC_A_20141124_01 55.261 39.321 995110 950310 0 44800 0 999 244 971 2589;2590 1683 1683 1 TAENATSGETLEENEAGD Unmodified 1836.7497 0.74972472 429 Q9UQ80 PA2G4 Proliferation-associated protein 2G4 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 44.139 44.139 2 0.016622 7699 YJC_A_20141124_01 48.919 33.14 345840 345840 0 0 0 1000 429 972 2591 1684 1684 1 TAFDEAIAELDTLNEDSYK Unmodified 2143.9797 0.97972465 286 P27348 YWHAQ 14-3-3 protein theta yes yes 0 0 0 By MS/MS By matching By matching By matching 1 86.206 86.206 3 0.021299 31399 YJC_A_20141124_01 58.688 39.754 1103600 1103600 0 0 0 1001 286 973 2592 1685 1685 1 TAFDEAIAELDTLSEESYK Unmodified 2130.9845 0.98447568 114 P63104;E7EX29;B0AZS6;B7Z2E6;H0YB80;P63104-2 YWHAZ 14-3-3 protein zeta/delta yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 90.641 90.611 3 5.4952E-13 31181 YJC_B_20141124_01 89.502 66.872 3134000 2649600 484410 0 0 1002 114 974 2593;2594 1686;1687 1687 2 TAFQEALDAAGDK Unmodified 1335.6307 0.63065962 258 P10599;P10599-2 TXN Thioredoxin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 61.436 61.456 2 0.00034232 12989 YJC_A_20141124_01 78.902 57.894 1463500 1264700 198870 0 0 1003 258 975 2595;2596 1688 1688 1 TALLDAAGVASLLTTAEVVVTEIPK Unmodified 2481.3942 0.39417132 260 P10809 HSPD1 60 kDa heat shock protein, mitochondrial yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By matching 2 2 2 94.626 94.589 2;3 1.0054E-170 33893 YJC_B_20141124_01 136.77 122.57 137790000 108300000 19147000 10347000 0 1004 260 976 2597;2598;2599;2600;2601;2602 1689;1690;1691;1692 1690 4 TATESFASDPILYR Unmodified 1569.7675 0.76748745 268 P14618;P14618-3;P14618-2;H3BTN5;H3BQ34;H3BT25;H3BUW1;H3BTJ2 PKM Pyruvate kinase PKM;Pyruvate kinase yes no 0 0 0 By MS/MS By matching By matching By matching 1 63.801 63.801 2 0.016805 14014 YJC_A_20141124_01 47.506 31.866 728340 728340 0 0 0 1005 268 977 2603 1693 1693 1 TATESFASDPILYRPVAVALDTKGPEIR Unmodified 3016.587 0.5869509 268 P14618;P14618-3;P14618-2;H3BTN5;H3BQ34;H3BT25;H3BUW1;H3BTJ2 PKM Pyruvate kinase PKM;Pyruvate kinase yes no 0 0 2 By matching By MS/MS By matching By matching 1 1 73.48 73.5 4 8.9139E-06 19542 YJC_B_20141124_01 43.241 30.219 4853000 3413800 1439200 0 0 1006 268 978 2604;2605 1694 1694 1 TATFAISILQQIELDLK Unmodified 1903.0666 0.066629587 328 P60842;J3QLN6;J3QR64;J3KTB5;J3QL43;J3QS69;J3KT12;P60842-2;J3QKZ9;J3KS25;J3KS93;B4E102 EIF4A1 Eukaryotic initiation factor 4A-I yes no 0 0 0 By matching By matching By MS/MS By matching 2 94.519 94.468 2;3 0 32388 YJC_C_20141124_01 247.02 210.49 20443000 0 0 20443000 0 1007 328 979 2606;2607 1695;1696;1697 1696 3 TEFLSFMNTELAAFTK Unmodified 1848.8968 0.89678707 297 P31949 S100A11 Protein S100-A11;Protein S100-A11, N-terminally processed yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 92.443 92.439 2 1.4978E-24 36697 YJC_A_20141124_01 98.408 79.74 1211000 919120 231590 60322 0 1008 297 980 2608;2609;2610 1698 1698 1 TEIIILATR Unmodified 1028.623 0.62299547 279 P23396;P23396-2;F2Z2S8;H0YF32;H0YCJ7;E9PPU1;H0YEU2;E9PL09;E9PQ96;E9PJH4;E9PK82 RPS3 40S ribosomal protein S3 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 62.35 62.371 2 0.019169 13373 YJC_A_20141124_01 62.633 37.507 1166900 997250 169640 0 0 1009 279 981 2611;2612 1699 1699 1 TELFIAAEGIHTGQFVYCGK Unmodified 2240.0936 0.093589394 124 P62917;E9PKU4;G3V1A1;E9PKZ0 RPL8 60S ribosomal protein L8 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 70.976 70.997 3 0.017843 17959 YJC_B_20141124_01 58.246 38.803 3410700 2953300 457390 0 0 1010 124 982 2613;2614 1700;1701 1700 2 TEWLDGK Unmodified 847.40758 0.40758296 346 P62937;Q567Q0;Q9Y536;F5H284;A2BFH1 PPIA;PPIAL4A;PPIAL4D;PPIAL4G Peptidyl-prolyl cis-trans isomerase A;Peptidyl-prolyl cis-trans isomerase A, N-terminally processed;Peptidyl-prolyl cis-trans isomerase A-like 4A/B/C;Peptidyl-prolyl cis-trans isomerase A-like 4D;Peptidyl-prolyl cis-trans isomerase A-like 4G yes no 0 0 0 By matching By MS/MS By matching By matching 1 49.006 49.047 2 0.02732 9806 YJC_B_20141124_01 52.786 34.003 314360 0 314360 0 0 1011 346 983 2615 1702 1702 0 TFAPEEISAMVLTK Unmodified 1535.7905 0.79053108 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 2 2 1 76.787 76.793 2;3 4.4515E-05 23676 YJC_A_20141124_01 82.202 55.67 5436600 3937100 1295200 204330 0 1012 261 984 2616;2617;2618;2619;2620 1703;1704;1705;1706 1704 4 TFCQLILDPIFK Unmodified 1493.7952 0.79522253 265 P13639 EEF2 Elongation factor 2 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 84.936 84.961 2 4.4053E-12 30381 YJC_A_20141124_01 94.781 69.333 937970 883090 0 54873 0 1013 265 985 2621;2622 1707 1707 1 TFDQLTPEESK Unmodified 1293.6089 0.60886155 220 O43852;O43852-4;O43852-9;O43852-5;O43852-2;O43852-3;O43852-12;O43852-13;O43852-14;O43852-7;O43852-11;O43852-8;O43852-10;O43852-6 CALU Calumenin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 48.803 48.823 2 0.0034387 8989 YJC_A_20141124_01 67.234 51.733 1846800 1537600 309220 0 0 1014 220 986 2623;2624 1708 1708 1 TFHIFYYLLSGAGEHLK Unmodified 1995.0254 0.025433475 302 P35579;P35579-2 MYH9 Myosin-9 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 85.193 85.213 4 2.0967E-51 30599 YJC_A_20141124_01 107.74 92.134 3761700 3406700 355030 0 0 1015 302 987 2625;2626 1709 1709 1 TFLVGER Unmodified 820.4443 0.44430282 28 P26641;B4DTG2 EEF1G Elongation factor 1-gamma yes no 0 0 0 By MS/MS By matching By matching By matching 1 49.926 49.926 2 0.012617 9316 YJC_A_20141124_01 51.346 31.986 916750 916750 0 0 0 1016 28 988 2627 1710 1710 0 TFWDLKEEFHKICMLAK Oxidation (M) 2211.0857 0.085667245 104 Q92844;E7ENY2;E7EVA2;E7EW82;H7C3L4;E7EQA9 TANK TRAF family member-associated NF-kappa-B activator yes no 0 1 2 By MS/MS By MS/MS By matching By MS/MS 2 2 2 2 66.757 66.805 3 0.0016865 15282 YJC_B_20141124_01 62.357 19.149 708220000 194380000 115550000 142190000 256100000 1017 104 989 2628;2629;2630;2631;2632;2633;2634;2635 1711;1712;1713;1714 1713 6 4 TGEAIVDAALSALR Unmodified 1385.7514 0.75144346 35 Q15084;Q15084-3;F8WA83;B5MCQ5;Q15084-2 PDIA6 Protein disulfide-isomerase A6 yes no 0 0 0 By MS/MS By matching By matching By matching 1 82.796 82.796 2 1.2697E-99 28821 YJC_A_20141124_01 124.81 71.211 0 0 0 0 0 1018 35 990 2636 1715 1715 1 TGGTVESDGSTESTGR Unmodified 1539.6649 0.66487288 403 Q8NDV7;Q8NDV7-2;Q8NDV7-6;Q8NDV7-5 TNRC6A Trinucleotide repeat-containing gene 6A protein yes no 0 0 0 By matching By matching By matching By MS/MS 1 29.709 29.808 2 1.8812E-10 4097 YJC_D_20141124_01 89.232 69.736 185460 0 0 0 185460 1019 403 991 2637 1716 1716 1 TGPNLHGLFGR Unmodified 1167.6149 0.6148904 79 CON__P62894;P99999;C9JFR7 CYCS Cytochrome c yes no 0 0 0 By MS/MS By matching By MS/MS By matching 1 1 1 1 59.817 59.839 3 0.020081 9901 YJC_C_20141124_01 49.3 38.204 22687000 5613400 5244300 6321400 5507500 + 1020 79 992 2638;2639;2640;2641 1717;1718 1718 2 THINIVVIGHVDSGK Unmodified 1587.8733 0.87328993 348 P68104;Q5VTE0;Q05639;Q5JR01;A6PW80 EEF1A1;EEF1A1P5;EEF1A2 Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2 yes no 0 0 0 By MS/MS By matching By MS/MS By matching 2 1 2 2 53.335 53.369 3;4 7.2433E-10 10316 YJC_A_20141124_01 89.466 64.999 18003000 13443000 2392100 1206200 961560 1021 348 993 2642;2643;2644;2645;2646;2647;2648 1719;1720;1721;1722;1723 1719 5 TIAECLADELINAAK Unmodified 1630.8236 0.82362212 209 P46782;M0QZN2;M0R0F0;M0R0R2 RPS5 40S ribosomal protein S5;40S ribosomal protein S5, N-terminally processed yes no 0 0 0 By MS/MS By matching By matching By matching 2 2 86.762 86.732 2;3 5.4958E-46 31877 YJC_A_20141124_01 95.755 67.028 3328300 2931300 397010 0 0 1022 209 994 2649;2650;2651;2652 1724;1725 1725 1 TIAQDYGVLK Unmodified 1106.5972 0.59717465 364 Q06830 PRDX1 Peroxiredoxin-1 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 55.031 55.061 2 1.0115E-05 10839 YJC_A_20141124_01 89.9 43.51 3720600 2859800 541560 319170 0 1023 364 995 2653;2654;2655 1726 1726 1 TIGGGDDSFNTFFSETGAGK Unmodified 2006.8858 0.88576469 349;150 Q9BQE3;F5H5D3;F8VVB9;F8VQQ4;F8VRZ4;F8VS66;F8VRK0;F8VX09;F8VWV9;F8VXZ7;F8W0F6;P68363 TUBA1C;KLK9;TUBA1A;TUBA1B Tubulin alpha-1C chain;Tubulin alpha-1B chain no no 0 0 0 By matching By MS/MS By matching By matching 1 72.271 72.311 2 0.0079665 18683 YJC_B_20141124_01 48.053 29.23 2451600 0 2451600 0 0 1024 150;349 996 2656 1727 1727 1 TIGTGLVTNTLAMTEEEK Unmodified 1906.9558 0.95575851 314 P49411 TUFM Elongation factor Tu, mitochondrial yes yes 0 0 0 By MS/MS By matching By matching By matching 1 70.809 70.809 2 0.017595 18786 YJC_A_20141124_01 46.461 32.06 584020 584020 0 0 0 1025 314 997 2657 1728 1728 1 TIQFVDWCPTGFK Unmodified 1597.7599 0.75989966 150 Q9BQE3;F5H5D3 TUBA1C Tubulin alpha-1C chain no no 0 0 0 By MS/MS By matching By matching By matching 1 75.969 75.969 2 1.7381E-16 23011 YJC_A_20141124_01 84.173 62.231 640380 640380 0 0 0 1026 150 998 2658 1729 1729 0 TITLEVEPSDTIENVK Unmodified 1786.92 0.92002493 29 P0CG47;P62979;P62987;J3QS39;J3QTR3;F5H6Q2;F5GYU3;F5H2Z3;F5H265;B4DV12;F5H388;F5H747;F5GXK7;J3QKN0;Q96C32;F5H041;P0CG48;M0R1V7;F5GZ39;J3QSA3;J3QLP7;J3QRK5 UBB;RPS27A;UBA52;UBC;UBBP4 Polyubiquitin-B;Ubiquitin;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Polyubiquitin-C;Ubiquitin yes no 0 0 0 By MS/MS By MS/MS By matching By MS/MS 2 3 1 1 63.538 63.576 2;3 9.5639E-293 