N Unused Total %Cov %Cov(50) %Cov(95) Accessions Names Used Annotation Contrib Conf Sequence Modifications Cleavages dMass Prec MW Prec m/z Theor MW Theor m/z Theor z Sc Spectrum Specific Time PrecursorSignal PrecursorElution 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 FNGNTLDNDIMLIK Ammonia-loss(N)@2 cleaved N-F@N-term -0.0026315 1589.773315 795.8939 1589.776001 795.8952637 2 19 1.1.1.5636.20 1 61.1918 974.5894 61.1977 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.0662212 2661.445801 888.1559 2661.379639 888.1337891 3 21 1.1.1.6145.20 1 74.3209 2299.485 74.3268 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 GNTLDNDIMLIKLSSPATLNSR Met->Hcy(M)@9; reduced acrolein addition +58(K)@12 cleaved N-G@N-term; missed K-L@12 0.0518496 2416.314941 806.4456 2416.263184 806.4283447 3 20 1.1.1.6042.19 1 71.6235 3527.129 71.5259 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10 -0.00915421 2283.147705 762.0565 2283.156982 762.0595703 3 13 1.1.1.6024.19 1 71.15 1740.457 71.3934 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 IITHPNFNGNTLDNDIMLIKLSSPA acrolein addition +94(K)@20 cleaved A-T@C-term; missed K-L@20 0.134474993 2831.587158 944.8697 2831.452881 944.8248901 3 10 1.1.1.6075.21 0 72.499 1458.758 72.5832 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 IITHPNFNGNTLDNDIMLIKLSSPATLNSRV cleaved V-A@C-term; missed K-L@20; missed R-V@30 -9.940990448 3397.846191 850.4688 3407.787109 852.9540405 4 15 1.1.1.6075.20 1 72.4982 6094.064 72.5562 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00253331 1939.930298 970.9724 1939.927612 970.9710693 2 21 1.1.1.5561.20 1 59.3166 4729.45 59.3225 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 LGEHNIDVLEGNEQFINAAK -0.0058145 2210.091064 737.7043 2210.09668 737.7061768 3 17 1.1.1.5928.21 1 68.656 411.8845 68.5312 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 LINSQWVVSAAH cleaved S-L@N-term; cleaved H-C@C-term -0.00502622 1323.688477 662.8515 1323.693481 662.8540649 2 15 1.1.1.5471.18 0 57.0647 519.9542 56.9711 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 LSSPATLNSR 0.00135694 1044.557617 523.2861 1044.556396 523.2854614 2 12 1.1.1.5046.7 1 46.636 420.9825 46.5241 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 NFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@3; acrolein addition +38(K)@15 cleaved P-N@N-term; missed K-L@15 0.334809005 2786.725586 558.3524 2786.390869 558.2854614 5 10 1.1.1.6082.12 1 72.6768 676.2371 72.6617 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00415429 1773.88562 887.9501 1773.889771 887.9521484 2 20 1.1.1.5687.13 1 62.4787 312.5099 62.5106 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 NSGSHFCGGSLINSQWVVSAAH Carbamidomethyl(C)@7 cleaved L-N@N-term; cleaved H-C@C-term 4.979100227 2319.033936 774.0186 2314.054932 772.3588867 3 12 1.1.1.6140.20 1 74.1989 940.9338 74.204 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 SSGSSYPSLLQCLK Formyl@N-term; Deamidated(Q)@11; Carbamidomethyl(C)@12; acrolein addition +76(K)@14 0.0231757 1630.778076 816.3963 1630.754883 816.3847046 2 13 1.1.1.6054.21 1 71.9416 1149.422 71.9995 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 SSGSSYPSLLQCLKAPVLSN Carbamidomethyl(C)@12; HPNE addition +172(K)@14; HexNAc(S)@19 cleaved N-S@C-term; missed K-A@14 0.0124822 2482.263672 828.4285 2482.251221 828.4243774 3 14 1.1.1.6127.20 1 73.8716 6628.536 73.7986 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 SSYPGQITGN cleaved N-M@C-term -0.000599533 1022.466309 512.2404 1022.466919 512.2407227 2 17 1.1.1.4358.3 1 31.5486 2881.509 31.4765 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 TLDNDIMLIKLSSPATLN cleaved N-T@N-term; cleaved N-S@C-term; missed K-L@10 0.0058284 1958.045288 980.0299 1958.039429 980.0269775 2 15 1.1.1.5933.21 1 68.7861 575.3472 68.8431 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 TLDNDIMLIKLSSPATLNSR Formyl(K)@10 cleaved N-T@N-term; missed K-L@10 0.072528698 2229.23999 744.0873 2229.16748 744.0631104 3 27 1.1.1.6108.19 1 73.3711 6173.529 73.3518 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 VATVSLPR 0.00350222 841.5056763 421.7601 841.5021362 421.7583618 2 8 1.1.1.5756.2 1 64.2271 304.219 64.1716 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 VLEGNEQFINAAK cleaved D-V@N-term 0.00323453 1431.739014 716.8768 1431.73584 716.8751831 2 14 1.1.1.5018.7 0 45.9582 166.7555 45.9175 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 2 99.00000095 YVNWIQQTIAAN cleaved N-Y@N-term -0.00326253 1419.711426 710.863 1419.714722 710.864624 2 17 1.1.1.5508.18 1 57.9918 1519.025 57.9484 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 1.920817852 99.00000095 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00369622 1019.532471 510.7735 1019.528748 510.7716675 2 13 1.1.1.4977.5 0 45.0133 1452.112 44.8557 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 1.7212466 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00469747 1565.736816 783.8757 1565.732178 783.8733521 2 18 1.1.1.5164.13 1 49.5148 584.2394 49.5199 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 1.657577038 99.00000095 IITHPNFNGN cleaved N-T@C-term -0.00199257 1125.554688 563.7846 1125.556763 563.7856445 2 15 1.1.1.4541.2 1 35.0163 660.6013 34.9497 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 1.387216091 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00149736 1387.674683 694.8446 1387.673218 694.8438721 2 18 1.1.1.4895.3 1 43.0888 890.4931 43.1177 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 1.050610065 99.00000095 LGEHNIDVLEGN cleaved N-E@C-term 0.00190875 1308.632935 655.3237 1308.630981 655.3227539 2 12 1.1.1.5217.19 1 50.8037 308.065 50.736 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.935542047 99.00000095 INSQWVVSAAH cleaved L-I@N-term; cleaved H-C@C-term 0.00173683 1210.611328 606.3129 1210.609497 606.3120117 2 10 1.1.1.5160.10 0 49.4111 182.5824 49.4195 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.931814194 99.00000095 SIPYQVSLNSG cleaved N-S@N-term; cleaved G-S@C-term 0.000747849 1163.58313 582.7988 1163.582275 582.7984009 2 15 1.1.1.4903.4 1 43.2577 776.7969 43.267 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.829738259 98.36999774 SSPATLNSR cleaved L-S@N-term -0.000130323 931.47229 466.7434 931.47229 466.7434387 2 11 1.1.1.3525.2 1 23.2737 273.5639 23.322 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.793174088 98.94999862 IDVLEGNEQFINAAK cleaved N-I@N-term 0.00272198 1659.849731 830.9321 1659.846802 830.9306641 2 15 1.1.1.5476.16 1 57.1905 150.2512 57.2497 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.548213601 97.43000269 IITHPNFN cleaved N-G@C-term 0.00410684 954.49646 478.2555 954.4923096 478.2534485 2 10 1.1.1.4504.2 1 34.3475 238.2613 34.3846 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.533132434 98.00000191 GNTLDNDIMLIK cleaved N-G@N-term -0.00330022 1345.687866 673.8512 1345.691162 673.8528442 2 14 1.1.1.5679.15 1 62.2729 629.3353 62.3848 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.401209474 98.97000194 SPATLNSR cleaved S-S@N-term 0.000815987 844.4411011 423.2278 844.4403076 423.227417 2 10 1.1.1.3404.2 1 22.4324 143.2809 22.4506 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.352617025 95.0600028 LGEHNIDVLEGNEQF cleaved F-I@C-term -0.00230237 1712.798218 857.4064 1712.800537 857.4075928 2 12 1.1.1.5542.15 1 58.841 398.9043 58.9995 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.139661998 95.96999884 TLDNDIMLIKL Oxidation(M)@7 cleaved N-T@N-term; cleaved L-S@C-term; missed K-L@10 0.000510719 1303.706299 652.8604 1303.705688 652.8601685 2 8 1.1.1.5904.18 0 68.0282 272.2945 68.0357 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.094204113 97.10999727 LGEHNIDVLEGNEQFINAAKII Deamidated(N)@17 cleaved I-T@C-term; missed K-I@20 0.0308886 2437.279785 813.4339 2437.249023 813.423584 3 11 1.1.1.5838.18 0 66.323 937.5542 66.1338 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.057495892 98.51999879 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAH Carbamidomethyl(C)@6; Carbamidomethyl(C)@24; Oxidation(W)@33 cleaved I-V@N-term; cleaved H-C@C-term 0.0221307 4110.918945 1028.737 4110.89502 1028.731079 4 10 1.1.1.6003.21 1 70.6035 247.8034 70.5835 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.045275208 43.00000072 SQWVVSAAH cleaved N-S@N-term; cleaved H-C@C-term 0.00429066 983.4868774 492.7507 983.4824829 492.7485046 2 8 1.1.1.4540.5 0 34.9924 169.5959 34.9975 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.044793461 48.98000062 IVGGYTCAAN Carbamidomethyl(C)@7 cleaved N-S@C-term -0.00199602 1024.462646 513.2386 1024.464722 513.2396851 2 11 1.1.1.4200.2 1 29.0615 362.3924 29.13 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.037630662 81.62000179 SIPYQVSLNS cleaved N-S@N-term; cleaved S-G@C-term 0.00394126 1106.564697 554.2896 1106.560791 554.2876587 2 9 1.1.1.4906.3 1 43.328 413.6489 43.3149 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.034798298 99.00000095 VNWIQQTIAAN Oxidation(W)@3 cleaved Y-V@N-term 0.005596 1272.651855 637.3332 1272.64624 637.3303833 2 13 1.1.1.4957.4 1 44.5337 190.9136 44.5189 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.025949096 30.80999851 LSSPATLN cleaved N-S@C-term 0.00274661 801.4260864 401.7203 801.4232178 401.7189026 2 10 1.1.1.4381.2 1 31.9961 2926.65 31.7855 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.021819482 94.41000223 AAHCYKSRIQVRLGEHNIDVLEGNEQFINAAK reduced HNE(H)@3; Carbamidomethyl(C)@4; acrolein addition +38(K)@6; reduced HNE(H)@16 cleaved S-A@N-term; missed K-S@6; missed R-I@8; missed R-L@12 0.0480626 4034.190918 1009.555 4034.141113 1009.542542 4 9 1.1.1.5824.21 1 65.983 460.4823 65.9881 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.013228266 95.95000148 NSRVATVSLPR Carbamidomethyl@N-term cleaved L-N@N-term; missed R-V@3 0.0159602 1255.715698 628.8651 1255.699707 628.8571167 2 8 1.1.1.5088.10 1 47.6454 95.2609 47.6307 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.010550182 72.26999998 LGEHNIDVL cleaved L-E@C-term -0.0104585 1008.513489 505.264 1008.523987 505.2692871 2 7 1.1.1.5500.7 1 57.7803 1070.647 57.8721 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.009661146 98.25000167 LGEHNIDVLEGNEQFINAAKIIT Deamidated(N)@17 cleaved T-H@C-term; missed K-I@20 -0.0271693 2538.269531 847.0971 2538.296631 847.1061401 3 11 1.1.1.5821.18 1 65.9059 417.5835 65.8146 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.006563769 98.94000292 NAAKIITHPNFNGNTLDNDIMLIK Deamidated(N)@1; Deamidated(N)@10; Oxidation(M)@21 cleaved I-N@N-term; missed K-I@4 -0.00516658 2684.342773 895.7882 2684.3479 895.789917 3 13 1.1.1.5982.21 1 70.0611 363.8937 70.0406 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.003926345 67.39000082 IQQTIAAN cleaved W-I@N-term 0.00248282 857.4632568 429.7389 857.4606934 429.7376099 2 9 1.1.1.3910.2 1 26.2148 1004.84 26.2958 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.003926345 61.21000051 IQVR 0.0102539 514.3330078 515.3403 514.3227539 515.3300171 1 5 1.1.1.4405.5 0 32.449 111.6838 32.454 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.003488328 34.95999873 EQFINAAK cleaved N-E@N-term 0.000738392 919.4770508 460.7458 919.4763184 460.7454529 2 7 1.1.1.4275.2 0 30.048 281.1479 29.9536 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.003488328 98.8499999 TLDNDIMLIK Delta:H(4)C(2)(K)@10 cleaved N-T@N-term 0.000558809 1202.658691 602.3366 1202.658081 602.3363037 2 10 1.1.1.5743.17 0 63.9066 538.3254 63.6851 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.001304842 46.90000117 LNSRVATVSLPR cleaved T-L@N-term; missed R-V@4 -0.021376301 1311.740845 656.8777 1311.762329 656.8884277 2 9 1.1.1.4887.3 1 42.8929 491.5992 42.88 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.001304842 86.15000248 RLGEHNIDVLEGNEQFINAAK cleaved V-R@N-term; missed R-L@1 -1.002349973 2365.195313 1183.605 2366.197754 1184.106201 2 12 1.1.1.5546.17 1 58.9452 532.1458 58.9502 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.000869459 22.59999961 CAAAGTECLISGWGNTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@8 cleaved S-C@N-term -0.0150493 1794.787842 898.4012 1794.802856 898.4087524 2 6 1.1.1.5572.20 1 59.5927 154.2263 59.524 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.000869459 92.25999713 GYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAH Dehydrated(T)@3; Carbamidomethyl(C)@4; reduced HNE(H)@20; Carbamidomethyl(C)@22 cleaved G-G@N-term; cleaved H-C@C-term -0.025815999 4078.902832 1020.733 4078.930664 1020.739929 4 11 1.1.1.6019.21 1 71.0207 1285.176 71.0258 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.000869459 73.89000058 IITHPNFNGNTLDNDIMLIKLS reduced acrolein addition +96(K)@20 cleaved S-S@C-term; missed K-L@20 -0.045772102 2578.301025 860.4409 2578.346436 860.4561157 3 9 1.1.1.5995.21 1 70.3979 695.0863 70.3513 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.000869459 72.85000086 NKPGVYTK Delta:H(4)C(2)@N-term 0.000732649 933.5290527 467.7718 933.5283813 467.7714539 2 10 1.1.1.3291.2 0 21.4404 247.2113 21.4753 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0.000434512 87.86000013 QVSLNSGSH cleaved Y-Q@N-term; cleaved H-F@C-term 0.000148212 927.4411011 464.7278 927.440979 464.7277832 2 10 1.1.1.3622.3 0 23.9337 1338.251 24.0093 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.3599987 AKIITHPNFNGNTLDNDIMLIK Carbamyl@N-term; acrolein addition +38(K)@2; Oxidation(M)@19 cleaved A-A@N-term; missed K-I@2 -0.02062 2578.301025 860.4409 2578.321289 860.4477539 3 9 1.1.1.5988.20 1 70.2157 695.0863 70.3513 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 APVLSNSSCK Deamidated(N)@6; No Carbamidomethyl(C)@9; acrolein addition +76(K)@10 -0.018659299 1081.49292 541.7537 1081.511353 541.7630005 2 11 1.1.1.3981.3 1 26.9727 140.4082 26.9778 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 58.49999785 APVLSNSSCKSSYPGQITGN Deamidated(N)@6; Carbamidomethyl(C)@9; reduced acrolein addition +58(K)@10; HexNAc(S)@12 cleaved N-M@C-term; missed K-S@10 -0.00346945 2328.075684 777.0325 2328.079102 777.0336304 3 9 1.1.1.5696.18 1 62.7082 307.794 62.741 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK Ammonia-loss(N)@2 cleaved N-F@N-term -0.0026315 1589.773315 795.8939 1589.776001 795.8952637 2 19 1.1.1.5629.18 1 61.0169 964.806 61.1977 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK Ammonia-loss(N)@2 cleaved N-F@N-term -0.0026315 1589.773315 795.8939 1589.776001 795.8952637 2 20 1.1.1.5643.19 1 61.365 974.5894 61.1977 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK Oxidation(M)@11 cleaved N-F@N-term 1.08E-06 1622.797485 812.406 1622.797363 812.4060059 2 23 1.1.1.5658.20 1 61.7447 6500.396 61.8515 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK Oxidation(M)@11 cleaved N-F@N-term 1.08E-06 1622.797485 812.406 1622.797363 812.4060059 2 24 1.1.1.5665.20 1 61.9209 6500.396 61.8515 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK Oxidation(M)@11 cleaved N-F@N-term 1.08E-06 1622.797485 812.406 1622.797363 812.4060059 2 22 1.1.1.5672.12 1 62.0955 6608.859 61.8515 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK Oxidation(M)@11 cleaved N-F@N-term 1.08E-06 1622.797485 812.406 1622.797363 812.4060059 2 20 1.1.1.5679.16 1 62.2746 4194.263 62.0024 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK Deamidated(N)@2 cleaved N-F@N-term 0.00117176 1607.78772 804.9011 1607.786499 804.9005127 2 22 1.1.1.5753.17 1 64.1632 2120.69 64.1457 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK cleaved N-F@N-term 0.00306081 1606.80542 804.41 1606.80249 804.4085083 2 23 1.1.1.5774.19 1 64.7029 9854.146 64.9399 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK cleaved N-F@N-term 0.00318288 1606.805664 804.4101 1606.80249 804.4085083 2 24 1.1.1.5781.20 1 64.8825 9970.448 64.9399 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK cleaved N-F@N-term 0.00318288 1606.805664 804.4101 1606.80249 804.4085083 2 19 1.1.1.5788.17 1 65.0601 9970.448 64.9399 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK Deamidated(N)@2 cleaved N-F@N-term 0.00117176 1607.78772 804.9011 1607.786499 804.9005127 2 14 1.1.1.5746.17 1 63.9835 2120.69 64.1457 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK Deamidated(N)@2 cleaved N-F@N-term 0.00117176 1607.78772 804.9011 1607.786499 804.9005127 2 15 1.1.1.5760.17 1 64.3419 2120.69 64.1457 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK cleaved N-F@N-term -0.00287011 1606.799683 536.6072 1606.80249 536.6080933 3 12 1.1.1.5786.9 1 65.0022 986.3772 64.914 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK cleaved N-F@N-term 0.00318288 1606.805664 804.4101 1606.80249 804.4085083 2 12 1.1.1.5795.16 1 65.2402 8245.42 64.9655 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK Methyl(K)@14 cleaved N-F@N-term -0.000381276 1620.817627 811.4161 1620.818115 811.4163208 2 16 1.1.1.5802.19 1 65.4235 982.868 65.4044 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK cleaved N-F@N-term 0.00257256 1606.805054 804.4098 1606.80249 804.4085083 2 12 1.1.1.5767.18 1 64.5222 3917.801 64.7602 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK cleaved N-F@N-term -0.00287011 1606.799683 536.6072 1606.80249 536.6080933 3 9 1.1.1.5786.8 1 65.0014 986.3772 64.914 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 FNGNTLDNDIMLIK Dethiomethyl(M)@11; acrolein addition +76(K)@14 cleaved N-F@N-term -0.00179708 1634.828613 818.4216 1634.830444 818.4224854 2 11 1.1.1.5811.20 1 65.6561 227.4246 65.662 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.39000106 FNGNTLDNDIMLIK Methyl(K)@14 cleaved N-F@N-term -0.000381276 1620.817627 811.4161 1620.818115 811.4163208 2 11 1.1.1.5795.17 1 65.241 982.868 65.4044 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.39000106 FNGNTLDNDIMLIK cleaved N-F@N-term 0.000375405 1606.802856 804.4087 1606.80249 804.4085083 2 9 1.1.1.5802.18 1 65.4227 1436.748 65.1459 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.39000106 FNGNTLDNDIMLIK Ammonia-loss(N)@4 cleaved N-F@N-term 0.000833271 1589.776855 795.8957 1589.776001 795.8952637 2 11 1.1.1.5849.17 1 66.6038 246.9333 66.6379 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.39000201 FNGNTLDNDIMLIK Deamidated(N)@2; Oxidation(M)@11 cleaved N-F@N-term -0.00187899 1623.779419 812.897 1623.781372 812.8980103 2 16 1.1.1.5637.17 1 61.214 1151.562 61.1977 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.39000201 FNGNTLDNDIMLIK Deamidated(N)@2; Oxidation(M)@11 cleaved N-F@N-term -0.00187899 1623.779419 812.897 1623.781372 812.8980103 2 17 1.1.1.5644.18 1 61.3901 1151.562 61.1977 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.39000201 FNGNTLDNDIMLIK Oxidation(M)@11 cleaved N-F@N-term -0.000243054 1622.797241 812.4059 1622.797363 812.4060059 2 16 1.1.1.5651.20 1 61.5666 5196.646 61.776 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 FNGNTLDNDIMLIK Deamidated(N)@2; Oxidation(M)@11 cleaved N-F@N-term -0.00187899 1623.779419 812.897 1623.781372 812.8980103 2 15 1.1.1.5630.17 1 61.0411 1151.562 61.1977 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 FNGNTLDNDIMLIK Ammonia-loss(N)@2 cleaved N-F@N-term -0.00177704 1589.774048 795.8943 1589.776001 795.8952637 2 12 1.1.1.5657.19 1 61.7181 466.2021 61.4468 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 FNGNTLDNDIMLIK Ammonia-loss(N)@2 cleaved N-F@N-term -0.0026315 1589.773315 795.8939 1589.776001 795.8952637 2 12 1.1.1.5664.19 1 61.8955 282.5331 61.6231 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 FNGNTLDNDIMLIK Oxidation(M)@11 cleaved N-F@N-term -0.000243054 1622.797241 812.4059 1622.797363 812.4060059 2 13 1.1.1.5686.12 1 62.4484 1314.009 62.1809 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 92.08999872 FNGNTLDNDIMLIK Ammonia-loss(N)@2 cleaved N-F@N-term -0.00214324 1589.773926 795.8942 1589.776001 795.8952637 2 12 1.1.1.5650.17 1 61.5389 752.4062 61.2971 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 84.85999703 FNGNTLDNDIMLIK Deamidated(N)@2; Oxidation(M)@11 cleaved N-F@N-term -0.00126867 1623.780029 812.8973 1623.781372 812.8980103 2 10 1.1.1.5623.17 1 60.8673 878.8166 61.0742 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 FNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@11 cleaved N-F@N-term 7.40E-05 1623.781494 812.898 1623.781372 812.8980103 2 11 1.1.1.5498.14 1 57.7372 126.6263 57.7226 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.39000201 GNTLDNDIMLIK cleaved N-G@N-term -0.00330022 1345.687866 673.8512 1345.691162 673.8528442 2 15 1.1.1.5686.8 1 62.4443 629.3353 62.3848 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 GNTLDNDIMLIK Oxidation(M)@9 cleaved N-G@N-term -0.00387752 1361.682251 681.8484 1361.686035 681.8502808 2 10 1.1.1.5505.18 1 57.9154 549.6008 57.8469 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 GNTLDNDIMLIK cleaved N-G@N-term -0.00330022 1345.687866 673.8512 1345.691162 673.8528442 2 9 1.1.1.5693.15 1 62.6284 648.1248 62.3593 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 GNTLDNDIMLIK Oxidation(M)@9 cleaved N-G@N-term -0.00692915 1361.679321 681.8469 1361.686035 681.8502808 2 9 1.1.1.5517.18 1 58.2177 287.2984 58.2253 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 GNTLDNDIMLIKLSSPATLNSR Met->Hcy(M)@9; reduced acrolein addition +58(K)@12 cleaved N-G@N-term; missed K-L@12 -0.000593909 2416.262939 806.4282 2416.263184 806.4283447 3 17 1.1.1.6035.20 1 71.4401 3533.974 71.5259 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.63000202 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Dethiomethyl(M)@9; acrolein addition +76(K)@12 cleaved N-G@N-term; missed K-L@12 -0.000922227 2401.248047 801.4233 2401.249023 801.423584 3 10 1.1.1.6033.20 1 71.3875 1105.161 71.235 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 91.61999822 GYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAH Dehydrated(T)@3; Carbamidomethyl(C)@4; reduced HNE(H)@20; Carbamidomethyl(C)@22 cleaved G-G@N-term; cleaved H-C@C-term -0.025815999 4078.902832 1020.733 4078.930664 1020.739929 4 10 1.1.1.6012.21 1 70.8371 1275.632 71.0258 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.51999879 IDVLEGNEQFINAAK cleaved N-I@N-term -0.00325921 1659.843628 830.9291 1659.846802 830.9306641 2 15 1.1.1.5483.21 1 57.3716 294.5388 57.4018 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 IDVLEGNEQFINAAK cleaved N-I@N-term -0.00484605 1659.842041 830.9283 1659.846802 830.9306641 2 11 1.1.1.5490.19 1 57.5432 298.5179 57.5009 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 92.08999872 IDVLEGNEQFINAAK cleaved N-I@N-term -0.00423573 1659.842651 830.9286 1659.846802 830.9306641 2 12 1.1.1.5498.15 1 57.7388 198.944 57.7226 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 IITHPNFN cleaved N-G@C-term -0.00291191 954.489502 478.252 954.4923096 478.2534485 2 5 1.1.1.4631.9 1 37.1284 112.2176 37.112 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 IITHPNFN cleaved N-G@C-term -0.00211849 954.4902954 478.2524 954.4923096 478.2534485 2 6 1.1.1.5041.6 1 46.5157 130.9651 46.4998 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 IITHPNFN cleaved N-G@C-term 7.87E-05 954.4924927 478.2535 954.4923096 478.2534485 2 5 1.1.1.4944.5 1 44.218 110.7958 44.2057 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 IITHPNFN cleaved N-G@C-term -0.00187436 954.4904785 478.2525 954.4923096 478.2534485 2 7 1.1.1.5027.3 1 46.1729 139.1717 46.2081 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term -0.00199257 1125.554688 563.7846 1125.556763 563.7856445 2 15 1.1.1.4461.2 1 33.5909 1998.559 33.5241 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term -0.000161599 1125.556519 563.7855 1125.556763 563.7856445 2 15 1.1.1.4592.2 1 36.2154 564.7809 36.1725 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.00423273 1125.560913 563.7877 1125.556763 563.7856445 2 14 1.1.1.4851.4 1 42.0949 833.0449 42.0282 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.00459893 1125.561279 563.7879 1125.556763 563.7856445 2 14 1.1.1.4926.3 1 43.8144 664.4836 43.7958 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.00655196 1125.563232 563.7889 1125.556763 563.7856445 2 14 1.1.1.5005.3 1 45.6485 649.8926 45.6298 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.00362241 1125.560303 563.7874 1125.556763 563.7856445 2 11 1.1.1.5047.10 1 46.6638 539.1498 46.5241 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.00362241 1125.560303 563.7874 1125.556763 563.7856445 2 14 1.1.1.5072.2 1 47.2487 503.4309 47.3135 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term -0.00174844 1125.554932 563.7847 1125.556763 563.7856445 2 14 1.1.1.4453.2 1 33.4176 2003.05 33.5241 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.000814919 1125.557495 563.786 1125.556763 563.7856445 2 14 1.1.1.4472.2 1 33.78 306.4954 33.8957 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term -0.00162638 1125.555054 563.7848 1125.556763 563.7856445 2 14 1.1.1.4502.4 1 34.3086 616.3392 34.2901 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.000814919 1125.557495 563.786 1125.556763 563.7856445 2 14 1.1.1.4524.3 1 34.6658 682.4402 34.6709 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.000570789 1125.557251 563.7859 1125.556763 563.7856445 2 14 1.1.1.4533.3 1 34.8436 660.5031 34.8781 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term -0.00174844 1125.554932 563.7847 1125.556763 563.7856445 2 14 1.1.1.4548.4 1 35.1835 675.6114 35.093 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.000204595 1125.556885 563.7857 1125.556763 563.7856445 2 14 1.1.1.4585.3 1 36.0475 540.6628 36.0286 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.000204595 1125.556885 563.7857 1125.556763 563.7856445 2 14 1.1.1.4828.4 1 41.5605 670.0429 41.5697 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.00105905 1125.557617 563.7861 1125.556763 563.7856445 2 14 1.1.1.4859.3 1 42.2847 900.3074 42.2897 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term -3.95E-05 1125.556641 563.7856 1125.556763 563.7856445 2 14 1.1.1.5054.3 1 46.8265 366.3589 46.7662 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN Deamidated(N)@8 cleaved N-T@C-term 0.00955201 1126.550293 564.2824 1126.540771 564.2776489 2 14 1.1.1.5121.4 1 48.4619 323.1732 48.2956 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN Deamidated(N)@8 cleaved N-T@C-term 0.0036929 1126.544434 564.2795 1126.540771 564.2776489 2 14 1.1.1.4673.3 1 38.1023 441.1169 38.06 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.00203557 1125.558716 563.7866 1125.556763 563.7856445 2 12 1.1.1.4705.5 1 38.8331 370.4192 38.8382 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term -0.00162638 1125.555054 563.7848 1125.556763 563.7856445 2 12 1.1.1.4964.5 1 44.6963 684.1747 44.6872 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.000448725 1125.557129 563.7858 1125.556763 563.7856445 2 13 1.1.1.4483.4 1 33.9487 450.8282 33.9702 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term -0.0022367 1125.554443 563.7845 1125.556763 563.7856445 2 13 1.1.1.4494.3 1 34.1374 587.7056 34.19 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term -0.00284702 1125.553833 563.7842 1125.556763 563.7856445 2 13 1.1.1.4578.2 1 35.8791 657.1105 35.8364 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.00105905 1125.557617 563.7861 1125.556763 563.7856445 2 13 1.1.1.4614.5 1 36.724 530.6832 36.6572 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term -0.00235876 1125.554321 563.7844 1125.556763 563.7856445 2 12 1.1.1.4636.5 1 37.2477 485.7044 37.2802 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.00118111 1125.557861 563.7862 1125.556763 563.7856445 2 13 1.1.1.4820.3 1 41.3745 583.0181 41.3796 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.00154731 1125.558228 563.7864 1125.556763 563.7856445 2 13 1.1.1.4875.4 1 42.6301 781.6371 42.5874 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term -0.00235876 1125.554321 563.7844 1125.556763 563.7856445 2 13 1.1.1.4885.3 1 42.8452 912.7708 42.7842 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN Deamidated(N)@8 cleaved N-T@C-term 0.00552388 1126.546265 564.2804 1126.540771 564.2776489 2 13 1.1.1.4970.3 1 44.8506 557.9431 44.8557 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.0039886 1125.560669 563.7876 1125.556763 563.7856445 2 14 1.1.1.4950.4 1 44.3693 661.2581 44.3262 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGN cleaved N-T@C-term 0.00325621 1125.559814 563.7872 1125.556763 563.7856445 2 13 1.1.1.5033.8 1 46.3244 541.5881 46.1595 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.54999781 IITHPNFNGN cleaved N-T@C-term 0.000448725 1125.557129 563.7858 1125.556763 563.7856445 2 12 1.1.1.4563.5 1 35.5218 609.6632 35.5746 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.54999781 IITHPNFNGN cleaved N-T@C-term 0.000814919 1125.557495 563.786 1125.556763 563.7856445 2 12 1.1.1.4643.3 1 37.4139 525.1732 37.4248 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.54999781 IITHPNFNGN cleaved N-T@C-term 0.00118111 1125.557861 563.7862 1125.556763 563.7856445 2 12 1.1.1.4689.3 1 38.4605 470.0604 38.4497 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.54999781 IITHPNFNGN cleaved N-T@C-term 0.00118111 1125.557861 563.7862 1125.556763 563.7856445 2 12 1.1.1.4867.5 1 42.4539 788.196 42.4623 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 IITHPNFNGN cleaved N-T@C-term -0.00284702 1125.553833 563.7842 1125.556763 563.7856445 2 12 1.1.1.4599.4 1 36.3834 513.5211 36.3645 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 IITHPNFNGN cleaved N-T@C-term -0.00235876 1125.554321 563.7844 1125.556763 563.7856445 2 12 1.1.1.4621.2 1 36.8912 501.2025 36.8724 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 IITHPNFNGN cleaved N-T@C-term 0.000814919 1125.557495 563.786 1125.556763 563.7856445 2 11 1.1.1.4681.3 1 38.2654 526.5113 38.2324 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 IITHPNFNGN cleaved N-T@C-term -3.95E-05 1125.556641 563.7856 1125.556763 563.7856445 2 12 1.1.1.4696.3 1 38.6296 476.6404 38.5465 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 IITHPNFNGN cleaved N-T@C-term 0.000570789 1125.557251 563.7859 1125.556763 563.7856445 2 11 1.1.1.4748.3 1 39.7952 486.6771 39.8476 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 IITHPNFNGN cleaved N-T@C-term -0.00199257 1125.554688 563.7846 1125.556763 563.7856445 2 12 1.1.1.4793.3 1 40.764 609.2527 40.7988 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 IITHPNFNGN cleaved N-T@C-term -0.000405729 1125.556274 563.7854 1125.556763 563.7856445 2 12 1.1.1.4812.6 1 41.2028 594.2335 41.1603 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 IITHPNFNGN cleaved N-T@C-term 0.000814919 1125.557495 563.786 1125.556763 563.7856445 2 12 1.1.1.4892.3 1 43.0176 696.8748 42.9752 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 IITHPNFNGN cleaved N-T@C-term 0.00179144 1125.558472 563.7865 1125.556763 563.7856445 2 12 1.1.1.4900.5 1 43.1866 780.6345 43.195 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 IITHPNFNGN cleaved N-T@C-term 0.00154731 1125.558228 563.7864 1125.556763 563.7856445 2 12 1.1.1.4996.3 1 45.4532 563.4133 45.5058 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 IITHPNFNGN Deamidated(N)@8 cleaved N-T@C-term 0.00918582 1126.549927 564.2822 1126.540771 564.2776489 2 9 1.1.1.5160.8 1 49.4078 238.272 49.3192 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 IITHPNFNGN cleaved N-T@C-term 0.000570789 1125.557251 563.7859 1125.556763 563.7856445 2 11 1.1.1.4657.4 1 37.7528 499.3514 37.7863 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 IITHPNFNGN cleaved N-T@C-term 0.00240176 1125.559082 563.7868 1125.556763 563.7856445 2 11 1.1.1.4764.4 1 40.1557 626.0223 40.1134 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 IITHPNFNGN Deamidated(N)@8 cleaved N-T@C-term 0.00979614 1126.550415 564.2825 1126.540771 564.2776489 2 12 1.1.1.4960.3 1 44.6014 581.0325 44.6389 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 IITHPNFNGN cleaved N-T@C-term 0.000204595 1125.556885 563.7857 1125.556763 563.7856445 2 11 1.1.1.5064.2 1 47.0618 366.3541 47.099 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 96.39000297 IITHPNFNGN cleaved N-T@C-term 0.000814919 1125.557495 563.786 1125.556763 563.7856445 2 11 1.1.1.4650.4 1 37.5841 520.2827 37.5211 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 96.39000297 IITHPNFNGN cleaved N-T@C-term 0.00105905 1125.557617 563.7861 1125.556763 563.7856445 2 11 1.1.1.4803.4 1 41.0074 595.7574 41.0125 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 96.39000297 IITHPNFNGN Deamidated(N)@8 cleaved N-T@C-term 0.00979614 1126.550415 564.2825 1126.540771 564.2776489 2 8 1.1.1.5153.11 1 49.2357 278.1544 49.1443 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.46999931 IITHPNFNGN Deamidated(N)@8 cleaved N-T@C-term 0.00991821 1126.550659 564.2826 1126.540771 564.2776489 2 11 1.1.1.4704.3 1 38.8036 379.317 38.8382 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 IITHPNFNGN cleaved N-T@C-term 0.00423273 1125.560913 563.7877 1125.556763 563.7856445 2 13 1.1.1.4730.6 1 39.4061 562.6588 39.4821 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 IITHPNFNGN cleaved N-T@C-term -0.00199257 1125.554688 563.7846 1125.556763 563.7856445 2 10 1.1.1.4628.5 1 37.059 505.507 36.9202 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 85.31000018 IITHPNFNGN cleaved N-T@C-term 0.00423273 1125.560913 563.7877 1125.556763 563.7856445 2 13 1.1.1.4844.4 1 41.9275 851.0742 41.9087 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 83.39999914 IITHPNFNGN cleaved N-T@C-term -3.95E-05 1125.556641 563.7856 1125.556763 563.7856445 2 10 1.1.1.4776.3 1 40.4034 584.8975 40.4321 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 IITHPNFNGN cleaved N-T@C-term 0.000448725 1125.557129 563.7858 1125.556763 563.7856445 2 10 1.1.1.4513.5 1 34.4959 769.7736 34.5959 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 IITHPNFNGN cleaved N-T@C-term -3.95E-05 1125.556641 563.7856 1125.556763 563.7856445 2 10 1.1.1.4713.5 1 39.0227 485.3499 39.0751 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 IITHPNFNGN