13674 YJC_B_20141124_01 164.7 101.03 325790000 134550000 189500000 1297800 445240 1027 29 999 2659;2660;2661;2662;2663;2664;2665 1730;1731;1732;1733;1734;1735;1736 1732 7 TITLEVEPSDTIENVKAK Unmodified 1986.0521 0.052101735 29 P0CG47;P62979;P62987;J3QS39;J3QTR3;F5H6Q2;F5GYU3;F5H2Z3;F5H265;B4DV12;F5H388;F5H747;F5GXK7;J3QKN0;Q96C32;F5H041;P0CG48;M0R1V7;F5GZ39;J3QSA3;J3QLP7;J3QRK5 UBB;RPS27A;UBA52;UBC;UBBP4 Polyubiquitin-B;Ubiquitin;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Polyubiquitin-C;Ubiquitin yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 59.069 59.089 2 3.8022E-166 12112 YJC_A_20141124_01 137.81 120.31 11720000 8250900 3469100 0 0 1028 29 1000 2666;2667 1737 1737 1 TITLEVEPSDTIENVKAKIQDK Unmodified 2470.3166 0.31664928 29 P0CG47;P62979;P62987;J3QS39;J3QTR3;F5H6Q2;F5GYU3;F5H2Z3;F5H265;B4DV12;F5H388;F5H747;F5GXK7;J3QKN0;Q96C32;F5H041;P0CG48;M0R1V7;F5GZ39;J3QSA3;J3QLP7;J3QRK5 UBB;RPS27A;UBA52;UBC;UBBP4 Polyubiquitin-B;Ubiquitin;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Polyubiquitin-C;Ubiquitin yes no 0 0 2 By MS/MS By matching By matching By matching 1 65.983 65.983 4 0.027827 15431 YJC_A_20141124_01 28.333 19.334 29968000 29968000 0 0 0 1029 29 1001 2668 1738 1738 1 TKDGVVEITGKHEER Unmodified 1696.8744 0.87441214 234 P04792 HSPB1 Heat shock protein beta-1 yes yes 0 0 2 By MS/MS By matching By matching By matching 1 34.098 34.098 3 0.0066585 4916 YJC_A_20141124_01 67.846 50.96 262370 262370 0 0 0 1030 234 1002 2669 1739 1739 1 TKPYIQVDIGGGQTK Unmodified 1603.857 0.85697116 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 1 By matching By MS/MS By matching By MS/MS 1 1 1 51.812 51.892 3 4.1805E-09 10469 YJC_B_20141124_01 87.669 57.562 24208000 14319000 6249400 0 3639900 1031 261 1003 2670;2671;2672 1740;1741 1740 2 TLAQLNPESSLFIIASK Unmodified 1831.0091 0.0091147084 203 P06744;P06744-2;K7EQ48 GPI Glucose-6-phosphate isomerase yes no 0 0 0 By MS/MS By matching By matching By matching 1 80.148 80.148 2 0.0034525 26719 YJC_A_20141124_01 62.658 44.792 1033200 1033200 0 0 0 + 1032 203 1004 2673 1742 1742 1 TLATDILMGVLK Unmodified 1273.7316 0.73155964 218 O43143 DHX15 Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 89.096 89.096 2 0.0080492 33730 YJC_A_20141124_01 57.175 25.681 385800 385800 0 0 0 1033 218 1005 2674 1743 1743 1 TLEEDEEELFK Unmodified 1380.6297 0.62965657 52 P43487;C9JJ34;C9JDM3 RANBP1 Ran-specific GTPase-activating protein yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 67.441 67.462 2 0.010474 16370 YJC_A_20141124_01 38.96 27.027 1778900 1461200 317640 0 0 1034 52 1006 2675;2676 1744 1744 0 TLETVPLERK Unmodified 1184.6765 0.6764876 278 P22626 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes yes 0 0 1 By matching By matching By matching By MS/MS 1 44.399 44.599 3 0.018834 7987 YJC_D_20141124_01 53.756 26.275 594770 0 0 0 594770 1035 278 1007 2677 1745 1745 1 TLLVADPR Unmodified 883.51272 0.51271674 214 P62249;M0R210 RPS16 40S ribosomal protein S16 yes no 0 0 0 By MS/MS By matching By matching By matching 1 48.855 48.855 2 0.0056526 9018 YJC_A_20141124_01 78.516 27.17 689060 689060 0 0 0 1036 214 1008 2678 1746 1746 1 TLNDELEIIEGMK Oxidation (M) 1519.744 0.74397482 260 P10809;E7ESH4;E7EXB4 HSPD1 60 kDa heat shock protein, mitochondrial yes no 0 1 0 By MS/MS By matching By matching By matching 1 70.013 70.013 2 0.0040424 18123 YJC_A_20141124_01 52.891 35.638 495150 495150 0 0 0 1037 260 1009 2679 1747 1747 33 0 TLNDELEIIEGMK Unmodified 1503.7491 0.7490602 260 P10809;E7ESH4;E7EXB4 HSPD1 60 kDa heat shock protein, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 76.901 76.922 2 0.016434 23737 YJC_A_20141124_01 44.132 27.558 2114600 1692100 422520 0 0 1038 260 1009 2680;2681 1748 1748 0 TLQQNAESR Unmodified 1045.5152 0.51523593 228 O95816;B4DXE2 BAG2 BAG family molecular chaperone regulator 2 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 29.207 29.278 2 0.013949 5273 YJC_B_20141124_01 65.278 8.2302 2716700 1916600 800110 0 0 1039 228 1010 2682;2683 1749 1749 1 TLRPALVGVVK Unmodified 1151.739 0.73902828 418 Q9HAV7 GRPEL1 GrpE protein homolog 1, mitochondrial yes yes 0 0 1 By matching By matching By matching By MS/MS 1 51.927 52.026 3 0.0016768 9982 YJC_D_20141124_01 52.391 42.953 1223600 0 0 0 1223600 1040 418 1011 2684 1750 1750 0 TLSDYNIQK Unmodified 1080.5451 0.54513908 29 P0CG47;P62979;P62987;J3QS39;J3QTR3;F5H6Q2;F5GYU3;F5H2Z3;F5H265;B4DV12;F5H388;F5H747;F5GXK7;J3QKN0;Q96C32;F5H041;P0CG48;M0R1V7;M0R1M6;M0R2S1 UBB;RPS27A;UBA52;UBC Polyubiquitin-B;Ubiquitin;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Polyubiquitin-C;Ubiquitin yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 45.072 45.101 2 0.0028181 7898 YJC_A_20141124_01 77.662 46.066 95169000 42032000 52878000 258650 0 1041 29 1012 2685;2686;2687 1751;1752 1751 2 TLSDYNIQKESTLHLVLR Unmodified 2129.1481 0.14806781 29 P0CG47;P62979;P62987;J3QS39;J3QTR3;F5H6Q2;F5GYU3;F5H2Z3;F5H265;B4DV12;F5H388;F5H747;F5GXK7;J3QKN0;Q96C32;F5H041;P0CG48;M0R1M6;M0R2S1 UBB;RPS27A;UBA52;UBC Polyubiquitin-B;Ubiquitin;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Polyubiquitin-C;Ubiquitin yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 63.207 63.227 4 8.2715E-05 13856 YJC_A_20141124_01 77.324 65.898 71891000 61297000 10593000 0 0 1042 29 1013 2688;2689 1753 1753 1 TLSSSTQASIEIDSLYEGIDFYTSITR Unmodified 2996.4502 0.45024222 262 P11142;E9PKE3;P11142-2;E9PN89;E9PNE6;A8K7Q2 HSPA8 Heat shock cognate 71 kDa protein yes no 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 2 2 2 1 94.431 94.399 2;3 1.0037E-134 32264 YJC_C_20141124_01 125.19 102.07 144830000 100280000 23749000 16333000 4465400 1043 262 1014 2690;2691;2692;2693;2694;2695;2696 1754;1755;1756;1757 1756 4 TLTAVHDAILEDLVFPSEIVGK Unmodified 2366.2733 0.2733279 34 P62081;B5MCP9 RPS7 40S ribosomal protein S7 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 86.258 86.288 3 0.0087074 31413 YJC_A_20141124_01 56.719 40.994 3525100 2215900 995200 313930 0 1044 34 1015 2697;2698;2699 1758 1758 1 TLTGKTITLEVEPSDTIENVK Unmodified 2287.2159 0.2158726 29 P0CG47;P62979;P62987;J3QS39;J3QTR3;F5H6Q2;F5GYU3;F5H2Z3;F5H265;B4DV12;F5H388;F5H747;F5GXK7;J3QKN0;Q96C32;F5H041;P0CG48;M0R1V7;F5GZ39;J3QSA3;J3QLP7;J3QRK5 UBB;RPS27A;UBA52;UBC;UBBP4 Polyubiquitin-B;Ubiquitin;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Polyubiquitin-C;Ubiquitin yes no 0 0 1 By MS/MS By MS/MS By matching By matching 2 2 62.025 62.046 2;3 1.0206E-111 13209 YJC_A_20141124_01 124.4 108.67 147710000 126220000 21492000 0 0 1045 29 1016 2700;2701;2702;2703 1759;1760;1761;1762;1763 1760 5 TLTGKTITLEVEPSDTIENVKAK Unmodified 2486.3479 0.34794941 29 P0CG47;P62979;P62987;J3QS39;J3QTR3;F5H6Q2;F5GYU3;F5H2Z3;F5H265;B4DV12;F5H388;F5H747;F5GXK7;J3QKN0;Q96C32;F5H041;P0CG48;M0R1V7;F5GZ39;J3QSA3;J3QLP7;J3QRK5 UBB;RPS27A;UBA52;UBC;UBBP4 Polyubiquitin-B;Ubiquitin;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Polyubiquitin-C;Ubiquitin yes no 0 0 2 By MS/MS By MS/MS By matching By matching 2 2 58.489 58.509 3;4 0.00046751 11895 YJC_A_20141124_01 59.339 46.022 147010000 127860000 19154000 0 0 1046 29 1017 2704;2705;2706;2707 1764;1765;1766 1764 3 TLTLVDTGIGMTK Unmodified 1348.7272 0.72720254 250 P08238 HSP90AB1 Heat shock protein HSP 90-beta yes yes 0 0 0 By MS/MS By matching By matching By matching 1 65.14 65.14 2 1.7726E-38 14836 YJC_A_20141124_01 107.99 83.74 3292500 3292500 0 0 0 1047 250 1018 2708 1767 1767 1 TLVLLDNLNVR Unmodified 1268.7452 0.74523587 113 P39656;E7EWT1;U3KQ84 DDOST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit yes no 0 0 0 By MS/MS By matching By matching By matching 1 72.694 72.694 2 4.7848E-07 20226 YJC_A_20141124_01 78.548 51.9 430520 430520 0 0 0 1048 113 1019 2709 1768 1768 0 TLVLSNLSYSATEETLQEVFEK Unmodified 2500.2585 0.2584657 275 P19338;H7BY16 NCL Nucleolin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 89.32 89.291 2 0.026608 34083 YJC_A_20141124_01 37.118 19.103 1973300 1604700 368610 0 0 1049 275 1020 2710;2711 1769 1769 1 TNAENEFVTIKK Unmodified 1392.7249 0.72489436 73 CON__P04264;P04264 KRT1 Keratin, type II cytoskeletal 1 yes no 0 0 1 By matching By matching By MS/MS By matching 1 47.234 47.283 3 0.00032814 7127 YJC_C_20141124_01 68.463 49.187 0 0 0 0 0 + 1050 73 1021 2712 1770 1770 1 TNEKVELQELNDR Unmodified 1586.79 0.79001381 251 P08670;B0YJC4;P17661 VIM;DES Vimentin;Desmin yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 48.102 48.222 3 0.021456 9591 YJC_B_20141124_01 57.425 20.245 1441500 0 550680 0 890830 1051 251 1022 2713;2714 1771 1771 1 TNRPPLSLSR Unmodified 1139.6411 0.64110515 156 Q07020;F8VUA6;F8VYV2;G3V203;H0YHA7;J3QQ67;F8VWC5 RPL18 60S ribosomal protein L18 yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 1 42.834 42.914 3 0.012875 7470 YJC_A_20141124_01 46.796 10.112 1715500 1092200 408300 0 215010 1052 156 1023 2715;2716;2717 1772 1772 0 TPETLLPFAEAEAFLKK Unmodified 1904.0295 0.0295158 385 Q3KQU3;Q3KQU3-2;Q3KQU3-4;Q3KQU3-3 MAP7D1 MAP7 domain-containing protein 1 yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 84.235 84.385 3 0.022045 30931 YJC_D_20141124_01 43.592 30.8 1001800 122130 0 0 879640 1053 385 1024 2718;2719 1773 1773 1 TPGPGAQSALR Unmodified 1053.5567 0.55670682 335 P62263;H0YB22;E5RH77 RPS14 40S ribosomal protein S14 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 37.859 37.929 2 0.025756 6943 YJC_B_20141124_01 42.976 19.905 562110 300460 261640 0 0 1054 335 1025 2720;2721 1774 1774 1 TPVEPEVAIHR Unmodified 1246.667 0.66698555 329 P60866;P60866-2;E5RIP1;E5RJX2 RPS20 40S ribosomal protein S20 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 44.937 44.957 3 5.5086E-05 8768 YJC_B_20141124_01 80.916 63.177 751780 460950 290830 0 0 1055 329 1026 2722;2723 1775;1776 1776 2 TSFFQALGITTK Unmodified 1312.7027 0.70270235 158 P05388;F8VW21;Q8NHW5;F8VPE8;F8VU65;F8VWS0;Q3B7A4;G3V210 RPLP0;RPLP0P6 60S acidic ribosomal protein P0;60S acidic ribosomal protein P0-like yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 78.453 78.473 2 0.027544 25125 YJC_A_20141124_01 43.297 27.433 2145500 1666800 478660 0 0 1056 158 1027 2724;2725 1777 1777 1 TSIDAYDNFDNISLAQR Unmodified 1941.9068 0.90683448 354 Q00610;Q00610-2;J3KS13;K7EJJ5 CLTC Clathrin heavy chain 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 67.906 67.926 2 0 16725 YJC_A_20141124_01 175.19 144.86 935330 689250 246080 0 0 1057 354 1028 2726;2727 1778 1778 1 TTGIVMDSGDGVTHTVPIYEGYALPHAILR Unmodified 3182.607 0.60703441 327 P60709;P63261;I3L3I0;I3L1U9;I3L4N8 ACTB;ACTG1 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed yes no 0 0 0 By MS/MS By MS/MS By matching By matching 2 1 1 72.338 72.335 3;4 0.0012722 19938 YJC_A_20141124_01 39.371 29.378 6122700 4998100 785360 339260 0 1058 327 1029 2728;2729;2730;2731 1779;1780 1779 1 TTHFVEGGDAGNREDQINR Unmodified 2114.973 0.97295699 7 P18124;A8MUD9 RPL7 60S ribosomal protein L7 yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 39.652 39.723 4 0.0037778 7369 YJC_B_20141124_01 55.546 43.883 895070 700790 194280 0 0 1059 7 1030 2732;2733 1781 1781 1 TTPSVVAFTADGER Unmodified 1449.71 0.70997257 307 P38646;D6RJI2;D6RA73 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 0 By matching By MS/MS By MS/MS By MS/MS 1 2 2 2 57.267 57.293 2;3 1.8622E-23 9283 YJC_C_20141124_01 100.4 75.898 257760000 4814800 3008000 9695900 240250000 1060 307 1031 2734;2735;2736;2737;2738;2739;2740 1782;1783;1784 1783 3 TTPSYVAFTDTER Unmodified 1486.694 0.69398816 262;249;273 P11142;E9PKE3;P11142-2;E9PNE6;E9PLF4;E9PI65;E9PQQ4;E9PQK7;E9PK54;P54652;E9PPY6;E9PN25;P17066;P48741;P08107;P08107-2 HSPA8;HSPA2;HSPA6;HSPA7;HSPA1A Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2;Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7;Heat shock 70 kDa protein 1A/1B no no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 1 57.252 57.274 2 0.0046445 11500 YJC_A_20141124_01 70.272 59.227 11867000 8013100 2302500 529900 1021200 1061 262;273;249 1032 2741;2742;2743;2744 1785;1786;1787 1785 3 TTTYIDPR Unmodified 965.48181 0.48181054 409 Q96J02;Q96J02-2;Q96J02-3 ITCH E3 ubiquitin-protein ligase Itchy homolog yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 41.287 41.358 2 0.0036809 6827 YJC_A_20141124_01 76.679 61.064 474800 303800 171000 0 0 1062 409 1033 2745;2746 1788 1788 1 TVAGGAWTYNTTSAVTVK Unmodified 1825.921 0.92102798 46 P61513;C9J4Z3 RPL37A 60S ribosomal protein L37a yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 59.058 59.078 2 0.0020812 12129 YJC_A_20141124_01 70.334 32.677 730130 542410 187720 0 0 1063 46 1034 2747;2748 1789;1790 1789 2 TVGGKEDVIWELLNHAQEHFGK Unmodified 2506.2605 0.2604718 81 CON__Q29443;CON__Q0IIK2 yes no 0 0 1 By MS/MS By matching By matching By matching 1 79.112 79.112 4 0.0090926 25777 YJC_A_20141124_01 37.925 30.827 3921600 3921600 0 0 0 + 1064 81 1035 2749 1791 1791 1 TVLIMELINNVAK Unmodified 1456.8323 0.83233632 239 P06576;F8VPV9;H0YH81;F8W0P7;F8W079;H0YI37 ATP5B ATP synthase subunit beta, mitochondrial;ATP synthase subunit beta yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 90.293 90.289 2 0.0029911 30952 YJC_B_20141124_01 64.827 51.237 2368000 1948300 286790 132890 0 1065 239 1036 2750;2751;2752 1792 1792 1 TVPPAVTGITFLSGGQSEEEASINLNAINK Unmodified 3056.5666 0.56660939 183 P04075;H3BQN4;J3KPS3;P04075-2;H3BR68 ALDOA Fructose-bisphosphate aldolase A yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 79.306 79.336 3 0.00099368 25819 YJC_A_20141124_01 40.208 34.757 9353700 6134200 2021100 1198400 0 1066 183 1037 2753;2754;2755 1793 1793 1 TVQSLEIDLDSMR Unmodified 1505.7396 0.73955814 161 P05783;F8VZY9;CON__H-INV:HIT000015463 KRT18 Keratin, type I cytoskeletal 18 yes no 0 0 0 By MS/MS By matching By matching By matching 1 71.014 71.014 2 0.011239 18873 YJC_A_20141124_01 51.03 26.101 711810 711810 0 0 0 1067 161 1038 2756 1794 1794 1 TVTNAVVTVPAYFNDSQR Unmodified 1980.9905 0.99050453 262 P11142;P11142-2;E9PN89;E9PLF4;E9PI65;E9PQQ4;E9PQK7;E9PK54 HSPA8 Heat shock cognate 71 kDa protein yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 65.978 65.998 2 7.5497E-05 15468 YJC_A_20141124_01 78.917 48.745 5112400 3315400 1797000 0 0 1068 262 1039 2757;2758 1795;1796 1795 2 TVVSGLVQFVPK Unmodified 1272.7442 0.74417324 324 P54577 YARS Tyrosine--tRNA ligase, cytoplasmic;Tyrosine--tRNA ligase, cytoplasmic, N-terminally processed yes yes 0 0 0 By MS/MS By matching By matching By matching 1 72.323 72.323 2 0.007305 19851 YJC_A_20141124_01 59.116 47.197 671970 671970 0 0 0 1069 324 1040 2759 1797 1797 1 TWNDPSVQQDIK Unmodified 1429.6838 0.68375782 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 1 52.083 52.105 2 8.3248E-99 10496 YJC_B_20141124_01 120.9 92.512 11174000 4884500 4187500 384710 1717400 1070 261 1041 2760;2761;2762;2763 1798;1799 1799 0 TYSLGSALRPSTSR Unmodified 1494.7791 0.77905519 251 P08670;B0YJC4 VIM Vimentin yes no 0 0 1 By matching By matching By MS/MS By matching 1 1 51.796 51.82 3 0.011006 8053 YJC_C_20141124_01 37.998 30.319 527170 156850 0 370320 0 1071 251 1042 2764;2765 1800 1800 0 VAAAVDLIIK Unmodified 1011.6328 0.63283187 313 P49327 FASN Fatty acid synthase;[Acyl-carrier-protein] S-acetyltransferase;[Acyl-carrier-protein] S-malonyltransferase;3-oxoacyl-[acyl-carrier-protein] synthase;3-oxoacyl-[acyl-carrier-protein] reductase;3-hydroxyacyl-[acyl-carrier-protein] dehydratase;Enoyl-[acyl-carrier-protein] reductase;Oleoyl-[acyl-carrier-protein] hydrolase yes yes 0 0 0 By MS/MS By matching By matching By matching 1 64.076 64.076 2 0.0062811 14239 YJC_A_20141124_01 51.762 20.965 341850 341850 0 0 0 1072 313 1043 2766 1801 1801 0 VACFACGGK Unmodified 968.42081 0.42080696 126 Q13490;E9PMH5;Q13490-2;H0YDY3;E9PQZ9 BIRC2 Baculoviral IAP repeat-containing protein 2 no no 0 0 0 By matching By MS/MS By matching By matching 1 1 37.625 37.696 2 0.017764 6892 YJC_B_20141124_01 63.565 54.793 535360 181070 354290 0 0 1073 126 1044 2767;2768 1802 1802 1 VAEFFQGVDVIVNASSVEDIDAGAIGQR Unmodified 2905.4458 0.44576597 88 Q16643;Q16643-3;D6RCR4;D6R9W4;Q16643-2 DBN1 Drebrin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 86.415 86.412 3 0.010518 31568 YJC_A_20141124_01 28.36 20.175 2364800 1415800 611970 337090 0 1074 88 1045 2769;2770;2771 1803 1803 0 VAGQDGSVVQFK Unmodified 1233.6354 0.63535107 6 P61956;P55854;Q6EEV6;H7BZT4;A8MUA9;A8MU27;P61956-2;P55854-2 SUMO2;SUMO3;SUMO4 Small ubiquitin-related modifier 2;Small ubiquitin-related modifier 3;Small ubiquitin-related modifier 4 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 2 48.587 48.607 2 3.3606E-06 9652 YJC_B_20141124_01 84.734 41.315 1720500 916250 804200 0 0 1075 6 1046 2772;2773;2774 1804;1805 1805 2 VAKVTGGAASKLSK Unmodified 1315.7823 0.78234966 133 P42766;F2Z388 RPL35 60S ribosomal protein L35 yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 1 30.588 30.668 3 9.0697E-30 4259 YJC_D_20141124_01 101.61 84.441 725900 140850 131780 0 453270 1076 133 1047 2775;2776;2777 1806 1806 1 VALTGLTVAEYFR Unmodified 1438.782 0.78201531 239 P06576;F8VPV9;H0YH81;F8W0P7 ATP5B ATP synthase subunit beta, mitochondrial;ATP synthase subunit beta yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 78.4 78.42 2 3.321E-160 25236 YJC_A_20141124_01 146.79 115.31 2765200 2406200 358950 0 0 1077 239 1048 2778;2779 1807;1808 1807 1 VAPEEHPVLLTEAPLNPK Unmodified 1953.0571 0.057127534 327 P60709;P63261;I3L3I0;I3L1U9;I3L4N8;E7EVS6;I3L3R2;G5E9R0;K7EM38;J3KT65 ACTB;ACTG1 Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed yes no 0 0 0 By matching By matching By MS/MS By matching 1 1 1 1 59.346 59.368 3 0.023489 9770 YJC_C_20141124_01 53.565 0 35223000 22362000 9110500 1786400 1964000 1078 327 1049 2780;2781;2782;2783 1809 1809 1 VAQPKEVYQQQQYGSGGRGNR Unmodified 2349.1574 0.15740371 87 Q99729-3;D6R9P3;D6RD18;D6RBZ0;Q99729-2;Q99729;Q99729-4 HNRNPAB Heterogeneous nuclear ribonucleoprotein A/B yes no 0 0 2 By matching By matching By matching By MS/MS 1 1 38.238 38.312 4 0.019093 6086 YJC_D_20141124_01 35.133 23.167 1583300 0 0 175360 1407900 1079 87 1050 2784;2785 1810 1810 1 VASAGSAISNASGER Unmodified 1375.6692 0.66917039 398 Q86YT6 MIB1 E3 ubiquitin-protein ligase MIB1 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 39.765 39.835 2 0.0080753 6371 YJC_A_20141124_01 56.768 30.109 245790 135550 110240 0 0 1080 398 1051 2786;2787 1811 1811 1 VASGPSPGEGISPQSAQAPQAPGDNHVVPVLR Unmodified 3118.5796 0.57957411 375 Q14764 MVP Major vault protein yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 1 1 2 2 58.15 58.172 3;4 6.8222E-08 12061 YJC_B_20141124_01 45.983 40.836 53376000 547300 273870 3380000 49175000 1081 