Deamidated(N)@8 cleaved N-T@C-term 0.005768 1126.546509 564.2805 1126.540771 564.2776489 2 7 1.1.1.5145.15 1 49.0348 309.5924 49.0201 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 74.07000065 IITHPNFNGN cleaved N-T@C-term 0.00337828 1125.560059 563.7873 1125.556763 563.7856445 2 13 1.1.1.4664.3 1 37.9169 530.9469 37.9304 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 74.07000065 IITHPNFNGN cleaved N-T@C-term 0.00704022 1125.563721 563.7891 1125.556763 563.7856445 2 13 1.1.1.4784.2 1 40.593 626.6849 40.527 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 IITHPNFNGN cleaved N-T@C-term 0.00362241 1125.560303 563.7874 1125.556763 563.7856445 2 12 1.1.1.5040.7 1 46.4897 539.3793 46.4755 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 IITHPNFNGN cleaved N-T@C-term 0.00459893 1125.561279 563.7879 1125.556763 563.7856445 2 9 1.1.1.5202.11 1 50.4314 215.5816 50.5378 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 IITHPNFNGN Deamidated(N)@8 cleaved N-T@C-term 0.00711072 1126.547852 564.2812 1126.540771 564.2776489 2 8 1.1.1.5113.10 1 48.2641 360.2277 48.2461 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 IITHPNFNGN cleaved N-T@C-term 0.000448725 1125.557129 563.7858 1125.556763 563.7856445 2 7 1.1.1.5131.12 1 48.6985 396.3792 48.7053 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 IITHPNFNGN cleaved N-T@C-term 0.00276795 1125.559448 563.787 1125.556763 563.7856445 2 12 1.1.1.4555.4 1 35.3502 733.1995 35.2604 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 IITHPNFNGN cleaved N-T@C-term 0.0039886 1125.560669 563.7876 1125.556763 563.7856445 2 12 1.1.1.4570.3 1 35.6828 610.8448 35.6937 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 IITHPNFNGN cleaved N-T@C-term 0.00423273 1125.560913 563.7877 1125.556763 563.7856445 2 12 1.1.1.4739.5 1 39.6189 562.6588 39.4821 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 IITHPNFNGN cleaved N-T@C-term 0.00423273 1125.560913 563.7877 1125.556763 563.7856445 2 12 1.1.1.4836.5 1 41.7519 693.2843 41.7603 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 IITHPNFNGN cleaved N-T@C-term 0.00362241 1125.560303 563.7874 1125.556763 563.7856445 2 12 1.1.1.4914.5 1 43.5226 404.5462 43.507 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 IITHPNFNGN cleaved N-T@C-term 0.00337828 1125.560059 563.7873 1125.556763 563.7856445 2 12 1.1.1.4936.3 1 44.033 835.2819 44.1576 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 IITHPNFNGN cleaved N-T@C-term 0.00984771 1125.566528 563.7905 1125.556763 563.7856445 2 12 1.1.1.4981.3 1 45.1117 609.6647 45.0692 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 IITHPNFNGN cleaved N-T@C-term 0.00362241 1125.560303 563.7874 1125.556763 563.7856445 2 12 1.1.1.4988.4 1 45.2795 633.5127 45.1884 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 IITHPNFNGN cleaved N-T@C-term 0.00362241 1125.560303 563.7874 1125.556763 563.7856445 2 11 1.1.1.5079.7 1 47.4245 503.4309 47.3135 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 IITHPNFNGN cleaved N-T@C-term 0.00325621 1125.559814 563.7872 1125.556763 563.7856445 2 10 1.1.1.5026.8 1 46.1494 541.5881 46.1595 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 IITHPNFNGN cleaved N-T@C-term 0.00118111 1125.557861 563.7862 1125.556763 563.7856445 2 9 1.1.1.4907.4 1 43.3511 704.9953 43.3629 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 IITHPNFNGN cleaved N-T@C-term 0.00142524 1125.558105 563.7863 1125.556763 563.7856445 2 6 1.1.1.5216.14 1 50.7747 194.4576 50.6861 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 IITHPNFNGN Deamidated(N)@8 cleaved N-T@C-term 0.00772104 1126.548462 564.2815 1126.540771 564.2776489 2 6 1.1.1.5249.8 1 51.5762 189.8345 51.61 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 IITHPNFNGN cleaved N-T@C-term 0.00655196 1125.563232 563.7889 1125.556763 563.7856445 2 10 1.1.1.5003.5 1 45.601 649.8926 45.6298 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 IITHPNFNGN cleaved N-T@C-term 0.00301208 1125.559692 563.7871 1125.556763 563.7856445 2 11 1.1.1.5012.5 1 45.8093 589.1843 45.773 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 IITHPNFNGN cleaved N-T@C-term 0.00325621 1125.559814 563.7872 1125.556763 563.7856445 2 11 1.1.1.5093.5 1 47.7665 445.993 47.68 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 56.12000227 IITHPNFNGN cleaved N-T@C-term 0.00362241 1125.560303 563.7874 1125.556763 563.7856445 2 11 1.1.1.5101.8 1 47.9701 393.067 47.9999 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 53.3100009 IITHPNFNGN cleaved N-T@C-term 0.0126552 1125.569214 563.7919 1125.556763 563.7856445 2 11 1.1.1.5190.3 1 50.1419 276.9221 50.0096 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 51.99999809 IITHPNFNGN cleaved N-T@C-term 0.00301208 1125.559692 563.7871 1125.556763 563.7856445 2 8 1.1.1.5174.9 1 49.7609 257.5557 49.7202 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.74999928 IITHPNFNGN cleaved N-T@C-term 0.00337828 1125.560059 563.7873 1125.556763 563.7856445 2 11 1.1.1.4607.5 1 36.5531 537.2736 36.5854 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 49.55999851 IITHPNFNGN cleaved N-T@C-term 0.00337828 1125.560059 563.7873 1125.556763 563.7856445 2 11 1.1.1.4712.3 1 38.9932 347.58 38.9329 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 49.55999851 IITHPNFNGN cleaved N-T@C-term 0.00337828 1125.560059 563.7873 1125.556763 563.7856445 2 11 1.1.1.4943.4 1 44.1964 835.2819 44.1576 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 49.55999851 IITHPNFNGN cleaved N-T@C-term 0.00276795 1125.559448 563.787 1125.556763 563.7856445 2 11 1.1.1.5019.6 1 45.9815 512.1227 45.9899 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 48.42000008 IITHPNFNGN cleaved N-T@C-term 0.00459893 1125.561279 563.7879 1125.556763 563.7856445 2 11 1.1.1.5181.2 1 49.9211 340.0242 49.9141 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 47.330001 IITHPNFNGN cleaved N-T@C-term 0.00301208 1125.559692 563.7871 1125.556763 563.7856445 2 11 1.1.1.4957.3 1 44.5295 663.4017 44.4469 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 47.330001 IITHPNFNGN cleaved N-T@C-term 0.00423273 1125.560913 563.7877 1125.556763 563.7856445 2 11 1.1.1.4973.2 1 44.9135 628.8735 44.8795 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.07000005 IITHPNFNGN cleaved N-T@C-term 0.00276795 1125.559448 563.787 1125.556763 563.7856445 2 10 1.1.1.4756.5 1 39.9629 664.6506 40.0423 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.07000005 IITHPNFNGN cleaved N-T@C-term 0.00484306 1125.561523 563.788 1125.556763 563.7856445 2 7 1.1.1.5281.9 1 52.3599 158.4503 52.3442 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 28.61999869 IITHPNFNGN cleaved N-T@C-term 0.00459893 1125.561279 563.7879 1125.556763 563.7856445 2 10 1.1.1.4722.4 1 39.2354 448.1539 39.1933 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 26.73000097 IITHPNFNGN cleaved N-T@C-term 0.00325621 1125.559814 563.7872 1125.556763 563.7856445 2 8 1.1.1.5086.8 1 47.5961 445.993 47.68 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 26.48999989 IITHPNFNGN cleaved N-T@C-term 0.00337828 1125.560059 563.7873 1125.556763 563.7856445 2 7 1.1.1.5223.14 1 50.9485 223.3004 50.8842 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 26.03999972 IITHPNFNGN cleaved N-T@C-term 0.00704022 1125.563721 563.7891 1125.556763 563.7856445 2 7 1.1.1.5236.9 1 51.2649 141.5737 51.2493 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 17.2299996 IITHPNFNGN cleaved N-T@C-term 0.00337828 1125.560059 563.7873 1125.556763 563.7856445 2 7 1.1.1.5115.8 1 48.3102 370.5366 48.2956 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 16.91000015 IITHPNFNGN cleaved N-T@C-term 0.00679609 1125.563477 563.789 1125.556763 563.7856445 2 6 1.1.1.5259.12 1 51.8168 199.0474 51.7541 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.000415667 2298.168457 767.0634 2298.167725 767.0632324 3 19 1.1.1.5975.20 1 69.8786 11912.38 70.1176 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.000499814 2298.167236 767.063 2298.167725 767.0632324 3 26 1.1.1.5982.20 1 70.0603 19309.68 70.2998 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.000781859 2298.168701 767.0635 2298.167725 767.0632324 3 24 1.1.1.5989.18 1 70.2403 26594.31 70.4804 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.000415667 2298.168457 767.0634 2298.167725 767.0632324 3 28 1.1.1.5996.17 1 70.421 27711.55 70.4804 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.0042357 2298.163818 575.5482 2298.167725 575.5492554 4 16 1.1.1.5997.11 1 70.4419 2528.978 70.4553 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.000415667 2298.168457 767.0634 2298.167725 767.0632324 3 28 1.1.1.6003.17 1 70.6002 27711.55 70.4804 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@14 0.00128226 2283.158203 762.06 2283.156982 762.0595703 3 15 1.1.1.6006.20 1 70.6797 1055.538 70.7907 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.000415667 2298.168457 767.0634 2298.167725 767.0632324 3 18 1.1.1.6010.18 1 70.7832 25817.26 70.5058 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@14 0.00128226 2283.158203 762.06 2283.156982 762.0595703 3 20 1.1.1.6014.16 1 70.8866 1055.538 70.7907 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 4.95E-05 2298.167725 767.0632 2298.167725 767.0632324 3 16 1.1.1.6017.18 1 70.9671 972.3381 70.9484 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.00617579 2298.161865 767.0612 2298.167725 767.0632324 3 14 1.1.1.6024.20 1 71.1508 836.9014 71.0784 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 -0.00311204 2283.153564 762.0585 2283.156982 762.0595703 3 18 1.1.1.6037.20 1 71.4941 7084.317 71.7352 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@14 0.061480202 2284.202393 762.4081 2284.140869 762.3875732 3 12 1.1.1.6044.17 1 71.6751 6704.596 71.9209 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Methyl(I)@19 0.04425 2297.216797 766.7462 2297.172607 766.7314453 3 16 1.1.1.6069.20 1 72.338 620.038 72.3181 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Methyl(K)@20 0.042791899 2296.231445 766.4177 2296.188477 766.4034424 3 18 1.1.1.6086.20 1 72.7887 1427.114 72.8214 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10; Methyl(K)@20 0.0331893 2297.205811 575.3087 2297.172607 575.300415 4 12 1.1.1.6087.14 1 72.8105 439.3904 72.7946 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.00342935 2298.164307 767.0621 2298.167725 767.0632324 3 11 1.1.1.6033.19 1 71.3867 781.652 71.1567 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.000907584 2299.152588 767.3915 2299.151855 767.3912354 3 23 1.1.1.5919.18 1 68.4189 6006.925 68.661 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@6; Deamidated(N)@8; Oxidation(M)@17 0.0204415 2300.15625 767.726 2300.135742 767.7192383 3 21 1.1.1.5922.20 1 68.4991 4058.414 68.7394 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.00218926 2299.154297 767.392 2299.151855 767.3912354 3 26 1.1.1.5926.19 1 68.6025 10535.71 68.8431 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.00182306 2299.153564 767.3918 2299.151855 767.3912354 3 28 1.1.1.5933.18 1 68.7836 10358.46 68.8431 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.00182306 2299.153564 767.3918 2299.151855 767.3912354 3 26 1.1.1.5940.19 1 68.9665 10358.46 68.8431 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.00163997 2299.153564 767.3918 2299.151855 767.3912354 3 23 1.1.1.5947.18 1 69.1484 8689.077 68.8691 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17; Methyl(K)@20 0.000585021 2312.184082 771.7353 2312.18335 771.7351074 3 22 1.1.1.6017.19 1 70.968 2745.619 70.8162 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17; Methyl(K)@20 0.000585021 2312.184082 771.7353 2312.18335 771.7351074 3 21 1.1.1.6010.19 1 70.784 2745.619 70.8162 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.000724487 2299.152588 767.3915 2299.151855 767.3912354 3 17 1.1.1.5905.19 1 68.0549 1030.09 68.1399 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10; Oxidation(M)@17 -0.00147267 2299.150146 767.3907 2299.151855 767.3912354 3 14 1.1.1.5889.18 1 67.6389 466.4092 67.6465 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@6; Oxidation(M)@17 0.000724487 2299.152588 767.3915 2299.151855 767.3912354 3 15 1.1.1.5912.16 1 68.2354 1030.09 68.1399 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.000907584 2299.152588 767.3915 2299.151855 767.3912354 3 14 1.1.1.5954.18 1 69.3311 3533.739 69.0518 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17; Methyl(K)@20 -0.000387922 2313.167236 772.063 2313.16748 772.0631104 3 16 1.1.1.5959.20 1 69.4619 692.4844 69.442 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17; Methyl(K)@20 0.00089375 2313.168457 772.0634 2313.16748 772.0631104 3 15 1.1.1.5966.19 1 69.6441 652.0319 69.5458 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@14; Oxidation(M)@17 -0.00165576 2299.150146 767.3907 2299.151855 767.3912354 3 12 1.1.1.5882.20 1 67.4596 674.9313 67.3612 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@14 -5.67E-05 2284.140869 762.3876 2284.140869 762.3875732 3 12 1.1.1.5960.19 1 69.4869 604.5015 69.6768 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Methyl(D)@15; Oxidation(M)@17 0.000585021 2312.184082 771.7353 2312.18335 771.7351074 3 13 1.1.1.6003.18 1 70.601 2730.719 70.8422 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.0042357 2298.163818 575.5482 2298.167725 575.5492554 4 12 1.1.1.5990.13 1 70.2615 2496.155 70.4553 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 -0.00348672 2299.148438 767.3901 2299.151855 767.3912354 3 11 1.1.1.5961.19 1 69.5133 682.5292 69.3907 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.39000106 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17; Methyl(K)@20 -0.000387922 2313.167236 772.063 2313.16748 772.0631104 3 11 1.1.1.5952.19 1 69.2794 692.4844 69.442 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.39000106 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17; Methyl(K)@20 3.57E-05 2312.183594 771.7351 2312.18335 771.7351074 3 11 1.1.1.6024.21 1 71.1516 2622.989 70.8688 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.10000062 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.00120459 2299.152832 575.7955 2299.151855 575.7952271 4 10 1.1.1.5942.12 1 69.0126 905.7426 68.7912 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.92000055 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.0429933 2283.199951 762.0739 2283.156982 762.0595703 3 27 1.1.1.6044.16 1 71.6742 12037.54 71.8413 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.92000055 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.0429933 2283.199951 762.0739 2283.156982 762.0595703 3 31 1.1.1.6051.18 1 71.8608 12037.54 71.8413 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.92000055 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.0426271 2283.199463 762.0738 2283.156982 762.0595703 3 27 1.1.1.6058.20 1 72.0464 12940.83 71.9725 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.92000055 IITHPNFNGNTLDNDIMLIK 0.042450801 2282.215332 761.7457 2282.172852 761.7315674 3 27 1.1.1.6074.18 1 72.4708 17425.04 72.5562 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.92000055 IITHPNFNGNTLDNDIMLIK 0.042450801 2282.215332 761.7457 2282.172852 761.7315674 3 25 1.1.1.6081.15 1 72.6516 17425.04 72.5562 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 96.85999751 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10; Oxidation(M)@17 -0.0053869 2299.146484 575.7939 2299.151855 575.7952271 4 8 1.1.1.5924.11 1 68.544 390.8917 68.5574 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 81.5500021 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.0429933 2283.199951 762.0739 2283.156982 762.0595703 3 15 1.1.1.6065.19 1 72.2319 13131.11 71.9725 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 81.5500021 IITHPNFNGNTLDNDIMLIK 0.019671399 2282.192627 571.5554 2282.172852 571.5504761 4 16 1.1.1.6079.14 1 72.5982 2259.359 72.5562 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 72.02000022 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10; Oxidation(M)@17 0.00120459 2299.152832 575.7955 2299.151855 575.7952271 4 7 1.1.1.5938.14 1 68.9098 905.7426 68.7912 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 63.52000237 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@10; Oxidation(M)@17 0.0153148 2300.151123 767.7243 2300.135742 767.7192383 3 8 1.1.1.5950.18 1 69.2266 3573.208 68.9469 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 60.07999778 IKLSSPATLNSR Delta:H(4)C(2)@N-term cleaved L-I@N-term; missed K-L@2 -0.000332697 1313.766357 438.9294 1313.766724 438.9295044 3 8 1.1.1.5724.4 1 63.4105 946.4542 63.4298 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.6699993 IKLSSPATLNSR Carbamidomethyl@N-term cleaved L-I@N-term; missed K-L@2 0.0429576 1342.799927 672.4072 1342.756836 672.3856812 2 9 1.1.1.4664.4 1 37.9211 282.0786 37.9066 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 INSQWVVSAAH cleaved L-I@N-term; cleaved H-C@C-term -0.000338265 1210.609131 606.3118 1210.609497 606.3120117 2 9 1.1.1.5169.14 0 49.6356 147.7345 49.6707 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.1400001 IQVRLGEHNIDVLEGNEQFINAAK Carbamidomethyl@N-term; Carbamyl(R)@4; reduced HNE(H)@8 missed R-L@4 0.0157647 2964.58252 989.2015 2964.566895 989.196228 3 14 1.1.1.5548.21 1 58.9945 878.6672 58.9008 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 20.23999989 IVGGYTCAAN Carbamidomethyl(C)@7 cleaved N-S@C-term -0.00175189 1024.463013 513.2388 1024.464722 513.2396851 2 9 1.1.1.4216.2 1 29.2541 349.8041 29.1364 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 70.78999877 LGEHNIDVL cleaved L-E@C-term -0.00447728 1008.51947 505.267 1008.523987 505.2692871 2 6 1.1.1.5490.6 1 57.5323 399.6548 57.6236 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.74999785 LGEHNIDVL cleaved L-E@C-term -0.00588103 1008.518066 505.2663 1008.523987 505.2692871 2 7 1.1.1.5514.7 1 58.1343 1181.056 58.2008 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 58.49999785 LGEHNIDVL cleaved L-E@C-term -0.00588103 1008.518066 505.2663 1008.523987 505.2692871 2 7 1.1.1.5521.7 1 58.3064 1181.056 58.2008 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 58.49999785 LGEHNIDVL cleaved L-E@C-term -0.00789512 1008.516052 505.2653 1008.523987 505.2692871 2 6 1.1.1.5528.4 1 58.4789 1159.202 58.2253 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGN cleaved N-E@C-term 0.0027632 1308.633911 655.3242 1308.630981 655.3227539 2 12 1.1.1.5196.7 1 50.288 341.5794 50.3434 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGN cleaved N-E@C-term 0.00435004 1308.635498 655.325 1308.630981 655.3227539 2 11 1.1.1.5203.13 1 50.4524 361.1731 50.5132 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGN cleaved N-E@C-term 0.00215288 1308.633301 655.3239 1308.630981 655.3227539 2 9 1.1.1.5272.16 1 52.142 208.3867 52.1512 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGN cleaved N-E@C-term 0.00496036 1308.636108 655.3253 1308.630981 655.3227539 2 10 1.1.1.5210.18 1 50.6289 351.0242 50.6117 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGN cleaved N-E@C-term 0.00496036 1308.636108 655.3253 1308.630981 655.3227539 2 11 1.1.1.5258.17 1 51.7958 250.8921 51.7783 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGN cleaved N-E@C-term 0.00166462 1308.63269 655.3236 1308.630981 655.3227539 2 9 1.1.1.5265.18 1 51.9674 272.6027 51.95 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGN cleaved N-E@C-term 0.00850023 1308.639526 655.327 1308.630981 655.3227539 2 9 1.1.1.5292.16 1 52.6365 140.9417 52.6181 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.8499999 LGEHNIDVLEGN cleaved N-E@C-term 0.00154256 1308.632446 655.3235 1308.630981 655.3227539 2 9 1.1.1.5224.17 1 50.9751 272.1776 50.9835 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.8499999 LGEHNIDVLEGN cleaved N-E@C-term 0.00190875 1308.632935 655.3237 1308.630981 655.3227539 2 10 1.1.1.5235.6 1 51.2358 242.118 51.2975 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 LGEHNIDVLEGN cleaved N-E@C-term 0.00850023 1308.639526 655.327 1308.630981 655.3227539 2 6 1.1.1.5175.16 1 49.7847 171.3894 49.8182 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00506367 1565.737305 783.8759 1565.732178 783.8733521 2 17 1.1.1.5136.5 1 48.8167 388.7161 48.9221 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00189 1565.734131 783.8743 1565.732178 783.8733521 2 14 1.1.1.5143.10 1 48.9887 581.5328 49.1694 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00189 1565.734131 783.8743 1565.732178 783.8733521 2 17 1.1.1.5150.7 1 49.1618 583.8485 49.1694 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00469747 1565.736816 783.8757 1565.732178 783.8733521 2 14 1.1.1.5157.12 1 49.3375 584.2811 49.5199 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00164587 1565.733887 783.8742 1565.732178 783.8733521 2 15 1.1.1.5171.12 1 49.6906 555.5597 49.6457 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00164587 1565.733887 783.8742 1565.732178 783.8733521 2 15 1.1.1.5184.10 1 50.0028 492.3911 50.0336 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00066936 1565.73291 783.8737 1565.732178 783.8733521 2 16 1.1.1.5191.7 1 50.169 388.994 50.2003 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term -0.00152779 1565.730713 783.8726 1565.732178 783.8733521 2 13 1.1.1.5206.19 1 50.5311 387.807 50.4641 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00433128 1565.73645 783.8755 1565.732178 783.8733521 2 12 1.1.1.5272.20 1 52.1453 157.1921 52.0757 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00591811 1565.738037 783.8763 1565.732178 783.8733521 2 13 1.1.1.5199.15 1 50.3607 396.3178 50.3434 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00567398 1565.737915 783.8762 1565.732178 783.8733521 2 12 1.1.1.5257.14 1 51.7732 212.1013 51.7541 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00189 1565.734131 783.8743 1565.732178 783.8733521 2 13 1.1.1.5213.18 1 50.7042 316.733 50.6613 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00445334 1565.736694 783.8756 1565.732178 783.8733521 2 12 1.1.1.5235.10 1 51.2425 242.3218 51.1052 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00189 1565.734131 783.8743 1565.732178 783.8733521 2 10 1.1.1.5265.20 1 51.969 221.4455 51.8759 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00530779 1565.737427 783.876 1565.732178 783.8733521 2 11 1.1.1.5220.19 1 50.8775 271.0178 50.909 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00213413 1565.734497 783.8745 1565.732178 783.8733521 2 9 1.1.1.5118.16 1 48.3875 148.8814 48.3696 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 LGEHNIDVLEGNEQF cleaved F-I@C-term -0.00230237 1712.798218 857.4064 1712.800537 857.4075928 2 11 1.1.1.5549.18 1 59.0166 398.9043 58.9995 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 LGEHNIDVLEGNEQF cleaved F-I@C-term -0.00132585 1712.799316 857.4069 1712.800537 857.4075928 2 11 1.1.1.5564.19 1 59.3908 387.3906 59.1226 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 84.85999703 LGEHNIDVLEGNEQF cleaved F-I@C-term -0.00169204 1712.798828 857.4067 1712.800537 857.4075928 2 9 1.1.1.5556.20 1 59.1917 402.0091 59.1226 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.650002 LGEHNIDVLEGNEQF cleaved F-I@C-term -0.00449954 1712.796021 857.4053 1712.800537 857.4075928 2 5 1.1.1.5572.18 1 59.591 144.7793 59.4735 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00265537 1939.930298 970.9724 1939.927612 970.9710693 2 21 1.1.1.5568.19 1 59.4921 3024.358 59.4735 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.51999879 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 9.20E-05 1939.927734 970.9711 1939.927612 970.9710693 2 18 1.1.1.5547.19 1 58.9681 4302.533 59.1226 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.51999879 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00265537 1939.930298 970.9724 1939.927612 970.9710693 2 18 1.1.1.5575.21 1 59.6676 3084.051 59.4226 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.39000201 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 9.20E-05 1939.927734 970.9711 1939.927612 970.9710693 2 18 1.1.1.5554.20 1 59.1417 4302.533 59.1226 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.39000201 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00350982 1939.93103 970.9728 1939.927612 970.9710693 2 15 1.1.1.5597.21 1 60.22 395.8771 60.0752 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -0.00946421 1939.918335 647.6467 1939.927612 647.6497803 3 16 1.1.1.5555.15 1 59.1625 1011.755 59.1226 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -0.0103797 1939.91748 647.6464 1939.927612 647.6497803 3 16 1.1.1.5562.15 1 59.3373 1122.138 59.3225 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00204505 1939.929688 970.9721 1939.927612 970.9710693 2 13 1.1.1.5606.21 1 60.4466 292.8456 60.4266 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 92.08999872 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -0.0100135 1939.917603 647.6465 1939.927612 647.6497803 3 11 1.1.1.5572.16 1 59.5893 1100.46 59.3225 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 92.08999872 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00704971 1939.934692 970.9746 1939.927612 970.9710693 2 11 1.1.1.5621.17 1 60.8178 252.6199 60.7763 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 87.41000295 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.00328159 1921.920288 961.9674 1921.916992 961.9657593 2 12 1.1.1.5659.21 1 61.7709 594.9185 61.7248 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 84.85999703 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -0.0103797 1939.91748 647.6464 1939.927612 647.6497803 3 12 1.1.1.5569.14 1 59.5131 1122.138 59.3225 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 84.85999703 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -0.00946421 1939.918335 647.6467 1939.927612 647.6497803 3 10 1.1.1.5580.14 1 59.7876 292.602 59.6978 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 84.85999703 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00326569 1939.930908 970.9727 1939.927612 970.9710693 2 12 1.1.1.5582.21 1 59.8439 1654.927 59.5738 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 84.85999703 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00167885 1939.929321 970.9719 1939.927612 970.9710693 2 11 1.1.1.5590.21 1 60.0449 508.0506 59.9501 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00265537 1939.930298 970.9724 1939.927612 970.9710693 2 10 1.1.1.5540.19 1 58.7939 2103.847 59.0242 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 77.57999897 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -3.992840052 1935.93457 646.3188 1939.927612 647.6497803 3 9 1.1.1.5354.11 1 54.1472 515.878 53.9636 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00192298 1939.929443 970.972 1939.927612 970.9710693 2 9 1.1.1.5613.19 1 60.6215 277.4879 60.604 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.00303746 1921.920044 961.9673 1921.916992 961.9657593 2 10 1.1.1.5652.21 1 61.5926 619.1221 61.6488 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -3.99248004 1935.935059 646.319 1939.927612 647.6497803 3 9 1.1.1.5318.9 1 53.2691 443.9376 53.4196 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -3.99248004 1935.935059 646.319 1939.927612 647.6497803 3 8 1.1.1.5325.17 1 53.4359 443.9376 53.4196 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.650002 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00729383 1939.934814 970.9747 1939.927612 970.9710693 2 7 1.1.1.5630.21 1 61.0445 285.203 61.0245 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 -0.00129386 2211.07959 738.0338 2211.080811 738.0341797 3 15 1.1.1.5758.21 1 64.2938 1047.341 64.5298 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.00467057 2211.085449 1106.55 2211.080811 1106.547607 2 11 1.1.1.5775.21 1 64.7302 455.7084 64.8371 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.00467057 2211.085449 1106.55 2211.080811 1106.547607 2 13 1.1.1.5778.21 1 64.8064 455.7084 64.8371 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Deamidated(Q)@14 -0.00019528 2211.080566 738.0341 2211.080811 738.0341797 3 23 1.1.1.5779.18 1 64.8295 4622.361 64.863 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 -0.00019528 2211.080566 738.0341 2211.080811 738.0341797 3 19 1.1.1.5781.19 1 64.8816 4622.361 64.863 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.00613533 2211.087402 1106.551 2211.080811 1106.547607 2 11 1.1.1.5784.21 1 64.9605 405.2758 64.9399 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 -0.00019528 2211.080566 738.0341 2211.080811 738.0341797 3 24 1.1.1.5786.18 1 65.0097 4622.361 64.863 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Deamidated(Q)@14 -0.00019528 2211.080566 738.0341 2211.080811 738.0341797 3 21 1.1.1.5788.14 1 65.0576 4622.361 64.863 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.000227676 2210.097168 737.7063 2210.09668 737.7061768 3 24 1.1.1.5796.18 1 65.2676 8929.865 65.5079 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.00412277 2210.101318 1106.058 2210.09668 1106.055664 2 10 1.1.1.5801.21 1 65.3993 2449.005 65.6364 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.00412277 2210.101318 1106.058 2210.09668 1106.055664 2 16 1.1.1.5802.21 1 65.4252 2795.445 65.662 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.00315721 2210.100098 737.7073 2210.09668 737.7061768 3 28 1.1.1.5803.19 1 65.4498 17269.93 65.6364 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.00412277 2210.101318 1106.058 2210.09668 1106.055664 2 17 1.1.1.5807.21 1 65.5546 6412.026 65.7902 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK -0.000138516 2210.09668 737.7062 2210.09668 737.7061768 3 29 1.1.1.5810.17 1 65.628 40174.68 65.8146 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK -0.00308323 2210.09375 553.5307 2210.09668 553.5314941 4 12 1.1.1.5811.12 1 65.6494 1939.27 65.8392 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK -0.000138516 2210.09668 737.7062 2210.09668 737.7061768 3 27 1.1.1.5817.11 1 65.8029 40563.31 65.8146 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.0043669 2210.101318 1106.058 2210.09668 1106.055664 2 20 1.1.1.5821.21 1 65.9084 8806.689 65.8146 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.000227676 2210.097168 737.7063 2210.09668 737.7061768 3 26 1.1.1.5824.14 1 65.9772 51743.45 66.0364 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.000227676 2210.097168 737.7063 2210.09668 737.7061768 3 12 1.1.1.5831.15 1 66.1485 51743.45 66.0364 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.000227676 2210.097168 737.7063 2210.09668 737.7061768 3 26 1.1.1.5831.16 1 66.1493 51743.45 66.0364 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.00179936 2210.098633 553.5319 2210.09668 553.5314941 4 13 1.1.1.5837.10 1 66.2914 2005.35 66.1094 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.00315721 2210.100098 737.7073 2210.09668 737.7061768 3 28 1.1.1.5838.17 1 66.3222 49969.65 66.061 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.00461102 2210.101318 1106.058 2210.09668 1106.055664 2 14 1.1.1.5839.21 1 66.3507 8091.144 66.1338 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK -0.000138516 2210.09668 737.7062 2210.09668 737.7061768 3 23 1.1.1.5845.20 1 66.5029 30632.13 66.232 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK -0.000138516 2210.09668 737.7062 2210.09668 737.7061768 3 24 1.1.1.5852.16 1 66.6803 4948.948 66.4069 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK -0.00306805 2210.09375 737.7052 2210.09668 737.7061768 3 20 1.1.1.5859.15 1 66.8598 1892.197 66.8187 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.00493141 2211.085693 738.0358 2211.080811 738.0341797 3 24 1.1.1.5866.18 1 67.0425 2794.577 66.9465 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.0040727 2210.10083 737.7076 2210.09668 737.7061768 3 21 1.1.1.5873.18 1 67.2249 1284.202 67.3612 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.0040727 2210.10083 737.7076 2210.09668 737.7061768 3 21 1.1.1.5880.18 1 67.4059 1284.202 67.3612 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.000410772 2210.097412 737.7064 2210.09668 737.7061768 3 14 1.1.1.5887.15 1 67.5849 934.5332 67.6206 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.000410772 2210.097412 737.7064 2210.09668 737.7061768 3 18 1.1.1.5894.14 1 67.7651 934.5332 67.6206 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK 0.000227676 2210.097168 737.7063 2210.09668 737.7061768 3 18 1.1.1.5901.19 1 67.952 594.2122 67.9588 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK -0.000138516 2210.09668 737.7062 2210.09668 737.7061768 3 16 1.1.1.5909.19 1 68.1593 434.7278 68.1399 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK -0.00489902 2210.092041 737.7046 2210.09668 737.7061768 3 16 1.1.1.5917.17 1 68.3664 462.2777 68.3232 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK -0.000687805 2210.096191 737.706 2210.09668 737.7061768 3 14 1.1.1.5998.19 1 70.4736 211.7799 70.4804 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 0.000954915 2224.113525 742.3784 2224.112305 742.3780518 3 17 1.1.1.5830.16 1 66.1246 7852.664 66.3057 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 0.00132111 2224.113525 742.3785 2224.112305 742.3780518 3 27 1.1.1.5837.16 1 66.2964 8200.178 66.3306 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 -0.00112097 2236.111328 746.3777 2236.112305 746.3780518 3 20 1.1.1.5840.16 1 66.372 1330.907 66.4577 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 0.00132111 2224.113525 742.3785 2224.112305 742.3780518 3 22 1.1.1.5844.15 1 66.4735 8200.178 66.3306 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Dimethyl(N)@12 -0.00234736 2238.125732 747.0492 2238.128174 747.0499878 3 22 1.1.1.5850.18 0 66.6303 5198.736 66.5088 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(H)@4 -0.00234736 2238.125732 747.0492 2238.128174 747.0499878 3 23 1.1.1.5857.18 0 66.8111 4941.059 66.5348 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17; Delta:H(4)C(2)(K)@20 -0.00277051 2239.109375 747.3771 2239.112061 747.3779907 3 15 1.1.1.5798.19 1 65.3203 347.2817 65.2494 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@13 -0.00450234 2232.074219 745.032 2232.078613 745.0335083 3 16 1.1.1.5822.11 1 65.9263 795.1097 65.8638 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 0.00872567 2236.121338 1119.068 2236.112305 1119.063477 2 11 1.1.1.5844.21 1 66.4785 360.4474 66.4323 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 0.00415741 2296.137695 766.3865 2296.133545 766.3851318 3 20 1.1.1.5866.19 1 67.0433 1743.282 67.05 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 0.00761539 2296.141357 1149.078 2296.133545 1149.074097 2 16 1.1.1.5867.21 1 67.0712 994.6765 67.05 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 0.00761539 2296.141357 1149.078 2296.133545 1149.074097 2 15 1.1.1.5868.21 1 67.0975 994.6765 67.05 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 0.00761539 2296.141357 1149.078 2296.133545 1149.074097 2 12 1.1.1.5870.21 1 67.1493 994.6765 67.05 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 0.00761539 2296.141357 1149.078 2296.133545 1149.074097 2 12 1.1.1.5871.21 1 67.1756 994.6765 67.05 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.39000106 LGEHNIDVLEGNEQFINAAK Deamidated(Q)@14; Methyl(K)@20 -0.00496102 2225.091309 742.7044 2225.096436 742.7061157 3 12 1.1.1.5780.20 1 64.8571 413.0886 65.0429 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.39000106 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(K)@20 -0.00271355 2238.125488 747.0491 2238.128174 747.0499878 3 10 1.1.1.5865.18 0 67.0167 1762.17 66.7415 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.10000062 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 0.00872567 2236.121338 1119.068 2236.112305 1119.063477 2 7 1.1.1.5846.21 1 66.5297 360.4474 66.4323 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.84000206 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@13 0.00080745 2232.07959 745.0338 2232.078613 745.0335083 3 10 1.1.1.5829.16 1 66.1001 864.7438 66.1094 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.93000007 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 0.00872567 2236.121338 1119.068 2236.112305 1119.063477 2 7 1.1.1.5843.20 1 66.4518 360.4474 66.4323 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 90.17000198 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17; Delta:H(4)C(2)(K)@20 -0.00277051 2239.109375 747.3771 2239.112061 747.3779907 3 9 1.1.1.5791.19 1 65.1392 347.2817 65.2494 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 90.17000198 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@13 -0.00450234 2232.074219 745.032 2232.078613 745.0335083 3 9 1.1.1.5815.14 1 65.7538 795.1097 65.8638 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.55999899 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12; Deamidated(N)@17 0.018423799 2212.083008 738.3683 2212.064697 738.3621826 3 7 1.1.1.5868.18 1 67.095 1212.76 66.9465 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 48.12999964 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.00613533 2211.087402 1106.551 2211.080811 1106.547607 2 7 1.1.1.5783.21 1 64.9348 405.2758 64.9399 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.63000202 LGEHNIDVLEGNEQFINAAKII Deamidated(N)@17 cleaved I-T@C-term; missed K-I@20 0.0308886 2437.279785 813.4339 2437.249023 813.423584 3 11 1.1.1.5831.19 0 66.1518 937.5542 66.1338 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 92.86000133 LGEHNIDVLEGNEQFINAAKII MDA adduct +54(K)@20 cleaved I-T@C-term; missed K-I@20 -0.0361109 2490.239258 1246.127 2490.275391 1246.14502 2 8 1.1.1.5831.21 1 66.1535 2962.488 66.1829 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.55999899 LGEHNIDVLEGNEQFINAAKII Deamidated(N)@17 cleaved I-T@C-term; missed K-I@20 0.0308886 2437.279785 813.4339 2437.249023 813.423584 3 8 1.1.1.5824.18 0 65.9805 937.5542 66.1338 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 LINSQWVVSAAH cleaved S-L@N-term; cleaved H-C@C-term -0.000998068 1323.692505 662.8535 1323.693481 662.8540649 2 12 1.1.1.5449.17 0 56.5149 474.4446 56.7252 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 92.08999872 LINSQWVVSAAH cleaved S-L@N-term; cleaved H-C@C-term -0.00466003 1323.688843 662.8517 1323.693481 662.8540649 2 11 1.1.1.5464.17 0 56.8884 570.7117 56.872 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 84.85999703 LINSQWVVSAAH cleaved S-L@N-term; cleaved H-C@C-term -0.0044159 1323.689087 662.8518 1323.693481 662.8540649 2 10 1.1.1.5456.17 0 56.6919 564.6918 56.872 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 LINSQWVVSAAH cleaved S-L@N-term; cleaved H-C@C-term -0.00160839 1323.691895 662.8532 1323.693481 662.8540649 2 8 1.1.1.5442.20 0 56.3381 220.2296 56.2934 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 28.92000079 LSSPATLN cleaved N-S@C-term 0.00256351 801.4259033 401.7202 801.4232178 401.7189026 2 10 1.1.1.4363.2 1 31.6375 10289.15 31.4765 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 18.99999976 LSSPATLN cleaved N-S@C-term 0.00256351 801.4259033 401.7202 801.4232178 401.7189026 2 8 1.1.1.4347.2 1 31.2878 10233.95 31.4765 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 18.51000041 LSSPATLN cleaved N-S@C-term 0.00231938 801.4256592 401.7201 801.4232178 401.7189026 2 9 1.1.1.4373.2 1 31.8207 2992.16 31.7802 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 17.74999946 LSSPATLN cleaved N-S@C-term 0.00256351 801.4259033 401.7202 801.4232178 401.7189026 2 8 1.1.1.4448.2 1 33.29 835.0532 33.2559 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 17.58999974 LSSPATLN cleaved N-S@C-term 0.00512689 801.4284668 401.7215 801.4232178 401.7189026 2 8 1.1.1.4474.2 1 33.8156 449.0443 33.8324 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 17.38000065 LSSPATLN cleaved N-S@C-term 0.00311281 801.4264526 401.7205 801.4232178 401.7189026 2 9 1.1.1.4491.2 1 34.0659 537.0501 33.9702 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 17.2299996 LSSPATLN cleaved N-S@C-term 0.00231938 801.4256592 401.7201 801.4232178 401.7189026 2 8 1.1.1.4455.2 1 33.4571 696.9756 33.4227 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 17.21999943 LSSPATLN cleaved N-S@C-term 0.00231938 801.4256592 401.7201 801.4232178 401.7189026 2 9 1.1.1.4425.2 1 32.8869 1041.716 32.8282 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 16.97999984 LSSPATLN cleaved N-S@C-term 0.00256351 801.4259033 401.7202 801.4232178 401.7189026 2 9 1.1.1.4354.2 1 31.4572 10289.08 31.4765 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LSSPATLNSR 0.000380425 1044.556641 523.2856 1044.556396 523.2854614 2 14 1.1.1.4253.3 1 29.7967 13080.6 29.6479 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LSSPATLNSR 0.000380425 1044.556641 523.2856 1044.556396 523.2854614 2 14 1.1.1.4270.3 1 29.9748 1852.495 29.9276 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LSSPATLNSR 1.42E-05 1044.556519 523.2855 1044.556396 523.2854614 2 14 1.1.1.4283.2 1 30.1432 2291.31 30.1483 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LSSPATLNSR 0.000380425 1044.556641 523.2856 1044.556396 523.2854614 2 14 1.1.1.4301.2 1 30.3129 2548.992 30.318 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LSSPATLNSR -0.00181674 1044.554443 523.2845 1044.556396 523.2854614 2 14 1.1.1.4341.2 1 31.1723 2270.445 30.9555 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LSSPATLNSR 0.00318792 1044.559448 523.287 1044.556396 523.2854614 2 14 1.1.1.4504.3 1 34.3558 1251.242 34.2901 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LSSPATLNSR 0.00074662 1044.557129 523.2858 1044.556396 523.2854614 2 14 1.1.1.4536.3 1 34.8969 1665.667 34.7954 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LSSPATLNSR 0.00233346 1044.558716 523.2866 1044.556396 523.2854614 2 11 1.1.1.5032.7 1 46.2977 465.5637 46.2081 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 LSSPATLNSR 0.00416444 1044.560425 523.2875 1044.556396 523.2854614 2 13 1.1.1.4775.2 1 40.3797 1130.355 40.3374 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.82000184 LSSPATLNSR 0.00050249 1044.556885 523.2857 1044.556396 523.2854614 2 13 1.1.1.4566.4 1 35.5934 1538.807 35.5269 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.82000184 LSSPATLNSR 0.000380425 1044.556641 523.2856 1044.556396 523.2854614 2 13 1.1.1.4652.4 1 37.6363 1720.442 37.6896 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 LSSPATLNSR Oxidation(P)@4 -0.00280857 1060.548462 531.2815 1060.55127 531.2828979 2 8 1.1.1.4245.3 1 29.6307 94.8812 29.6173 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.000380425 1044.556641 523.2856 1044.556396 523.2854614 2 13 1.1.1.4244.2 1 29.6005 13080.6 29.6479 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR -0.00425804 1044.552124 523.2833 1044.556396 523.2854614 2 13 1.1.1.4315.2 1 30.6574 2424.458 30.6955 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR -0.00206087 1044.554321 523.2844 1044.556396 523.2854614 2 13 1.1.1.4324.2 1 30.8338 2476.602 30.7386 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.000380425 1044.556641 523.2856 1044.556396 523.2854614 2 13 1.1.1.4357.4 1 31.5247 2270.416 31.4765 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.00099075 1044.557251 523.2859 1044.556396 523.2854614 2 13 1.1.1.4420.2 1 32.7751 1755.488 32.7319 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.000380425 1044.556641 523.2856 1044.556396 523.2854614 2 13 1.1.1.4438.2 1 33.1156 1626.386 33.0859 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.00050249 1044.556885 523.2857 1044.556396 523.2854614 2 13 1.1.1.4455.3 1 33.4655 1553.958 33.4227 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR -0.00181674 1044.554443 523.2845 1044.556396 523.2854614 2 13 1.1.1.4488.2 1 34.0128 1632.184 33.9648 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 1.42E-05 1044.556519 523.2855 1044.556396 523.2854614 2 12 1.1.1.4550.5 1 35.2281 1505.42 35.1646 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.00074662 1044.557129 523.2858 1044.556396 523.2854614 2 13 1.1.1.4624.5 1 36.9597 1695.53 36.8486 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.000136295 1044.556519 523.2855 1044.556396 523.2854614 2 12 1.1.1.4631.10 1 37.1309 1581.5 37.088 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.00355411 1044.559814 523.2872 1044.556396 523.2854614 2 13 1.1.1.4749.2 1 39.8188 1167.898 39.8713 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.00416444 1044.560425 523.2875 1044.556396 523.2854614 2 12 1.1.1.4758.5 1 40.0135 1283.67 40.0897 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR -0.00120642 1044.555298 523.2849 1044.556396 523.2854614 2 12 1.1.1.4801.2 1 40.9482 1177.787 40.8462 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.00355411 1044.559814 523.2872 1044.556396 523.2854614 2 13 1.1.1.4818.3 1 41.327 1079.192 41.3321 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.00160107 1044.558105 523.2863 1044.556396 523.2854614 2 13 1.1.1.4872.2 1 42.5467 1178.096 42.5634 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.00099075 1044.557251 523.2859 1044.556396 523.2854614 2 11 1.1.1.4951.7 1 44.3935 639.7877 44.3021 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR 0.00172314 1044.558105 523.2863 1044.556396 523.2854614 2 10 1.1.1.4965.5 1 44.7204 608.1548 44.6872 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 LSSPATLNSR -0.00218294 1044.554321 523.2844 1044.556396 523.2854614 2 10 1.1.1.4989.5 1 45.2971 541.165 45.333 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 85.31000018 LSSPATLNSR 0.00416444 1044.560425 523.2875 1044.556396 523.2854614 2 12 1.1.1.4707.6 1 38.8772 895.572 38.8382 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 85.31000018 LSSPATLNSR 0.00416444 1044.560425 523.2875 1044.556396 523.2854614 2 10 1.1.1.5018.6 1 45.9557 444.8704 45.9175 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 74.07000065 LSSPATLNSR -0.00181674 1044.554443 523.2845 1044.556396 523.2854614 2 12 1.1.1.4558.7 1 35.403 1497.115 35.3845 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 74.07000065 LSSPATLNSR -0.00145055 1044.554932 523.2847 1044.556396 523.2854614 2 11 1.1.1.4581.7 1 35.9487 1499.361 35.9805 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 74.07000065 LSSPATLNSR 0.0131972 1044.569702 523.2921 1044.556396 523.2854614 2 8 1.1.1.5163.10 1 49.4806 228.8216 49.5199 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR 1.42E-05 1044.556519 523.2855 1044.556396 523.2854614 2 12 1.1.1.4308.2 1 30.4849 2360.332 30.4206 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR -0.00169468 1044.554688 523.2846 1044.556396 523.2854614 2 12 1.1.1.4334.2 1 31.0041 2255.142 30.9555 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR -0.00206087 1044.554321 523.2844 1044.556396 523.2854614 2 12 1.1.1.4349.3 1 31.3499 2213.472 31.25 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR 0.00074662 1044.557129 523.2858 1044.556396 523.2854614 2 12 1.1.1.4365.3 1 31.6982 1749.45 31.7033 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR 0.00050249 1044.556885 523.2857 1044.556396 523.2854614 2 12 1.1.1.4383.3 1 32.0519 1760.908 32.0332 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR 0.000380425 1044.556641 523.2856 1044.556396 523.2854614 2 12 1.1.1.4428.2 1 32.9492 1617.847 33.0859 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR 0.000380425 1044.556641 523.2856 1044.556396 523.2854614 2 12 1.1.1.4448.3 1 33.2983 1599.909 33.2322 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR -0.00169468 1044.554688 523.2846 1044.556396 523.2854614 2 12 1.1.1.4474.4 1 33.8273 1415.954 33.785 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR 0.00074662 1044.557129 523.2858 1044.556396 523.2854614 2 12 1.1.1.4496.2 1 34.1849 1459.194 34.19 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR 0.000380425 1044.556641 523.2856 1044.556396 523.2854614 2 12 1.1.1.4543.4 1 35.0573 1558.966 34.9736 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR 0.00074662 1044.557129 523.2858 1044.556396 523.2854614 2 12 1.1.1.4610.5 1 36.6281 1552.025 36.7051 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR 0.00294379 1044.559326 523.2869 1044.556396 523.2854614 2 12 1.1.1.4731.3 1 39.4239 1255.412 39.5058 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR 0.00099075 1044.557251 523.2859 1044.556396 523.2854614 2 12 1.1.1.4833.3 1 41.678 1051.832 41.7127 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR 0.00233346 1044.558716 523.2866 1044.556396 523.2854614 2 10 1.1.1.5025.6 1 46.1226 465.5637 46.2081 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 LSSPATLNSR 0.00440857 1044.560913 523.2877 1044.556396 523.2854614 2 9 1.1.1.5076.8 1 47.354 312.596 47.3859 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 LSSPATLNSR Deamidated(N)@8 0.0132692 1045.553711 523.7841 1045.540405 523.7774658 2 12 1.1.1.4374.2 1 31.8569 745.7481 31.7909 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 LSSPATLNSR -0.00181674 1044.554443 523.2845 1044.556396 523.2854614 2 11 1.1.1.4588.5 1 36.1195 1591.564 36.1245 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 LSSPATLNSR 0.00074662 1044.557129 523.2858 1044.556396 523.2854614 2 11 1.1.1.4617.9 1 36.7957 1695.53 36.8486 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 LSSPATLNSR 0.00050249 1044.556885 523.2857 1044.556396 523.2854614 2 11 1.1.1.4638.5 1 37.2959 1566.307 37.2321 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 LSSPATLNSR 0.00135694 1044.557617 523.2861 1044.556396 523.2854614 2 11 1.1.1.4684.4 1 38.3412 1304.589 38.3288 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 LSSPATLNSR 0.00355411 1044.559814 523.2872 1044.556396 523.2854614 2 11 1.1.1.4715.5 1 39.07 1098.954 39.0988 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 LSSPATLNSR 0.00440857 1044.560913 523.2877 1044.556396 523.2854614 2 11 1.1.1.4891.3 1 42.988 953.2497 42.9989 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 LSSPATLNSR 0.00135694 1044.557617 523.2861 1044.556396 523.2854614 2 10 1.1.1.4944.6 1 44.2213 702.6649 44.1337 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 LSSPATLNSR 0.00196727 1044.558228 523.2864 1044.556396 523.2854614 2 8 1.1.1.5039.8 1 46.4654 420.1195 46.4025 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 LSSPATLNSR 0.00379824 1044.560303 523.2874 1044.556396 523.2854614 2 8 1.1.1.5083.7 1 47.5223 282.6777 47.5324 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 LSSPATLNSR 0.00330998 1044.559692 523.2871 1044.556396 523.2854614 2 8 1.1.1.5104.12 1 48.0375 303.2698 48.0246 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 LSSPATLNSR 0.0107559 1044.567017 523.2908 1044.556396 523.2854614 2 7 1.1.1.5177.10 1 49.8282 192.7535 49.7693 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 LSSPATLNSR 0.00050249 1044.556885 523.2857 1044.556396 523.2854614 2 11 1.1.1.4375.4 1 31.8807 1849.241 31.862 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 LSSPATLNSR 0.000136295 1044.556519 523.2855 1044.556396 523.2854614 2 11 1.1.1.4393.3 1 32.2345 1780.248 32.1865 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 LSSPATLNSR 0.000380425 1044.556641 523.2856 1044.556396 523.2854614 2 11 1.1.1.4404.4 1 32.4249 1691.612 32.4058 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 LSSPATLNSR 0.000136295 1044.556519 523.2855 1044.556396 523.2854614 2 11 1.1.1.4659.5 1 37.7988 1540.891 37.8828 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 LSSPATLNSR 0.00160107 1044.558105 523.2863 1044.556396 523.2854614 2 11 1.1.1.4677.3 1 38.1735 1291.52 38.1844 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 LSSPATLNSR 0.00135694 1044.557617 523.2861 1044.556396 523.2854614 2 11 1.1.1.4723.4 1 39.259 1313.561 39.2641 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 LSSPATLNSR 0.00355411 1044.559814 523.2872 1044.556396 523.2854614 2 11 1.1.1.4783.3 1 40.5593 1240.36 40.527 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 LSSPATLNSR 0.00160107 1044.558105 523.2863 1044.556396 523.2854614 2 11 1.1.1.4841.3 1 41.8476 1226.554 41.8373 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 LSSPATLNSR 0.00099075 1044.557251 523.2859 1044.556396 523.2854614 2 11 1.1.1.4848.2 1 42.0106 1179.032 42.0043 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 LSSPATLNSR 0.00111281 1044.557495 523.286 1044.556396 523.2854614 2 10 1.1.1.4899.5 1 43.1594 855.2005 43.1471 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 LSSPATLNSR 0.00379824 1044.560303 523.2874 1044.556396 523.2854614 2 10 1.1.1.4974.6 1 44.9456 464.9606 44.9032 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.00074662 1044.557129 523.2858 1044.556396 523.2854614 2 11 1.1.1.4232.2 1 29.431 4553.536 29.5401 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.000380425 1044.556641 523.2856 1044.556396 523.2854614 2 11 1.1.1.4413.4 1 32.6056 1600.977 32.6107 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.00074662 1044.557129 523.2858 1044.556396 523.2854614 2 11 1.1.1.4463.3 1 33.6389 1595.527 33.5241 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.00074662 1044.557129 523.2858 1044.556396 523.2854614 2 11 1.1.1.4515.4 1 34.5433 1493.089 34.5959 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR -0.00145055 1044.554932 523.2847 1044.556396 523.2854614 2 11 1.1.1.4574.7 1 35.7837 1702.274 35.8364 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR -0.00108435 1044.555298 523.2849 1044.556396 523.2854614 2 11 1.1.1.4595.4 1 36.2873 1489.668 36.2444 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.000136295 1044.556519 523.2855 1044.556396 523.2854614 2 11 1.1.1.4669.2 1 37.9958 1534.346 37.8828 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.00050249 1044.556885 523.2857 1044.556396 523.2854614 2 11 1.1.1.4740.3 1 39.6425 1262.265 39.624 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.00318792 1044.559448 523.287 1044.556396 523.2854614 2 11 1.1.1.4766.2 1 40.1947 1064.643 40.2318 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.00135694 1044.557617 523.2861 1044.556396 523.2854614 2 10 1.1.1.4855.4 1 42.1781 1221.81 42.2186 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.00099075 1044.557251 523.2859 1044.556396 523.2854614 2 10 1.1.1.4907.3 1 43.3478 786.5936 43.3629 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.00318792 1044.559448 523.287 1044.556396 523.2854614 2 10 1.1.1.4929.4 1 43.8813 506.8415 43.8668 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.00160107 1044.558105 523.2863 1044.556396 523.2854614 2 8 1.1.1.4982.7 1 45.1289 533.5659 45.1884 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.00721606 1044.563721 523.2891 1044.556396 523.2854614 2 9 1.1.1.5011.8 1 45.7894 498.6104 45.749 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.00392031 1044.560303 523.2874 1044.556396 523.2854614 2 7 1.1.1.5090.9 1 47.6945 319.0887 47.68 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 LSSPATLNSR 0.00099075 1044.557251 523.2859 1044.556396 523.2854614 2 7 1.1.1.5204.12 1 50.476 385.6967 50.5624 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 53.3100009 LSSPATLNSR 0.0107559 1044.567017 523.2908 1044.556396 523.2854614 2 7 1.1.1.5170.13 1 49.6607 194.3521 49.6707 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 51.99999809 LSSPATLNSR 0.00050249 1044.556885 523.2857 1044.556396 523.2854614 2 10 1.1.1.4645.6 1 37.4646 1772.425 37.4007 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.74999928 LSSPATLNSR 0.00111281 1044.557495 523.286 1044.556396 523.2854614 2 10 1.1.1.4881.5 1 42.7519 963.0897 42.7603 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 48.42000008 LSSPATLNSR 0.00379824 1044.560303 523.2874 1044.556396 523.2854614 2 10 1.1.1.4809.5 1 41.1314 964.2238 41.2845 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 48.42000008 LSSPATLNSR 0.00160107 1044.558105 523.2863 1044.556396 523.2854614 2 10 1.1.1.4958.4 1 44.5618 599.3413 44.5429 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 47.330001 LSSPATLNSR 0.00099075 1044.557251 523.2859 1044.556396 523.2854614 2 10 1.1.1.4699.7 1 38.7091 1147.184 38.7379 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 43.43999922 LSSPATLNSR 0.00111281 1044.557495 523.286 1044.556396 523.2854614 2 10 1.1.1.4791.4 1 40.734 1189.663 40.7167 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.18000066 LSSPATLNSR 0.00074662 1044.557129 523.2858 1044.556396 523.2854614 2 10 1.1.1.4691.3 1 38.5089 1281.745 38.5465 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 39.44999874 LSSPATLNSR -0.00169468 1044.554688 523.2846 1044.556396 523.2854614 2 10 1.1.1.4826.5 1 41.5171 1092.519 41.4509 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 38.74999881 LSSPATLNSR 0.00050249 1044.556885 523.2857 1044.556396 523.2854614 2 10 1.1.1.4603.4 1 36.4608 1514.361 36.442 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 38.74999881 LSSPATLNSR 0.00196727 1044.558228 523.2864 1044.556396 523.2854614 2 10 1.1.1.4863.2 1 42.3682 1284.556 42.4088 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 38.74999881 LSSPATLNSR 0.00440857 1044.560913 523.2877 1044.556396 523.2854614 2 6 1.1.1.5118.11 1 48.3808 253.647 48.3942 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 37.43000031 LSSPATLNSR 0.00050249 1044.556885 523.2857 1044.556396 523.2854614 2 10 1.1.1.4526.6 1 34.7101 1514.461 34.6233 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 37.43000031 LSSPATLNSR 0.00099075 1044.557251 523.2859 1044.556396 523.2854614 2 10 1.1.1.4921.4 1 43.6944 796.3044 43.6513 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 37.43000031 LSSPATLNSR 0.00135694 1044.557617 523.2861 1044.556396 523.2854614 2 10 1.1.1.4937.4 1 44.0568 702.6649 44.1337 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 37.43000031 LSSPATLNSR 0.00099075 1044.557251 523.2859 1044.556396 523.2854614 2 9 1.1.1.5003.4 1 45.5968 449.6836 45.5824 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 35.1000011 LSSPATLNSR 0.00514096 1044.561523 523.288 1044.556396 523.2854614 2 6 1.1.1.5111.11 1 48.208 301.1202 48.1478 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.07000005 LSSPATLNSR Deamidated(N)@8 0.016442901 1045.556885 523.7857 1045.540405 523.7774658 2 10 1.1.1.4400.2 1 32.3388 835.3142 32.2986 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.07000005 LSSPATLNSR 0.0193005 1044.575684 523.2951 1044.556396 523.2854614 2 6 1.1.1.5142.12 1 48.9584 264.9606 48.9955 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 32.22000003 LSSPATLNSR Deamidated(N)@8 0.0144899 1045.554932 523.7847 1045.540405 523.7774658 2 10 1.1.1.4336.2 1 31.0523 739.299 31.0091 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 32.22000003 LSSPATLNSR 0.028211201 1044.584717 523.2996 1044.556396 523.2854614 2 7 1.1.1.5240.5 1 51.3542 199.123 51.3218 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 30.25999963 LSSPATLNSR Deamidated(N)@8 0.00936314 1045.549927 523.7822 1045.540405 523.7774658 2 10 1.1.1.4326.2 1 30.8841 914.1215 30.7386 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 27.2300005 LSSPATLNSR Deamidated(N)@8 0.015954699 1045.556519 523.7855 1045.540405 523.7774658 2 10 1.1.1.4352.2 1 31.415 855.6242 31.4821 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 27.2300005 LSSPATLNSR Deamidated(N)@8 0.018518001 1045.558838 523.7867 1045.540405 523.7774658 2 10 1.1.1.4410.2 1 32.5325 697.0786 32.5137 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 27.2300005 LSSPATLNSR 0.00099075 1044.557251 523.2859 1044.556396 523.2854614 2 9 1.1.1.4914.4 1 43.5192 796.3044 43.6513 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 26.48999989 LSSPATLNSR 0.00160107 1044.558105 523.2863 1044.556396 523.2854614 2 6 1.1.1.5097.9 1 47.8648 337.4866 47.8766 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 24.46999997 LSSPATLNSR Deamidated(N)@8 0.018762199 1045.559326 523.7869 1045.540405 523.7774658 2 9 1.1.1.4429.5 1 32.9733 698.6801 32.9062 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.68999964 LSSPATLNSR 0.00416444 1044.560425 523.2875 1044.556396 523.2854614 2 6 1.1.1.5135.6 1 48.7876 263.9595 48.777 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 18.08000058 LSSPATLNSR 0.0191784 1044.575439 523.295 1044.556396 523.2854614 2 6 1.1.1.5149.11 1 49.1326 267.1423 49.0201 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 16.96999967 LSSPATLNSR Deamidated(N)@8 0.0125368 1045.553101 523.7838 1045.540405 523.7774658 2 9 1.1.1.4360.3 1 31.5906 739.7841 31.6071 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 16.86999947 LSSPATLNSR Deamidated(N)@8 0.0153443 1045.555908 523.7852 1045.540405 523.7774658 2 9 1.1.1.4343.3 1 31.2206 834.9641 31.25 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK Deamidated(N)@13 cleaved H-N@N-term 0.00458445 1774.878296 888.4464 1774.873779 888.4441528 2 19 1.1.1.5455.20 1 56.6697 1017.052 56.8476 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK Deamidated(N)@13 cleaved H-N@N-term 0.00458445 1774.878296 888.4464 1774.873779 888.4441528 2 23 1.1.1.5462.15 1 56.8426 1038.782 56.872 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK Deamidated(N)@13 cleaved H-N@N-term 0.00458445 1774.878296 888.4464 1774.873779 888.4441528 2 22 1.1.1.5469.20 1 57.0158 1038.782 56.872 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK Deamidated(N)@13 cleaved H-N@N-term 0.00043424 1774.874023 888.4443 1774.873779 888.4441528 2 19 1.1.1.5476.18 1 57.1939 911.0474 56.9214 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.000240045 1773.890015 887.9523 1773.889771 887.9521484 2 18 1.1.1.5507.19 1 57.9671 4140.593 58.2008 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.00341373 1773.893311 887.9539 1773.889771 887.9521484 2 25 1.1.1.5514.18 1 58.1435 11066.03 58.3726 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.00085037 1773.890625 887.9526 1773.889771 887.9521484 2 28 1.1.1.5521.18 1 58.3156 9428.795 58.2743 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.00365786 1773.893433 887.954 1773.889771 887.9521484 2 27 1.1.1.5528.16 1 58.4889 25499.39 58.6232 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.00365786 1773.893433 887.954 1773.889771 887.9521484 2 27 1.1.1.5535.18 1 58.6668 25499.39 58.6232 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.00365786 1773.893433 887.954 1773.889771 887.9521484 2 27 1.1.1.5542.17 1 58.8426 28702.54 58.7751 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.00341373 1773.893311 887.9539 1773.889771 887.9521484 2 26 1.1.1.5549.19 1 59.0174 29817.98 58.9257 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.00341373 1773.893311 887.9539 1773.889771 887.9521484 2 27 1.1.1.5556.21 1 59.1925 30011.76 58.9257 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00195712 1773.887817 887.9512 1773.889771 887.9521484 2 27 1.1.1.5563.20 1 59.3667 11081.1 59.2724 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00207919 1773.887695 887.9511 1773.889771 887.9521484 2 26 1.1.1.5570.17 1 59.5406 11137.31 59.2724 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.000240045 1773.890015 887.9523 1773.889771 887.9521484 2 27 1.1.1.5577.21 1 59.7178 3862.261 59.6479 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.000240045 1773.890015 887.9523 1773.889771 887.9521484 2 24 1.1.1.5584.18 1 59.8919 3857.198 59.6479 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00012615 1773.889648 887.9521 1773.889771 887.9521484 2 24 1.1.1.5591.20 1 60.0693 2179.271 59.8994 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00256745 1773.887329 887.9509 1773.889771 887.9521484 2 23 1.1.1.5598.16 1 60.2406 1471.265 60.2499 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00256745 1773.887329 887.9509 1773.889771 887.9521484 2 26 1.1.1.5605.17 1 60.4182 1387.954 60.3758 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00268951 1773.887085 887.9508 1773.889771 887.9521484 2 19 1.1.1.5612.17 1 60.5956 1320.193 60.477 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00268951 1773.887085 887.9508 1773.889771 887.9521484 2 22 1.1.1.5619.18 1 60.7687 1325.946 60.6282 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00256745 1773.887329 887.9509 1773.889771 887.9521484 2 26 1.1.1.5626.19 1 60.9436 1465.665 61.0495 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00256745 1773.887329 887.9509 1773.889771 887.9521484 2 22 1.1.1.5633.20 1 61.1177 1465.665 61.0495 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00256745 1773.887329 887.9509 1773.889771 887.9521484 2 18 1.1.1.5640.18 1 61.2896 1503.384 61.0245 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.000240045 1773.890015 887.9523 1773.889771 887.9521484 2 19 1.1.1.5647.21 1 61.4669 793.966 61.4219 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.000240045 1773.890015 887.9523 1773.889771 887.9521484 2 21 1.1.1.5654.21 1 61.6438 760.6131 61.6231 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.0037881 1773.886108 887.9503 1773.889771 887.9521484 2 19 1.1.1.5661.20 1 61.8207 596.8542 61.8266 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.0037881 1773.886108 887.9503 1773.889771 887.9521484 2 20 1.1.1.5668.19 1 61.9957 596.8542 61.8266 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.000484175 1773.890259 887.9524 1773.889771 887.9521484 2 21 1.1.1.5694.16 1 62.6571 234.0808 62.6898 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00415429 1773.88562 887.9501 1773.889771 887.9521484 2 17 1.1.1.5701.20 1 62.8377 289.3276 62.8436 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00354397 1773.88623 887.9504 1773.889771 887.9521484 2 19 1.1.1.5708.18 1 63.0158 288.3856 62.9198 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK Oxidation(F)@11 cleaved H-N@N-term 0.00484494 1789.889526 895.952 1789.884644 895.949585 2 13 1.1.1.5396.16 1 55.1868 115.1146 55.1675 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.00147085 1773.891235 887.9529 1773.889771 887.9521484 2 15 1.1.1.5730.20 1 63.5767 220.3044 63.4807 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.94999862 NIDVLEGNEQFINAAK Deamidated(N)@13 cleaved H-N@N-term 0.000556305 1774.874268 888.4444 1774.873779 888.4441528 2 17 1.1.1.5448.21 1 56.4929 810.0341 56.6756 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.51999879 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00708385 1773.88269 887.9486 1773.889771 887.9521484 2 16 1.1.1.5676.20 1 62.2005 471.236 62.1809 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.9100008 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00627856 1773.883667 592.3018 1773.889771 592.303833 3 18 1.1.1.5550.10 1 59.0347 5642.63 58.9502 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 NIDVLEGNEQFINAAK Deamidated(N)@8 cleaved H-N@N-term 0.000556305 1774.874268 888.4444 1774.873779 888.4441528 2 15 1.1.1.5485.20 1 57.4208 343.2613 57.3766 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 92.08999872 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.0101236 1773.879639 592.3005 1773.889771 592.303833 3 12 1.1.1.5636.12 1 61.1851 343.8905 61.0742 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 84.85999703 NIDVLEGNEQFINAAK Deamidated(N)@13 cleaved H-N@N-term 0.00177695 1774.875488 888.445 1774.873779 888.4441528 2 10 1.1.1.5441.20 1 56.3128 409.5587 56.5491 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 NIDVLEGNEQFINAAK Deamidated(N)@8 cleaved H-N@N-term 0.0105207 1774.884277 592.6354 1774.873779 592.6318359 3 9 1.1.1.5551.7 1 59.0566 2227.023 58.9257 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.0147011 1773.875244 592.299 1773.889771 592.303833 3 8 1.1.1.5647.14 1 61.461 197.3445 61.4468 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.00793831 1773.881836 887.9482 1773.889771 887.9521484 2 10 1.1.1.5681.21 1 62.3287 395.705 62.3337 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.74999785 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.0101236 1773.879639 592.3005 1773.889771 592.303833 3 9 1.1.1.5628.8 1 60.9837 343.8905 61.0742 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 31.56000078 NIDVLEGNEQFINAAK cleaved H-N@N-term -0.0137856 1773.876099 592.2993 1773.889771 592.303833 3 6 1.1.1.5655.11 1 61.6609 196.9852 61.5977 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 NSRVATVSLPR Arg->GluSA(R)@3 cleaved L-N@N-term; missed R-V@3 0.018760899 1155.643433 578.829 1155.624756 578.8196411 2 8 1.1.1.4954.7 1 44.4592 429.3934 44.3503 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 NSRVATVSLPR Arg->GluSA(R)@3 cleaved L-N@N-term; missed R-V@3 0.0221787 1155.646851 578.8307 1155.624756 578.8196411 2 8 1.1.1.5043.4 1 46.5586 248.9376 46.6216 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 78.03999782 QVRLGEHNIDVLEGNEQFINAAK Gln->pyro-Glu@N-term; Cation:K(E)@6; reduced HNE(H)@7 cleaved I-Q@N-term; missed R-L@3 0.055085599 2772.439697 925.1539 2772.384766 925.1355591 3 11 1.1.1.5525.18 1 58.4155 415.4785 58.4482 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 QVRLGEHNIDVLEGNEQFINAAK Carbamyl@N-term; Cation:Na(E)@6; reduced HNE(H)@7 cleaved I-Q@N-term; missed R-L@3 0.0257154 2816.469238 939.8303 2816.443359 939.8217163 3 12 1.1.1.5558.14 1 59.2423 280.3913 59.2474 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 83.39999914 QVSLNSGSH cleaved Y-Q@N-term; cleaved H-F@C-term -0.000279016 927.4406738 464.7276 927.440979 464.7277832 2 11 1.1.1.3664.2 0 24.2772 652.996 24.1714 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 75.3000021 QVSLNSGSH cleaved Y-Q@N-term; cleaved H-F@C-term -0.000279016 927.4406738 464.7276 927.440979 464.7277832 2 11 1.1.1.3644.2 0 24.1041 2145.074 24.0581 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 RLGEHNIDVLEGNEQFINAAK cleaved V-R@N-term; missed R-L@1 -1.002840042 2365.195313 1183.605 2366.197754 1184.106201 2 9 1.1.1.5539.21 1 58.77 515.5377 58.9502 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00326899 1019.532043 510.7733 1019.528748 510.7716675 2 11 1.1.1.5010.5 0 45.7646 705.9682 45.7251 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 85.31000018 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00326899 1019.532043 510.7733 1019.528748 510.7716675 2 13 1.1.1.4918.5 1 43.6221 9325.743 43.6513 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 85.31000018 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00168214 1019.530457 510.7725 1019.528748 510.7716675 2 13 1.1.1.4933.4 1 43.9802 6553.607 43.7236 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 74.07000065 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00326899 1019.532043 510.7733 1019.528748 510.7716675 2 13 1.1.1.4925.6 1 43.7857 9325.743 43.6513 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00406241 1019.532898 510.7737 1019.528748 510.7716675 2 10 1.1.1.5002.3 1 45.5656 762.3049 45.5824 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00345209 1019.532288 510.7734 1019.528748 510.7716675 2 12 1.1.1.4948.5 1 44.3178 2141.984 44.278 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00107182 1019.529846 510.7722 1019.528748 510.7716675 2 12 1.1.1.4962.4 1 44.6579 1914.321 44.5189 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00369622 1019.532471 510.7735 1019.528748 510.7716675 2 12 1.1.1.4969.4 1 44.8269 1452.112 44.8557 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00345209 1019.532288 510.7734 1019.528748 510.7716675 2 11 1.1.1.4911.5 1 43.4538 9084.518 43.6272 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 51.99999809 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00326899 1019.532043 510.7733 1019.528748 510.7716675 2 11 1.1.1.4941.4 1 44.1526 3117.399 44.0144 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 51.99999809 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00107182 1019.529846 510.7722 1019.528748 510.7716675 2 10 1.1.1.4955.6 1 44.4849 1914.321 44.5189 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 35.1000011 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00564926 1019.534485 510.7745 1019.528748 510.7716675 2 8 1.1.1.4992.9 1 45.3713 929.2055 45.3571 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 35.1000011 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00308589 1019.53186 510.7732 1019.528748 510.7716675 2 8 1.1.1.5017.6 1 45.9316 674.7083 45.8452 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 31.79999888 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00143801 1019.530273 510.7724 1019.528748 510.7716675 2 7 1.1.1.5039.7 1 46.4637 490.321 46.4512 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 28.61999869 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00168214 1019.530457 510.7725 1019.528748 510.7716675 2 7 1.1.1.5046.6 1 46.6335 441.0757 46.6216 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 21.46999985 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00668681 1019.535461 510.775 1019.528748 510.7716675 2 6 1.1.1.5074.7 0 47.2984 293.0666 47.2416 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 18.17000061 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00143801 1019.530273 510.7724 1019.528748 510.7716675 2 7 1.1.1.5032.6 1 46.2952 606.603 46.1352 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 17.61000007 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.000644591 1019.52948 510.772 1019.528748 510.7716675 2 7 1.1.1.4985.10 1 45.204 1046.174 45.2124 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 16.69999957 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00107182 1019.529846 510.7722 1019.528748 510.7716675 2 6 1.1.1.5081.10 1 47.4716 273.7908 47.4834 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 16.59999937 SIPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00143801 1019.530273 510.7724 1019.528748 510.7716675 2 6 1.1.1.5025.5 1 46.1201 606.603 46.1352 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 SIPYQVSLNS cleaved N-S@N-term; cleaved S-G@C-term 0.00223235 1106.56311 554.2888 1106.560791 554.2876587 2 8 1.1.1.4899.6 1 43.1627 629.2155 43.0939 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSG cleaved N-S@N-term; cleaved G-S@C-term 0.0036774 1163.585815 582.8002 1163.582275 582.7984009 2 14 1.1.1.4887.2 1 42.8871 1690.345 42.88 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSG cleaved N-S@N-term; cleaved G-S@C-term 0.0036774 1163.585815 582.8002 1163.582275 582.7984009 2 14 1.1.1.4895.2 1 43.0805 1690.345 42.88 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.54999781 SIPYQVSLNSG cleaved N-S@N-term; cleaved G-S@C-term 0.000747849 1163.58313 582.7988 1163.582275 582.7984009 2 11 1.1.1.4910.4 1 43.4198 776.7969 43.267 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 SIPYQVSLNSG cleaved N-S@N-term; cleaved G-S@C-term 0.00331121 1163.585449 582.8 1163.582275 582.7984009 2 11 1.1.1.4880.6 1 42.728 1690.615 42.8561 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 SIPYQVSLNSG cleaved N-S@N-term; cleaved G-S@C-term 0.00636282 1163.588623 582.8016 1163.582275 582.7984009 2 11 1.1.1.4934.3 1 44.0038 304.4557 44.0858 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 92.93000102 SIPYQVSLNSG cleaved N-S@N-term; cleaved G-S@C-term 0.000869914 1163.58313 582.7988 1163.582275 582.7984009 2 9 1.1.1.4945.6 1 44.2488 275.7393 44.2298 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 91.20000005 SIPYQVSLNSG cleaved N-S@N-term; cleaved G-S@C-term 0.000747849 1163.58313 582.7988 1163.582275 582.7984009 2 11 1.1.1.4924.3 1 43.7608 484.1895 43.555 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 SIPYQVSLNSG cleaved N-S@N-term; cleaved G-S@C-term 0.000747849 1163.58313 582.7988 1163.582275 582.7984009 2 9 1.1.1.4917.5 1 43.5913 484.1895 43.555 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00284007 1387.676025 694.8453 1387.673218 694.8438721 2 17 1.1.1.4848.5 1 42.0231 600.4624 42.0522 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.00192044 1387.671265 694.8429 1387.673218 694.8438721 2 18 1.1.1.4863.4 1 42.3799 954.6656 42.4623 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 1.002550006 1388.675903 695.3452 1387.673218 694.8438721 2 18 1.1.1.4872.4 1 42.5584 373.3927 42.5396 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.0047931 1387.678101 694.8463 1387.673218 694.8438721 2 16 1.1.1.4887.4 1 42.8988 881.4138 42.9039 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00125323 1387.674438 694.8445 1387.673218 694.8438721 2 17 1.1.1.4903.5 1 43.2619 1074.8 43.2191 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00125323 1387.674438 694.8445 1387.673218 694.8438721 2 16 1.1.1.4910.8 1 43.4298 899.879 43.4589 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.00216457 1387.671021 694.8428 1387.673218 694.8438721 2 15 1.1.1.4954.9 1 44.4634 833.2755 44.3744 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00125323 1387.674438 694.8445 1387.673218 694.8438721 2 15 1.1.1.4961.10 1 44.6339 837.0276 44.663 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00125323 1387.674438 694.8445 1387.673218 694.8438721 2 13 1.1.1.4985.12 1 45.2074 750.0547 45.2846 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00149736 1387.674683 694.8446 1387.673218 694.8438721 2 14 1.1.1.4992.10 1 45.373 744.3215 45.3088 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.0047931 1387.678101 694.8463 1387.673218 694.8438721 2 16 1.1.1.5010.6 1 45.7679 719.2641 45.749 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00149736 1387.674683 694.8446 1387.673218 694.8438721 2 15 1.1.1.5017.8 1 45.9366 761.616 45.8934 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00186355 1387.675049 694.8448 1387.673218 694.8438721 2 14 1.1.1.5117.9 1 48.3645 544.5663 48.2708 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.0112625 1387.684448 694.8495 1387.673218 694.8438721 2 13 1.1.1.5128.7 1 48.6262 324.685 48.61 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.0108963 1387.684082 694.8493 1387.673218 694.8438721 2 12 1.1.1.5142.15 1 48.9625 458.186 48.7053 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.0010091 1387.674316 694.8444 1387.673218 694.8438721 2 14 1.1.1.5149.15 1 49.1393 409.2332 49.1443 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00528135 1387.678467 694.8465 1387.673218 694.8438721 2 15 1.1.1.5180.6 1 49.909 358.0031 49.8664 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00369452 1387.67688 694.8457 1387.673218 694.8438721 2 15 1.1.1.4832.3 1 41.66 275.3795 41.6413 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00149736 1387.674683 694.8446 1387.673218 694.8438721 2 13 1.1.1.5201.8 1 50.408 308.8066 50.3674 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00320626 1387.676514 694.8455 1387.673218 694.8438721 2 15 1.1.1.4841.5 1 41.8559 595.9771 42.0282 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00406071 1387.677246 694.8459 1387.673218 694.8438721 2 15 1.1.1.4855.9 1 42.1898 544.5599 42.1949 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00125323 1387.674438 694.8445 1387.673218 694.8438721 2 15 1.1.1.4968.5 1 44.7995 837.0276 44.663 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.0047931 1387.678101 694.8463 1387.673218 694.8438721 2 14 1.1.1.4977.6 1 45.0166 667.0891 45.0454 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00125323 1387.674438 694.8445 1387.673218 694.8438721 2 15 1.1.1.5110.4 1 48.1917 577.2354 48.1232 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.006502 1387.679688 694.8471 1387.673218 694.8438721 2 13 1.1.1.5135.10 1 48.7943 440.9362 48.7292 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.000887038 1387.674072 694.8443 1387.673218 694.8438721 2 15 1.1.1.4924.4 1 43.7667 997.2283 43.6272 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 3.26E-05 1387.673218 694.8439 1387.673218 694.8438721 2 15 1.1.1.4932.4 1 43.9566 850.3689 43.8668 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.000887038 1387.674072 694.8443 1387.673218 694.8438721 2 13 1.1.1.4940.10 1 44.1269 990.1601 44.1097 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00381658 1387.677124 694.8458 1387.673218 694.8438721 2 14 1.1.1.4947.8 1 44.2945 738.3642 44.278 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.0010091 1387.674316 694.8444 1387.673218 694.8438721 2 13 1.1.1.5002.5 1 45.5706 668.5231 45.5058 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00186355 1387.675049 694.8448 1387.673218 694.8438721 2 13 1.1.1.5024.6 1 46.1024 773.9356 46.1595 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00186355 1387.675049 694.8448 1387.673218 694.8438721 2 14 1.1.1.5031.6 1 46.2759 773.9356 46.1595 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00161942 1387.674927 694.8447 1387.673218 694.8438721 2 13 1.1.1.5038.8 1 46.4436 657.1262 46.3781 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00125323 1387.674438 694.8445 1387.673218 694.8438721 2 13 1.1.1.5045.11 1 46.6166 643.5864 46.6216 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.0044269 1387.677734 694.8461 1387.673218 694.8438721 2 15 1.1.1.5053.3 1 46.8027 597.2504 46.7423 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00125323 1387.674438 694.8445 1387.673218 694.8438721 2 14 1.1.1.5074.11 1 47.3051 626.8645 47.2895 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00198562 1387.675049 694.8448 1387.673218 694.8438721 2 13 1.1.1.5096.8 1 47.8444 596.5778 47.7782 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00125323 1387.674438 694.8445 1387.673218 694.8438721 2 14 1.1.1.5103.5 1 48.0195 577.2354 48.1232 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00430484 1387.67749 694.846 1387.673218 694.8438721 2 11 1.1.1.5170.16 1 49.6657 329.776 49.6457 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00564755 1387.678833 694.8467 1387.673218 694.8438721 2 12 1.1.1.5187.7 1 50.0763 383.6142 49.9856 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.0010091 1387.674316 694.8444 1387.673218 694.8438721 2 11 1.1.1.5156.17 1 49.3142 409.2332 49.1443 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00161942 1387.674927 694.8447 1387.673218 694.8438721 2 14 1.1.1.5065.5 1 47.0939 495.9796 47.0752 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00369452 1387.67688 694.8457 1387.673218 694.8438721 2 12 1.1.1.5089.12 1 47.6733 535.2433 47.6554 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.00155425 1387.671631 694.8431 1387.673218 694.8438721 2 13 1.1.1.4880.7 1 42.7313 936.9256 42.7364 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.000887038 1387.674072 694.8443 1387.673218 694.8438721 2 13 1.1.1.4917.7 1 43.598 997.2283 43.6272 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00430484 1387.67749 694.846 1387.673218 694.8438721 2 11 1.1.1.5082.15 1 47.4995 517.1296 47.5079 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.0044269 1387.677734 694.8461 1387.673218 694.8438721 2 10 1.1.1.5163.15 1 49.4882 331.4919 49.5199 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.8499999 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 1.002550006 1388.675903 695.3452 1387.673218 694.8438721 2 14 1.1.1.4871.5 1 42.5345 373.3927 42.5396 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 SIPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00149736 1387.674683 694.8446 1387.673218 694.8438721 2 8 1.1.1.5208.10 1 50.5803 303.3585 50.4641 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 96.6899991 SRIQVRLGEHNIDVLEGNEQFINAAK Dioxidation(R)@6 missed R-I@2; missed R-L@6 0.0749529 2981.606934 994.8762 2981.531982 994.8512573 3 16 1.1.1.5543.14 1 58.8706 416.983 58.9008 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 SRIQVRLGEHNIDVLEGNEQFINAAK Methyl(H)@10; Deamidated(N)@11 missed R-I@2; missed R-L@6 0.0409168 2964.58252 989.2015 2964.541748 989.1878662 3 12 1.1.1.5541.20 1 58.8199 878.6672 58.9008 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 58.49999785 SRIQVRLGEHNIDVLEGNEQFINAAK Deamidated(Q)@4; Methyl(H)@10 missed R-I@2; missed R-L@6 0.0369648 2964.578857 742.152 2964.541748 742.1427002 4 9 1.1.1.5545.19 1 58.9189 384.7104 58.9008 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSGSSYPSLLQCLK Delta:H(4)C(2)@N-term; Deamidated(Q)@11; Carbamidomethyl(C)@12; acrolein addition +76(K)@14 -0.0132098 1630.778076 816.3963 1630.79126 816.4028931 2 13 1.1.1.6061.20 1 72.1261 1149.422 71.9995 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSGSSYPSLLQCLK Formyl@N-term; Deamidated(Q)@11; Carbamidomethyl(C)@12; acrolein addition +76(K)@14 0.0273261 1630.782227 816.3984 1630.754883 816.3847046 2 12 1.1.1.6068.21 1 72.313 757.2745 72.186 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSGSSYPSLLQCLK Carbamidomethyl(S)@8; Carbamidomethyl(C)@12; MDA adduct +62(K)@14 -0.0256804 1644.756104 823.3853 1644.781738 823.3981323 2 12 1.1.1.6141.13 1 74.2217 6402.063 74.3268 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSGSSYPSLLQCLK Phospho(S)@8; Deamidated(Q)@11; Carbamidomethyl(C)@12; acrolein addition +38(K)@14 0.045437299 1644.756104 823.3853 1644.710693 823.3626099 2 14 1.1.1.6148.19 1 74.3958 6402.063 74.3268 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term 1.08E-05 1022.466919 512.2407 1022.466919 512.2407227 2 16 1.1.1.4309.2 1 30.5105 13041.41 30.573 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term 1.08E-05 1022.466919 512.2407 1022.466919 512.2407227 2 16 1.1.1.4316.3 1 30.6904 13041.41 30.573 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term 1.08E-05 1022.466919 512.2407 1022.466919 512.2407227 2 16 1.1.1.4325.2 1 30.8589 10626.52 30.6463 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term 1.08E-05 1022.466919 512.2407 1022.466919 512.2407227 2 16 1.1.1.4335.2 1 31.0282 5096.368 30.8389 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term -0.000355403 1022.466431 512.2405 1022.466919 512.2407227 2 16 1.1.1.4342.2 1 31.1881 3497.252 31.1774 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term -0.000599533 1022.466309 512.2404 1022.466919 512.2407227 2 16 1.1.1.4376.2 1 31.9043 1907.295 31.8857 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term -0.000233338 1022.466675 512.2406 1022.466919 512.2407227 2 16 1.1.1.4394.2 1 32.2501 1340.286 32.192 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term 0.000254922 1022.467041 512.2408 1022.466919 512.2407227 2 13 1.1.1.4421.5 1 32.7959 1034.317 32.7319 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term -0.000233338 1022.466675 512.2406 1022.466919 512.2407227 2 15 1.1.1.4440.3 1 33.1633 727.3541 33.1207 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term -0.000599533 1022.466309 512.2404 1022.466919 512.2407227 2 15 1.1.1.4458.2 1 33.519 631.8373 33.4466 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term -0.000233338 1022.466675 512.2406 1022.466919 512.2407227 2 15 1.1.1.4350.3 1 31.369 2776.137 31.3799 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term -0.000233338 1022.466675 512.2406 1022.466919 512.2407227 2 15 1.1.1.4366.4 1 31.7221 2269.905 31.6793 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term 0.00318448 1022.470093 512.2423 1022.466919 512.2407227 2 12 1.1.1.4562.3 1 35.498 204.2331 35.5507 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term 0.000254922 1022.467041 512.2408 1022.466919 512.2407227 2 13 1.1.1.4477.3 1 33.8615 416.8958 33.9248 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term 0.000254922 1022.467041 512.2408 1022.466919 512.2407227 2 10 1.1.1.4544.5 1 35.0879 259.6827 35.0452 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN cleaved N-M@C-term -0.000843663 1022.466064 512.2403 1022.466919 512.2407227 2 14 1.1.1.4384.2 1 32.0671 1863.929 31.9568 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN Nitro(Y)@3 cleaved N-M@C-term 0.000502092 1067.452515 534.7335 1067.452026 534.7332764 2 16 1.1.1.4579.2 1 35.9031 853.0943 35.9082 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 SSYPGQITGN Deamidated(N)@10 cleaved N-M@C-term 0.0187591 1023.469727 512.7421 1023.450928 512.7327271 2 13 1.1.1.4310.3 1 30.5434 3848.545 30.573 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 SSYPGQITGN cleaved N-M@C-term -0.00243051 1022.464478 512.2395 1022.466919 512.2407227 2 8 1.1.1.4583.4 1 35.9994 139.7573 35.9805 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 SSYPGQITGN cleaved N-M@C-term 0.000254922 1022.467041 512.2408 1022.466919 512.2407227 2 12 1.1.1.4302.2 1 30.33 12553.54 30.573 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 93.88999939 SSYPGQITGN cleaved N-M@C-term -0.000599533 1022.466309 512.2404 1022.466919 512.2407227 2 11 1.1.1.4414.5 1 32.6232 1077.227 32.6107 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 85.31000018 SSYPGQITGN cleaved N-M@C-term 0.00245209 1022.469238 512.2419 1022.466919 512.2407227 2 11 1.1.1.4497.3 1 34.2087 375.9143 34.1424 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 74.07000065 SSYPGQITGN cleaved N-M@C-term -0.000355403 1022.466431 512.2405 1022.466919 512.2407227 2 12 1.1.1.4405.4 1 32.4448 1210.558 32.3522 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 74.07000065 SSYPGQITGN cleaved N-M@C-term 0.00306242 1022.469849 512.2422 1022.466919 512.2407227 2 11 1.1.1.4505.3 1 34.3795 331.7828 34.2848 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 SSYPGQITGN cleaved N-M@C-term -0.000355403 1022.466431 512.2405 1022.466919 512.2407227 2 12 1.1.1.4450.4 1 33.3459 657.0641 33.3034 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 SSYPGQITGN cleaved N-M@C-term 0.000254922 1022.467041 512.2408 1022.466919 512.2407227 2 11 1.1.1.4465.3 1 33.6874 500.7018 33.6683 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 SSYPGQITGN cleaved N-M@C-term 1.08E-05 1022.466919 512.2407 1022.466919 512.2407227 2 10 1.1.1.4527.3 1 34.7373 307.0751 34.7717 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 SSYPGQITGN cleaved N-M@C-term -0.000355403 1022.466431 512.2405 1022.466919 512.2407227 2 10 1.1.1.4489.2 1 34.025 387.4084 34.0948 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.80999875 SSYPGQITGN cleaved N-M@C-term 0.0066023 1022.473511 512.244 1022.466919 512.2407227 2 11 1.1.1.4516.2 1 34.5671 298.2906 34.6014 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 59.42999721 SSYPGQITGN cleaved N-M@C-term -0.000233338 1022.466675 512.2406 1022.466919 512.2407227 2 10 1.1.1.4429.4 1 32.9691 793.9856 32.9542 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 SSYPGQITGN cleaved N-M@C-term 0.00367274 1022.470703 512.2426 1022.466919 512.2407227 2 8 1.1.1.4605.4 1 36.5086 110.1053 36.5376 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 53.3100009 SSYPGQITGN cleaved N-M@C-term 0.00342861 1022.470215 512.2424 1022.466919 512.2407227 2 8 1.1.1.4537.4 1 34.9165 226.5987 34.8543 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 21.57000005 SSYPGQITGN cleaved N-M@C-term 0.0066023 1022.473511 512.244 1022.466919 512.2407227 2 6 1.1.1.4574.6 1 35.7804 147.226 35.7412 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 18.78000051 SSYPGQITGN cleaved N-M@C-term 0.00257416 1022.469482 512.242 1022.466919 512.2407227 2 7 1.1.1.4637.3 1 37.2751 95.2668 37.16 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.8499999 TLDNDIMLIK Delta:H(4)C(2)(K)@10 cleaved N-T@N-term 0.000558809 1202.658691 602.3366 1202.658081 602.3363037 2 11 1.1.1.5736.17 0 63.7274 538.3254 63.6851 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.39000106 TLDNDIMLIK Methyl(K)@10 cleaved N-T@N-term 0.00136858 1188.643921 595.3292 1188.642456 595.3284912 2 10 1.1.1.5729.14 0 63.5466 1373.139 63.2769 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.39000106 TLDNDIMLIK cleaved N-T@N-term -2.17E-05 1174.626709 588.3206 1174.626709 588.3206787 2 8 1.1.1.5737.13 0 63.7498 311.0402 63.6595 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.10000062 TLDNDIMLIK Delta:H(4)C(2)(K)@10 cleaved N-T@N-term 0.000558809 1202.658691 602.3366 1202.658081 602.3363037 2 8 1.1.1.5729.16 0 63.5482 538.3254 63.6851 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 90.17000198 TLDNDIMLIK Deamidated(N)@4; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term 0.0217446 1203.663818 602.8392 1203.64209 602.8283081 2 7 1.1.1.5731.12 0 63.5954 318.0764 63.6851 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.00421848 1190.617432 596.316 1190.621704 596.3181152 2 10 1.1.1.5455.13 0 56.6639 2277.4 56.8968 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.005195 1190.616455 596.3155 1190.621704 596.3181152 2 12 1.1.1.5462.9 0 56.8325 5626.528 57.0216 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 15 1.1.1.5469.13 0 57.0099 6959.281 57.1231 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 16 1.1.1.5476.10 0 57.1847 6959.281 57.1231 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 15 1.1.1.5483.13 0 57.3649 5627.537 57.351 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.005195 1190.616455 596.3155 1190.621704 596.3181152 2 14 1.1.1.5490.12 0 57.5373 5640.586 57.2752 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.00775838 1190.613892 596.3142 1190.621704 596.3181152 2 13 1.1.1.5497.11 0 57.7092 4444.795 57.4516 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK Oxidation(M)@7; Methyl(K)@10 cleaved N-T@N-term 0.0118 1204.649048 603.3318 1204.637329 603.3259277 2 12 1.1.1.5506.13 0 57.9366 872.9335 57.8978 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.00421848 1190.617432 596.316 1190.621704 596.3181152 2 10 1.1.1.5525.10 0 58.4089 864.8729 58.2497 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK cleaved N-T@N-term -0.00769337 1174.619019 588.3168 1174.626709 588.3206787 2 13 1.1.1.5674.10 0 62.1409 5454.972 62.3848 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK cleaved N-T@N-term -0.00561826 1174.621216 588.3179 1174.626709 588.3206787 2 15 1.1.1.5681.11 0 62.3203 7881.058 62.562 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK cleaved N-T@N-term -0.00561826 1174.621216 588.3179 1174.626709 588.3206787 2 16 1.1.1.5688.12 0 62.498 7728.612 62.5361 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK cleaved N-T@N-term -0.00561826 1174.621216 588.3179 1174.626709 588.3206787 2 15 1.1.1.5695.14 0 62.6789 7728.612 62.5361 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK cleaved N-T@N-term -0.00366521 1174.623047 588.3188 1174.626709 588.3206787 2 13 1.1.1.5702.14 0 62.8582 6183.781 62.5873 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK cleaved N-T@N-term -0.00403141 1174.622925 588.3187 1174.626709 588.3206787 2 12 1.1.1.5709.15 0 63.0361 3368.827 62.7666 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK Methyl(K)@10 cleaved N-T@N-term -0.00461168 1188.637817 595.3262 1188.642456 595.3284912 2 13 1.1.1.5715.11 0 63.1861 1396.289 63.2769 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK cleaved N-T@N-term -0.00329902 1174.623413 588.319 1174.626709 588.3206787 2 10 1.1.1.5716.12 0 63.2128 660.7101 63.2254 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK Methyl(K)@10 cleaved N-T@N-term -0.00461168 1188.637817 595.3262 1188.642456 595.3284912 2 13 1.1.1.5722.12 0 63.366 1396.289 63.2769 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.43999767 TLDNDIMLIK cleaved N-T@N-term -0.00329902 1174.623413 588.319 1174.626709 588.3206787 2 10 1.1.1.5723.11 0 63.3907 660.7101 63.2254 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.00580533 1190.615845 596.3152 1190.621704 596.3181152 2 9 1.1.1.5504.14 0 57.8868 2470.457 57.6236 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 9 1.1.1.5511.13 0 58.0635 912.9232 57.9994 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 TLDNDIMLIK Oxidation(M)@7; Methyl(K)@10 cleaved N-T@N-term 0.0124103 1204.649902 603.3322 1204.637329 603.3259277 2 11 1.1.1.5513.13 0 58.1144 890.1987 57.9994 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.00421848 1190.617432 596.316 1190.621704 596.3181152 2 9 1.1.1.5518.5 0 58.2313 864.8729 58.2497 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term 0.0586452 1190.680298 596.3474 1190.621704 596.3181152 2 9 1.1.1.5553.12 0 59.11 18514.11 58.9008 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 TLDNDIMLIK Dethiomethyl(M)@7; MDA adduct +62(K)@10 cleaved N-T@N-term -0.00148498 1188.637451 595.326 1188.639038 595.3267822 2 8 1.1.1.5708.8 0 63.0049 1252.251 63.2515 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 67.79000163 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.00397435 1190.617676 596.3161 1190.621704 596.3181152 2 7 1.1.1.5532.11 0 58.5848 520.9286 58.5233 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 63.52000237 TLDNDIMLIK cleaved N-T@N-term 0.000222386 1174.626831 588.3207 1174.626709 588.3206787 2 4 1.1.1.5756.16 1 64.2388 271.7516 64.1457 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 58.49999785 TLDNDIMLIK Deamidated(N)@4; Oxidation(M)@7 cleaved N-T@N-term 0.0125807 1191.618286 596.8164 1191.605713 596.8101196 2 8 1.1.1.5516.8 0 58.1874 513.9291 58.1761 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 58.49999785 TLDNDIMLIK Deamidated(N)@4 cleaved N-T@N-term -0.00615223 1175.604614 588.8096 1175.610718 588.8126831 2 5 1.1.1.5599.15 0 60.2652 191.0884 60.2752 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 33.66999924 TLDNDIMLIK cleaved N-T@N-term 0.00266368 1174.629517 588.322 1174.626709 588.3206787 2 7 1.1.1.5730.9 0 63.5676 483.2747 63.3023 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 28.00000012 TLDNDIMLIK Oxidation(M)@7 cleaved N-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 6 1.1.1.5491.15 0 57.5642 5627.537 57.351 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLN Dethiomethyl(M)@7; acrolein addition +76(K)@10 cleaved N-T@N-term; cleaved N-S@C-term; missed K-L@10 0.00797069 1986.075317 994.0449 1986.067383 994.0409546 2 20 1.1.1.5990.21 1 70.2682 8917.43 70.3513 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLN Dethiomethyl(M)@7; acrolein addition +76(K)@10 cleaved N-T@N-term; cleaved N-S@C-term; missed K-L@10 0.00870307 1986.07605 994.0453 1986.067383 994.0409546 2 20 1.1.1.6000.21 1 70.527 9696.976 70.5058 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLN Oxidation(M)@7 cleaved N-T@N-term; cleaved N-S@C-term; missed K-L@10 0.00441788 1974.038818 988.0267 1974.034302 988.0244751 2 12 1.1.1.5789.21 1 65.0892 397.1838 65.0685 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLN Dethiomethyl(M)@7; acrolein addition +76(K)@10 cleaved N-T@N-term; cleaved N-S@C-term; missed K-L@10 0.00809276 1986.075439 994.045 1986.067383 994.0409546 2 18 1.1.1.5981.18 1 70.033 7939.146 70.2216 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLN Dethiomethyl(M)@7; acrolein addition +76(K)@10 cleaved N-T@N-term; cleaved N-S@C-term; missed K-L@10 0.00797069 1986.075317 994.0449 1986.067383 994.0409546 2 19 1.1.1.5991.21 1 70.2947 8917.43 70.3513 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLN Dethiomethyl(M)@7; acrolein addition +76(K)@10 cleaved N-T@N-term; cleaved N-S@C-term; missed K-L@10 0.00797069 1986.075317 994.0449 1986.067383 994.0409546 2 17 1.1.1.5993.21 1 70.3462 8917.43 70.3513 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.39000106 TLDNDIMLIKLSSPATLN Dethiomethyl(M)@7; acrolein addition +76(K)@10 cleaved N-T@N-term; cleaved N-S@C-term; missed K-L@10 0.00102236 1986.068481 663.0301 1986.067383 663.0297241 3 13 1.1.1.6009.17 1 70.7554 9520.667 70.4804 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 96.85999751 TLDNDIMLIKLSSPATLN Dethiomethyl(M)@7; acrolein addition +76(K)@10 cleaved N-T@N-term; cleaved N-S@C-term; missed K-L@10 0.00431809 1986.071777 663.0312 1986.067383 663.0297241 3 12 1.1.1.6002.19 1 70.5768 9960.811 70.403 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.63000202 TLDNDIMLIKLSSPATLN cleaved N-T@N-term; cleaved N-S@C-term; missed K-L@10 -0.00458909 1958.034668 653.6855 1958.039429 653.6870728 3 8 1.1.1.5940.16 1 68.964 621.6118 68.9469 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10; Deamidated(N)@18 cleaved N-T@N-term; missed K-L@10 0.0392492 2230.227051 744.4163 2230.187988 744.4032593 3 16 1.1.1.6085.19 1 72.7609 690.367 72.7153 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.036143199 2229.23999 744.0873 2229.203857 744.0752563 3 24 1.1.1.6101.20 1 73.186 6173.529 73.3518 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.036143199 2229.23999 744.0873 2229.203857 744.0752563 3 22 1.1.1.6115.20 1 73.5569 6173.529 73.3518 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -6.60E-05 2245.198975 749.4069 2245.19873 749.4068604 3 22 1.1.1.6015.21 1 70.9169 9365.106 71.0784 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -6.60E-05 2245.198975 749.4069 2245.19873 749.4068604 3 22 1.1.1.6022.18 1 71.0966 9365.106 71.0784 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -6.60E-05 2245.198975 749.4069 2245.19873 749.4068604 3 19 1.1.1.6029.18 1 71.2802 9365.106 71.0784 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -0.000615299 2245.198242 749.4067 2245.19873 749.4068604 3 13 1.1.1.6008.17 1 70.7292 6175.188 70.9747 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.75000215 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -0.00320474 2245.195801 562.3062 2245.19873 562.3069458 4 11 1.1.1.6020.14 1 71.0408 642.6378 71.0784 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 VATVSLPR 0.00307499 841.505249 421.7599 841.5021362 421.7583618 2 6 1.1.1.5741.2 1 63.8428 253.1491 63.5826 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 VATVSLPR 0.00228156 841.5044556 421.7595 841.5021362 421.7583618 2 7 1.1.1.5785.2 1 64.9709 252.6548 65.0429 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 VATVSLPR Delta:H(2)C(2)@N-term 0.0030054 867.520874 434.7677 867.5178223 434.7661743 2 9 1.1.1.5019.4 1 45.9756 469.2715 45.9658 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 VATVSLPR Dehydrated(T)@3 0.00434362 823.4958496 412.7552 823.4915771 412.7530823 2 10 1.1.1.4909.2 1 43.3933 1267.268 43.4109 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 VATVSLPR 0.00429564 841.5064697 421.7605 841.5021362 421.7583618 2 7 1.1.1.5763.3 1 64.4068 273.3734 64.3244 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 VATVSLPR 0.00411254 841.5062866 421.7604 841.5021362 421.7583618 2 7 1.1.1.5861.3 1 66.9012 205.8748 66.8951 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.8499999 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 