375 1052 2788;2789;2790;2791;2792;2793 1812;1813;1814;1815;1816;1817;1818 1814 7 VATVSLPR Unmodified 841.50215 0.50215205 67 CON__P00761 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 25 22 23 38 72.619 72.692 2 3.109E-297 8968 YJC_D_20141124_01 170.3 95.107 187160000 37670000 24117000 32508000 92864000 + 1082 67 1053 2794;2795;2796;2797;2798;2799;2800;2801;2802;2803;2804;2805;2806;2807;2808;2809;2810;2811;2812;2813;2814;2815;2816;2817;2818;2819;2820;2821;2822;2823;2824;2825;2826;2827;2828;2829;2830;2831;2832;2833;2834;2835;2836;2837;2838;2839;2840;2841;2842;2843;2844;2845;2846;2847;2848;2849;2850;2851;2852;2853;2854;2855;2856;2857;2858;2859;2860;2861;2862;2863;2864;2865;2866;2867;2868;2869;2870;2871;2872;2873;2874;2875;2876;2877;2878;2879;2880;2881;2882;2883;2884;2885;2886;2887;2888;2889;2890;2891;2892;2893;2894;2895;2896;2897;2898;2899;2900;2901 1819;1820;1821;1822;1823;1824;1825;1826;1827;1828;1829;1830;1831;1832;1833;1834;1835;1836;1837;1838;1839;1840;1841;1842;1843;1844;1845;1846;1847;1848;1849;1850;1851;1852;1853;1854;1855;1856;1857;1858;1859;1860;1861;1862;1863;1864;1865;1866;1867;1868;1869;1870;1871;1872;1873;1874;1875;1876;1877;1878;1879;1880;1881;1882;1883;1884;1885;1886;1887;1888;1889;1890;1891;1892;1893;1894;1895;1896;1897;1898;1899;1900;1901;1902;1903;1904;1905;1906;1907;1908;1909;1910;1911;1912;1913;1914;1915;1916;1917;1918;1919;1920;1921;1922;1923;1924;1925;1926;1927;1928;1929;1930;1931;1932;1933 1921 113 VAVFFGGLSIK Unmodified 1136.6594 0.65938097 26 Q13838;B4DP52;Q5STU3;F8VQ10;Q13838-2;F6QYI9;F6R6M7;F6S4E6;F6TRA5;B4DIJ6;F6UJC5;F6WLT2 DDX39B;hCG_2005638 Spliceosome RNA helicase DDX39B yes no 0 0 0 By MS/MS By matching By matching By matching 1 75.795 75.795 2 0.0099068 22749 YJC_A_20141124_01 52.167 37.869 538180 538180 0 0 0 1083 26 1054 2902 1934 1934 1 VCNYVNWIQQTIAAN Unmodified 1792.8567 0.85665359 67 CON__P00761 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 1 2 2 2 86.464 86.546 2;3 0 31497 YJC_A_20141124_01 196.37 167.38 1071300000 180180000 139310000 155200000 596610000 + 1084 67 1055 2903;2904;2905;2906;2907;2908;2909 1935;1936;1937;1938;1939;1940 1935 6 VDKGGDPALIR Unmodified 1139.6299 0.62987176 315 P49591;Q5T5C7 SARS Serine--tRNA ligase, cytoplasmic yes no 0 0 1 By MS/MS By matching By matching By matching 1 1 39.529 39.599 3 0.0054719 6350 YJC_A_20141124_01 47.894 15.676 235980 114950 121030 0 0 1085 315 1056 2910;2911 1941 1941 0 VDLATVPR Unmodified 869.49707 0.49706667 213 Q96CB9;M0R1K5;Q96CB9-2 NSUN4 5-methylcytosine rRNA methyltransferase NSUN4 yes no 0 0 0 By matching By matching By MS/MS By matching 1 1 60.084 60.078 2 0.0032465 9998 YJC_C_20141124_01 67.169 6.4876 1530400 0 792830 737520 0 1086 213 1057 2912;2913 1942 1942 0 VEDVSAVEIVGGATR Unmodified 1500.7784 0.77838649 31 Q92598;B4DY72;Q92598-2;Q92598-3;Q92598-4 HSPH1 Heat shock protein 105 kDa yes no 0 0 0 By MS/MS By matching By matching By matching 1 60.048 60.048 2 0.0022329 12408 YJC_A_20141124_01 76.341 45.27 395810 395810 0 0 0 1087 31 1058 2914 1943 1943 1 VEEIMEK Unmodified 876.42627 0.4262695 224 O75688;O75688-2;C9JIR6;O75688-4;B8ZZF0;O75688-3 PPM1B Protein phosphatase 1B yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 38.506 38.576 2 0.010547 5999 YJC_A_20141124_01 75.189 30.468 2275900 1750300 525610 0 0 1088 224 1059 2915;2916 1944 1944 1 VEIIANDQGNRITPSYVAFTPEGER Unmodified 2775.3828 0.38277178 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 1 By MS/MS By matching By matching By matching 1 1 64.739 64.839 3 0.0062996 14584 YJC_A_20141124_01 53.589 41.992 26972000 18282000 0 0 8689500 1089 261 1060 2917;2918 1945 1945 1 VEILANDQGNR Unmodified 1227.6208 0.62076364 273 P17066;P48741 HSPA6;HSPA7 Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7 yes no 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 1 1 1 1 41.485 41.583 2 2.4721E-123 7830 YJC_B_20141124_01 139.76 114.06 13273000 6458400 4275700 391540 2147600 1090 273 1061 2919;2920;2921;2922 1946;1947;1948;1949 1947 4 VELQELNDR Unmodified 1114.5619 0.56185177 251 P08670;B0YJC4;P17661 VIM;DES Vimentin;Desmin yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 49.304 49.304 2 1.425E-39 9137 YJC_A_20141124_01 118.23 71.771 720370 720370 0 0 0 1091 251 1062 2923;2924 1950;1951;1952 1951 3 VESLQEEIAFLK Unmodified 1404.75 0.75004648 251 P08670;B0YJC4;B0YJC5;Q5JVS8 VIM Vimentin yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 74.795 74.816 2 3.0314E-68 22018 YJC_A_20141124_01 122.46 77.631 2309000 1788100 520860 0 0 1092 251 1063 2925;2926 1953;1954 1953 2 VESSMRSTSGSPR Oxidation (M) 1395.6412 0.64124108 185 Q9H0E3-2;H7BXF5;Q9H0E3-3 SAP130 yes no 0 1 1 By matching By matching By matching By MS/MS 1 62.449 62.648 2 0.01338 13809 YJC_D_20141124_01 41.218 19.822 275490 0 0 0 275490 1093 185 1064 2927 1955 1955 13 0 VETGVLKPGMVVTFAPVNVTTEVK Unmodified 2514.3767 0.37674711 348 P68104;Q5VTE0 EEF1A1;EEF1A1P5 Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3 yes no 0 0 1 By MS/MS By MS/MS By MS/MS By matching 1 1 1 1 71.873 71.92 3 1.4397E-14 16460 YJC_C_20141124_01 82.56 59.822 46028000 28030000 10532000 4892000 2574600 1094 348 1065 2928;2929;2930;2931 1956;1957;1958 1958 3 VETGVLKPGMVVTFAPVNVTTEVK Oxidation (M) 2530.3717 0.37166174 348 P68104;Q5VTE0 EEF1A1;EEF1A1P5 Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3 yes no 0 1 1 By matching By matching By MS/MS By matching 1 1 1 67.891 67.887 3 0.0026794 13674 YJC_C_20141124_01 43.38 29.717 7812900 5672600 1306100 834210 0 1095 348 1065 2932;2933;2934 1959 1959 49 1 VEVEEDGQLK Unmodified 1144.5612 0.56118307 57 P25686;C9JRD2;C9JXB9;P25686-2;O75190;Q8NHS0;O75190-2;C9J2C4;O75190-4;O75190-3 DNAJB2;DNAJB6;DNAJB8 DnaJ homolog subfamily B member 2;DnaJ homolog subfamily B member 6;DnaJ homolog subfamily B member 8 yes no 0 0 0 By MS/MS By matching By matching By matching 1 41.643 41.643 2 0.02643 6930 YJC_A_20141124_01 46.352 10.811 275580 275580 0 0 0 1096 57 1066 2935 1960 1960 1 VFDAIMNFK Unmodified 1083.5423 0.54230231 265 P13639 EEF2 Elongation factor 2 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 69.761 69.781 2 0.020735 17259 YJC_B_20141124_01 61.593 51.49 1094200 864070 230150 0 0 1097 265 1067 2936;2937 1961;1962 1962 2 VFDFELSSQDMTTLLSYNR Unmodified 2265.0623 0.062348845 270 P15121 AKR1B1 Aldose reductase yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 86.467 86.437 2 0.0067133 31669 YJC_A_20141124_01 60.826 44.211 1733500 1147600 585890 0 0 1098 270 1068 2938;2939 1963;1964 1964 2 VFDMLNR Oxidation (M) 909.43784 0.43783723 328 P60842;Q14240;E7EQG2;Q14240-2;Q9NZE6;J3QLN6;J3QR64;J3KTB5;J3QL43;J3QS69;J3KT12;P60842-2;J3QKZ9;J3KS25;J3KSZ0 EIF4A1;EIF4A2 Eukaryotic initiation factor 4A-I;Eukaryotic initiation factor 4A-II yes no 0 1 0 By MS/MS By matching By matching By matching 1 45.604 45.604 2 0.017103 8134 YJC_A_20141124_01 56.122 16.459 0 0 0 0 0 1099 328 1069 2940 1965 1965 44 1 VFIMDSCDELIPEYLNFIR Unmodified 2373.1385 0.13849068 250 P08238 HSP90AB1 Heat shock protein HSP 90-beta yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 1 93.02 93.016 3 0.020997 32644 YJC_B_20141124_01 52.172 41.015 3292200 2753400 378750 160080 0 1100 250 1070 2941;2942;2943 1966 1966 1 VFLDFFTYAPPK Unmodified 1443.7438 0.74383889 381 Q15397 KIAA0020 Pumilio domain-containing protein KIAA0020 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 58.95 58.95 2 0.010176 12067 YJC_A_20141124_01 51.286 19.564 449500 449500 0 0 0 1101 381 1071 2944 1967;1968 1968 2 VFSGLVSTGLK Unmodified 1106.6336 0.63356015 265 P13639 EEF2 Elongation factor 2 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 1 60.792 60.788 2 0.010061 12724 YJC_A_20141124_01 48.513 31.983 2173300 1702600 354730 115950 0 1102 265 1072 2945;2946;2947 1969 1969 1 VGAGAPVYLAAVLEYLTAEILELAGNAAR Unmodified 2914.5804 0.58040896 178 P16104;P0C0S8;Q8IUE6;Q9BTM1;Q99878;Q93077;Q7L7L0;P04908;Q96KK5;P20671;H0YFX9;Q9BTM1-2 H2AFX;HIST1H2AG;HIST2H2AB;H2AFJ;HIST1H2AJ;HIST1H2AC;HIST3H2A;HIST1H2AB;HIST1H2AH;HIST1H2AD Histone H2AX;Histone H2A type 1;Histone H2A type 2-B;Histone H2A.J;Histone H2A type 1-J;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 1-B/E;Histone H2A type 1-H;Histone H2A type 1-D;Histone H2A yes no 0 0 0 By MS/MS By matching By MS/MS By matching 1 1 1 95.021 94.984 3 4.0932E-16 38761 YJC_A_20141124_01 75.539 63.321 4173500 2381300 934730 857550 0 1103 178 1073 2948;2949;2950 1970;1971 1970 2 VGEVTYVELLMDAEGK Unmodified 1751.8652 0.86515259 211 P52272;P52272-2;M0R0N3;M0R019;M0R2T0 HNRNPM Heterogeneous nuclear ribonucleoprotein M yes no 0 0 0 By MS/MS By matching By matching By matching 1 83.609 83.609 2 0.021517 29440 YJC_A_20141124_01 45.452 23.125 404320 404320 0 0 0 1104 211 1074 2951 1972 1972 1 VGLIAAR Unmodified 698.44391 0.44390889 124 P62917;E9PKU4;E9PP36 RPL8 60S ribosomal protein L8 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 43.739 43.819 2 0.0070193 8476 YJC_B_20141124_01 77.374 28.614 1041100 508810 326190 0 206140 1105 124 1075 2952;2953;2954 1973;1974 1974 2 VGLQVVAVK Unmodified 911.5804 0.58040237 260 P10809 HSPD1 60 kDa heat shock protein, mitochondrial yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 52.824 52.82 2 2.0987E-19 10153 YJC_A_20141124_01 106.68 49.962 2647600 2051500 440110 156020 0 1106 260 1076 2955;2956;2957 1975;1976 1975 2 VGVNGFGR Unmodified 804.42424 0.42423608 233 P04406 GAPDH Glyceraldehyde-3-phosphate dehydrogenase yes yes 0 0 0 By matching By MS/MS By matching By MS/MS 1 1 1 44.326 44.423 2 2.8819E-27 7959 YJC_D_20141124_01 113.5 76.405 3627000 0 2236800 286510 1103700 1107 233 1077 2958;2959;2960 1977;1978 1978 2 VHLVGIDIFTGK Unmodified 1297.7394 0.73942221 347 P63241;P63241-2;Q6IS14;I3L397;I3L504;Q9GZV4;F8WCJ1;C9J7B5;C9J4W5 EIF5A;EIF5AL1;EIF5A2 Eukaryotic translation initiation factor 5A-1;Eukaryotic translation initiation factor 5A-1-like;Eukaryotic translation initiation factor 5A-2 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 2 2 1 70.634 70.64 2;3 0.0085086 17748 YJC_B_20141124_01 62.528 40.872 4517400 3522100 735590 259760 0 1108 347 1078 2961;2962;2963;2964;2965 1979;1980;1981 1980 2 VHNEGLPAPIVR Unmodified 1300.7252 0.72516913 65;64 CON__ENSEMBL:ENSBTAP00000024466;CON__ENSEMBL:ENSBTAP00000024462 no no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 48.443 48.567 2 2.6911E-05 9071 YJC_D_20141124_01 79.886 55.632 4776700 0 0 1760500 3016200 + 1109 65;64 1079 2966;2967 1982;1983 1983 2 VIAVYDLGGGTFDISILEIQK Unmodified 2250.2148 0.21475039 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By MS/MS 2 2 2 1 88.066 88.106 2;3 2.6635E-47 29423 YJC_B_20141124_01 105.79 97.255 20850000 10591000 6274200 2631200 1354300 1110 307 1080 2968;2969;2970;2971;2972;2973;2974 1984;1985;1986;1987;1988;1989;1990 1987 7 VIFSGSLDFFSDSFFNSAVQK Unmodified 2341.1267 0.12666366 113 P39656;E7EWT1 DDOST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 91.955 92.002 2 2.9448E-134 36332 YJC_A_20141124_01 129.51 105.61 3243100 1237500 524320 376760 1104500 1111 113 1081 2975;2976;2977;2978 1991;1992 1992 2 VIGLSSDLQQVGGASAR Unmodified 1656.8795 0.87949752 14 O00303;H0YDT6;B4DEW9;B3KSH1 EIF3F Eukaryotic translation initiation factor 3 subunit F yes no 0 0 0 By MS/MS By matching By matching By matching 1 60.403 60.403 2 1.3803E-11 12568 YJC_A_20141124_01 85.054 65.784 413520 413520 0 0 0 1112 14 1082 2979 1993;1994 1994 2 VIGSGCNLDSAR Unmodified 1247.5928 0.59283433 229;9 P07195;A8MW50;P07864;Q6ZMR3;F5H5G7;F5H155;G3XAP5;F5H245;P00338;P00338-3;P00338-2;P00338-5;P00338-4 LDHB;LDHC;LDHAL6A;LDHA L-lactate dehydrogenase B chain;L-lactate dehydrogenase;L-lactate dehydrogenase C chain;L-lactate dehydrogenase A-like 6A;L-lactate dehydrogenase A chain no no 0 0 0 By MS/MS By matching By matching By matching 1 1 41.686 41.756 2 0.0099718 6972 YJC_A_20141124_01 51.726 33.536 1644000 1469500 174580 0 0 1113 9;229 1083 2980;2981 1995 1995 1 VIHDNFGIVEGLMTTVHAITATQK Unmodified 2594.3527 0.35265763 233 P04406;P04406-2;E7EUT5 GAPDH Glyceraldehyde-3-phosphate dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 89.7 89.696 4 0.00052996 34242 YJC_A_20141124_01 48.244 27.638 17362000 13223000 3090500 1047600 0 1114 233 1084 2982;2983;2984 1996 1996 1 VINEPTAAALAYGLDK Unmodified 1644.8723 0.87228688 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 0 By MS/MS By matching By MS/MS By MS/MS 2 2 2 2 67.522 67.569 2;3 0.0021623 17118 YJC_D_20141124_01 76.82 46.336 17050000 3240100 819490 2497500 10493000 1115 307 1085 2985;2986;2987;2988;2989;2990;2991;2992 1997;1998;1999;2000;2001 2001 5 VIQQLEGAFALVFK Unmodified 1561.8868 0.88681473 99 Q06210;O94808;Q06210-2;E5RJP4 GFPT1;GFPT2 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1;Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 yes no 0 0 0 By MS/MS By matching By matching By matching 1 89.614 89.614 2 0.017385 34297 YJC_A_20141124_01 39.033 21.781 276230 276230 0 0 0 1116 99 1086 2993 2002 2002 0 VISGVLQLGNIVFK Unmodified 1485.8919 0.89190011 302 P35579;P35579-2 MYH9 Myosin-9 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 83.153 83.174 2 2.2039E-79 29019 YJC_A_20141124_01 125.22 107.2 2629600 2186900 442690 0 0 1117 302 1087 2994;2995 2003;2004 2003 2 VKSAEPADCAEGPVQCKNGLLV Unmodified 2341.1406 0.14061594 392 Q5VU13 VSIG8 V-set and immunoglobulin domain-containing protein 8 yes yes 0 0 2 By matching By matching By matching By MS/MS 1 1 1 1 65.782 65.829 4 0.016034 15641 YJC_D_20141124_01 30.336 10.64 366070000 102760000 89025000 79294000 94989000 1118 392 1088 2996;2997;2998;2999 2005 2005 0 VLAELYVSDR Unmodified 1163.6186 0.61863837 18 O43776;K7EJ19;K7EIU7;K7EQ35;B4DG16 NARS Asparagine--tRNA ligase, cytoplasmic yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 57.891 57.911 2 0.00092954 11767 YJC_A_20141124_01 44.614 4.7655 1092100 743350 348740 0 0 1119 18 1089 3000;3001 2006;2007 2006 0 VLALSVETDYTFPLAEK Unmodified 1894.9928 0.99279594 158 P05388;F8VW21;F8VWS0;Q3B7A4;F8W1K8;F8VZS0 RPLP0 60S acidic ribosomal protein P0 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 77.199 77.219 2 9.2406E-19 24148 YJC_A_20141124_01 92.427 65.294 2314000 1836500 477540 0 0 1120 158 1090 3002;3003 2008 2008 1 VLDLDLFR Unmodified 989.55458 0.55458155 315 P49591;Q5T5C7 SARS Serine--tRNA ligase, cytoplasmic yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 76.084 76.104 2 0.001379 23122 YJC_A_20141124_01 74.464 7.7725 797970 561890 236070 0 0 1121 315 1091 3004;3005 2009 2009 1 VLDQKEHR Unmodified 1023.5461 0.54614213 87 Q99729-3;D6R9P3;D6RD18;D6RBZ0;Q99729-2;Q99729;Q99729-4 HNRNPAB Heterogeneous nuclear ribonucleoprotein A/B yes no 0 0 1 By matching By matching By matching By MS/MS 1 22.039 22.138 2 1.1763E-10 2751 YJC_D_20141124_01 101.46 77.228 300330 0 0 0 300330 1122 87 1092 3006 2010 2010 1 VLEGNEQFINAAK Unmodified 1431.7358 0.73579339 13 P35030;B1AN99;P35030-5;P35030-3;P35030-2;P35030-4 PRSS3 Trypsin-3 yes no 0 0 0 By MS/MS By matching By MS/MS By matching 1 1 1 1 53.965 54.012 2 0 10530 YJC_A_20141124_01 185.2 156.97 90539000 19565000 12104000 22012000 36858000 1123 13 1093 3007;3008;3009;3010 2011;2012 2011 2 VLENAEGAR Unmodified 957.48796 0.48795855 307 P38646;D6RJI2;D6RA73 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 1 31.936 32.008 2 1.4914E-05 4106 YJC_C_20141124_01 93.096 32.698 71109000 671440 597920 548750 69291000 1124 307 1094 3011;3012;3013;3014 2013;2014 2013 2 VLEQLTGQTPVFSK Unmodified 1545.8403 0.84025847 345 P62913;Q5VVC8;P62913-2;Q5VVC9 RPL11 60S ribosomal protein L11 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 61.76 61.78 2 7.1412E-15 13085 YJC_A_20141124_01 91.355 73.569 1785900 1407300 378610 0 0 1125 345 1095 3015;3016 2015;2016 2015 2 VLGLVLLR Unmodified 881.60622 0.60622319 15 P14678;P63162;P14678-2;B3KVR1;J3QLE5;P14678-3 SNRPB;SNRPN Small nuclear ribonucleoprotein-associated proteins B and B';Small nuclear ribonucleoprotein-associated protein N yes no 0 0 0 By MS/MS By matching By matching By matching 1 74.308 74.308 2 0.00050748 21513 YJC_A_20141124_01 90.777 76.774 808170 808170 0 0 0 1126 15 1096 3017 2017 2017 1 VLGMTLIQK Unmodified 1001.5943 0.59433788 362 Q04760;Q04760-2 GLO1 Lactoylglutathione lyase yes no 0 0 0 By MS/MS By matching By matching By matching 1 62.089 62.089 2 0.022237 13219 YJC_A_20141124_01 49.418 32.178 638820 638820 0 0 0 1127 362 1097 3018 2018 2018 0 VLITTDLLAR Unmodified 1113.6758 0.67575932 328 P60842;Q14240;E7EQG2;Q14240-2;Q9NZE6 EIF4A1;EIF4A2 Eukaryotic initiation factor 4A-I;Eukaryotic initiation factor 4A-II yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 67.359 67.379 2 1.7521E-10 16398 YJC_A_20141124_01 96.171 64.677 3545800 2790400 755400 0 0 1128 328 1098 3019;3020 2019 2019 1 VLLESEQFLTELTR Unmodified 1676.8985 0.89850163 304 P37108;H0YLA2 SRP14 Signal recognition particle 14 kDa protein yes no 0 0 0 By MS/MS By matching By matching By MS/MS 1 1 1 81.412 81.525 2 1.2209E-115 27821 YJC_A_20141124_01 133.25 113.56 3756700 2194100 651840 0 910760 1129 304 1099 3021;3022;3023 2020;2021 2020 2 VLLVLELQGLQK Unmodified 1351.8439 0.84388728 374 Q14697;Q14697-2 GANAB Neutral alpha-glucosidase AB yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 79.666 79.686 2 0.026083 26178 YJC_A_20141124_01 43.761 36.151 1057800 922690 135110 0 0 1130 374 1100 3024;3025 2022 2022 1 VLNTNIDGR Unmodified 1000.5302 0.53015772 336 P62269 RPS18 40S ribosomal protein S18 yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 1 41.71 41.823 2 0.0030442 7966 YJC_B_20141124_01 65.157 16.734 1494200 676360 398480 0 419330 1131 336 1101 3026;3027;3028 2023 2023 0 VLPGVDALSNI Unmodified 1096.6128 0.61282471 41 P00558;B7Z7A9;E7ERH5 PGK1 Phosphoglycerate kinase 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 76.06 76.06 2 0.026869 22946 YJC_A_20141124_01 42.843 24.508 2311500 2311500 0 0 0 1132 41 1102 3029 2024 2024 1 VLQATVVAVGSGSK Unmodified 1314.7507 0.75071518 331 P61604;B8ZZL8;S4R3N1 HSPE1;HSPE1-MOB4 10 kDa heat shock protein, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 49.513 49.513 2 2.6629E-274 9223 YJC_A_20141124_01 163.9 120.4 2545900 2545900 0 0 0 1133 331 1103 3030 2025;2026 2026 2 VLQLYPNNK Unmodified 1087.6026 0.60259438 177 Q02790;H0YFG2 FKBP4 Peptidyl-prolyl cis-trans isomerase FKBP4;Peptidyl-prolyl cis-trans isomerase FKBP4, N-terminally processed yes no 0 0 0 By MS/MS By matching By matching By matching 1 51.672 51.672 2 0.013121 9824 YJC_A_20141124_01 62.582 38.593 401530 401530 0 0 0 1134 177 1104 3031 2027 2027 0 VLTQPSSVSGSLGQR Unmodified 1514.8053 0.80526994 63 CON__ENSEMBL:ENSBTAP00000014147 yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 48.448 48.572 2 4.3876E-34 9025 YJC_D_20141124_01 101.3 68.075 10223000 0 0 3557900 6664600 + 1135 63 1105 3032;3033 2028;2029 2029 2 VMVQPINLIFR Oxidation (M) 1344.7588 0.75877744 338 P62304 SNRPE Small nuclear ribonucleoprotein E yes yes 0 1 0 By MS/MS By matching By matching By matching 1 76.765 76.765 2 0.0049095 23651 YJC_A_20141124_01 66.92 47.954 435210 435210 0 0 0 1136 338 1106 3034 2030 2030 45 1 VNFHFILFNNVDGHLYELDGR Unmodified 2518.2393 0.23934243 84 P09936;D6RE83;D6R956 UCHL1 Ubiquitin carboxyl-terminal hydrolase isozyme L1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 79.838 79.858 4 0.0080119 26437 YJC_A_20141124_01 57.616 49.792 3554500 2526700 1027900 0 0 1137 84 1107 3035;3036 2031 2031 1 VNIEVQLASELAIAAIEK Unmodified 1910.0724 0.072443247 97 Q9P015;E5RHF4 MRPL15 39S ribosomal protein L15, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 92.553 92.549 3 0.00047182 36861 YJC_A_20141124_01 77.221 61.7 861780 371460 211270 279050 0 1138 97 1108 3037;3038;3039 2032 2032 1 VNPTVFFDIAVDGEPLGR Unmodified 1944.9945 0.99452728 346 P62937;F8WE65;C9J5S7;E5RIZ5 PPIA Peptidyl-prolyl cis-trans isomerase A;Peptidyl-prolyl cis-trans isomerase A, N-terminally processed;Peptidyl-prolyl cis-trans isomerase yes no 0 0 0 By MS/MS By matching By matching By matching 2 2 2 86.366 86.396 2;3 8.4022E-13 31404 YJC_A_20141124_01 89.877 60.244 8748200 5902000 2026600 819650 0 1139 346 1109 3040;3041;3042;3043;3044;3045 2033;2034 2033 2 VPHNAAVQVYDYR Unmodified 1530.7579 0.75792582 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 48.73 48.812 3 4.2728E-21 7440 YJC_C_20141124_01 95.477 61.376 4002600 491010 0 1149200 2362400 1140 375 1110 3046;3047;3048 2035;2036 2035 2 VPTANVSVVDLTCR Unmodified 1529.7872 0.78717704 233 P04406;P04406-2;E7EUT5 GAPDH Glyceraldehyde-3-phosphate dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 1 60.642 60.689 2 5.6099E-30 12627 YJC_A_20141124_01 101.42 78.303 7651200 5877200 838260 493050 442650 1141 233 1111 3049;3050;3051;3052 2037 2037 1 VQGGALEDSQLVAGVAFK Unmodified 1787.9418 0.94176342 38 Q99832;B7Z1C9;F5GZK5;Q99832-4;Q99832-3 CCT7 T-complex protein 1 subunit eta yes no 0 0 0 By MS/MS By matching By matching By matching 1 69.159 69.159 2 0.015971 17455 YJC_A_20141124_01 49.537 32.651 888810 888810 0 0 0 1142 38 1112 3053 2038 2038 1 VQQTVQDLFGR Unmodified 1289.6728 0.67279921 307 P38646 HSPA9 Stress-70 protein, mitochondrial yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 1 1 61.746 61.793 2 1.2394E-170 10573 YJC_C_20141124_01 150.51 105.87 15918000 2342100 800520 3009600 9766000 1143 307 1113 3054;3055;3056;3057 2039;2040 2039 2 VREAAEKAK Unmodified 1000.5665 0.56654322 307 P38646;H0YBG6 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 2 By matching By matching By matching By MS/MS 1 16.608 16.607 3 8.9377E-08 2041 YJC_D_20141124_01 96.665 30.314 852200 0 0 0 852200 1144 307 1114 3058 2041 2041 1 VRGCSTLPPSRSR Unmodified 1471.7678 0.767779 222 O75161;O75161-2 NPHP4 Nephrocystin-4 yes no 0 0 2 By MS/MS By matching By matching By matching 1 52.355 52.355 3 0.017179 10036 YJC_A_20141124_01 38.674 17.635 250610 250610 0 0 0 1145 222 1115 3059 2042 2042 0 VSDEAVKK Unmodified 874.476 0.47599688 224 O75688;O75688-2;C9JIR6;O75688-4;O75688-3;O75688-5 PPM1B Protein phosphatase 1B yes no 0 0 1 By MS/MS By MS/MS By matching By matching 1 1 21.952 21.972 2 1.592E-07 2701 YJC_A_20141124_01 100.02 27.787 208200 98549 109650 0 0 1146 224 1116 3060;3061 2043;2044 2043 2 VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFR Unmodified 4592.0999 0.099939503 245;350 P68371;P04350;Q9BUF5;M0R042;M0R2D3;M0QYM7;K7ESM5;P07437;Q5JP53;Q5ST81;Q9BVA1 TUBB4B;TUBB4A;TUBB6;TUBB;TUBB2B Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-6 chain;Tubulin beta chain;Tubulin beta-2B chain no no 0 0 0 By MS/MS By matching By matching By matching 1 86.685 86.685 4 1.5428E-11 31822 YJC_A_20141124_01 43.462 41.074 13216000 13216000 0 0 0 1147 350;245 1117 3062 2045 2045 1 VSFELFADK Unmodified 1054.5335 0.53351176 346 P62937;F8WE65;C9J5S7 PPIA Peptidyl-prolyl cis-trans isomerase A;Peptidyl-prolyl cis-trans isomerase A, N-terminally processed;Peptidyl-prolyl cis-trans isomerase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 69.592 69.588 2 9.8388E-13 17732 YJC_A_20141124_01 101.38 73.557 5892200 4886900 709080 296250 0 1148 346 1118 3063;3064;3065 2046 2046 1 VSFELFADKVPK Unmodified 1378.7497 0.74965254 346 P62937;F8WE65;C9J5S7 PPIA Peptidyl-prolyl cis-trans isomerase A;Peptidyl-prolyl cis-trans isomerase A, N-terminally processed;Peptidyl-prolyl cis-trans isomerase yes no 0 0 1 By matching By MS/MS By matching By matching 1 1 1 67.709 67.789 3 0.0073111 16126 YJC_B_20141124_01 72.531 54.866 3641200 1836200 1230700 0 574360 1149 346 1119 3066;3067;3068 2047 2047 1 VSHLLGINVTDFTR Unmodified 1570.8467 0.84674083 302 P35579;P35579-2 MYH9 Myosin-9 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 68.989 69.009 3 0.0028283 17412 YJC_A_20141124_01 77.894 64.476 2711100 2204300 506820 0 0 1150 302 1120 3069;3070 2048 2048 1 VSHQAGDHWLIR Unmodified 1417.7215 0.72148073 375 Q14764 MVP Major vault protein yes yes 0 0 0 By matching By matching By matching By MS/MS 1 47.773 47.973 3 0.00077931 8911 YJC_D_20141124_01 75.788 55.581 1659700 0 0 0 1659700 1151 375 1121 3071 2049 2049 1 VSITCSGSSNNIGR Unmodified 1450.6834 0.68344025 63 CON__ENSEMBL:ENSBTAP00000014147 yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 42.35 42.474 2 0.0044901 7365 YJC_D_20141124_01 71.031 40.467 2976700 0 0 945890 2030800 + 1152 63 1122 3072;3073 2050;2051 2051 2 VSTNGSDDPEDAGAGENR Unmodified 1789.7351 0.73507771 409 Q96J02;Q96J02-2;Q96J02-3 ITCH E3 ubiquitin-protein ligase Itchy homolog yes no 0 0 0 By MS/MS By matching By matching By matching 1 34.628 34.628 2 0.014476 5034 YJC_A_20141124_01 50.956 34.294 213710 213710 0 0 0 1153 409 1123 3074 2052 2052 1 VTDGALVVVDCVSGVCVQTETVLR Unmodified 2575.2986 0.29857315 265 P13639 EEF2 Elongation factor 2 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 78.372 78.372 3 0.0049669 25137 YJC_A_20141124_01 55.575 41.32 865800 865800 0 0 0 1154 265 1124 3075 2053 2053 1 VTDLVQFLLFK Unmodified 1321.7646 0.76457433 48 P43363;C9J9A2;C9J958 MAGEA10 Melanoma-associated antigen 10 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 91.012 90.983 2 1.2881E-10 35425 YJC_A_20141124_01 91.701 66.848 507250 399410 107840 0 0 1155 48 1125 3076;3077 2054 2054 1 VTHAVVTVPAYFNDAQR Unmodified 1886.9639 0.96389585 261 P11021 HSPA5 78 kDa glucose-regulated protein yes yes 0 0 0 By MS/MS By MS/MS By matching By MS/MS 2 2 1 1 59.77 59.791 2;3 4.9228E-38 12466 YJC_B_20141124_01 100.68 83.326 21248000 12618000 5230300 540360 2860100 1156 261 1126 3078;3079;3080;3081;3082;3083 2055;2056;2057;2058 2056 4 VTIASLPR Unmodified 855.5178 0.51780212 144 Q12912;F8W9L6;F5H006;Q12912-2 LRMP Lymphoid-restricted membrane protein;Processed lymphoid-restricted membrane protein yes no 0 0 0 By matching By MS/MS By matching By MS/MS 1 1 48.15 48.27 2 8.7549E-11 9661 YJC_B_20141124_01 82.241 9.4513 0 0 0 0 0 1157 144 1127 3084;3085 2059;2060 2059 2 VTILELFR Unmodified 989.59097 0.59096706 54 P11166;C9JIM8 SLC2A1 Solute carrier family 2, facilitated glucose transporter member 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 82.185 82.185 2 0.00856 28378 YJC_A_20141124_01 83.998 62.038 294740 294740 0 0 0 1158 54 1128 3086 2061 2061 1 VTNIGNQQIDK Unmodified 1228.6412 0.64116473 155 Q6P3W7;F8VSC5 SCYL2 SCY1-like protein 2 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 38.98 39.05 2 1.7405E-10 7211 YJC_B_20141124_01 90.412 53.827 314410 190700 123710 0 0 1159 155 1129 3087;3088 2062;2063 2063 2 VTSVVFHPSQDLVFSASPDATIR Unmodified 2472.2649 0.26488848 427 Q9UMS4 PRPF19 Pre-mRNA-processing factor 19 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 69.385 69.385 3 0.001621 17623 YJC_A_20141124_01 60.332 27.535 849890 849890 0 0 0 1160 427 1130 3089 2064 2064 1 VVDFIDEGVNIGLEVK Unmodified 1744.9247 0.92471638 24 P34897;H0YIZ0;B4DLV4;P34897-3;P34897-2 SHMT2 Serine hydroxymethyltransferase, mitochondrial;Serine hydroxymethyltransferase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 79.022 79.042 2 0.011156 25772 YJC_A_20141124_01 55.437 38.373 656210 536280 119930 0 0 1161 24 1131 3090;3091 2065 2065 1 VVDLLAPYAK Unmodified 1087.6277 0.6277465 239 P06576;F8VPV9;H0YH81;F8W079 ATP5B ATP synthase subunit beta, mitochondrial;ATP synthase subunit beta yes no 0 0 0 By MS/MS By matching By matching By matching 1 65.57 65.57 2 0.00090393 15162 YJC_A_20141124_01 66.056 48.582 859680 859680 0 0 0 1162 239 1132 3092 2066 2066 0 VVDLMAHMASK Unmodified 1200.5995 0.59949961 233 P04406;P04406-2;E7EUT5 GAPDH Glyceraldehyde-3-phosphate dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 53.58 53.58 2 0.0099108 10387 YJC_A_20141124_01 52.071 26.73 341180 341180 0 0 0 1163 233 1133 3093 2067 2067 1 VVDVSVPR Unmodified 869.49707 0.49706667 399 Q8IW75 SERPINA12 Serpin A12 yes yes 0 0 0 By matching By MS/MS By MS/MS By MS/MS 1 2 1 2 54.92 54.991 2 0.00032089 9467 YJC_D_20141124_01 92.47 9.7991 47474000 2442200 5535600 7765400 31731000 1164 399 1134 3094;3095;3096;3097;3098;3099 2068;2069;2070;2071 2070 2 VVIGMDVAASEFFR