13 1.1.1.4948.4 1 44.3144 16994.54 44.3744 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.8499999 VATVSLPR Dehydrated(T)@3 -0.00224792 823.489502 412.752 823.4915771 412.7530823 2 9 1.1.1.4982.2 1 45.1205 2378.355 45.1645 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 VATVSLPR Oxidation(P)@7 0.00192353 857.4990845 429.7568 857.4970703 429.7557983 2 10 1.1.1.4513.4 1 34.4917 228.0538 34.4427 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.17000031 VATVSLPR Delta:H(4)C(2)@N-term 0.00302174 869.536499 435.7755 869.5334473 435.7740173 2 12 1.1.1.4955.3 1 44.4774 16982.57 44.495 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Oxidation(P)@7 0.0013132 857.4984741 429.7565 857.4970703 429.7557983 2 10 1.1.1.4316.2 1 30.6821 137.6361 30.5972 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Pro->pyro-Glu(P)@7 0.00184552 855.4832764 428.7489 855.4814453 428.7479858 2 9 1.1.1.4526.3 1 34.7018 389.2543 34.7717 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Pro->pyro-Glu(P)@7 0.00422579 855.4856567 428.7501 855.4814453 428.7479858 2 11 1.1.1.4550.4 1 35.2248 745.7789 35.3316 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 12 1.1.1.4638.3 1 37.2892 32722.91 37.2321 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Dehydrated(T)@3 0.00391639 823.4954834 412.755 823.4915771 412.7530823 2 8 1.1.1.4648.2 1 37.5259 1389.383 37.4248 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00222832 869.5356445 435.7751 869.5334473 435.7740173 2 12 1.1.1.4652.3 1 37.6305 15999.98 37.7137 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00222832 869.5356445 435.7751 869.5334473 435.7740173 2 12 1.1.1.4659.3 1 37.7938 15999.98 37.7137 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00222832 869.5356445 435.7751 869.5334473 435.7740173 2 12 1.1.1.4668.3 1 37.9779 15633.32 37.8105 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 12 1.1.1.4705.3 1 38.8248 11137.88 38.8382 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 12 1.1.1.4721.3 1 39.2118 10999.08 39.1696 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 12 1.1.1.4778.3 1 40.4508 9618.722 40.5033 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 12 1.1.1.4786.3 1 40.6405 9098.13 40.5981 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Dehydrated(T)@3 0.00416052 823.4958496 412.7552 823.4915771 412.7530823 2 10 1.1.1.4879.2 1 42.6957 1362.189 42.6886 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 12 1.1.1.4881.3 1 42.7452 15082.19 42.7364 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 12 1.1.1.4896.4 1 43.1126 14037.44 43.0939 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Dehydrated(T)@3 0.00416052 823.4958496 412.7552 823.4915771 412.7530823 2 10 1.1.1.4902.2 1 43.2296 1403.726 43.267 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 12 1.1.1.4904.3 1 43.2801 16630.12 43.243 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.0042424 869.5376587 435.7761 869.5334473 435.7740173 2 12 1.1.1.4911.4 1 43.4496 15029.44 43.507 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 12 1.1.1.4933.3 1 43.9743 13321.57 43.9142 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 12 1.1.1.5009.5 1 45.7405 19309.72 45.773 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 12 1.1.1.5023.4 1 46.0773 19733.37 46.014 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Dehydrated(T)@3 0.00355019 823.4953003 412.7549 823.4915771 412.7530823 2 8 1.1.1.5032.3 1 46.2877 1166.361 46.2567 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(2)C(2)@N-term -0.00883495 867.5088501 434.7617 867.5178223 434.7661743 2 9 1.1.1.5044.6 1 46.5838 1701.165 46.3781 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 12 1.1.1.5051.5 1 46.7578 19984.11 46.6216 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Dehydrated(T)@3 0.00373329 823.4953003 412.7549 823.4915771 412.7530823 2 9 1.1.1.5061.2 1 46.9862 948.5545 46.98 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VATVSLPR Delta:H(4)C(2)@N-term 0.00466963 869.5380859 435.7763 869.5334473 435.7740173 2 9 1.1.1.5321.4 1 53.3274 5525.286 53.4196 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 96.39000297 VATVSLPR Dehydrated(T)@3 0.00355019 823.4953003 412.7549 823.4915771 412.7530823 2 8 1.1.1.4814.2 1 41.2369 1162.279 41.2845 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 96.39000297 VATVSLPR Dehydrated(T)@3 0.00373329 823.4953003 412.7549 823.4915771 412.7530823 2 7 1.1.1.5090.4 1 47.6862 1101.884 47.6554 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 96.39000297 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 9 1.1.1.5335.3 1 53.6743 4531.203 53.6944 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 96.39000297 VATVSLPR Delta:H(4)C(2)@N-term 0.00485273 869.538269 435.7764 869.5334473 435.7740173 2 8 1.1.1.5370.4 1 54.5301 3286.19 54.5494 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.46999931 VATVSLPR Oxidation(P)@7 0.0011301 857.498291 429.7564 857.4970703 429.7557983 2 11 1.1.1.4551.3 1 35.247 499.9649 35.2365 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.46999931 VATVSLPR Dehydrated(T)@3 0.00330606 823.494873 412.7547 823.4915771 412.7530823 2 7 1.1.1.4552.2 1 35.2657 2511.758 35.2841 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.46999931 VATVSLPR Oxidation(P)@7 0.00491413 857.5020752 429.7583 857.4970703 429.7557983 2 10 1.1.1.4559.2 1 35.4143 604.669 35.3553 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.46999931 VATVSLPR Dehydrated(T)@3 0.0063577 823.4980469 412.7563 823.4915771 412.7530823 2 9 1.1.1.4806.2 1 41.0661 1049.278 41.0599 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.46999931 VATVSLPR Dehydrated(T)@3 0.00416052 823.4958496 412.7552 823.4915771 412.7530823 2 9 1.1.1.4923.2 1 43.7342 1330.408 43.7236 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.46999931 VATVSLPR Dehydrated(T)@3 0.00293986 823.4944458 412.7545 823.4915771 412.7530823 2 9 1.1.1.4966.2 1 44.7428 1416.938 44.7355 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.46999931 VATVSLPR Delta:H(2)C(2)@N-term -0.00859081 867.5092773 434.7619 867.5178223 434.7661743 2 7 1.1.1.5028.3 1 46.188 1691.466 46.3781 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.46999931 VATVSLPR Dehydrated(T)@3 0.00391639 823.4954834 412.755 823.4915771 412.7530823 2 8 1.1.1.5069.4 1 47.1789 1011.962 47.194 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.46999931 VATVSLPR Delta:H(2)C(2)@N-term -0.00303684 867.5146484 434.7646 867.5178223 434.7661743 2 7 1.1.1.5105.3 1 48.0538 1239.208 48.0493 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 92.93000102 VATVSLPR Delta:H(4)C(2)@N-term 0.00466963 869.5380859 435.7763 869.5334473 435.7740173 2 11 1.1.1.4827.3 1 41.535 10749.02 41.4984 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 92.93000102 VATVSLPR Dehydrated(T)@3 0.00391639 823.4954834 412.755 823.4915771 412.7530823 2 8 1.1.1.4938.2 1 44.0674 1311.53 44.1097 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 92.93000102 VATVSLPR Delta:H(4)C(2)@N-term 0.00466963 869.5380859 435.7763 869.5334473 435.7740173 2 6 1.1.1.5304.4 1 52.9114 5440.206 52.9306 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 91.20000005 VATVSLPR Pro->pyro-Glu(P)@7 0.00422579 855.4856567 428.7501 855.4814453 428.7479858 2 10 1.1.1.4558.6 1 35.3997 742.6364 35.3316 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 91.20000005 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 11 1.1.1.4770.3 1 40.2694 9002.466 40.2609 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 91.20000005 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 11 1.1.1.4834.3 1 41.6993 11023.22 41.7365 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 91.20000005 VATVSLPR Delta:H(4)C(2)@N-term 0.00302174 869.536499 435.7755 869.5334473 435.7740173 2 11 1.1.1.5001.5 1 45.5502 17826 45.6061 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 91.20000005 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 11 1.1.1.5059.6 1 46.9461 19310.95 46.7184 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 91.20000005 VATVSLPR Delta:H(4)C(2)@N-term 0.00466963 869.5380859 435.7763 869.5334473 435.7740173 2 11 1.1.1.5081.6 1 47.4658 18684.15 47.5079 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Dehydrated(T)@3 0.00330606 823.494873 412.7547 823.4915771 412.7530823 2 7 1.1.1.4655.2 1 37.6945 1178.746 37.7137 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Delta:H(4)C(2)@N-term 0.00222832 869.5356445 435.7751 869.5334473 435.7740173 2 11 1.1.1.4762.4 1 40.1083 10183.17 40.0423 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 11 1.1.1.4795.3 1 40.8175 9951.837 40.8462 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Deamidated(R)@8 0.021838 842.5080566 422.2613 842.486145 422.2503662 2 10 1.1.1.4798.2 1 40.877 7236.697 40.8938 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Delta:H(4)C(2)@N-term 0.00302174 869.536499 435.7755 869.5334473 435.7740173 2 11 1.1.1.4803.3 1 41.0016 10649.55 41.0837 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 11 1.1.1.4849.3 1 42.0371 13573.68 41.9804 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Dehydrated(T)@3 0.00513704 823.4967041 412.7556 823.4915771 412.7530823 2 9 1.1.1.4854.2 1 42.1544 1248.811 42.1474 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Delta:H(4)C(2)@N-term 0.00662267 869.5401001 435.7773 869.5334473 435.7740173 2 11 1.1.1.4856.3 1 42.2035 11879.19 42.1712 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Delta:H(4)C(2)@N-term 0.00302174 869.536499 435.7755 869.5334473 435.7740173 2 11 1.1.1.4888.3 1 42.9168 13963.69 42.8321 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 11 1.1.1.5044.7 1 46.5855 19984.11 46.6216 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Delta:H(4)C(2)@N-term 0.0042424 869.5376587 435.7761 869.5334473 435.7740173 2 11 1.1.1.5067.4 1 47.1372 18798.62 47.2895 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Delta:H(4)C(2)@N-term 0.00222832 869.5356445 435.7751 869.5334473 435.7740173 2 11 1.1.1.5123.6 1 48.5064 21830.48 48.2461 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 89.07999992 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 10 1.1.1.5152.7 1 49.2025 16493.93 49.1443 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 88.63999844 VATVSLPR Delta:H(4)C(2)@N-term -0.00581462 869.5276489 435.7711 869.5334473 435.7740173 2 9 1.1.1.5512.5 1 58.0823 1134.426 57.9739 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 11 1.1.1.4631.4 1 37.1192 32722.91 37.2321 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 11 1.1.1.4645.3 1 37.4562 33778.23 37.2081 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00222832 869.5356445 435.7751 869.5334473 435.7740173 2 11 1.1.1.4676.3 1 38.1437 13168.38 38.1366 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 11 1.1.1.4729.5 1 39.3825 11601.61 39.4585 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 11 1.1.1.4737.3 1 39.5716 9910.759 39.624 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00302174 869.536499 435.7755 869.5334473 435.7740173 2 11 1.1.1.4746.3 1 39.7479 9728.447 39.6476 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 11 1.1.1.4754.3 1 39.9188 8555.809 39.8239 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00302174 869.536499 435.7755 869.5334473 435.7740173 2 11 1.1.1.4811.3 1 41.1707 10707.8 41.0837 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 11 1.1.1.4873.3 1 42.5739 14388.5 42.6408 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.0042424 869.5376587 435.7761 869.5334473 435.7740173 2 11 1.1.1.4918.4 1 43.618 16554.08 43.6513 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.0042424 869.5376587 435.7761 869.5334473 435.7740173 2 11 1.1.1.4925.5 1 43.7832 16554.08 43.6513 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 11 1.1.1.4941.3 1 44.1467 16701.24 44.1097 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 11 1.1.1.4962.3 1 44.6521 18824.68 44.6872 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 11 1.1.1.4969.3 1 44.821 17925.01 44.832 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Dehydrated(T)@3 0.00434362 823.4958496 412.7552 823.4915771 412.7530823 2 8 1.1.1.4974.2 1 44.9322 1523.774 44.9032 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 11 1.1.1.4977.4 1 45.01 17925.01 44.832 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 11 1.1.1.4985.6 1 45.1973 17996.26 45.1645 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00302174 869.536499 435.7755 869.5334473 435.7740173 2 11 1.1.1.5016.4 1 45.9082 19246.33 45.9175 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Dehydrated(T)@3 0.00330606 823.494873 412.7547 823.4915771 412.7530823 2 7 1.1.1.5025.3 1 46.1167 1315.947 46.1595 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 11 1.1.1.5037.5 1 46.4117 21370.62 46.3781 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.0042424 869.5376587 435.7761 869.5334473 435.7740173 2 11 1.1.1.5074.6 1 47.2967 18798.62 47.2895 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(2)C(2)@N-term 0.00239507 867.5202637 434.7674 867.5178223 434.7661743 2 8 1.1.1.5090.7 1 47.6912 695.0876 47.6554 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(2)C(2)@N-term -0.00303684 867.5146484 434.7646 867.5178223 434.7661743 2 8 1.1.1.5098.3 1 47.8827 1239.208 48.0493 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.0010687 869.5344849 435.7745 869.5334473 435.7740173 2 11 1.1.1.5102.8 1 47.984 30323.76 48.0493 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00302174 869.536499 435.7755 869.5334473 435.7740173 2 11 1.1.1.5131.7 1 48.6902 15487.8 48.7053 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(2)C(2)@N-term -0.00224341 867.5155029 434.765 867.5178223 434.7661743 2 8 1.1.1.5161.5 1 49.4297 832.7081 49.4195 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 11 1.1.1.5182.3 1 49.9467 11075.93 49.9856 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 86.51000261 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 11 1.1.1.5246.2 1 51.498 9495.329 51.4671 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 83.39999914 VATVSLPR Dehydrated(T)@3 0.00330606 823.494873 412.7547 823.4915771 412.7530823 2 8 1.1.1.4729.2 1 39.37 749.6467 39.4348 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 83.39999914 VATVSLPR Dehydrated(T)@3 0.00470981 823.4962769 412.7554 823.4915771 412.7530823 2 9 1.1.1.4831.2 1 41.6362 1132.242 41.6413 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 83.39999914 VATVSLPR Dehydrated(T)@3 0.00495394 823.4967041 412.7556 823.4915771 412.7530823 2 8 1.1.1.4846.2 1 41.962 1490.701 41.9565 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 83.39999914 VATVSLPR Dehydrated(T)@3 0.00391639 823.4954834 412.755 823.4915771 412.7530823 2 7 1.1.1.5039.3 1 46.457 1376.557 46.4025 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 82.19000101 VATVSLPR 0.993061006 842.4953003 422.2549 841.5021362 421.7583618 2 8 1.1.1.5474.3 1 57.1283 754.274 56.9965 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 80.00000119 VATVSLPR 0.00252569 841.5046997 421.7596 841.5021362 421.7583618 2 5 1.1.1.5847.2 1 66.5395 227.4365 66.5862 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Oxidation(P)@7 0.00192353 857.4990845 429.7568 857.4970703 429.7557983 2 9 1.1.1.4466.4 1 33.7111 158.1887 33.6925 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Oxidation(P)@7 0.00332728 857.5004883 429.7575 857.4970703 429.7557983 2 9 1.1.1.4524.2 1 34.6575 333.0377 34.7424 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Oxidation(P)@7 0.00174043 857.4989014 429.7567 857.4970703 429.7557983 2 9 1.1.1.4537.2 1 34.9082 320.2118 34.801 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Dehydrated(T)@3 0.00416052 823.4958496 412.7552 823.4915771 412.7530823 2 8 1.1.1.4613.2 1 36.6875 1472.74 36.7051 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Dehydrated(T)@3 0.00513704 823.4967041 412.7556 823.4915771 412.7530823 2 9 1.1.1.4785.2 1 40.605 806.4227 40.5981 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Dehydrated(T)@3 0.00391639 823.4954834 412.755 823.4915771 412.7530823 2 9 1.1.1.4838.2 1 41.7911 1135.753 41.7365 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Dehydrated(T)@3 0.00452671 823.4960938 412.7553 823.4915771 412.7530823 2 9 1.1.1.4894.2 1 43.065 1305.819 43.0701 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Deamidated(R)@8 0.022814499 842.5090942 422.2618 842.486145 422.2503662 2 10 1.1.1.4930.3 1 43.9033 9059.732 43.8431 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Dehydrated(T)@3 0.00355019 823.4953003 412.7549 823.4915771 412.7530823 2 7 1.1.1.4945.2 1 44.2354 1393.897 44.278 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Acetyl@N-term 0.00280915 883.5155029 442.765 883.5126953 442.7636414 2 6 1.1.1.5025.4 1 46.1184 290.8571 46.1838 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Delta:H(4)C(2)@N-term 0.00466963 869.5380859 435.7763 869.5334473 435.7740173 2 9 1.1.1.5028.4 1 46.1889 21378.8 46.1595 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Dehydrated(T)@3 0.00391639 823.4954834 412.755 823.4915771 412.7530823 2 7 1.1.1.5076.6 1 47.349 1042.931 47.3617 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 10 1.1.1.5138.7 1 48.8567 16009.2 48.8493 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 11 1.1.1.5197.2 1 50.3027 11644.16 50.3434 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Delta:H(4)C(2)@N-term 0.00466963 869.5380859 435.7763 869.5334473 435.7740173 2 9 1.1.1.5211.4 1 50.6421 11525.19 50.6365 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Delta:H(4)C(2)@N-term 0.00466963 869.5380859 435.7763 869.5334473 435.7740173 2 9 1.1.1.5218.7 1 50.8182 11525.19 50.6365 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 9 1.1.1.5239.4 1 51.3271 7731.422 51.3218 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 8 1.1.1.5309.3 1 53.0319 5433.255 53.052 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Delta:H(4)C(2)@N-term 0.00466963 869.5380859 435.7763 869.5334473 435.7740173 2 8 1.1.1.5328.3 1 53.4991 5525.286 53.4196 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Delta:H(4)C(2)@N-term 0.00466963 869.5380859 435.7763 869.5334473 435.7740173 2 8 1.1.1.5349.4 1 54.0165 4461.554 53.9876 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 79.68000174 VATVSLPR Delta:H(4)C(2)@N-term 0.00485273 869.538269 435.7764 869.5334473 435.7740173 2 9 1.1.1.5384.4 1 54.8845 3616.211 54.8274 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 VATVSLPR Formyl@N-term 0.0267868 869.5238647 435.7692 869.4970703 435.7557983 2 7 1.1.1.5456.4 1 56.6811 1514.399 56.6756 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 VATVSLPR Formyl@N-term 0.028800899 869.5258789 435.7702 869.4970703 435.7557983 2 7 1.1.1.5519.7 1 58.2575 1031.297 58.2743 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 75.3000021 VATVSLPR Oxidation(P)@7 0.00174043 857.4989014 429.7567 857.4970703 429.7557983 2 9 1.1.1.4457.3 1 33.4949 198.9893 33.5 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 75.3000021 VATVSLPR Dehydrated(T)@3 0.00293986 823.4944458 412.7545 823.4915771 412.7530823 2 9 1.1.1.4554.2 1 35.314 2901.42 35.3845 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 75.3000021 VATVSLPR Delta:H(4)C(2)@N-term 0.00247245 869.5358887 435.7752 869.5334473 435.7740173 2 10 1.1.1.4624.4 1 36.9564 25508.47 37.184 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 75.3000021 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 9 1.1.1.5088.5 1 47.637 20295.66 47.68 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 75.3000021 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 10 1.1.1.5159.6 1 49.3769 14572.59 49.5199 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 75.3000021 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 10 1.1.1.5173.4 1 49.7281 13980.1 49.6203 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 70.78999877 VATVSLPR Delta:H(4)C(2)@N-term -0.0078287 869.5256958 435.7701 869.5334473 435.7740173 2 7 1.1.1.5412.3 1 55.5729 2801.047 55.4915 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 70.78999877 VATVSLPR Formyl@N-term 0.0285568 869.5256958 435.7701 869.4970703 435.7557983 2 7 1.1.1.5470.5 1 57.0284 1902.67 57.0216 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 70.78999877 VATVSLPR Formyl@N-term 0.026603701 869.5236816 435.7691 869.4970703 435.7557983 2 7 1.1.1.5491.3 1 57.5542 1371.545 57.5989 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 70.20999789 VATVSLPR Dehydrated(T)@3 0.00355019 823.4953003 412.7549 823.4915771 412.7530823 2 9 1.1.1.4634.2 1 37.1946 1335.138 37.2321 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 70.20999789 VATVSLPR Dehydrated(T)@3 0.00416052 823.4958496 412.7552 823.4915771 412.7530823 2 6 1.1.1.5184.3 1 49.9912 581.2676 49.9856 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 70.20999789 VATVSLPR Delta:H(4)C(2)@N-term 0.00466963 869.5380859 435.7763 869.5334473 435.7740173 2 7 1.1.1.5342.3 1 53.8474 4312.78 53.7696 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 70.20999789 VATVSLPR Delta:H(4)C(2)@N-term 0.00485273 869.538269 435.7764 869.5334473 435.7740173 2 10 1.1.1.5391.2 1 55.0571 3261.858 54.9738 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 66.00000262 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 7 1.1.1.4609.3 1 36.5909 49167.54 36.5376 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.74999785 VATVSLPR Formyl@N-term 0.0285568 869.5256958 435.7701 869.4970703 435.7557983 2 7 1.1.1.5405.4 1 55.3965 2881.348 55.3651 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Oxidation(P)@7 -0.018278301 857.4788818 429.7467 857.4970703 429.7557983 2 8 1.1.1.3962.2 1 26.7572 101.2154 26.7319 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Deamidated(R)@8 0.021838 842.5080566 422.2613 842.486145 422.2503662 2 10 1.1.1.4553.4 1 35.2928 22917.51 35.3845 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Dehydrated(T)@3 0.00312296 823.4946899 412.7546 823.4915771 412.7530823 2 9 1.1.1.4562.2 1 35.4897 2875.578 35.3845 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Pro->pyro-Glu(P)@7 0.039258599 855.5206909 428.7676 855.4814453 428.7479858 2 10 1.1.1.4575.2 1 35.7992 7131.775 36.0286 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Pro->pyro-Glu(P)@7 0.0386483 855.5200806 428.7673 855.4814453 428.7479858 2 11 1.1.1.4603.2 1 36.4491 4001.159 36.4179 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Dehydrated(T)@3 0.00330606 823.494873 412.7547 823.4915771 412.7530823 2 8 1.1.1.4671.2 1 38.0465 952.8489 37.965 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Dehydrated(T)@3 0.00330606 823.494873 412.7547 823.4915771 412.7530823 2 8 1.1.1.4695.2 1 38.6017 859.2219 38.5465 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Delta:H(4)C(2)@N-term 0.00247245 869.5358887 435.7752 869.5334473 435.7740173 2 10 1.1.1.4697.4 1 38.655 14875.85 38.5465 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 10 1.1.1.4713.4 1 39.0185 12011.19 38.9567 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Pro->pyro-Glu(P)@7 0.039868899 855.5213013 428.7679 855.4814453 428.7479858 2 11 1.1.1.4778.2 1 40.4424 3917.881 40.5744 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 10 1.1.1.4842.4 1 41.8698 12227.6 41.8373 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Pro->pyro-Glu(P)@7 0.039624799 855.5210571 428.7678 855.4814453 428.7479858 2 11 1.1.1.4864.3 1 42.3938 5980.352 42.4145 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Dehydrated(T)@3 0.00416052 823.4958496 412.7552 823.4915771 412.7530823 2 9 1.1.1.4886.2 1 42.8749 1236.87 42.8561 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Dehydrated(T)@3 0.00355019 823.4953003 412.7549 823.4915771 412.7530823 2 7 1.1.1.4952.2 1 44.4051 1393.897 44.278 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Dehydrated(T)@3 -0.00224792 823.489502 412.752 823.4915771 412.7530823 2 7 1.1.1.4989.3 1 45.292 2378.355 45.1645 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Dehydrated(T)@3 0.00373329 823.4953003 412.7549 823.4915771 412.7530823 2 10 1.1.1.5004.2 1 45.6248 1230.134 45.6536 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 10 1.1.1.5095.6 1 47.8098 20980.28 47.8028 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Delta:H(2)C(2)@N-term 0.00257817 867.5204468 434.7675 867.5178223 434.7661743 2 6 1.1.1.5118.7 1 48.3775 763.6067 48.3942 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Dehydrated(T)@3 0.00355019 823.4953003 412.7549 823.4915771 412.7530823 2 5 1.1.1.5149.2 1 49.1234 854.4906 49.1443 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 10 1.1.1.5189.2 1 50.1105 10584.45 50.2003 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Dehydrated(T)@3 0.00495394 823.4967041 412.7556 823.4915771 412.7530823 2 6 1.1.1.5191.3 1 50.159 584.72 50.2241 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Delta:H(4)C(2)@N-term 0.00204522 869.5354614 435.775 869.5334473 435.7740173 2 8 1.1.1.5274.3 1 52.1795 6340.599 52.1754 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 64.38999772 VATVSLPR Delta:H(4)C(2)@N-term 0.00485273 869.538269 435.7764 869.5334473 435.7740173 2 7 1.1.1.5377.6 1 54.7084 3616.211 54.8274 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.650002 VATVSLPR Delta:H(4)C(2)@N-term -0.00941556 869.5240479 435.7693 869.5334473 435.7740173 2 8 1.1.1.5419.5 1 55.7535 2835.971 55.6949 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.650002 VATVSLPR Delta:H(4)C(2)@N-term -0.00758457 869.5258789 435.7702 869.5334473 435.7740173 2 7 1.1.1.5463.5 1 56.8536 1646.057 56.8476 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 61.650002 VATVSLPR Formyl@N-term 0.0269699 869.5240479 435.7693 869.4970703 435.7557983 2 5 1.1.1.5561.3 1 59.3024 668.6262 59.3474 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 58.49999785 VATVSLPR Formyl@N-term 0.0269699 869.5240479 435.7693 869.4970703 435.7557983 2 6 1.1.1.5426.5 1 55.9264 2877.827 55.6693 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 58.49999785 VATVSLPR Formyl@N-term 0.025993399 869.5230713 435.7688 869.4970703 435.7557983 2 7 1.1.1.5433.4 1 56.0973 2302.169 56.0915 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 58.49999785 VATVSLPR Formyl@N-term 0.026359599 869.5234985 435.769 869.4970703 435.7557983 2 6 1.1.1.5449.4 1 56.504 1915.012 56.3954 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 58.49999785 VATVSLPR Delta:H(4)C(2)@N-term -0.00941556 869.5240479 435.7693 869.5334473 435.7740173 2 5 1.1.1.5568.4 1 59.4796 668.6262 59.3474 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Pro->pyro-Glu(P)@7 0.0036765 855.4850464 428.7498 855.4814453 428.7479858 2 9 1.1.1.4566.2 1 35.5817 632.7753 35.4794 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Dehydrated(T)@3 0.00355019 823.4953003 412.7549 823.4915771 412.7530823 2 8 1.1.1.4627.2 1 37.0266 1365.208 37.0401 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Pro->pyro-Glu(P)@7 0.038831402 855.5202637 428.7674 855.4814453 428.7479858 2 10 1.1.1.4631.3 1 37.1176 7397.26 37.0401 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 10 1.1.1.4683.3 1 38.3103 15004.81 38.3288 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Dehydrated(T)@3 0.00391639 823.4954834 412.755 823.4915771 412.7530823 2 8 1.1.1.4688.2 1 38.4321 896.8633 38.4255 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.00265555 869.5360718 435.7753 869.5334473 435.7740173 2 10 1.1.1.4690.4 1 38.483 14812.32 38.4497 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Dehydrated(T)@3 0.0065408 823.4980469 412.7563 823.4915771 412.7530823 2 8 1.1.1.4750.2 1 39.83 817.8199 39.8476 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Dehydrated(T)@3 0.00355019 823.4953003 412.7549 823.4915771 412.7530823 2 8 1.1.1.4777.2 1 40.4187 978.2919 40.4084 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 10 1.1.1.4819.3 1 41.3424 10321.73 41.2845 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Dehydrated(T)@3 0.00452671 823.4960938 412.7553 823.4915771 412.7530823 2 9 1.1.1.4823.2 1 41.4458 1145.383 41.4509 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 10 1.1.1.4864.4 1 42.3971 14960.8 42.4383 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Dehydrated(T)@3 0.00330606 823.494873 412.7547 823.4915771 412.7530823 2 7 1.1.1.4959.2 1 44.5741 1328.896 44.5429 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 10 1.1.1.4992.6 1 45.3663 17729.9 45.3088 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Acetyl@N-term -0.00695608 883.5058594 442.7602 883.5126953 442.7636414 2 8 1.1.1.4995.3 1 45.4236 530.8552 45.387 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Dehydrated(T)@3 0.00355019 823.4953003 412.7549 823.4915771 412.7530823 2 7 1.1.1.5018.3 1 45.9482 1319.591 45.9175 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.00466963 869.5380859 435.7763 869.5334473 435.7740173 2 10 1.1.1.5030.4 1 46.2374 21378.8 46.1595 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.0042424 869.5376587 435.7761 869.5334473 435.7740173 2 10 1.1.1.5069.5 1 47.1814 19284.25 47.4102 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Dehydrated(T)@3 0.00391639 823.4954834 412.755 823.4915771 412.7530823 2 6 1.1.1.5083.5 1 47.5173 1042.931 47.3617 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.0010687 869.5344849 435.7745 869.5334473 435.7740173 2 10 1.1.1.5109.7 1 48.1556 30323.76 48.0493 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.0012518 869.534668 435.7746 869.5334473 435.7740173 2 10 1.1.1.5116.8 1 48.3289 29810.67 48.0739 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(2)C(2)@N-term 0.00221198 867.5200806 434.7673 867.5178223 434.7661743 2 6 1.1.1.5144.4 1 49.0009 621.7035 49.0201 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.00466963 869.5380859 435.7763 869.5334473 435.7740173 2 9 1.1.1.5204.6 1 50.471 12288.41 50.4886 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.000824567 869.5343018 435.7744 869.5334473 435.7740173 2 10 1.1.1.5253.2 1 51.6634 12262.78 51.6578 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.00204522 869.5354614 435.775 869.5334473 435.7740173 2 9 1.1.1.5281.2 1 52.3482 6456.836 52.2718 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.00186212 869.5352783 435.7749 869.5334473 435.7740173 2 9 1.1.1.5295.2 1 52.6957 6900.757 52.5171 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.85999894 VATVSLPR Delta:H(4)C(2)@N-term 0.00283865 869.5362549 435.7754 869.5334473 435.7740173 2 7 1.1.1.5363.5 1 54.3576 4081.631 54.3028 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 11 1.1.1.4597.2 1 36.3353 50129.46 36.3164 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 57.66999722 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 11 1.1.1.4788.2 1 40.6762 27777.91 40.7167 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 56.12000227 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 7 1.1.1.4864.2 1 42.3904 43134.99 42.4145 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 54.68000174 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 8 1.1.1.5363.4 1 54.3568 5601.85 54.3272 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 54.68000174 VATVSLPR 0.00668631 841.5088501 421.7617 841.5021362 421.7583618 2 8 1.1.1.5392.2 1 55.074 5001.356 55.0219 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 53.46000195 VATVSLPR -0.00150246 841.5006714 421.7576 841.5021362 421.7583618 2 6 1.1.1.5854.3 1 66.7214 206.6897 66.7157 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 53.3100009 VATVSLPR 0.00247505 841.5046997 421.7596 841.5021362 421.7583618 2 7 1.1.1.4572.3 1 35.7278 31206.19 35.8364 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 52.05000043 VATVSLPR Delta:H(4)C(2)@N-term -0.0078287 869.5256958 435.7701 869.5334473 435.7740173 2 6 1.1.1.5526.3 1 58.4282 919.496 58.3726 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 51.99999809 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 6 1.1.1.5026.3 1 46.1411 37005.3 46.1595 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.74999928 VATVSLPR 0.00284125 841.5050659 421.7598 841.5021362 421.7583618 2 7 1.1.1.4549.2 1 35.1941 89723.66 35.3791 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.74999928 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 5 1.1.1.5102.5 1 47.9815 28324.24 47.9506 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.69000125 VATVSLPR Dioxidation(P)@7 0.000938001 873.4928589 437.7537 873.4920044 437.7532654 2 8 1.1.1.4126.3 1 28.4332 167.0114 28.4621 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.69000125 VATVSLPR Pro->pyro-Glu(P)@7 0.039258599 855.5206909 428.7676 855.4814453 428.7479858 2 10 1.1.1.4581.3 1 35.9387 13979.78 36.1245 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.69000125 VATVSLPR Methyl(T)@3 0.00323927 855.5210571 428.7678 855.5178223 428.7661743 2 10 1.1.1.4857.2 1 42.2372 4716.433 42.2186 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.69000125 VATVSLPR Dehydrated(T)@3 0.00434362 823.4958496 412.7552 823.4915771 412.7530823 2 7 1.1.1.4930.2 1 43.8975 1110.299 43.9142 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.69000125 VATVSLPR Delta:H(2)C(2)@N-term 0.00239507 867.5202637 434.7674 867.5178223 434.7661743 2 6 1.1.1.5082.5 1 47.4895 651.7912 47.5324 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.69000125 VATVSLPR Dehydrated(T)@3 -0.000477974 823.4910889 412.7528 823.4915771 412.7530823 2 7 1.1.1.5125.2 1 48.5457 1082.992 48.2956 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.69000125 VATVSLPR Delta:H(2)C(2)@N-term 0.00257817 867.5204468 434.7675 867.5178223 434.7661743 2 6 1.1.1.5153.5 1 49.2257 674.6599 49.1694 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.69000125 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 9 1.1.1.5232.4 1 51.1621 8837.703 51.1772 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.69000125 VATVSLPR Delta:H(4)C(2)@N-term 0.00186212 869.5352783 435.7749 869.5334473 435.7740173 2 8 1.1.1.5288.5 1 52.5239 6900.757 52.5171 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 