Unmodified 1539.7755 0.77554972 242 P06733;P06733-2 ENO1 Alpha-enolase yes no 0 0 0 By MS/MS By matching By MS/MS By matching 1 1 1 1 80.297 80.394 2 4.1764E-96 26844 YJC_A_20141124_01 127.36 113.94 16932000 11498000 3304200 878930 1251400 1165 242 1135 3100;3101;3102;3103 2072;2073;2074 2072 3 VVIGMDVAASEFFR Oxidation (M) 1555.7705 0.77046434 242 P06733;P06733-2 ENO1 Alpha-enolase yes no 0 1 0 By matching By MS/MS By matching By matching 1 1 71.64 71.66 2 0.018512 18328 YJC_B_20141124_01 50.659 37.086 4598400 3776500 821940 0 0 1166 242 1135 3104;3105 2075 2075 18 1 VVLDDKDYFLFR Unmodified 1528.7926 0.79257999 331 P61604;B8ZZ54 HSPE1 10 kDa heat shock protein, mitochondrial yes no 0 0 1 By MS/MS By matching By MS/MS By matching 2 2 1 71.081 71.087 2;3 0.0017513 18998 YJC_A_20141124_01 77.124 55.068 8633500 6920900 1252300 460420 0 1167 331 1136 3106;3107;3108;3109;3110 2076;2077 2076 1 VVSYRVPHNAAVQVYDYR Unmodified 2135.0912 0.091221629 375 Q14764 MVP Major vault protein yes yes 0 0 1 By matching By matching By matching By MS/MS 2 2 54.727 54.751 3;4 0.00038396 10779 YJC_D_20141124_01 78.441 60.207 6832100 0 0 745490 6086700 1168 375 1137 3111;3112;3113;3114 2078;2079 2079 2 VVTDTDETELAR Unmodified 1347.6518 0.65178899 236 P05198 EIF2S1 Eukaryotic translation initiation factor 2 subunit 1 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 43.791 43.812 2 2.0556E-41 7597 YJC_A_20141124_01 113.95 94.45 480560 335960 144600 0 0 1169 236 1138 3115;3116 2080 2080 1 VWLDPNETNEIANANSR Unmodified 1941.9181 0.91806787 193 P84098;J3QR09;J3KTE4;J3QL15 RPL19 60S ribosomal protein L19;Ribosomal protein L19 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 61.903 61.923 2 1.5517E-38 13150 YJC_B_20141124_01 102.57 88.937 985270 397720 587560 0 0 1170 193 1139 3117;3118 2081;2082 2082 2 VYINYYDMNAANVGWNNSTFA Unmodified 2426.0637 0.063745829 267 P14174 MIF Macrophage migration inhibitory factor yes yes 0 0 0 By matching By MS/MS By matching By matching 1 1 81.186 81.206 2 9.8852E-07 25071 YJC_B_20141124_01 75.057 61.098 1928500 1467800 460610 0 0 1171 267 1140 3119;3120 2083 2083 1 VYNVTQHAVGIVVNK Unmodified 1639.9046 0.90459006 162 P46778;G3V1B3;M0R181 RPL21 60S ribosomal protein L21 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 2 54.338 54.432 3 9.2291E-06 11113 YJC_B_20141124_01 84.169 66.917 2278700 1710500 568140 0 0 1172 162 1141 3121;3122;3123 2084;2085 2085 2 VYPLSSCCGDK Unmodified 1284.5479 0.54785797 65 CON__ENSEMBL:ENSBTAP00000024466 yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 45.071 45.195 2 6.449E-30 6711 YJC_C_20141124_01 106.67 81.194 3671400 0 0 1968100 1703300 + 1173 65 1142 3124;3125 2086;2087;2088;2089 2087 4 WALSQSNPSALR Unmodified 1328.6837 0.68369824 326 P55072 VCP Transitional endoplasmic reticulum ATPase yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 57.749 57.769 2 1.511E-53 11692 YJC_A_20141124_01 117.03 80.501 2228300 1409000 819330 0 0 1174 326 1143 3126;3127 2090 2090 1 WAQLSEVLSWQFSSVTK Unmodified 1995.0102 0.010177341 191 P42224;J3KPM9;P42224-2 STAT1 Signal transducer and activator of transcription 1-alpha/beta;Signal transducer and activator of transcription yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 87.111 87.107 2 7.0807E-19 32068 YJC_A_20141124_01 93.115 69.682 1262900 835910 197630 229390 0 1175 191 1144 3128;3129;3130 2091 2091 1 WGDAGAEYVVESTGVFTTMEK Unmodified 2276.0307 0.030714366 233 P04406;P04406-2;E7EUT5 GAPDH Glyceraldehyde-3-phosphate dehydrogenase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 79.873 79.903 2 0.026055 26351 YJC_A_20141124_01 38.736 27.847 3667000 2554200 858100 254620 0 1176 233 1145 3131;3132;3133 2092 2092 1 WGTLTDCVVMR Unmodified 1336.6268 0.62677699 319 P51991;P51991-2 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 yes no 0 0 0 By matching By matching By matching By MS/MS 1 64.133 64.333 2 0.0099833 14836 YJC_D_20141124_01 50.354 28.958 1105800 0 0 0 1105800 1177 319 1146 3134 2093 2093 1 WISLNTVALVTDNAVYHWSMEGESQPVK Unmodified 3173.5492 0.54918518 354 Q00610;Q00610-2 CLTC Clathrin heavy chain 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 91.784 91.784 3 0.011942 36167 YJC_A_20141124_01 27.803 10.589 1990900 1990900 0 0 0 1178 354 1147 3135 2094 2094 0 YAASSYLSLTSSDWK Unmodified 1677.7886 0.78861683 82 CON__Q1RMN8 yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 2 1 69.688 69.72 2;3 0.0038343 18532 YJC_D_20141124_01 67.646 54.06 17755000 0 0 8513600 9241100 + 1179 82 1148 3136;3137;3138 2095;2096;2097 2097 3 YADLPGIAR Unmodified 974.51853 0.5185304 147 Q13561;F8W0U6;F8VRV7;F8VW18;F8W1I6;F5H2S7;Q13561-3;Q13561-2 DCTN2 Dynactin subunit 2 yes no 0 0 0 By matching By MS/MS By matching By matching 1 54.548 54.689 2 0.017014 11193 YJC_B_20141124_01 56.013 29.571 0 0 0 0 0 1180 147 1149 3139 2098 2098 1 YAIAVNDLGTEYVHR Unmodified 1719.858 0.8580338 227 O94925;O94925-3;H7BZD1 GLS Glutaminase kidney isoform, mitochondrial yes no 0 0 0 By MS/MS By matching By matching By matching 1 60.92 60.92 3 0.015173 12803 YJC_A_20141124_01 42.797 26.999 787280 787280 0 0 0 1181 227 1150 3140 2099 2099 0 YALPLVGHR Unmodified 1024.5818 0.58179936 266 P13667 PDIA4 Protein disulfide-isomerase A4 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 55.316 55.316 3 0.0182 10986 YJC_A_20141124_01 47.574 47.574 259580 259580 0 0 0 1182 266 1151 3141 2100 2100 0 YALYDATYETK Unmodified 1336.6187 0.61869795 281 P23528;G3V1A4;E9PP50;E9PK25;E9PQB7;E9PLJ3;Q9Y281;Q9Y281-3 CFL1;CFL2 Cofilin-1;Cofilin-2 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 1 55.225 55.272 2 1.6446E-84 10872 YJC_A_20141124_01 129.88 102.32 8385800 6064700 1504800 236070 580130 1183 281 1152 3142;3143;3144;3145 2101;2102 2101 2 YDCGEEILITVLSAMTEEAAVAIK Oxidation (M) 2641.2867 0.28667106 347 P63241;P63241-2;Q6IS14 EIF5A;EIF5AL1 Eukaryotic translation initiation factor 5A-1;Eukaryotic translation initiation factor 5A-1-like yes no 0 1 0 By matching By MS/MS By matching By matching 1 1 94.493 94.463 3 0.0003164 33753 YJC_B_20141124_01 49.433 34.544 10900000 0 6165600 0 4734700 1184 347 1153 3146;3147 2103 2103 47 1 YDCGEEILITVLSAMTEEAAVAIK Unmodified 2625.2918 0.29175643 347 P63241;P63241-2;Q6IS14 EIF5A;EIF5AL1 Eukaryotic translation initiation factor 5A-1;Eukaryotic translation initiation factor 5A-1-like yes no 0 0 0 By matching By MS/MS By MS/MS By MS/MS 1 2 2 1 94.65 94.612 2;3 2.1081E-196 32537 YJC_C_20141124_01 138.82 114.92 120990000 19798000 42238000 21736000 37220000 1185 347 1153 3148;3149;3150;3151;3152;3153 2104;2105;2106;2107;2108 2106 5 YDDPEVQK Unmodified 992.44509 0.44509068 307 P38646;D6RJI2 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 0 By matching By MS/MS By matching By MS/MS 1 1 1 1 34.782 34.854 2 1.2488E-86 5210 YJC_D_20141124_01 137.14 84.349 3534100 94177 117310 166000 3156600 1186 307 1154 3154;3155;3156;3157 2109;2110 2110 2 YDDPEVQKDIK Unmodified 1348.6511 0.65106071 307 P38646;D6RJI2 HSPA9 Stress-70 protein, mitochondrial yes no 0 0 1 By matching By matching By MS/MS By MS/MS 1 2 41.102 41.251 2;3 1.1383E-21 6960 YJC_D_20141124_01 104.82 84.617 4445000 0 0 254940 4190100 1187 307 1155 3158;3159;3160 2111;2112;2113 2112 3 YDDYSSSR Unmodified 991.3883 0.38830408 306 P38159;P38159-2;Q96E39;B3KRG5;H3BUY5 RBMX;RBMXL1 RNA-binding motif protein, X chromosome;RNA-binding motif protein, X chromosome, N-terminally processed;RNA binding motif protein, X-linked-like-1 yes no 0 0 0 By matching By matching By matching By MS/MS 1 1 32.017 32.137 2 0.00024676 4581 YJC_D_20141124_01 83.647 75.307 556960 0 112970 0 443980 1188 306 1156 3161;3162 2114 2114 1 YDPSIGIYGLDFYVVLGR Unmodified 2046.0462 0.046228496 345 P62913;Q5VVC8;P62913-2 RPL11 60S ribosomal protein L11 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 93.024 93.021 2 0.01612 37074 YJC_A_20141124_01 49.395 37.665 2846100 2167900 437700 240470 0 1189 345 1157 3163;3164;3165 2115;2116 2115 2 YEELQITAGR Unmodified 1178.5932 0.5931519 73 CON__P04264;P04264 KRT1 Keratin, type II cytoskeletal 1 no no 0 0 0 By matching By MS/MS By MS/MS By matching 1 1 52.477 52.471 2 6.8109E-93 8231 YJC_C_20141124_01 134.75 103.26 1447600 0 922550 525040 0 + 1190 73 1158 3166;3167 2117;2118 2118 2 YFPTQALNFAFK Unmodified 1445.7343 0.73433683 189 P12236;I7HJJ0;P05141;P12235;Q9H0C2;V9GYG0 SLC25A6;SLC25A5;SLC25A4;SLC25A31 ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 1;ADP/ATP translocase 4 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 1 78.474 78.471 2 0.026898 23242 YJC_B_20141124_01 43.502 6.8183 2565200 1974700 398700 191770 0 1191 189 1159 3168;3169;3170 2119 2119 1 YGKIETIEVMEDR Unmodified 1581.7709 0.77085827 319 P51991;P51991-2 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 yes no 0 0 1 By matching By matching By matching By MS/MS 1 1 57.007 57.031 3 0.015585 11483 YJC_D_20141124_01 60.345 40.564 2233000 0 0 415950 1817100 1192 319 1160 3171;3172 2120 2120 1 YGTTPPQLDADSSYFLYSK Unmodified 2152.0001 6.61646E-05 65;64 CON__ENSEMBL:ENSBTAP00000024466;CON__ENSEMBL:ENSBTAP00000024462 no no 0 0 0 By matching By matching By MS/MS By MS/MS 2 2 70.14 70.214 2;3 4.7065E-84 15375 YJC_C_20141124_01 116.98 96.726 32418000 0 0 23428000 8990300 + 1193 65;64 1161 3173;3174;3175;3176 2121;2122 2121 2 YGVGWYQQVPGSGLR Unmodified 1665.8263 0.82633974 63 CON__ENSEMBL:ENSBTAP00000014147 yes yes 0 0 0 By matching By matching By MS/MS By MS/MS 1 1 66.437 66.511 2 0.00081708 16312 YJC_D_20141124_01 78.508 43.547 4288900 0 0 1473300 2815600 + 1194 63 1162 3177;3178 2123;2124 2124 2 YHEQLSTQSLIELFESFK Unmodified 2198.0895 0.089549874 354 Q00610;Q00610-2 CLTC Clathrin heavy chain 1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 91.948 91.944 3 0.0005039 36241 YJC_A_20141124_01 77.051 63.415 2558100 2142300 299490 116250 0 1195 354 1163 3179;3180;3181 2125 2125 1 YHTINGHNAEVR Unmodified 1409.68 0.68000985 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 0 By matching By matching By MS/MS By MS/MS 2 1 3 3 32.238 32.303 2;3;4 3.0718E-16 4573 YJC_D_20141124_01 99.669 83.291 30809000 337230 200190 5539100 24732000 1196 278 1164 3182;3183;3184;3185;3186;3187;3188;3189;3190 2126;2127;2128 2127 3 YHTINGHNAEVRK Unmodified 1537.775 0.77497287 278 P22626;P22626-2 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 yes no 0 0 1 By matching By matching By MS/MS By MS/MS 1 1 28.817 28.89 4 0.013668 3894 YJC_D_20141124_01 29.544 29.544 8263300 0 0 1331500 6931900 1197 278 1165 3191;3192 2129;2130 2130 2 YHTINGHNCEVKK Unmodified 1598.7624 0.76235927 319 P51991;P51991-2 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 yes no 0 0 1 By matching By matching By MS/MS By MS/MS 1 1 27.715 27.789 4 0.021979 3493 YJC_C_20141124_01 22.578 13.981 3907100 0 0 1106500 2800600 1198 319 1166 3193;3194 2131;2132 2131 2 YHTSQSGDEMTSLSEYVSR Oxidation (M) 2191.9328 0.93279124 250 P08238 HSP90AB1 Heat shock protein HSP 90-beta yes yes 0 1 0 By MS/MS By matching By matching By matching 1 1 1 1 52.12 52.142 3 6.8005E-13 9966 YJC_A_20141124_01 85.054 75.142 3897800 2674100 553160 223480 447050 1199 250 1167 3195;3196;3197;3198 2133 2133 27 1 YICDNQDTISSK Unmodified 1442.6348 0.63475872 72 CON__P02769 yes yes 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 40.298 40.412 2 0.0010208 6510 YJC_A_20141124_01 73.927 19.585 3525800 972120 747210 0 1806500 + 1200 72 1168 3199;3200;3201 2134;2135 2134 2 YICENQDSISSK Unmodified 1442.6348 0.63475872 71 P02768;CON__P02768-1;C9JKR2;H0YA55;D6RHD5;B7WNR0;P02768-2 ALB Serum albumin yes no 0 0 0 By matching By matching By MS/MS By matching 1 40.266 40.315 2 9.6541E-05 5568 YJC_C_20141124_01 78.964 23.924 395150 0 0 395150 0 + 1201 71 1169 3202 2136 2136 1 YINENLIVNTDELGR Unmodified 1761.8897 0.88972785 110 P17987;E7ERF2;F5H7Y1;F5H136 TCP1 T-complex protein 1 subunit alpha yes no 0 0 0 By MS/MS By matching By matching By matching 1 66.13 66.13 2 1.0809E-46 15620 YJC_A_20141124_01 109.67 78.054 928590 928590 0 0 0 1202 110 1170 3203 2137 2137 1 YIPIQYVLSR Unmodified 1250.7023 0.70230842 70 CON__P02668 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 73.459 73.459 2 0.017131 20913 YJC_A_20141124_01 51.762 26.42 495750 495750 0 0 0 + 1203 70 1171 3204 2138 2138 1 YISPDQLADLYK Unmodified 1424.7187 0.71874635 242 P06733;P06733-2 ENO1 Alpha-enolase yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 1 1 69.888 69.935 2 1.2588E-16 18078 YJC_A_20141124_01 99.834 73.423 11732000 8315000 2406300 486060 525130 1204 242 1172 3205;3206;3207;3208 2139;2140 2139 2 YLAEFATGNDR Unmodified 1255.5833 0.5833155 334 P62258;K7EM20;P62258-2 YWHAE 14-3-3 protein epsilon yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 53.61 53.68 2 1.6456E-123 10403 YJC_A_20141124_01 140.63 117.27 1966300 1604300 362000 0 0 1205 334 1173 3209;3210 2141 2141 1 YLAEVAAGDDKK Unmodified 1278.6456 0.6455814 114 P63104;E7EX29;B0AZS6;B7Z2E6;H0YB80;P63104-2 YWHAZ 14-3-3 protein zeta/delta yes no 0 0 1 By MS/MS By matching By matching By matching 1 39.301 39.301 3 0.010369 6238 YJC_A_20141124_01 53.6 23.208 511640 511640 0 0 0 1206 114 1174 3211 2142 2142 1 YLEVVLNTLQQASQAQVDK Unmodified 2146.127 0.12699801 376 Q14974;F5H4R7;J3KTM9;Q14974-2 KPNB1 Importin subunit beta-1 yes no 0 0 0 By MS/MS By matching By matching By matching 1 79.039 79.039 2 0.014747 25759 YJC_A_20141124_01 56.017 31.651 0 0 0 0 0 1207 376 1175 3212 2143 2143 1 YLGYLEQLLR Unmodified 1266.6972 0.69722304 69 CON__P02662 yes yes 0 0 0 By MS/MS By MS/MS By MS/MS By matching 1 1 1 82.155 82.184 2 0.00091046 24405 YJC_C_20141124_01 73.499 50.487 2464000 1674000 122470 667600 0 + 1208 69 1176 3213;3214;3215 2144;2145;2146 2146 3 YLTAEAFGFK Unmodified 1145.5757 0.57571092 190 Q16658;J3KNT0 FSCN1 Fascin yes no 0 0 0 By MS/MS By matching By matching By matching 1 69.111 69.111 2 0.011998 17396 YJC_A_20141124_01 61.78 29.459 671310 671310 0 0 0 1209 190 1177 3216 2147 2147 1 YLTVAAVFR Unmodified 1038.5862 0.58621603 245;350 P68371;P04350;P07437;Q5JP53;Q5ST81 TUBB4B;TUBB4A;TUBB Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta chain no no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 69.623 69.619 2 0.0018047 17757 YJC_A_20141124_01 83.647 46.887 13028000 10237000 2161500 629340 0 1210 350;245 1178 3217;3218;3219 2148 2148 1 YLYTLVITDK Unmodified 1227.6751 0.67509062 192 P63173;J3KT73;J3QL01 RPL38 60S ribosomal protein L38 yes no 0 0 0 By matching By MS/MS By matching By matching 1 1 68.027 68.048 2 8.3283E-07 16247 YJC_B_20141124_01 91.469 66.173 1790400 776760 1013700 0 0 1211 192 1179 3220;3221 2149 2149 1 YMACCLLYR Oxidation (M) 1264.5403 0.54027017 349;150 Q9BQE3;F5H5D3;A6NHL2;A6NHL2-2;P68363;P68366;A8MUB1 TUBA1C;TUBAL3;TUBA1B;TUBA4A Tubulin alpha-1C chain;Tubulin alpha chain-like 3;Tubulin alpha-1B chain;Tubulin alpha-4A chain no no 0 1 0 By MS/MS By matching By matching By matching 1 57.306 57.306 2 0.020354 11555 YJC_A_20141124_01 65.246 38.54 755550 755550 0 0 0 1212 150;349 1180 3222 2150 2150 11 1 YMTISGFQIEETIDR Unmodified 1801.8557 0.85565053 90 P08758;D6RBE9;D6RBL5 ANXA5 Annexin A5;Annexin yes no 0 0 0 By MS/MS By matching By matching By matching 1 74.757 74.757 2 0.02212 21860 YJC_A_20141124_01 43.592 32.731 982990 982990 0 0 0 1213 90 1181 3223 2151 2151 1 YQAVTATLEEK Unmodified 1251.6347 0.63468237 208 P40429;M0QYS1;Q6NVV1 RPL13A;RPL13AP3 60S ribosomal protein L13a;Putative 60S ribosomal protein L13a protein RPL13AP3 yes no 0 0 0 By MS/MS By MS/MS By matching By matching 1 1 48.985 49.005 2 0.010059 9074 YJC_A_20141124_01 48.568 29.602 722180 489930 232240 0 0 1214 208 1182 3224;3225 2152;2153 2152 2 YVASYLLAALGGNSSPSAK Unmodified 1867.968 0.96797818 238 P05387 RPLP2 60S acidic ribosomal protein P2 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 79.085 79.105 2 3.6294E-28 25863 YJC_A_20141124_01 95.429 54.997 1530200 1287700 242490 0 0 1215 238 1183 3226;3227 2154 2154 1 YVDIAIPCNNK Unmodified 1305.6387 0.63872189 50 P08865;C9J9K3;A6NE09 RPSA;RPSAP58 40S ribosomal protein SA yes no 0 0 0 By MS/MS By matching By matching By matching 1 55.584 55.584 2 0.022196 11031 YJC_A_20141124_01 43.897 24.765 272220 272220 0 0 0 1216 50 1184 3228 2155 2155 1 YVDSEGHLYTVPIR Unmodified 1647.8257 0.82567103 360 Q03135 CAV1 Caveolin-1 yes yes 0 0 0 By matching By MS/MS By matching By matching 1 55.38 55.521 2 0.0029424 11397 YJC_B_20141124_01 72.321 42.145 430490 0 430490 0 0 1217 360 1185 3229 2156;2157 2156 2 YVDSEGHLYTVPIREQGNIYKPNNK Unmodified 2933.4672 0.46717011 360 Q03135 CAV1 Caveolin-1 yes yes 0 0 2 By MS/MS By matching By matching By matching 1 1 53.298 53.369 4 0.0074006 10330 YJC_A_20141124_01 35.538 29.23 4297400 2639900 1657500 0 0 1218 360 1186 3230;3231 2158 2158 1 YVEPIEDVPCGNIVGLVGVDQFLVK Unmodified 2758.4252 0.42515387 265 P13639 EEF2 Elongation factor 2 yes yes 0 0 0 By MS/MS By matching By matching By matching 1 1 88.466 88.437 3 0.0004806 33279 YJC_A_20141124_01 48.224 37.224 2308800 1998300 310490 0 0 1219 265 1187 3232;3233 2159 2159 1 YVWAATAGGVFQSITPIEIDMIVGK Unmodified 2665.3826 0.38256077 45 P35080;P35080-2;C9JQ45;C9J2N0;G5E9Q6 PFN2 Profilin-2;Profilin yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 1 94.429 94.392 3 0.00052831 38166 YJC_A_20141124_01 48.077 33.118 18171000 11178000 3488700 3504100 0 1220 45 1188 3234;3235;3236 2160 2160 1 YWELIYEDSMDLIAK Unmodified 1887.8965 0.89645272 21 O75390;F8VRI6;F8VPA1;F8VR34;B4DJV2 CS Citrate synthase, mitochondrial;Citrate synthase yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 87.807 87.777 2 1.2675E-10 32838 YJC_A_20141124_01 89.911 73.729 677390 544830 132560 0 0 1221 21 1189 3237;3238 2161 2161 1 YYTSASGDEMVSLK Oxidation (M) 1565.6919 0.69193925 247 P07900;P07900-2;Q86U12 HSP90AA1 Heat shock protein HSP 90-alpha yes no 0 1 0 By MS/MS By matching By matching By matching 1 48.47 48.47 2 6.3839E-81 8923 YJC_A_20141124_01 122.52 98.006 0 0 0 0 0 1222 247 1190 3239 2162 2162 25 1 YYTSASGDEMVSLK Unmodified 1549.697 0.69702463 247 P07900;P07900-2;Q86U12 HSP90AA1 Heat shock protein HSP 90-alpha yes no 0 0 0 By MS/MS By matching By matching By matching 1 1 55.418 55.392 2 6.8697E-73 10949 YJC_A_20141124_01 108.97 96.912 1016700 927800 0 88939 0 1223 247 1190 3240;3241 2163 2163 0 YYVTIIDAPGHR Unmodified 1403.7197 0.7197494 348 P68104;Q5VTE0;Q5JR01;A6PW80 EEF1A1;EEF1A1P5 Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3 yes no 0 0 0 By MS/MS By MS/MS By MS/MS By matching 2 2 1 1 56.925 56.98 2;3 1.9022E-06 11436 YJC_A_20141124_01 84.605 69.617 12155000 9383100 1562200 725660 484370 1224 348 1191 3242;3243;3244;3245;3246;3247 2164;2165;2166 2164 3