50.69000125 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 8 1.1.1.5398.3 1 55.2228 2917.775 55.2404 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 49.55999851 VATVSLPR 0.00284125 841.5050659 421.7598 841.5021362 421.7583618 2 7 1.1.1.4632.2 1 37.1415 39652.8 37.0401 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 49.55999851 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 10 1.1.1.5138.3 1 48.8534 21387.3 48.8251 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 49.55999851 VATVSLPR 0.00326848 841.5054932 421.76 841.5021362 421.7583618 2 8 1.1.1.5356.3 1 54.1858 4938.845 54.1327 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 49.55999851 VATVSLPR 0.00686941 841.5090942 421.7618 841.5021362 421.7583618 2 8 1.1.1.5377.4 1 54.7067 5289.924 54.7511 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 49.21000004 VATVSLPR -0.00150246 841.5006714 421.7576 841.5021362 421.7583618 2 5 1.1.1.5749.2 1 64.0471 217.3857 63.9403 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 48.42000008 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 10 1.1.1.4715.2 1 39.0575 23628.71 39.0751 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 48.42000008 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 10 1.1.1.5009.2 1 45.7305 36216.66 45.8934 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 48.42000008 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 6 1.1.1.5012.2 1 45.8018 36216.66 45.8934 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 48.42000008 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 10 1.1.1.5187.4 1 50.0671 16925.34 50.0096 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 48.12999964 VATVSLPR -0.00107524 841.5010986 421.7578 841.5021362 421.7583618 2 5 1.1.1.5974.2 1 69.8377 162.4179 69.8586 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 47.330001 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 10 1.1.1.4883.2 1 42.7905 41440.67 42.6408 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 46.29000127 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 10 1.1.1.4685.2 1 38.3571 23498.49 38.353 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 46.11000121 VATVSLPR 0.00289189 841.5050659 421.7598 841.5021362 421.7583618 2 5 1.1.1.5881.2 1 67.4182 217.4499 67.3096 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 45.30000091 VATVSLPR 0.00284125 841.5050659 421.7598 841.5021362 421.7583618 2 6 1.1.1.4656.3 1 37.7204 33896.27 37.7137 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 45.30000091 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 10 1.1.1.4851.2 1 42.0832 41609.99 42.0282 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 44.20999885 VATVSLPR -0.00107524 841.5010986 421.7578 841.5021362 421.7583618 2 5 1.1.1.5727.2 1 63.4855 283.5926 63.4807 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 44.20999885 VATVSLPR 0.00228156 841.5044556 421.7595 841.5021362 421.7583618 2 5 1.1.1.5869.4 1 67.1092 185.4297 66.9978 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 43.43999922 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 10 1.1.1.5001.3 1 45.5435 36698.7 45.6061 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 43.00000072 VATVSLPR Dioxidation(P)@7 0.000754902 873.4926758 437.7536 873.4920044 437.7532654 2 9 1.1.1.4559.3 1 35.4185 595.8263 35.4556 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 43.00000072 VATVSLPR Dehydrated(T)@3 0.00355019 823.4953003 412.7549 823.4915771 412.7530823 2 5 1.1.1.4631.2 1 37.1159 1335.138 37.2321 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 41.74000025 VATVSLPR 0.00265815 841.5048828 421.7597 841.5021362 421.7583618 2 10 1.1.1.4764.2 1 40.144 25241.99 40.1371 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.93999863 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 10 1.1.1.4583.3 1 35.9936 47563.5 36.0526 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.93999863 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 10 1.1.1.4731.2 1 39.4181 23701.89 39.4585 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.93999863 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 10 1.1.1.4805.2 1 41.0432 31177.75 41.1074 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.93999863 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 10 1.1.1.4956.2 1 44.5022 38763.43 44.5429 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.93999863 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 9 1.1.1.5272.4 1 52.132 12267.81 52.0001 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.18000066 VATVSLPR 0.00284125 841.5050659 421.7598 841.5021362 421.7583618 2 10 1.1.1.4633.3 1 37.1731 39652.8 37.0401 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.18000066 VATVSLPR 0.00284125 841.5050659 421.7598 841.5021362 421.7583618 2 10 1.1.1.4661.2 1 37.8455 33896.27 37.7137 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.18000066 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 10 1.1.1.4867.2 1 42.4439 43134.99 42.4145 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.18000066 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 10 1.1.1.4919.3 1 43.6362 41042.95 43.6272 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.18000066 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 5 1.1.1.5094.3 1 47.7844 28058.67 47.7782 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.18000066 VATVSLPR 0.00503843 841.5072632 421.7609 841.5021362 421.7583618 2 10 1.1.1.5109.4 1 48.1531 26748.33 48.1478 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 40.18000066 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.5258.3 1 51.7825 12593.31 51.6339 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 39.44999874 VATVSLPR 0.00503843 841.5072632 421.7609 841.5021362 421.7583618 2 9 1.1.1.5216.3 1 50.7655 14181.03 50.6117 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 38.74999881 VATVSLPR 0.00265815 841.5048828 421.7597 841.5021362 421.7583618 2 10 1.1.1.4553.3 1 35.2902 90457.73 35.3845 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 38.74999881 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 10 1.1.1.4619.2 1 36.8352 46621.27 36.8247 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 38.74999881 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 8 1.1.1.5370.3 1 54.5293 4707.271 54.5244 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 38.08000088 VATVSLPR 0.00503843 841.5072632 421.7609 841.5021362 421.7583618 2 8 1.1.1.5328.2 1 53.4982 8322.102 53.3951 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 37.43000031 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 10 1.1.1.4829.2 1 41.5884 32148.82 41.4984 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 37.43000031 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 10 1.1.1.4970.2 1 44.8423 41344.49 44.7114 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 37.43000031 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 7 1.1.1.5061.3 1 46.9904 29745.09 47.0038 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 36.21999919 VATVSLPR 0.00284125 841.5050659 421.7598 841.5021362 421.7583618 2 10 1.1.1.4654.2 1 37.6845 33896.27 37.7137 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 36.21999919 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 10 1.1.1.4963.2 1 44.682 41344.49 44.7114 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 35.64999998 VATVSLPR 0.00247505 841.5046997 421.7596 841.5021362 421.7583618 2 10 1.1.1.4576.2 1 35.823 31206.19 35.8364 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 35.64999998 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 7 1.1.1.4896.2 1 43.101 36658.02 43.0939 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 35.64999998 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 6 1.1.1.4968.2 1 44.7895 41344.49 44.7114 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 35.64999998 VATVSLPR 0.00503843 841.5072632 421.7609 841.5021362 421.7583618 2 8 1.1.1.5349.3 1 54.0157 6747.244 53.9876 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 35.1000011 VATVSLPR 0.00265815 841.5048828 421.7597 841.5021362 421.7583618 2 10 1.1.1.4561.2 1 35.4659 90457.73 35.3845 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.95999873 VATVSLPR Dehydrated(T)@3 0.00330606 823.494873 412.7547 823.4915771 412.7530823 2 7 1.1.1.4547.2 1 35.147 2511.758 35.2841 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.95999873 VATVSLPR Dehydrated(T)@3 0.00373329 823.4953003 412.7549 823.4915771 412.7530823 2 7 1.1.1.4584.2 1 36.0102 1593.407 36.0286 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.95999873 VATVSLPR Dehydrated(T)@3 0.00391639 823.4954834 412.755 823.4915771 412.7530823 2 8 1.1.1.4606.2 1 36.5241 1633.982 36.5615 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.95999873 VATVSLPR Delta:H(4)C(2)@N-term 0.0044255 869.5379028 435.7762 869.5334473 435.7740173 2 8 1.1.1.5166.5 1 49.5518 14572.59 49.5199 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.95999873 VATVSLPR Methyl(T)@3 0.00287308 855.5206909 428.7676 855.5178223 428.7661743 2 8 1.1.1.5206.3 1 50.5177 2952.954 50.4886 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.07000005 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 7 1.1.1.4590.2 1 36.1549 47563.5 36.0526 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.07000005 VATVSLPR 0.00284125 841.5050659 421.7598 841.5021362 421.7583618 2 7 1.1.1.4598.3 1 36.3511 51833.46 36.2444 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.07000005 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 7 1.1.1.4640.2 1 37.3357 38131.79 37.4007 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.07000005 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.5116.5 1 48.3264 27367.35 48.2708 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.07000005 VATVSLPR 0.00503843 841.5072632 421.7609 841.5021362 421.7583618 2 9 1.1.1.5209.4 1 50.5924 14181.03 50.6117 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.07000005 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 9 1.1.1.5223.3 1 50.9385 15073.91 50.8842 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.07000005 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 8 1.1.1.5307.2 1 52.9822 8420.107 52.979 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 34.07000005 VATVSLPR 0.00503843 841.5072632 421.7609 841.5021362 421.7583618 2 8 1.1.1.5321.2 1 53.3257 8322.102 53.3951 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 33.66999924 VATVSLPR -0.00186866 841.5002441 421.7574 841.5021362 421.7583618 2 4 1.1.1.5809.2 1 65.5897 251.1118 65.5079 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 32.64999986 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 8 1.1.1.5293.3 1 52.6475 9620.703 52.6676 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 32.64999986 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 8 1.1.1.5314.2 1 53.156 8420.107 52.979 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 32.22000003 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 9 1.1.1.5152.4 1 49.2 23772.01 49.1443 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 32.22000003 VATVSLPR 0.00503843 841.5072632 421.7609 841.5021362 421.7583618 2 8 1.1.1.5385.5 1 54.9071 5359.3 54.8274 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 31.00000024 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 8 1.1.1.5335.2 1 53.6735 6689.811 53.819 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 27.2300005 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 5 1.1.1.5034.2 1 46.3345 36519.05 46.3781 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 27.2300005 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 8 1.1.1.5286.3 1 52.4717 10554.65 52.442 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 26.75999999 VATVSLPR Dehydrated(T)@3 0.00171921 823.4932861 412.7539 823.4915771 412.7530823 2 8 1.1.1.4794.2 1 40.7854 931.0436 40.775 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 26.73000097 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.5088.3 1 47.6354 30427.3 47.6554 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 26.03999972 VATVSLPR 0.00284125 841.5050659 421.7598 841.5021362 421.7583618 2 9 1.1.1.4594.2 1 36.2483 51833.46 36.2444 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 25.02000034 VATVSLPR 0.00247505 841.5046997 421.7596 841.5021362 421.7583618 2 8 1.1.1.4539.3 1 34.9685 28366.84 35.1886 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 25.02000034 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4836.2 1 41.7418 43418.84 41.9565 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 25.02000034 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4905.2 1 43.2957 42336.56 43.2191 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 25.02000034 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 9 1.1.1.5051.3 1 46.7511 33041.3 46.7184 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 25.02000034 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.5059.4 1 46.9411 33079.06 46.7184 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 25.02000034 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.5123.3 1 48.4981 27615.35 48.2461 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 25.02000034 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.5173.3 1 49.7264 17302.65 49.6956 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 24.97999966 VATVSLPR -0.000892138 841.5012817 421.7579 841.5021362 421.7583618 2 4 1.1.1.5802.2 1 65.4094 257.6756 65.327 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 24.8300001 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 9 1.1.1.4699.2 1 38.6949 23169.94 38.5465 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 24.8300001 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.5102.6 1 47.9823 28324.24 47.9506 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 24.8300001 VATVSLPR 0.00326848 841.5054932 421.76 841.5021362 421.7583618 2 9 1.1.1.5195.4 1 50.2567 15249.8 50.2003 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 24.46999997 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 9 1.1.1.5023.2 1 46.069 37005.3 46.1595 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 24.46999997 VATVSLPR 0.00503843 841.5072632 421.7609 841.5021362 421.7583618 2 9 1.1.1.5230.3 1 51.1141 13405.04 51.0812 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 24.30000007 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4992.4 1 45.363 35336 45.3088 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 24.30000007 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.5166.3 1 49.5501 20058.85 49.545 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 24.13000017 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4985.4 1 45.194 37937.57 45.1645 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 24.13000017 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 9 1.1.1.5037.3 1 46.4084 36519.05 46.3781 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 24.13000017 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 9 1.1.1.5180.3 1 49.899 17424.14 49.8425 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 23.81000072 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4898.2 1 43.1295 42336.56 43.2191 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 23.81000072 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 9 1.1.1.5030.2 1 46.2357 37005.3 46.1595 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 23.51000011 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 6 1.1.1.5041.3 1 46.5074 36519.05 46.3781 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 23.21999967 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 9 1.1.1.4590.3 1 36.159 47563.5 36.0526 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 23.21999967 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 9 1.1.1.4620.3 1 36.8615 46621.27 36.8247 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 23.21999967 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 9 1.1.1.4692.2 1 38.5281 23169.94 38.5465 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 23.21999967 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 9 1.1.1.4723.2 1 39.2474 23254 39.4112 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 23.21999967 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 9 1.1.1.4748.2 1 39.7869 23385.86 39.8713 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 23.21999967 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 9 1.1.1.4912.2 1 43.4653 37929.12 43.531 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.82000035 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4612.2 1 36.6643 44216.59 36.729 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.82000035 VATVSLPR 0.00284125 841.5050659 421.7598 841.5021362 421.7583618 2 9 1.1.1.4626.2 1 36.9993 39652.8 37.0401 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.82000035 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 9 1.1.1.4640.3 1 37.3415 38131.79 37.4007 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.82000035 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 9 1.1.1.4797.2 1 40.8566 30929.94 40.7988 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.82000035 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4875.2 1 42.6184 40726.72 42.5874 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.82000035 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 9 1.1.1.4942.2 1 44.1682 41543.89 44.1097 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.82000035 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 9 1.1.1.5044.4 1 46.5805 35140.77 46.6216 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.82000035 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.5067.2 1 47.1289 28474 47.2655 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.68999964 VATVSLPR 0.00284125 841.5050659 421.7598 841.5021362 421.7583618 2 9 1.1.1.4670.3 1 38.0312 28854.96 37.8105 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.68999964 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 9 1.1.1.4780.2 1 40.4898 28839.36 40.5033 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.68999964 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4821.3 1 41.3883 31365.68 41.4034 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.68999964 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4926.2 1 43.806 39631.26 43.7236 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.68999964 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 9 1.1.1.4949.2 1 44.3335 38692.54 44.3744 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.56000042 VATVSLPR 0.00308538 841.505249 421.7599 841.5021362 421.7583618 2 9 1.1.1.4707.2 1 38.8663 19721.46 38.8619 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.56000042 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 8 1.1.1.5265.4 1 51.9557 12267.81 52.0001 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.43999988 VATVSLPR 0.00284125 841.5050659 421.7598 841.5021362 421.7583618 2 9 1.1.1.4678.2 1 38.1916 23105.18 38.2084 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.43999988 VATVSLPR 0.00265815 841.5048828 421.7597 841.5021362 421.7583618 2 9 1.1.1.4772.2 1 40.3268 25312.03 40.2555 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.43999988 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4813.2 1 41.2149 31180.77 41.1074 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.43999988 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4890.2 1 42.9617 36114.92 43.0227 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.43999988 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4978.2 1 45.0278 37937.57 45.1645 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.21000046 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 9 1.1.1.4605.2 1 36.4969 49167.54 36.5376 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.21000046 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.5016.2 1 45.8999 36216.66 45.8934 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.10000008 VATVSLPR 0.00265815 841.5048828 421.7597 841.5021362 421.7583618 2 9 1.1.1.4568.2 1 35.6411 89416.47 35.3845 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.10000008 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4844.2 1 41.9158 43393.73 41.9326 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 21.77000046 VATVSLPR 0.00326848 841.5054932 421.76 841.5021362 421.7583618 2 9 1.1.1.4739.3 1 39.6105 21952.8 39.624 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 21.77000046 VATVSLPR 0.00265815 841.5048828 421.7597 841.5021362 421.7583618 2 9 1.1.1.4756.2 1 39.9529 26217.14 40.0423 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 21.77000046 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 9 1.1.1.4859.2 1 42.2763 40384.87 42.3135 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 21.77000046 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 9 1.1.1.4934.2 1 43.9955 41544.06 44.1097 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 21.37999982 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 9 1.1.1.4647.2 1 37.5035 38131.79 37.4007 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 21.27999961 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 7 1.1.1.5342.2 1 53.8466 6689.811 53.819 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 20.23999989 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 8 1.1.1.5251.4 1 51.6146 12593.31 51.6339 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 19.72000003 VATVSLPR 0.00747974 841.5096436 421.7621 841.5021362 421.7583618 2 8 1.1.1.5279.3 1 52.2999 10859.77 52.2477 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 19.55000013 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 4 1.1.1.5166.2 1 49.5493 20058.85 49.545 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 19.49999928 VATVSLPR 0.00265815 841.5048828 421.7597 841.5021362 421.7583618 2 8 1.1.1.4556.2 1 35.3656 90457.73 35.3845 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 19.33999956 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 8 1.1.1.5300.3 1 52.8166 9620.703 52.6676 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 18.70000064 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 5 1.1.1.4919.2 1 43.6329 41042.95 43.6272 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 18.65999997 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 6 1.1.1.4582.2 1 35.9629 47563.5 36.0526 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 18.65999997 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 5 1.1.1.4648.4 1 37.5309 38131.79 37.4007 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 17.91000068 VATVSLPR 0.00284125 841.5050659 421.7598 841.5021362 421.7583618 2 8 1.1.1.5131.3 1 48.6852 23637.98 48.7053 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 17.58999974 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 8 1.1.1.5202.4 1 50.4205 15072.16 50.4641 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 17.44000018 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 8 1.1.1.5074.4 1 47.2942 28474 47.2655 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 16.91000015 VATVSLPR 0.00485533 841.5070801 421.7608 841.5021362 421.7583618 2 7 1.1.1.4908.2 1 43.3734 37225.14 43.3629 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 16.91000015 VATVSLPR 0.00448913 841.5066528 421.7606 841.5021362 421.7583618 2 8 1.1.1.5244.3 1 51.4504 13505.25 51.4432 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 16.77999943 VATVSLPR 0.00503843 841.5072632 421.7609 841.5021362 421.7583618 2 8 1.1.1.5237.6 1 51.2799 12417.62 51.2975 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 16.76000059 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 8 1.1.1.5081.4 1 47.4641 29030.71 47.3859 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 16.6899994 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 4 1.1.1.5078.3 1 47.3917 29030.71 47.3859 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 16.41000062 VATVSLPR 0.00467223 841.506897 421.7607 841.5021362 421.7583618 2 8 1.1.1.5145.3 1 49.0248 21293.81 49.0201 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.00319157 1869.823486 935.919 1869.820313 935.9174194 2 15 1.1.1.5977.19 1 69.9294 1187.197 70.0662 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.63000202 VCNYVNWIQQTIAAN Carbamidomethyl(C)@2; Nitro(Y)@4; Dioxidation(W)@7 -0.00804183 1869.823486 935.919 1869.831543 935.9230347 2 12 1.1.1.5984.20 1 70.1117 1187.197 70.0662 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 63.52000237 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAH Carbamidomethyl(C)@6; Carbamidomethyl(C)@24; Oxidation(W)@33 cleaved I-V@N-term; cleaved H-C@C-term 0.0118774 4110.906738 1028.734 4110.89502 1028.731079 4 9 1.1.1.5981.19 1 70.0338 832.919 70.0921 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 VLEGNEQFINAAK cleaved D-V@N-term 0.00201389 1431.737915 716.8762 1431.73584 716.8751831 2 10 1.1.1.5028.11 0 46.1997 156.8162 46.1595 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 22.10000008 VLEGNEQFINAAK cleaved D-V@N-term 0.00347866 1431.739258 716.8769 1431.73584 716.8751831 2 8 1.1.1.4949.4 0 44.3452 103.4832 44.3262 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.54999781 VNWIQQTIAAN Oxidation(W)@3 cleaved Y-V@N-term 0.00315471 1272.649414 637.332 1272.64624 637.3303833 2 11 1.1.1.4964.7 1 44.7013 235.535 44.663 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VNWIQQTIAAN cleaved Y-V@N-term -0.00177712 1256.649414 629.332 1256.651367 629.3329468 2 9 1.1.1.5294.7 1 52.68 425.2742 52.7159 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 VNWIQQTIAAN cleaved Y-V@N-term 0.00371578 1256.655029 629.3348 1256.651367 629.3329468 2 8 1.1.1.5312.15 1 53.1167 338.3825 53.0766 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00471432 1435.714233 718.8644 1435.709595 718.8620605 2 16 1.1.1.5118.14 1 48.3842 521.9466 48.419 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00166272 1435.711304 718.8629 1435.709595 718.8620605 2 18 1.1.1.5191.6 1 50.1665 567.0914 50.1766 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00251717 1435.712036 718.8633 1435.709595 718.8620605 2 17 1.1.1.5235.8 1 51.2392 431.6076 51.2733 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Dioxidation(W)@4 cleaved N-Y@N-term 0.00057506 1451.705078 726.8598 1451.704468 726.8594971 2 16 1.1.1.5088.11 1 47.647 780.0813 47.68 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Dioxidation(W)@4 cleaved N-Y@N-term 0.000697125 1451.705322 726.8599 1451.704468 726.8594971 2 16 1.1.1.5095.15 1 47.8207 735.0997 47.7537 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Dioxidation(W)@4 cleaved N-Y@N-term 0.000330932 1451.704834 726.8597 1451.704468 726.8594971 2 16 1.1.1.5102.15 1 47.9932 590.6144 47.9258 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00202891 1435.71167 718.8631 1435.709595 718.8620605 2 16 1.1.1.5111.15 1 48.2147 422.3623 48.2708 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Dioxidation(W)@4 cleaved N-Y@N-term 0.000208868 1451.704712 726.8596 1451.704468 726.8594971 2 16 1.1.1.5136.4 1 48.8134 301.607 48.8493 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00166272 1435.711304 718.8629 1435.709595 718.8620605 2 16 1.1.1.5162.16 1 49.4631 777.8229 49.4448 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00166272 1435.711304 718.8629 1435.709595 718.8620605 2 16 1.1.1.5169.16 1 49.6389 777.8229 49.4448 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00166272 1435.711304 718.8629 1435.709595 718.8620605 2 15 1.1.1.5177.14 1 49.8341 627.9296 49.7448 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00251717 1435.712036 718.8633 1435.709595 718.8620605 2 16 1.1.1.5184.8 1 49.9995 527.54 50.0336 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Trp->Kynurenin(W)@4 cleaved N-Y@N-term 0.000919617 1423.710449 712.8625 1423.709595 712.8620605 2 17 1.1.1.5194.4 1 50.2429 254.0376 50.3434 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term -0.00151095 1435.70813 718.8613 1435.709595 718.8620605 2 16 1.1.1.5199.13 1 50.3573 448.4933 50.3195 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Trp->Kynurenin(W)@4 cleaved N-Y@N-term -0.000178961 1423.709473 712.862 1423.709595 712.8620605 2 13 1.1.1.5203.14 1 50.454 215.7374 50.4886 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00508051 1435.714722 718.8646 1435.709595 718.8620605 2 14 1.1.1.5206.16 1 50.5286 490.599 50.4886 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00166272 1435.711304 718.8629 1435.709595 718.8620605 2 15 1.1.1.5213.13 1 50.6992 388.7764 50.6117 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00202891 1435.71167 718.8631 1435.709595 718.8620605 2 15 1.1.1.5242.7 1 51.4117 487.4248 51.4671 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00508051 1435.714722 718.8646 1435.709595 718.8620605 2 14 1.1.1.5259.14 1 51.8202 297.4871 51.8759 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00129652 1435.710815 718.8627 1435.709595 718.8620605 2 15 1.1.1.5276.6 1 52.2392 269.918 52.1754 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00630116 1435.71582 718.8652 1435.709595 718.8620605 2 15 1.1.1.5341.15 1 53.835 702.4384 54.0116 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00605703 1435.715698 718.8651 1435.709595 718.8620605 2 16 1.1.1.5348.11 1 54.0032 710.4899 54.0116 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00263923 1435.71228 718.8634 1435.709595 718.8620605 2 14 1.1.1.5355.17 1 54.1732 538.34 54.1082 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00532464 1435.714844 718.8647 1435.709595 718.8620605 2 14 1.1.1.5362.13 1 54.3431 383.1789 54.3516 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00483639 1435.714478 718.8645 1435.709595 718.8620605 2 16 1.1.1.5127.3 1 48.6049 593.987 48.6814 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Dioxidation(W)@4 cleaved N-Y@N-term 0.00741065 1451.711914 726.8632 1451.704468 726.8594971 2 15 1.1.1.5128.8 1 48.6287 367.928 48.61 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00166272 1435.711304 718.8629 1435.709595 718.8620605 2 16 1.1.1.5134.7 1 48.7719 804.9491 48.9221 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Dioxidation(W)@4 cleaved N-Y@N-term -3.53E-05 1451.704468 726.8595 1451.704468 726.8594971 2 12 1.1.1.5151.19 1 49.1876 271.4798 49.1694 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00483639 1435.714478 718.8645 1435.709595 718.8620605 2 13 1.1.1.5369.17 1 54.516 279.9731 54.5244 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(Y)@1; Oxidation(W)@4 cleaved N-Y@N-term 0.0035046 1451.70813 726.8613 1451.704468 726.8594971 2 14 1.1.1.5109.14 1 48.1639 548.4788 48.0246 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00190684 1435.711426 718.863 1435.709595 718.8620605 2 16 1.1.1.5141.7 1 48.9388 820.5767 48.9464 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Dioxidation(W)@4 cleaved N-Y@N-term 0.00057506 1451.705078 726.8598 1451.704468 726.8594971 2 12 1.1.1.5143.9 1 48.9871 290.3258 48.9955 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00166272 1435.711304 718.8629 1435.709595 718.8620605 2 16 1.1.1.5155.9 1 49.2864 777.8229 49.4448 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00727767 1435.716919 718.8657 1435.709595 718.8620605 2 14 1.1.1.5228.7 1 51.0761 371.1422 51.0812 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00385987 1435.713501 718.864 1435.709595 718.8620605 2 13 1.1.1.5266.18 1 51.9934 291.5694 52.0001 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00532464 1435.714844 718.8647 1435.709595 718.8620605 2 12 1.1.1.5383.14 1 54.8669 218.5894 54.7511 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Dioxidation(W)@4 cleaved N-Y@N-term 0.00057506 1451.705078 726.8598 1451.704468 726.8594971 2 13 1.1.1.5081.13 1 47.4766 761.0066 47.6554 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00190684 1435.711426 718.863 1435.709595 718.8620605 2 11 1.1.1.5104.16 1 48.0442 382.0148 48.2214 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00202891 1435.71167 718.8631 1435.709595 718.8620605 2 15 1.1.1.5148.8 1 49.1142 978.8531 49.1443 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00471432 1435.714233 718.8644 1435.709595 718.8620605 2 12 1.1.1.5283.14 1 52.4071 219.4058 52.3926 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00202891 1435.71167 718.8631 1435.709595 718.8620605 2 10 1.1.1.5290.13 1 52.5811 185.422 52.5171 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 99.00000095 YVNWIQQTIAAN Trp->Kynurenin(W)@4 cleaved N-Y@N-term 0.00226232 1423.711914 712.8632 1423.709595 712.8620605 2 8 1.1.1.5210.19 1 50.6298 182.147 50.6365 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.8499999 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00166272 1435.711304 718.8629 1435.709595 718.8620605 2 11 1.1.1.5220.16 1 50.875 384.6574 50.8842 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 98.51999879 YVNWIQQTIAAN cleaved N-Y@N-term -0.00350666 1419.711304 710.8629 1419.714722 710.864624 2 18 1.1.1.5473.19 1 57.1164 4912.911 57.2752 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.39000201 YVNWIQQTIAAN cleaved N-Y@N-term -0.00375079 1419.710815 710.8627 1419.714722 710.864624 2 18 1.1.1.5494.19 1 57.6417 5791.189 57.4516 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 97.11999893 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00544671 1435.715088 718.8648 1435.709595 718.8620605 2 11 1.1.1.5252.9 1 51.6478 398.2856 51.6578 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 96.39000297 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term 0.00447019 1435.714111 718.8643 1435.709595 718.8620605 2 8 1.1.1.5334.19 1 53.6629 482.2025 53.8675 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.9100008 YVNWIQQTIAAN cleaved N-Y@N-term -0.00326253 1419.711426 710.863 1419.714722 710.864624 2 17 1.1.1.5480.19 1 57.2939 5518.934 57.3766 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.9100008 YVNWIQQTIAAN cleaved N-Y@N-term -0.00375079 1419.710815 710.8627 1419.714722 710.864624 2 17 1.1.1.5487.19 1 57.4697 5791.189 57.4516 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.9100008 YVNWIQQTIAAN cleaved N-Y@N-term -0.00350666 1419.711304 710.8629 1419.714722 710.864624 2 17 1.1.1.5501.14 1 57.8118 4915.041 57.5499 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 95.9100008 YVNWIQQTIAAN cleaved N-Y@N-term -0.00655829 1419.70813 710.8613 1419.714722 710.864624 2 15 1.1.1.5522.18 1 58.341 968.0055 58.2253 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 YVNWIQQTIAAN cleaved N-Y@N-term -0.00155361 1419.713013 710.8638 1419.714722 710.864624 2 13 1.1.1.5466.21 1 56.9411 3043.949 57.1739 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 YVNWIQQTIAAN cleaved N-Y@N-term -0.00350666 1419.711304 710.8629 1419.714722 710.864624 2 14 1.1.1.5515.17 1 58.1677 1479.22 57.9739 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 YVNWIQQTIAAN cleaved N-Y@N-term -0.00253014 1419.712036 710.8633 1419.714722 710.864624 2 13 1.1.1.5553.18 1 59.115 319.2927 59.0977 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 94.12999749 YVNWIQQTIAAN cleaved N-Y@N-term -0.00655829 1419.70813 710.8613 1419.714722 710.864624 2 13 1.1.1.5574.18 1 59.6404 236.9573 59.6726 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 92.08999872 YVNWIQQTIAAN Deamidated(Q)@7 cleaved N-Y@N-term -0.00331029 1420.695435 711.355 1420.69873 711.3566284 2 13 1.1.1.5567.19 1 59.4667 361.7873 59.4735 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 YVNWIQQTIAAN Oxidation(W)@4 cleaved N-Y@N-term -0.00311647 1435.706421 718.8605 1435.709595 718.8620605 2 8 1.1.1.5411.18 1 55.56 131.1847 55.5421 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 76.6200006 YVNWIQQTIAAN Deamidated(N)@3 cleaved N-Y@N-term 0.00328124 1420.702026 711.3583 1420.69873 711.3566284 2 10 1.1.1.5591.18 1 60.0677 287.3885 60.0752 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 58.49999785 YVNWIQQTIAAN Deamidated(Q)@7 cleaved N-Y@N-term -1.45E-05 1420.69873 711.3566 1420.69873 711.3566284 2 6 1.1.1.5586.15 1 59.9401 276.3654 59.975 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 31.56000078 YVNWIQQTIAAN cleaved N-Y@N-term -0.00607003 1419.708618 710.8616 1419.714722 710.864624 2 5 1.1.1.5582.15 1 59.8389 193.4466 59.8489 1 55.63 55.63 81.16999865 73.08999896 68.15999746 cont|000143; cont|000023 "pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)]" 0 31.56000078 YVNWIQQTIAAN cleaved N-Y@N-term 0.00869987 1419.723511 710.869 1419.714722 710.864624 2 5 1.1.1.5634.15 1 61.1382 117.9812 61.0988 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 2 99.00000095 AEAESLYQSKYEELQITAGR missed K-Y@10 -0.000776612 2285.116943 762.7129 2285.117676 762.7131348 3 14 1.1.1.5738.20 1 63.7811 383.0367 63.6851 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 2 99.00000095 DVDGAYMTK 7.50E-05 998.4380493 500.2263 998.4379272 500.2262268 2 13 1.1.1.4109.2 1 28.2402 115.922 28.2453 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 2 99.00000095 GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR -0.010789 2382.933594 795.3185 2382.94458 795.3221436 3 37 1.1.1.4005.2 1 27.2353 210.2135 27.2404 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 2 99.00000095 GGSGGGGGGSSGGRGSGGGSSGGSIGGR missed R-G@14 -0.0127242 2078.894775 693.9722 2078.907471 693.9763794 3 32 1.1.1.3242.2 1 21.0118 193.5169 21.0169 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 2 99.00000095 GSGGGSSGGSIGGR -0.00351836 1091.492065 546.7533 1091.495605 546.7550659 2 16 1.1.1.2848.2 1 18.1019 108.7488 18.113 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 2 99.00000095 GSGGGSSGGSIGGRGSSSGGVK missed R-G@14 -0.00620177 1750.813232 584.6117 1750.819458 584.6137695 3 20 1.1.1.3350.2 1 21.9748 906.1988 22.0068 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 2 99.00000095 LALDLEIATYR 0.000587074 1276.703247 639.3589 1276.702759 639.3586426 2 10 1.1.1.5802.12 1 65.4177 855.7637 65.5597 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 2 99.00000095 SKAEAESLYQSKYEELQITAGR missed K-A@2; missed K-Y@12 -0.0033721 2500.241455 626.0676 2500.244629 626.0684204 4 18 1.1.1.5976.14 1 69.8999 1083.03 69.8846 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 2 99.00000095 SLDLDSIIAEVK 0.00081899 1301.708618 651.8616 1301.707886 651.8612061 2 16 1.1.1.6009.15 1 70.7538 2546.724 70.922 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 2 99.00000095 SLVNLGGSK 0.0037455 873.4956665 437.7551 873.4920044 437.7532654 2 9 1.1.1.5091.5 1 47.7107 640.7607 47.7291 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 2 99.00000095 SLVNLGGSKSISISVAR missed K-S@9 0.00147525 1686.964233 844.4894 1686.962891 844.4887085 2 12 1.1.1.5855.19 1 66.7605 1066.831 66.8951 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 1.602060437 99.00000095 SLNNQFASFIDK -0.00695652 1382.676025 692.3453 1382.682983 692.3488159 2 13 1.1.1.5708.16 1 63.0124 220.7022 63.0718 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 1.337242126 98.72000217 SGGGFSSGSAGIINYQR -0.00354346 1656.782104 829.3983 1656.785645 829.4000854 2 9 1.1.1.5091.19 1 47.7241 89.7794 47.6554 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0.90309 96.31999731 AQYEDIAQK -0.00423237 1064.509644 533.2621 1064.513794 533.2642212 2 13 1.1.1.4040.2 1 27.6015 306.1989 27.6283 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0.350665152 97.94999957 SRQFSSR Protein Terminal Acetyl@N-term cleaved M-S@N-term; missed R-Q@2 -0.00113105 908.4452515 455.2299 908.4464111 455.2304993 2 9 1.1.1.3622.2 1 23.9254 246.2025 23.9793 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0.206908405 69.44000125 TLLEGEESR -0.0016429 1032.50708 517.2608 1032.508789 517.2616577 2 12 1.1.1.4234.2 1 29.4634 683.1505 29.3841 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0.149353772 60.50000191 YEELQITAGR 0.00392447 1178.597046 590.3058 1178.59314 590.303833 2 9 1.1.1.5014.5 0 45.8643 114.5927 45.821 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0.139661998 58.50999951 SISISVAR 0.00321717 831.4846802 416.7496 831.4814453 416.7479858 2 7 1.1.1.4842.2 1 41.8648 582.3621 41.7841 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0.129011184 56.23999834 LRSEIDNVKK missed R-S@2; missed K-K@9 -0.00116045 1200.681396 401.2344 1200.682617 401.2348328 3 6 1.1.1.5840.2 1 66.3603 427.8125 66.3812 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0.036684487 92.11000204 GSGGGSYGSGG cleaved Y-G@N-term; cleaved G-G@C-term 0.0130226 841.333252 421.6739 841.3202515 421.6673889 2 9 1.1.1.3403.2 0 22.4073 109.2351 22.3801 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 AEAESLYQSKYEELQITAGR missed K-Y@10 -0.000776612 2285.116943 762.7129 2285.117676 762.7131348 3 16 1.1.1.5731.19 1 63.6013 383.0367 63.6851 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 GSGGGSSGGSIGGR -0.00327423 1091.49231 546.7534 1091.495605 546.7550659 2 15 1.1.1.2796.2 1 17.7406 111.5211 17.714 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 GSGGGSSGGSIGGR -0.00254184 1091.493042 546.7538 1091.495605 546.7550659 2 15 1.1.1.2822.2 1 17.9212 114.3567 17.9024 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 GSGGGSSGGSIGGR -0.00229771 1091.493286 546.7539 1091.495605 546.7550659 2 17 1.1.1.2871.2 1 18.2673 123.0193 18.2485 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 GSGGGSSGGSIGGR -0.00351836 1091.492065 546.7533 1091.495605 546.7550659 2 16 1.1.1.2895.2 1 18.4406 112.6171 18.4137 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 GSGGGSSGGSIGGR -0.000466738 1091.495117 546.7548 1091.495605 546.7550659 2 17 1.1.1.2917.2 1 18.6108 101.8384 18.6285 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 GSGGGSSGGSIGGR -0.00351836 1091.492065 546.7533 1091.495605 546.7550659 2 16 1.1.1.2954.2 1 18.8799 97.0729 18.8913 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 LALDLEIATYR 0.000587074 1276.703247 639.3589 1276.702759 639.3586426 2 16 1.1.1.5809.15 1 65.6006 855.7637 65.5597 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 LALDLEIATYR 0.000587074 1276.703247 639.3589 1276.702759 639.3586426 2 12 1.1.1.5816.18 1 65.7827 855.7637 65.5597 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 56.12000227 SISISVAR 0.00358337 831.4850464 416.7498 831.4814453 416.7479858 2 9 1.1.1.4923.3 1 43.7426 870.7757 43.7236 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 40.93999863 SISISVAR 0.00956458 831.4910889 416.7528 831.4814453 416.7479858 2 6 1.1.1.5243.2 1 51.4223 278.2501 51.4193 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 37.43000031 SISISVAR 0.00217961 831.4837036 416.7491 831.4814453 416.7479858 2 7 1.1.1.4602.3 1 36.4236 612.44 36.4179 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 19.72000003 SISISVAR 0.00376646 831.4852905 416.7499 831.4814453 416.7479858 2 6 1.1.1.4948.2 1 44.3078 698.3312 44.278 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 17.1299994 SISISVAR 0.00297304 831.4844971 416.7495 831.4814453 416.7479858 2 6 1.1.1.4826.2 1 41.5046 572.3459 41.4747 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 SKAEAESLYQSKYEELQITAGR missed K-A@2; missed K-Y@12 -0.0033721 2500.241455 626.0676 2500.244629 626.0684204 4 14 1.1.1.5983.12 1 70.0796 1083.03 69.8846 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 44.20999885 SKAEAESLYQSKYEELQITAGR missed K-A@2; missed K-Y@12 -0.00410449 2500.240479 626.0674 2500.244629 626.0684204 4 11 1.1.1.5969.12 1 69.7167 1093.581 69.703 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 16.45999998 SKAEAESLYQSKYEELQITAGR missed K-A@2; missed K-Y@12 -0.00138511 2500.243164 834.4217 2500.244629 834.4221191 3 7 1.1.1.5974.19 1 69.8519 289.0486 69.8067 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 SLDLDSIIAEVK 0.00081899 1301.708618 651.8616 1301.707886 651.8612061 2 19 1.1.1.6016.12 1 70.9358 2546.724 70.922 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 SLDLDSIIAEVK 0.00081899 1301.708618 651.8616 1301.707886 651.8612061 2 13 1.1.1.6023.17 1 71.1218 2546.724 70.922 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 SLVNLGGSK 0.00417273 873.4960938 437.7553 873.4920044 437.7532654 2 11 1.1.1.5077.3 1 47.3691 643.2041 47.4102 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 93.88999939 SLVNLGGSK 0.0033793 873.4953003 437.7549 873.4920044 437.7532654 2 10 1.1.1.5051.6 1 46.7611 650.192 46.7423 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 85.31000018 SLVNLGGSK 0.00295207 873.494873 437.7547 873.4920044 437.7532654 2 11 1.1.1.4526.4 1 34.7043 2783.261 34.647 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 66.00000262 SLVNLGGSK 0.00276897 873.4946899 437.7546 873.4920044 437.7532654 2 10 1.1.1.4515.3 1 34.5375 2820.569 34.6709 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 66.00000262 SLVNLGGSK 0.0037455 873.4956665 437.7551 873.4920044 437.7532654 2 12 1.1.1.5008.2 1 45.72 558.4671 45.749 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 66.00000262 SLVNLGGSK 0.0035624 873.4954834 437.755 873.4920044 437.7532654 2 9 1.1.1.5044.8 1 46.5871 615.2068 46.5972 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 66.00000262 SLVNLGGSK 0.00398963 873.4958496 437.7552 873.4920044 437.7532654 2 8 1.1.1.5119.3 1 48.3989 683.4731 48.2956 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 61.80999875 SLVNLGGSK 0.0033793 873.4953003 437.7549 873.4920044 437.7532654 2 10 1.1.1.4653.2 1 37.647 558.9961 37.7137 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 61.80999875 SLVNLGGSK 0.00276897 873.4946899 437.7546 873.4920044 437.7532654 2 9 1.1.1.4787.2 1 40.6525 297.1495 40.5981 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 61.80999875 SLVNLGGSK 0.0033793 873.4953003 437.7549 873.4920044 437.7532654 2 8 1.1.1.4964.2 1 44.6913 516.7316 44.6872 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 61.80999875 SLVNLGGSK 0.0037455 873.4956665 437.7551 873.4920044 437.7532654 2 10 1.1.1.5016.5 1 45.9124 596.785 45.9899 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 61.80999875 SLVNLGGSK 0.00417273 873.4960938 437.7553 873.4920044 437.7532654 2 8 1.1.1.5084.4 1 47.5403 643.2041 47.4102 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 61.80999875 SLVNLGGSK 0.006553 873.4984741 437.7565 873.4920044 437.7532654 2 7 1.1.1.5112.2 1 48.2252 716.5249 48.0493 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 61.80999875 SLVNLGGSK 0.00313517 873.4950562 437.7548 873.4920044 437.7532654 2 7 1.1.1.5128.2 1 48.6137 681.8368 48.7053 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 61.80999875 SLVNLGGSK 0.0067361 873.4986572 437.7566 873.4920044 437.7532654 2 6 1.1.1.5216.4 1 50.7664 365.9932 50.736 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 59.42999721 SLVNLGGSK 0.00838398 873.5002441 437.7574 873.4920044 437.7532654 2 11 1.1.1.4839.2 1 41.8266 390.8499 41.7841 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 57.66999722 SLVNLGGSK 0.00154832 873.4934692 437.754 873.4920044 437.7532654 2 10 1.1.1.4901.2 1 43.2056 439.2662 43.2191 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 57.66999722 SLVNLGGSK 0.0067361 873.4986572 437.7566 873.4920044 437.7532654 2 11 1.1.1.4980.2 1 45.0879 471.716 44.9744 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 57.66999722 SLVNLGGSK 0.00398963 873.4958496 437.7552 873.4920044 437.7532654 2 10 1.1.1.5023.5 1 46.0815 599.5282 46.014 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 57.66999722 SLVNLGGSK 0.0037455 873.4956665 437.7551 873.4920044 437.7532654 2 10 1.1.1.5070.2 1 47.2044 650.1106 47.194 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 57.66999722 SLVNLGGSK 0.0037455 873.4956665 437.7551 873.4920044 437.7532654 2 6 1.1.1.5142.3 1 48.9508 555.4262 48.9221 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 57.66999722 SLVNLGGSK 0.00978773 873.5016479 437.7581 873.4920044 437.7532654 2 8 1.1.1.5193.3 1 50.2065 383.3774 50.2003 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 57.66999722 SLVNLGGSK 0.00716333 873.4990845 437.7568 873.4920044 437.7532654 2 7 1.1.1.5200.5 1 50.3748 419.261 50.3434 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 57.66999722 SLVNLGGSK 0.00313517 873.4950562 437.7548 873.4920044 437.7532654 2 6 1.1.1.5251.6 1 51.6163 391.4793 51.5863 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 56.12000227 SLVNLGGSK 0.0063699 873.498291 437.7564 873.4920044 437.7532654 2 8 1.1.1.4919.4 1 43.6395 362.4075 43.6031 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 56.12000227 SLVNLGGSK 0.00575958 873.4976807 437.7561 873.4920044 437.7532654 2 8 1.1.1.5037.6 1 46.4134 644.7659 46.4025 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 51.99999809 SLVNLGGSK 0.0035624 873.4954834 437.755 873.4920044 437.7532654 2 9 1.1.1.4869.2 1 42.4782 439.5852 42.3611 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 41.74000025 SLVNLGGSK 0.00435582 873.4962769 437.7554 873.4920044 437.7532654 2 7 1.1.1.5135.3 1 48.7826 618.0443 48.8251 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 40.18000066 SLVNLGGSK 0.00435582 873.4962769 437.7554 873.4920044 437.7532654 2 8 1.1.1.4987.3 1 45.2454 551.7971 45.1884 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 40.18000066 SLVNLGGSK 0.00435582 873.4962769 437.7554 873.4920044 437.7532654 2 7 1.1.1.5098.4 1 47.8843 658.1263 47.9011 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 37.43000031 SLVNLGGSK 0.006553 873.4984741 437.7565 873.4920044 437.7532654 2 9 1.1.1.5060.3 1 46.9665 620.2794 47.0277 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 37.43000031 SLVNLGGSK 0.00417273 873.4960938 437.7553 873.4920044 437.7532654 2 6 1.1.1.5149.4 1 49.1251 565.5759 49.1443 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 36.21999919 SLVNLGGSK 0.00313517 873.4950562 437.7548 873.4920044 437.7532654 2 9 1.1.1.4939.2 1 44.093 430.7603 44.0858 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 34.07000005 SLVNLGGSK 0.00234174 873.4942627 437.7544 873.4920044 437.7532654 2 8 1.1.1.4580.3 1 35.9187 539.7139 35.8603 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 32.64999986 SLVNLGGSK 0.00276897 873.4946899 437.7546 873.4920044 437.7532654 2 8 1.1.1.4909.3 1 43.3975 450.7613 43.3629 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 32.64999986 SLVNLGGSK 0.0037455 873.4956665 437.7551 873.4920044 437.7532654 2 8 1.1.1.4957.2 1 44.5253 511.6871 44.5429 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 30.25999963 SLVNLGGSK 0.00417273 873.4960938 437.7553 873.4920044 437.7532654 2 7 1.1.1.4880.2 1 42.7171 413.5591 42.6646 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 30.25999963 SLVNLGGSK 0.006553 873.4984741 437.7565 873.4920044 437.7532654 2 6 1.1.1.5105.4 1 48.0547 716.5249 48.0493 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 25.6099999 SLVNLGGSK 0.0033793 873.4953003 437.7549 873.4920044 437.7532654 2 8 1.1.1.4617.7 1 36.7907 782.6157 36.8247 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 25.6099999 SLVNLGGSK 0.00698023 873.4989014 437.7567 873.4920044 437.7532654 2 5 1.1.1.5223.5 1 50.9402 326.3199 50.909 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 22.82000035 SLVNLGGSK 0.00258587 873.4944458 437.7545 873.4920044 437.7532654 2 7 1.1.1.4544.4 1 35.0837 653.6309 35.2604 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 22.82000035 SLVNLGGSK 0.0033793 873.4953003 437.7549 873.4920044 437.7532654 2 5 1.1.1.5156.7 1 49.3025 470.5276 49.3192 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 22.82000035 SLVNLGGSK 0.017966099 873.5098877 437.7622 873.4920044 437.7532654 2 7 1.1.1.5190.2 1 50.1361 392.4578 50.1052 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 22.10000008 SLVNLGGSK 0.0033793 873.4953003 437.7549 873.4920044 437.7532654 2 8 1.1.1.4625.3 1 36.977 782.6157 36.8247 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 21.77000046 SLVNLGGSK 0.000937992 873.4928589 437.7537 873.4920044 437.7532654 2 7 1.1.1.4602.7 1 36.4319 723.6485 36.4659 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 21.18999958 SLVNLGGSK 0.00197555 873.4938965 437.7542 873.4920044 437.7532654 2 8 1.1.1.4572.4 1 35.7319 558.4067 35.8364 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 20.37999928 SLVNLGGSK 0.00276897 873.4946899 437.7546 873.4920044 437.7532654 2 7 1.1.1.4537.3 1 34.9124 1992.213 34.7186 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 20.23999989 SLVNLGGSK 0.0061868 873.4980469 437.7563 873.4920044 437.7532654 2 9 1.1.1.4741.2 1 39.6661 273.592 39.6713 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 18.17000061 SLVNLGGSK 0.00496615 873.4968872 437.7557 873.4920044 437.7532654 2 7 1.1.1.4802.2 1 40.9753 350.0586 41.1074 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 17.88000017 SLVNLGGSK 0.0035624 873.4954834 437.755 873.4920044 437.7532654 2 5 1.1.1.5030.5 1 46.2382 616.1802 46.2324 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 17.03000069 SLVNLGGSK 0.0111915 873.5032959 437.7589 873.4920044 437.7532654 2 7 1.1.1.4708.4 1 38.9042 314.5673 38.9092 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 16.60999954 SLVNLGGSK 0.000571796 873.4924927 437.7535 873.4920044 437.7532654 2 8 1.1.1.4632.3 1 37.1449 571.0374 37.0641 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 16.49000049 SLVNLGGSK 0.00295207 873.494873 437.7547 873.4920044 437.7532654 2 6 1.1.1.4639.3 1 37.3099 502.1011 37.3043 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 SLVNLGGSKSISISVAR missed K-S@9 0.00237317 1686.965088 563.329 1686.962891 563.3282471 3 17 1.1.1.5854.13 1 66.7297 3509.656 66.9213 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 SLVNLGGSKSISISVAR missed K-S@9 0.00182388 1686.964966 563.3289 1686.962891 563.3282471 3 22 1.1.1.5862.11 1 66.9331 3632.89 66.9465 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 SLVNLGGSKSISISVAR missed K-S@9 0.00182388 1686.964966 563.3289 1686.962891 563.3282471 3 20 1.1.1.5869.13 1 67.1167 3632.89 66.9465 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 99.00000095 SLVNLGGSKSISISVAR Deamidated(N)@4 missed K-S@9 0.0164194 1687.963257 563.6617 1687.946899 563.65625 3 13 1.1.1.5876.10 1 67.2953 1669.477 67.0243 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 24.97999966 SLVNLGGSKSISISVAR missed K-S@9 -0.00110567 1686.961792 563.3279 1686.962891 563.3282471 3 7 1.1.1.5897.9 1 67.8386 245.3126 67.6981 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 66.00000262 TLLEGEESR -0.00213116 1032.506714 517.2606 1032.508789 517.2616577 2 11 1.1.1.4219.2 1 29.2958 683.7442 29.3602 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 30.25999963 TLLEGEESR 0.00690165 1032.515625 517.2651 1032.508789 517.2616577 2 5 1.1.1.4645.5 1 37.4612 75.9781 37.473 2 26.92 26.92 59.32000279 33.07000101 28.42000127 sp|P04264|K2C1_HUMAN; cont|000135 "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]" 0 26.96999907 YEELQITAGR 0.00807467 1178.601318 590.3079 1178.59314 590.303833 2 6 1.1.1.5155.6 0 49.2806 47.2733 49.1943 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 2 99.00000095 DIENQYETQITQIEHEVSSSGQEVQSSAK 0.0053222 3263.513184 1088.845 3263.506592 1088.842773 3 13 1.1.1.5849.21 1 66.6072 611.5673 66.6122 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 2 99.00000095 FSSSSGYGGGSSR -0.00462383 1234.516846 618.2657 1234.521484 618.2680054 2 16 1.1.1.3701.2 1 24.6086 503.8148 24.4999 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 2 99.00000095 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR -0.00608775 2704.147461 902.3898 2704.153809 902.3919067 3 23 1.1.1.5459.18 1 56.7673 912.0688 56.5491 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 2 99.00000095 GGSGGSYGGGGSGGGYGGGSGSR -0.0106749 1790.709839 896.3622 1790.720459 896.3674927 2 33 1.1.1.3611.2 1 23.8531 266.5172 23.8863 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 2 99.00000095 HGVQELEIELQSQLSK -0.00199287 1836.956177 613.326 1836.95813 613.3266602 3 20 1.1.1.6029.13 1 71.2761 1811.731 71.2617 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 2 99.00000095 SGGGGGGGLGSGGSIR -0.00410994 1231.586426 616.8005 1231.590576 616.8025513 2 19 1.1.1.4116.3 1 28.3253 93.8052 28.3048 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 2 99.00000095 STMQELNSR -0.00161528 1064.490479 533.2525 1064.492065 533.2532959 2 13 1.1.1.3981.2 1 26.9644 352.3382 27.0307 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 2 99.00000095 TLNDMRQEYEQLIAK missed R-Q@6 -0.00328927 1850.91626 617.9794 1850.919678 617.9804688 3 12 1.1.1.5895.18 1 67.7945 2592.43 67.6981 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 1.522879124 99.00000095 SRSGGGGGGGLGSGGSIR cleaved L-S@N-term; missed R-S@2 -0.00133206 1474.72229 492.5814 1474.723633 492.5818176 3 19 1.1.1.3758.2 1 25.0577 758.5048 25.1045 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 1.013228297 99.00000095 GGGGGGGLGSGGSIR cleaved S-G@N-term -0.000256793 1144.558228 573.2864 1144.558472 573.286499 2 23 1.1.1.3950.2 1 26.6634 180.5572 26.6901 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0.478861898 90.23000002 IGLGGRGGSGGSYGR missed R-G@6 0.00326798 1349.683228 450.9017 1349.680054 450.9006042 3 12 1.1.1.4110.2 1 28.259 195.7794 28.2991 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0.028724153 24.05000031 TLLDIDNTR 0.00408086 1059.560303 530.7874 1059.55603 530.7852783 2 5 1.1.1.5315.7 1 53.1902 162.8691 53.177 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0.018181393 90.200001 GGSGGSYGGGS cleaved S-G@C-term 0.0130226 841.333252 421.6739 841.3202515 421.6673889 2 9 1.1.1.3403.2 0 22.4073 109.2351 22.3801 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 99.00000095 FSSSSGYGGGSSR -0.00254873 1234.518921 618.2667 1234.521484 618.2680054 2 19 1.1.1.3682.2 1 24.4393 583.6127 24.4858 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 99.00000095 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR -0.00132722 2704.152344 902.3914 2704.153809 902.3919067 3 23 1.1.1.5431.10 1 56.0617 887.3188 56.2934 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 99.00000095 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR -0.00132722 2704.152344 902.3914 2704.153809 902.3919067 3 30 1.1.1.5438.17 1 56.2357 881.4879 56.2678 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 99.00000095 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR -0.00608775 2704.147461 902.3898 2704.153809 902.3919067 3 23 1.1.1.5445.17 1 56.4126 912.0688 56.5491 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 99.00000095 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR -0.00608775 2704.147461 902.3898 2704.153809 902.3919067 3 19 1.1.1.5452.19 1 56.5937 912.0688 56.5491 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 92.08999872 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR Oxidation(Y)@10; Ser->LacticAcid(S)@14; Oxidation(F)@18 0.048167702 2721.181152 908.0676 2721.132813 908.0515137 3 18 1.1.1.5435.20 1 56.161 397.5276 56.192 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 82.19000101 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR Dioxidation(Y)@10; Ser->LacticAcid(S)@14 0.041576199 2721.174561 908.0654 2721.132813 908.0515137 3 16 1.1.1.5445.18 1 56.4134 352.0424 56.498 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 46.02000117 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR 0.000503759 2704.154297 902.392 2704.153809 902.3919067 3 11 1.1.1.5468.19 1 56.9898 239.8265 56.9711 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 57.85999894 GGSGGSHGGGS Delta:H(2)C(2)(H)@7 cleaved S-G@C-term 0.00178922 841.333252 421.6739 841.3314819 421.6730042 2 9 1.1.1.3403.2 0 22.4073 109.2351 22.3801 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 57.85999894 GGSGGSYGR Nitro(Y)@7 0.00178922 841.333252 421.6739 841.3314819 421.6730042 2 9 1.1.1.3403.2 0 22.4073 109.2351 22.3801 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 22.07999974 IGLGGRGGSGGSYGR missed R-G@6 -0.0103363 1349.669678 450.8972 1349.680054 450.9006042 3 12 1.1.1.5658.4 1 61.7313 2305.143 61.5977 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 99.00000095 SGGGGGGGLGSGGSIR -0.00215691 1231.588501 616.8015 1231.590576 616.8025513 2 27 1.1.1.3946.2 1 26.6178 2064.114 26.6963 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 99.00000095 SGGGGGGGLGSGGSIR -0.00398788 1231.586426 616.8005 1231.590576 616.8025513 2 29 1.1.1.3963.2 1 26.7915 2165.893 26.7039 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 99.00000095 SGGGGGGGLGSGGSIR -0.0028893 1231.587646 616.8011 1231.590576 616.8025513 2 20 1.1.1.3983.2 1 27.004 97.2759 26.9778 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 99.00000095 SGGGGGGGLGSGGSIR 0.00187122 1231.592529 616.8035 1231.590576 616.8025513 2 19 1.1.1.4140.2 1 28.5596 87.7803 28.5824 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 99.00000095 SGGGGGGGLGSGGSIR 0.00187122 1231.592529 616.8035 1231.590576 616.8025513 2 16 1.1.1.4315.3 1 30.6657 89.0844 30.6463 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 99.00000095 SGGGGGGGLGSGGSIR 0.00260361 1231.593018 616.8038 1231.590576 616.8025513 2 13 1.1.1.4530.3 1 34.7903 103.0295 34.801 3 19.06 19.06 50.88000298 30.82000017 24.87999946 sp|P35527|K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 0 99.00000095 STMQELNSR Oxidation(M)@3 -0.000416065 1080.48645 541.2505 1080.486938 541.2507324 2 14 1.1.1.3368.2 1 22.1584 225.7175 22.181 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 2 99.00000095 GSLGGGFSSGGFSGGSFSR 0.00515755 1706.77002 854.3923 1706.764893 854.3897095 2 30 1.1.1.5392.16 1 55.0865 2390.876 55.0463 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 2 99.00000095 ISSSKGSLGGGFSSGGFSGGSFSR missed K-G@5 -0.0010985 2209.038818 737.3536 2209.040039 737.3539429 3 11 1.1.1.5745.17 1 63.9577 543.1905 63.787 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 2 99.00000095 NVSTGDVNVEMNAAPGVDLTQLLNNMR Oxidation(M)@11 0.000876351 2887.381348 963.4677 2887.380371 963.4674072 3 19 1.1.1.6032.21 1 71.3618 580.677 71.3668 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 2 99.00000095 SLLEGEGSSGGGGR -0.00254614 1261.58728 631.8009 1261.589844 631.8021851 2 21 1.1.1.4195.2 1 29.0056 207.6213 29.0249 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 2 99.00000095 SSSKGSLGGGFSSGGFSGGSFSR cleaved I-S@N-term; missed K-G@4 -0.00667359 2095.949219 699.657 2095.955811 699.6592407 3 24 1.1.1.5713.20 1 63.1426 3498.089 63.2515 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 2 99.00000095 SSSSGSVGESSSKGP cleaved P-R@C-term; missed K-G@13 -0.00522246 1338.584717 670.2996 1338.589966 670.3022461 2 26 1.1.1.3315.2 1 21.6902 882.2424 21.6121 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0.149966747 96.77000046 GGGFSSGGFSGGSFSR cleaved L-G@N-term 0.00767628 1449.635132 725.8248 1449.627319 725.8209229 2 9 1.1.1.5113.11 1 48.2658 135.613 48.3203 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0.052566279 97.54999876 SKGSLGGGFSSGGFSGGSFSR cleaved S-S@N-term; missed K-G@2 -0.00137373 1921.890747 641.6375 1921.891846 641.6378784 3 8 1.1.1.5748.12 1 64.0302 152.4249 63.9919 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0.038104527 31.92000091 SQYEQLAEQNRKDAEAWFNEK missed R-K@11; missed K-D@12 -0.00211231 2583.197021 646.8065 2583.198975 646.8070068 4 8 1.1.1.6029.16 1 71.2786 530.9922 71.3143 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0.037630662 31.58999979 LAADDFR 0.00410335 806.3964844 404.2055 806.3922729 404.2033997 2 7 1.1.1.4360.2 1 31.5847 244.2811 31.6015 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0.020907098 21.24000043 VLDELTLTK 0.027372699 1030.61853 516.3165 1030.591064 516.3027954 2 6 1.1.1.5345.7 1 53.9295 7963.028 53.6696 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 89.07999992 GGGFSSGGFSGGSFSR cleaved L-G@N-term 0.0099955 1449.637329 725.8259 1449.627319 725.8209229 2 8 1.1.1.5142.16 1 48.9642 131.8064 48.9955 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 GSLGGGFSSGGFSGGSFSR 0.00540168 1706.770264 854.3924 1706.764893 854.3897095 2 24 1.1.1.5371.15 1 54.568 1497.284 54.7767 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 GSLGGGFSSGGFSGGSFSR 0.0056458 1706.770508 854.3925 1706.764893 854.3897095 2 26 1.1.1.5378.16 1 54.7444 2305.479 54.877 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 GSLGGGFSSGGFSGGSFSR 0.0056458 1706.770508 854.3925 1706.764893 854.3897095 2 31 1.1.1.5385.16 1 54.9171 2305.479 54.877 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 GSLGGGFSSGGFSGGSFSR -0.000991053 1706.763916 854.3892 1706.764893 854.3897095 2 21 1.1.1.5399.20 1 55.2594 2363.575 55.0463 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 GSLGGGFSSGGFSGGSFSR -0.000502793 1706.764526 854.3895 1706.764893 854.3897095 2 17 1.1.1.5406.20 1 55.435 1694.648 55.1675 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 GSLGGGFSSGGFSGGSFSR -0.000502793 1706.764526 854.3895 1706.764893 854.3897095 2 15 1.1.1.5413.17 1 55.6117 1108.513 55.3651 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 GSLGGGFSSGGFSGGSFSR -0.000746923 1706.764038 854.3893 1706.764893 854.3897095 2 17 1.1.1.5420.19 1 55.7906 544.1071 55.6949 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 GSLGGGFSSGGFSGGSFSR 0.00540168 1706.770264 854.3924 1706.764893 854.3897095 2 12 1.1.1.5364.14 1 54.3923 820.0707 54.6248 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 96.1499989 GSLGGGFSSGGFSGGSFSR -0.00453094 1706.760498 854.3875 1706.764893 854.3897095 2 13 1.1.1.5429.18 1 56.0112 295.8997 55.9935 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 ISSSKGSLGGGFSSGGFSGGSFSR missed K-G@5 -0.0010985 2209.038818 737.3536 2209.040039 737.3539429 3 10 1.1.1.5731.18 1 63.6004 539.5497 63.787 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 ISSSKGSLGGGFSSGGFSGGSFSR missed K-G@5 -0.0010985 2209.038818 737.3536 2209.040039 737.3539429 3 18 1.1.1.5738.18 1 63.7794 543.1905 63.787 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 SSSKGSLGGGFSSGGFSGGSFSR cleaved I-S@N-term; missed K-G@4 -0.00667359 2095.949219 699.657 2095.955811 699.6592407 3 27 1.1.1.5720.17 1 63.3191 3498.089 63.2515 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 SSSKGSLGGGFSSGGFSGGSFSR cleaved I-S@N-term; missed K-G@4 -0.000206853 2095.955811 699.6592 2095.955811 699.6592407 3 19 1.1.1.5727.19 1 63.4996 3600.86 63.2254 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 92.08999872 SSSKGSLGGGFSSGGFSGGSFSR cleaved I-S@N-term; missed K-G@4 0.0100158 2095.965332 1048.99 2095.955811 1048.985229 2 9 1.1.1.5718.21 1 63.2718 279.2396 63.2515 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 76.6200006 SSSKGSLGGGFSSGGFSGGSFSR cleaved I-S@N-term; missed K-G@4 -0.00703979 2095.948975 699.6569 2095.955811 699.6592407 3 8 1.1.1.5706.19 1 62.9636 2330.69 63.1996 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 73.72999787 SSSKGSLGGGFSSGGFSGGSFSR cleaved I-S@N-term; missed K-G@4 -0.00667359 2095.949219 699.657 2095.955811 699.6592407 3 10 1.1.1.5725.18 1 63.4478 3498.089 63.2515 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 99.00000095 SSSSGSVGESSSKGP cleaved P-R@C-term; missed K-G@13 -0.00485627 1338.585083 670.2998 1338.589966 670.3022461 2 25 1.1.1.3297.2 1 21.523 854.3655 21.6121 4 12.31 12.31 33.73000026 13.69999945 13.69999945 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)]" 0 17.5699994 VLDELTLTK 0.0212695 1030.612305 516.3134 1030.591064 516.3027954 2 5 1.1.1.5352.8 1 54.0948 531.3849 54.1082 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.00000095 DALSSVQESQVAQQAR -0.0122896 1715.831421 858.923 1715.843872 858.9291992 2 25 1.1.1.4731.4 1 39.4298 0 -1 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.00000095 SEAEDASLLSFMQGYMK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term -0.000768322 1937.837891 969.9262 1937.838623 969.9266357 2 20 1.1.1.5435.21 1 56.1619 1209.423 55.896 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.00000095 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12 cleaved A-S@N-term; missed K-H@17 0.0237156 2359.106201 590.7838 2359.08252 590.7778931 4 12 1.1.1.6049.11 1 71.8011 572.8149 71.7615 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00490365 2016.028564 673.0168 2016.02356 673.0151367 3 24 1.1.1.5317.9 1 53.2426 1880.644 53.2261 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.79587996 99.00000095 PEVRPTSAVAA cleaved D-P@N-term -0.00149636 1096.586304 549.3004 1096.587646 549.3010864 2 14 1.1.1.4205.2 1 29.1174 164.5219 29.1364 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.437707126 90.9799993 HATKTAKDALSSVQESQVAQQAR missed K-T@4; missed K-D@7 0.0267465 2453.289063 614.3295 2453.262207 614.3228149 4 16 1.1.1.6067.15 1 72.2821 781.6008 72.2922 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 DALSSVQESQVAQQAR -0.00167 1715.842041 858.9283 1715.843872 858.9291992 2 18 1.1.1.4639.9 1 37.3233 485.2021 37.4971 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 DALSSVQESQVAQQAR 0.000585662 1715.84436 572.9554 1715.843872 572.9552002 3 17 1.1.1.4646.6 1 37.492 818.2836 37.473 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 DALSSVQESQVAQQAR -0.000329823 1715.843384 572.9551 1715.843872 572.9552002 3 23 1.1.1.4653.6 1 37.6604 833.3093 37.5692 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 DALSSVQESQVAQQAR -0.00362557 1715.840088 572.954 1715.843872 572.9552002 3 21 1.1.1.4660.4 1 37.8297 833.4118 37.7137 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 DALSSVQESQVAQQAR -0.0060643 1715.837646 858.9261 1715.843872 858.9291992 2 24 1.1.1.4664.5 1 37.9253 545.1547 37.6655 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 DALSSVQESQVAQQAR 0.00553177 1715.849243 858.9319 1715.843872 858.9291992 2 24 1.1.1.4676.7 1 38.1554 304.3696 38.1366 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 DALSSVQESQVAQQAR -0.00240238 1715.841431 858.928 1715.843872 858.9291992 2 24 1.1.1.4684.6 1 38.3479 312.0587 38.2805 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 DALSSVQESQVAQQAR 0.000160958 1715.844116 858.9293 1715.843872 858.9291992 2 22 1.1.1.4692.6 1 38.5414 230.7907 38.5465 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 DALSSVQESQVAQQAR -0.0030127 1715.84082 858.9277 1715.843872 858.9291992 2 25 1.1.1.4801.4 1 40.9599 176.3125 40.965 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term 0.00240536 1937.841064 969.9278 1937.838623 969.9266357 2 20 1.1.1.5407.21 1 55.461 1056.602 55.5675 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term 0.0022833 1937.84082 969.9277 1937.838623 969.9266357 2 23 1.1.1.5414.21 1 55.6389 1389.653 55.8228 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term 0.00240536 1937.841064 969.9278 1937.838623 969.9266357 2 24 1.1.1.5421.20 1 55.8177 1396.688 55.8228 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term 0.00240536 1937.841064 969.9278 1937.838623 969.9266357 2 24 1.1.1.5428.16 1 55.9885 1396.688 55.8228 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMK cleaved A-S@N-term 0.053954799 1905.902832 953.9587 1905.848877 953.9317017 2 23 1.1.1.6081.19 1 72.655 1119.276 72.6894 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term 0.00548009 1921.849243 961.9319 1921.84375 961.9291382 2 20 1.1.1.5850.20 1 66.632 2179.973 66.8187 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term 0.00548009 1921.849243 961.9319 1921.84375 961.9291382 2 24 1.1.1.5857.20 1 66.8128 2190.501 66.8187 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 97.39000201 SEAEDASLLSFMQGYMK Oxidation(M)@12 cleaved A-S@N-term 0.00364888 1921.847534 961.931 1921.84375 961.9291382 2 15 1.1.1.5621.16 1 60.817 226.4535 60.9007 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 92.08999872 SEAEDASLLSFMQGYMK Oxidation(M)@12 cleaved A-S@N-term 0.00145171 1921.845215 961.9299 1921.84375 961.9291382 2 11 1.1.1.5608.21 1 60.4973 158.6453 60.477 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 76.6200006 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term 0.00645637 1921.85022 961.9324 1921.84375 961.9291382 2 7 1.1.1.5630.20 1 61.0436 247.2629 61.0495 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMKHATK Oxidation(Y)@15 cleaved A-S@N-term; missed K-H@17 0.056077499 2359.138428 787.3868 2359.08252 787.368103 3 19 1.1.1.6139.7 1 74.1718 986.8332 74.1551 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 -0.00452856 2375.072998 594.7755 2375.077393 594.7766113 4 21 1.1.1.5973.15 1 69.8226 2742.532 69.5725 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 -0.00452856 2375.072998 594.7755 2375.077393 594.7766113 4 18 1.1.1.5959.12 1 69.4552 2729.054 69.5725 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 -0.00452856 2375.072998 594.7755 2375.077393 594.7766113 4 19 1.1.1.5966.13 1 69.6391 2729.054 69.5725 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 0.000547828 2375.077881 792.6999 2375.077393 792.699707 3 13 1.1.1.5976.21 1 69.9057 836.9137 69.6244 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 -0.00501681 2375.072266 594.7753 2375.077393 594.7766113 4 14 1.1.1.5950.12 1 69.2216 2449.929 69.4678 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 98.39000106 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 -0.00452856 2375.072998 594.7755 2375.077393 594.7766113 4 13 1.1.1.5958.11 1 69.4286 2729.054 69.5725 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 98.39000106 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 0.000364732 2375.077637 792.6998 2375.077393 792.699707 3 11 1.1.1.5962.21 1 69.5407 866.7593 69.5989 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 98.39000106 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 0.000364732 2375.077637 792.6998 2375.077393 792.699707 3 12 1.1.1.5964.20 1 69.593 866.7593 69.5989 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 98.39000106 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 0.000364732 2375.077637 792.6998 2375.077393 792.699707 3 11 1.1.1.5968.20 1 69.6971 866.7593 69.5989 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 97.33999968 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 0.000364732 2375.077637 792.6998 2375.077393 792.699707 3 11 1.1.1.5960.20 1 69.4877 866.7593 69.5989 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 97.33999968 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 -0.00379617 2375.073242 594.7756 2375.077393 594.7766113 4 12 1.1.1.5980.14 1 70.0032 2011.782 69.7292 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 96.85999751 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 -0.00452856 2375.072998 594.7755 2375.077393 594.7766113 4 12 1.1.1.5965.13 1 69.6126 2729.054 69.5725 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.0102135 2016.034058 673.0186 2016.02356 673.0151367 3 15 1.1.1.5282.15 1 52.3826 634.6286 52.6181 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00545294 2016.029297 673.017 2016.02356 673.0151367 3 19 1.1.1.5289.14 1 52.5569 1075.122 52.7159 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00545294 2016.029297 673.017 2016.02356 673.0151367 3 24 1.1.1.5296.8 1 52.7321 1075.122 52.7159 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00600223 2016.029785 673.0172 2016.02356 673.0151367 3 24 1.1.1.5303.8 1 52.899 1715.105 53.052 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00600223 2016.029785 673.0172 2016.02356 673.0151367 3 15 1.1.1.5305.15 1 52.948 1715.105 53.052 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00600223 2016.029785 673.0172 2016.02356 673.0151367 3 23 1.1.1.5310.16 1 53.0674 1715.105 53.052 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00600223 2016.029785 673.0172 2016.02356 673.0151367 3 13 1.1.1.5312.19 1 53.1201 1715.105 53.052 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00545294 2016.029297 673.017 2016.02356 673.0151367 3 23 1.1.1.5324.17 1 53.4128 2255.36 53.4196 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00545294 2016.029297 673.017 2016.02356 673.0151367 3 15 1.1.1.5328.15 1 53.5091 2255.36 53.4196 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00636843 2016.030029 673.0173 2016.02356 673.0151367 3 23 1.1.1.5331.12 1 53.588 1895.116 53.5948 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00929797 2016.032715 673.0182 2016.02356 673.0151367 3 14 1.1.1.5335.17 1 53.686 1693.433 53.6944 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00929797 2016.032715 673.0182 2016.02356 673.0151367 3 21 1.1.1.5338.16 1 53.7612 1693.433 53.6944 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00581914 2016.029419 673.0171 2016.02356 673.0151367 3 22 1.1.1.5346.8 1 53.9535 1206.107 53.9396 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00600223 2016.029785 673.0172 2016.02356 673.0151367 3 16 1.1.1.5353.18 1 54.1251 1201.063 53.8675 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00636843 2016.030029 673.0173 2016.02356 673.0151367 3 21 1.1.1.5362.10 1 54.3381 550.1229 54.3516 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00868325 2016.015137 673.0123 2016.02356 673.0151367 3 14 1.1.1.5401.16 1 55.3055 241.8408 55.3651 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00868325 2016.015137 673.0123 2016.02356 673.0151367 3 14 1.1.1.5408.14 1 55.4805 241.8408 55.3651 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00545294 2016.029297 673.017 2016.02356 673.0151367 3 12 1.1.1.5321.15 1 53.3366 2255.36 53.4196 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00874868 2016.032593 673.0181 2016.02356 673.0151367 3 11 1.1.1.5376.15 1 54.6908 385.847 54.7009 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.00545294 2016.029297 673.017 2016.02356 673.0151367 3 10 1.1.1.5290.12 1 52.5803 1075.122 52.7159 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.00000095 TAKDALSSVQESQVAQQAR missed K-D@3 0.0127137 2016.035522 1009.025 2016.02356 1009.019104 2 8 1.1.1.5308.11 1 53.0224 172.5244 53.1018 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 85.31000018 TAKDALSSVQESQVAQQAR missed K-D@3 0.00636843 2016.030029 673.0173 2016.02356 673.0151367 3 11 1.1.1.5369.12 1 54.5119 550.1229 54.3516 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 50.74999928 TAKDALSSVQESQVAQQAR missed K-D@3 0.0158277 2016.039307 505.0171 2016.02356 505.0131836 4 8 1.1.1.5332.13 1 53.6082 238.134 53.5948 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 46.02000117 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00758466 2016.015869 673.0126 2016.02356 673.0151367 3 12 1.1.1.5417.10 1 55.7072 201.8374 55.5165 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 34.07000005 TAKDALSSVQESQVAQQAR missed K-D@3 0.00526781 2016.029419 1009.022 2016.02356 1009.019104 2 6 1.1.1.5332.20 1 53.6141 287.8525 53.62 5 9.23 9.23 86.87000275 51.52000189 51.52000189 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 19.14000064 TAKDALSSVQESQVAQQAR missed K-D@3 0.00545294 2016.029297 673.017 2016.02356 673.0151367 3 7 1.1.1.5371.12 1 54.5629 383.2471 54.5494 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 2 99.00000095 FLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAH Carbamidomethyl(C)@25; Carbamidomethyl(C)@43 cleaved I-F@N-term; cleaved H-C@C-term; missed K-I@18 -10.90779972 6117.046387 1020.515 6127.951172 1022.33252 6 12 1.1.1.6045.21 1 71.7041 9097.41 71.9467 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 2 99.00000095 PYQVSLNSGYHFCGGSLINSQWVVSAAH Carbamidomethyl(C)@13 cleaved V-P@N-term; cleaved H-C@C-term -6.919980049 3070.526123 1024.516 3077.445313 1026.822388 3 16 1.1.1.6055.20 1 71.9666 1469.905 71.9467 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 2 99.00000095 SGYHFCGGSLINSQWVVSAAH Carbamidomethyl(C)@6; Deamidated(N)@12 cleaved N-S@N-term; cleaved H-C@C-term -0.00976258 2277.017578 760.0131 2277.027344 760.0163574 3 12 1.1.1.6046.20 1 71.7293 993.2553 71.7352 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 2 99.00000095 TLNNDIMLIKL Deamidated(N)@3; Dethiomethyl(M)@7; acrolein addition +76(K)@10 cleaved N-T@N-term; cleaved L-K@C-term; missed K-L@10 0.024647599 1315.763428 658.889 1315.73877 658.8766479 2 13 1.1.1.6097.20 0 73.0804 1434.18 73.1128 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0.003050752 99.00000095 TLNNDIMLIK Deamidated(N)@3 cleaved N-T@N-term -0.00561825 1174.621216 588.3179 1174.626709 588.3206787 2 15 1.1.1.5681.11 0 62.3203 7881.058 62.562 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 99.00000095 INSQWVVSAAH cleaved L-I@N-term; cleaved H-C@C-term 0.00173683 1210.611328 606.3129 1210.609497 606.3120117 2 10 1.1.1.5160.10 0 49.4111 182.5824 49.4195 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 97.11999893 INSQWVVSAAH cleaved L-I@N-term; cleaved H-C@C-term -0.000338265 1210.609131 606.3118 1210.609497 606.3120117 2 9 1.1.1.5169.14 0 49.6356 147.7345 49.6707 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 61.21000051 IQVR cleaved G-I@N-term 0.0102539 514.3330078 515.3403 514.3227539 515.3300171 1 5 1.1.1.4405.5 0 32.449 111.6838 32.454 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 99.00000095 LINSQWVVSAAH cleaved S-L@N-term; cleaved H-C@C-term -0.00502622 1323.688477 662.8515 1323.693481 662.8540649 2 15 1.1.1.5471.18 0 57.0647 519.9542 56.9711 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 94.12999749 LINSQWVVSAAH cleaved S-L@N-term; cleaved H-C@C-term -0.000998068 1323.692505 662.8535 1323.693481 662.8540649 2 12 1.1.1.5449.17 0 56.5149 474.4446 56.7252 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 92.08999872 LINSQWVVSAAH cleaved S-L@N-term; cleaved H-C@C-term -0.00466003 1323.688843 662.8517 1323.693481 662.8540649 2 11 1.1.1.5464.17 0 56.8884 570.7117 56.872 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 84.85999703 LINSQWVVSAAH cleaved S-L@N-term; cleaved H-C@C-term -0.0044159 1323.689087 662.8518 1323.693481 662.8540649 2 10 1.1.1.5456.17 0 56.6919 564.6918 56.872 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 76.6200006 LINSQWVVSAAH cleaved S-L@N-term; cleaved H-C@C-term -0.00160839 1323.691895 662.8532 1323.693481 662.8540649 2 8 1.1.1.5442.20 0 56.3381 220.2296 56.2934 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 72.85000086 NKPGVYTK Delta:H(4)C(2)@N-term 0.000732649 933.5290527 467.7718 933.5283813 467.7714539 2 10 1.1.1.3291.2 0 21.4404 247.2113 21.4753 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 99.00000095 PYQVSLNSGYHFCGGSLINSQWVVSAAH Carbamidomethyl(C)@13 cleaved V-P@N-term; cleaved H-C@C-term -3.176569939 3074.270264 1025.764 3077.445313 1026.822388 3 12 1.1.1.6057.19 1 72.0199 1004.182 72.0266 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 43.00000072 SQWVVSAAH cleaved N-S@N-term; cleaved H-C@C-term 0.00429066 983.4868774 492.7507 983.4824829 492.7485046 2 8 1.1.1.4540.5 0 34.9924 169.5959 34.9975 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 99.00000095 TLNNDIMLIK Deamidated(N)@3; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term 0.000558809 1202.658691 602.3366 1202.658081 602.3363037 2 11 1.1.1.5736.17 0 63.7274 538.3254 63.6851 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 99.00000095 TLNNDIMLIK Deamidated(N)@3 cleaved N-T@N-term -2.17E-05 1174.626709 588.3206 1174.626709 588.3206787 2 8 1.1.1.5737.13 0 63.7498 311.0402 63.6595 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 99.00000095 TLNNDIMLIK Deamidated(N)@3; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term 0.000558809 1202.658691 602.3366 1202.658081 602.3363037 2 10 1.1.1.5743.17 0 63.9066 538.3254 63.6851 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 98.8499999 TLNNDIMLIK Deamidated(N)@3; Methyl(K)@10 cleaved N-T@N-term 0.00136858 1188.643921 595.3292 1188.642456 595.3284912 2 10 1.1.1.5729.14 0 63.5466 1373.139 63.2769 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 98.39000106 TLNNDIMLIK Deamidated(N)@3; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term 0.000558809 1202.658691 602.3366 1202.658081 602.3363037 2 8 1.1.1.5729.16 0 63.5482 538.3254 63.6851 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 96.1499989 TLNNDIMLIK Deamidated(N)@3 cleaved N-T@N-term -0.00769337 1174.619019 588.3168 1174.626709 588.3206787 2 13 1.1.1.5674.10 0 62.1409 5454.972 62.3848 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 96.1499989 TLNNDIMLIK Deamidated(N)@3 cleaved N-T@N-term -0.00561825 1174.621216 588.3179 1174.626709 588.3206787 2 16 1.1.1.5688.12 0 62.498 7728.612 62.5361 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 94.12999749 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 15 1.1.1.5469.13 0 57.0099 6959.281 57.1231 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 94.12999749 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 16 1.1.1.5476.10 0 57.1847 6959.281 57.1231 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.005195 1190.616455 596.3155 1190.621704 596.3181152 2 12 1.1.1.5462.9 0 56.8325 5626.528 57.0216 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 15 1.1.1.5483.13 0 57.3649 5627.537 57.351 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.005195 1190.616455 596.3155 1190.621704 596.3181152 2 14 1.1.1.5490.12 0 57.5373 5640.586 57.2752 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.00775838 1190.613892 596.3142 1190.621704 596.3181152 2 13 1.1.1.5497.11 0 57.7092 4444.795 57.4516 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7; Methyl(K)@10 cleaved N-T@N-term 0.0118 1204.649048 603.3318 1204.637329 603.3259277 2 12 1.1.1.5506.13 0 57.9366 872.9335 57.8978 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Methyl(K)@10 cleaved N-T@N-term -0.00461168 1188.637817 595.3262 1188.642456 595.3284912 2 13 1.1.1.5715.11 0 63.1861 1396.289 63.2769 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Methyl(K)@10 cleaved N-T@N-term -0.00461168 1188.637817 595.3262 1188.642456 595.3284912 2 13 1.1.1.5722.12 0 63.366 1396.289 63.2769 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 91.61999822 TLNNDIMLIK Deamidated(N)@3; Deamidated(N)@4; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term 0.0217446 1203.663818 602.8392 1203.64209 602.8283081 2 7 1.1.1.5731.12 0 63.5954 318.0764 63.6851 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 84.85999703 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.00421848 1190.617432 596.316 1190.621704 596.3181152 2 10 1.1.1.5455.13 0 56.6639 2277.4 56.8968 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 84.85999703 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.00421848 1190.617432 596.316 1190.621704 596.3181152 2 10 1.1.1.5525.10 0 58.4089 864.8729 58.2497 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 79.43999767 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 9 1.1.1.5511.13 0 58.0635 912.9232 57.9994 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 79.43999767 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7; Methyl(K)@10 cleaved N-T@N-term 0.0124103 1204.649902 603.3322 1204.637329 603.3259277 2 11 1.1.1.5513.13 0 58.1144 890.1987 57.9994 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 76.6200006 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.00580533 1190.615845 596.3152 1190.621704 596.3181152 2 9 1.1.1.5504.14 0 57.8868 2470.457 57.6236 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 76.6200006 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.00421848 1190.617432 596.316 1190.621704 596.3181152 2 9 1.1.1.5518.5 0 58.2313 864.8729 58.2497 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 76.6200006 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term 0.0586452 1190.680298 596.3474 1190.621704 596.3181152 2 9 1.1.1.5553.12 0 59.11 18514.11 58.9008 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 76.6200006 TLNNDIMLIK Deamidated(N)@3; Dethiomethyl(M)@7; MDA adduct +62(K)@10 cleaved N-T@N-term -0.00148498 1188.637451 595.326 1188.639038 595.3267822 2 8 1.1.1.5708.8 0 63.0049 1252.251 63.2515 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 70.78999877 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.00397435 1190.617676 596.3161 1190.621704 596.3181152 2 7 1.1.1.5532.11 0 58.5848 520.9286 58.5233 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 61.650002 TLNNDIMLIK Deamidated(N)@3; Deamidated(N)@4 cleaved N-T@N-term -0.00615223 1175.604614 588.8096 1175.610718 588.8126831 2 5 1.1.1.5599.15 0 60.2652 191.0884 60.2752 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 58.49999785 TLNNDIMLIK Deamidated(N)@3; Deamidated(N)@4; Oxidation(M)@7 cleaved N-T@N-term 0.0125807 1191.618286 596.8164 1191.605713 596.8101196 2 8 1.1.1.5516.8 0 58.1874 513.9291 58.1761 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 46.02000117 TLNNDIMLIK Deamidated(N)@3 cleaved N-T@N-term -0.00561825 1174.621216 588.3179 1174.626709 588.3206787 2 15 1.1.1.5695.14 0 62.6789 7728.612 62.5361 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 46.02000117 TLNNDIMLIK Deamidated(N)@3 cleaved N-T@N-term -0.0036652 1174.623047 588.3188 1174.626709 588.3206787 2 13 1.1.1.5702.14 0 62.8582 6183.781 62.5873 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 46.02000117 TLNNDIMLIK Deamidated(N)@3 cleaved N-T@N-term -0.0040314 1174.622925 588.3187 1174.626709 588.3206787 2 12 1.1.1.5709.15 0 63.0361 3368.827 62.7666 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 36.25999987 TLNNDIMLIK Deamidated(N)@3 cleaved N-T@N-term 0.00266368 1174.629517 588.322 1174.626709 588.3206787 2 7 1.1.1.5730.9 0 63.5676 483.2747 63.3023 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 31.56000078 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 6 1.1.1.5491.15 0 57.5642 5627.537 57.351 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 16.84000045 TLNNDIMLIK Deamidated(N)@3 cleaved N-T@N-term 0.00400639 1174.630615 588.3226 1174.626709 588.3206787 2 5 1.1.1.5744.14 0 63.9294 230.6157 63.915 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 94.84000206 TLNNDIMLIKL Deamidated(N)@3; Oxidation(M)@7 cleaved N-T@N-term; cleaved L-K@C-term; missed K-L@10 0.000510719 1303.706299 652.8604 1303.705688 652.8601685 2 8 1.1.1.5904.18 0 68.0282 272.2945 68.0357 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 66.00000262 TVPYQVSLN cleaved N-T@N-term; cleaved N-S@C-term 0.00369622 1019.532471 510.7735 1019.528748 510.7716675 2 13 1.1.1.4977.5 0 45.0133 1452.112 44.8557 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 66.00000262 TVPYQVSLN cleaved N-T@N-term; cleaved N-S@C-term 0.00326899 1019.532043 510.7733 1019.528748 510.7716675 2 11 1.1.1.5010.5 0 45.7646 705.9682 45.7251 6 8 12.42 50.20999908 33.32999945 28.40000093 cont|000137 spt|P00760| Cationic trypsin precursor (EC 3.4.21.4) (Beta-trypsin) (Fragment) [Bos taurus (contaminant)] 0 20.83999962 TVPYQVSLN cleaved N-T@N-term; cleaved N-S@C-term 0.00668681 1019.535461 510.775 1019.528748 510.7716675 2 6 1.1.1.5074.7 0 47.2984 293.0666 47.2416 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 2 99.00000095 GFSSGSAVVSGGSR -0.00391336 1253.596313 627.8054 1253.599976 627.807312 2 19 1.1.1.4250.2 1 29.7224 115.7395 29.7024 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 2 99.00000095 NLDLDSIIAEVK 0.00300263 1328.721924 665.3682 1328.71875 665.3666382 2 13 1.1.1.6012.17 0 70.8338 618.6852 70.7907 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 2 99.00000095 SISISVAGGGGGFGAAGGFGGR 0.00128125 1837.908447 919.9615 1837.907104 919.9608154 2 14 1.1.1.5564.21 1 59.3925 345.0325 59.3225 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 0.0893756 99.00000095 SLVGLGGTKSISISVAGGGGGFGAAGGFGGR missed K-S@9 -1.000380039 2649.382324 884.1347 2650.382813 884.4682007 3 20 1.1.1.6019.19 1 71.019 499.3441 71.0001 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 0.009217308 18.76000017 SLVGLGGTK 0.00106853 830.4872437 416.2509 830.486145 416.2503662 2 5 1.1.1.4992.2 1 45.3605 995.79 45.4107 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 0.001304842 39.07999992 SSGSSSYGSGGRQSGSR cleaved Y-S@N-term; missed R-Q@12 0.0136561 1602.711914 802.3632 1602.698242 802.3563843 2 7 1.1.1.6011.21 1 70.8111 1052.886 70.922 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 0 66.2800014 GGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGR Hex(R)@3 cleaved F-G@N-term; missed R-G@3 -0.021143001 2830.186768 944.4029 2830.208008 944.4099121 3 19 1.1.1.5646.16 1 61.44 376.9309 61.4719 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 0 99.00000095 SISISVAGGGGGFGAAGGFGGR 0.00250189 1837.909668 919.9621 1837.907104 919.9608154 2 13 1.1.1.5542.20 1 58.8451 299.5743 58.9502 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 0 99.00000095 SISISVAGGGGGFGAAGGFGGR 0.00152538 1837.908691 919.9616 1837.907104 919.9608154 2 21 1.1.1.5550.21 1 59.0438 435.0754 59.1226 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 0 99.00000095 SISISVAGGGGGFGAAGGFGGR 0.00152538 1837.908691 919.9616 1837.907104 919.9608154 2 14 1.1.1.5557.21 1 59.2175 435.0754 59.1226 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 0 99.00000095 SISISVAGGGGGFGAAGGFGGR 0.00128125 1837.908447 919.9615 1837.907104 919.9608154 2 14 1.1.1.5571.18 1 59.5671 354.5671 59.2972 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 0 18.65999997 SLVGLGGTK 0.00704974 830.4932861 416.2539 830.486145 416.2503662 2 7 1.1.1.5126.2 1 48.5728 663.7468 48.467 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 0 29.87999916 SSGSSSYGSGGRQSGSR cleaved Y-S@N-term; missed R-Q@12 0.0110928 1602.709229 802.3619 1602.698242 802.3563843 2 7 1.1.1.6025.17 1 71.1748 942.7934 71.1567 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 0 23.66999984 SSGSSSYGSGGRQSGSR cleaved Y-S@N-term; missed R-Q@12 0.0108487 1602.709106 802.3618 1602.698242 802.3563843 2 6 1.1.1.6039.20 1 71.5475 1418.663 71.5259 7 6.11 6.11 45.69999874 13.61999959 8.919999748 sp|P35908|K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 0 38.56999874 TAAENDFVTLKK Carbamidomethyl@N-term missed K-K@11 -0.0104342 1392.714355 465.2454 1392.724854 465.2489014 3 5 1.1.1.5626.2 0 60.9295 744.5291 61.0742 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 2 99.00000095 AAKIIRHPKYNRITLNNDIMLIK reduced acrolein addition +96(K)@9; Deamidated(N)@16 cleaved N-A@N-term; missed K-I@3; missed R-H@6; missed K-Y@9; missed R-I@12 -0.033534098 2831.587158 944.8697 2831.62085 944.8808594 3 11 1.1.1.6075.21 0 72.499 1458.758 72.5832 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 2 99.00000095 VYNYVDWIKDTIAAN Oxidation(W)@7; acrolein addition +112(K)@9 cleaved N-S@C-term; missed K-D@9 -0.0398512 1911.88562 956.9501 1911.925415 956.9699707 2 10 1.1.1.6108.21 1 73.3728 1823.388 73.4577 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0.703334808 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00563187 1373.66333 687.8389 1373.657593 687.8360596 2 19 1.1.1.4733.2 1 39.477 281.4212 39.4585 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0.01999663 79.61999774 SVPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00371847 1005.516846 503.7657 1005.513123 503.7638245 2 13 1.1.1.4811.4 1 41.1748 5119.379 41.2316 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0.017728766 94.94000077 SVPYQVSLNSG cleaved N-S@N-term; cleaved G-S@C-term 0.00324908 1149.569824 575.7922 1149.56665 575.7905884 2 11 1.1.1.4779.3 1 40.4744 859.0697 40.527 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0.003050752 80.83000183 EHNIEVLEGNEQFINAAK cleaved G-E@N-term 0.0219763 2054.029297 1028.022 2054.006836 1028.010742 2 11 1.1.1.5540.20 1 58.7947 1497.627 58.7499 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0.001304842 97.93000221 LGEHNIEVLEGNEQFINAAK Deamidated(N)@5; Cation:K(E)@7 -0.041452099 2263.010742 755.3442 2263.052246 755.3580322 3 12 1.1.1.5824.15 1 65.978 716.4065 65.9881 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0.000434512 30.86000085 SVPYQVSLNS cleaved N-S@N-term; cleaved S-G@C-term 0.000203154 1092.545532 547.28 1092.545166 547.2798462 2 9 1.1.1.4794.3 1 40.7937 226.8491 40.775 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 79.43999767 EHNIEVLEGNEQFINAAK cleaved G-E@N-term 0.0219763 2054.029297 1028.022 2054.006836 1028.010742 2 10 1.1.1.5533.20 1 58.6173 1497.627 58.7499 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 79.43999767 EHNIEVLEGNEQFINAAK cleaved G-E@N-term 0.0219763 2054.029297 1028.022 2054.006836 1028.010742 2 10 1.1.1.5547.20 1 58.969 1497.627 58.7499 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 34.95999873 EQFINAAK cleaved N-E@N-term 0.000738392 919.4770508 460.7458 919.4763184 460.7454529 2 7 1.1.1.4275.2 0 30.048 281.1479 29.9536 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 61.21000051 IQVR cleaved H-I@N-term 0.0102539 514.3330078 515.3403 514.3227539 515.3300171 1 5 1.1.1.4405.5 0 32.449 111.6838 32.454 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 47.08999991 IVGGYTCEENSVPYQVSLN Oxidation(Y)@5; Carbamidomethyl(C)@7; Deamidated(N)@10 cleaved N-S@C-term 0.0052631 2144.963379 1073.489 2144.957275 1073.48584 2 11 1.1.1.5628.18 1 60.9929 2938.747 61.0245 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.75000119 IVGGYTCEENSVPYQVSLNSGSH Oxidation(Y)@5; Carbamidomethyl(C)@7; Deamidated(N)@10 cleaved H-F@C-term -0.00113136 2513.10083 838.7075 2513.101563 838.7078247 3 15 1.1.1.5747.19 1 64.0105 2901.848 64.1199 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.10000062 IVGGYTCEENSVPYQVSLNSGSH Oxidation(Y)@5; Carbamidomethyl(C)@7; Deamidated(N)@10 cleaved H-F@C-term -0.00113136 2513.10083 838.7075 2513.101563 838.7078247 3 11 1.1.1.5754.19 1 64.1902 2901.848 64.1199 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 88.48999739 IVGGYTCEENSVPYQVSLNSGSH Oxidation(Y)@5; Carbamidomethyl(C)@7; Deamidated(N)@10 cleaved H-F@C-term -0.000948261 2513.10083 838.7075 2513.101563 838.7078247 3 10 1.1.1.5740.19 1 63.8314 2358.012 64.0173 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 75.18000007 IVGGYTCEENSVPYQVSLNSGSH Carbamidomethyl(C)@7 cleaved H-F@C-term 2.959700108 2499.082275 834.0347 2496.122803 833.0481567 3 13 1.1.1.5672.13 1 62.0972 1953.077 62.1809 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 58.49999785 IVGGYTCEENSVPYQVSLNSGSH Carbamidomethyl(C)@7 cleaved H-F@C-term 2.959700108 2499.082275 834.0347 2496.122803 833.0481567 3 12 1.1.1.5679.17 1 62.2763 1953.077 62.1809 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.39000106 LGEHNIEVLEGNEQFINAAK Methyl(E)@7 -0.00234736 2238.125732 747.0492 2238.128174 747.0499878 3 21 1.1.1.5850.18 0 66.6303 5198.736 66.5088 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 86.55999899 LGEHNIEVLEGNEQFINAAK Deamidated(N)@5; Cation:K(E)@7 -0.041452099 2263.010742 755.3442 2263.052246 755.3580322 3 10 1.1.1.5832.13 1 66.1728 716.4065 65.9881 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 86.55999899 LGEHNIEVLEGNEQFINAAK Methyl(E)@7 -0.00271355 2238.125488 747.0491 2238.128174 747.0499878 3 8 1.1.1.5865.18 0 67.0167 1762.17 66.7415 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 93.41999888 MFCVGFLEGGK Carbamyl@N-term; Carbamidomethyl(C)@3 -0.0279298 1286.550903 644.2827 1286.578735 644.2966309 2 8 1.1.1.5998.16 1 70.4711 620.6285 70.5321 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 84.34000015 MFCVGFLEGGK Carbamyl@N-term; Carbamidomethyl(C)@3 -0.028540101 1286.550293 644.2824 1286.578735 644.2966309 2 7 1.1.1.6012.16 1 70.833 750.9838 70.6856 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 87.86000013 QVSLNSGSH cleaved Y-Q@N-term; cleaved H-F@C-term 0.000148212 927.4411011 464.7278 927.440979 464.7277832 2 10 1.1.1.3622.3 0 23.9337 1338.251 24.0093 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 83.39999914 QVSLNSGSH cleaved Y-Q@N-term; cleaved H-F@C-term -0.000279016 927.4406738 464.7276 927.440979 464.7277832 2 11 1.1.1.3664.2 0 24.2772 652.996 24.1714 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 75.3000021 QVSLNSGSH cleaved Y-Q@N-term; cleaved H-F@C-term -0.000279016 927.4406738 464.7276 927.440979 464.7277832 2 11 1.1.1.3644.2 0 24.1041 2145.074 24.0581 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 96.59000039 RLGEHNIEVLEGNEQFINAAK Carbamidomethyl@N-term cleaved V-R@N-term; missed R-L@1 0.0448073 2437.279785 813.4339 2437.235107 813.4189453 3 10 1.1.1.5824.18 0 65.9805 937.5542 66.1338 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 92.86000133 RLGEHNIEVLEGNEQFINAAK Carbamidomethyl@N-term cleaved V-R@N-term; missed R-L@1 0.0448073 2437.279785 813.4339 2437.235107 813.4189453 3 11 1.1.1.5838.18 0 66.323 937.5542 66.1338 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 67.9700017 RLGEHNIEVLEGNEQFINAAK Carbamidomethyl@N-term cleaved V-R@N-term; missed R-L@1 0.0448073 2437.279785 813.4339 2437.235107 813.4189453 3 10 1.1.1.5831.19 0 66.1518 937.5542 66.1338 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 57.85999894 RRPGVYTK Arg->Orn(R)@2 missed R-R@1 -0.0105008 933.5290527 467.7718 933.5396118 467.7770691 2 10 1.1.1.3291.2 0 21.4404 247.2113 21.4753 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 53.3100009 SVPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00194853 1005.515076 503.7648 1005.513123 503.7638245 2 9 1.1.1.4883.4 1 42.7989 675.9557 42.6408 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 51.99999809 SVPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00371847 1005.516846 503.7657 1005.513123 503.7638245 2 11 1.1.1.4822.3 1 41.4162 5119.379 41.2316 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 51.99999809 SVPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.0041457 1005.517273 503.7659 1005.513123 503.7638245 2 11 1.1.1.4838.3 1 41.797 1966.325 41.5459 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 16.84000045 SVPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00390157 1005.51709 503.7658 1005.513123 503.7638245 2 9 1.1.1.4862.4 1 42.356 1042.184 42.2897 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 75.3000021 SVPYQVSLNSG cleaved N-S@N-term; cleaved G-S@C-term 0.00324908 1149.569824 575.7922 1149.56665 575.7905884 2 10 1.1.1.4787.4 1 40.6642 859.0697 40.527 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 57.85999894 SVPYQVSLNSG cleaved N-S@N-term; cleaved G-S@C-term 0.00105191 1149.567627 575.7911 1149.56665 575.7905884 2 9 1.1.1.4799.3 1 40.9124 392.689 40.9413 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.00144786 1373.656128 687.8353 1373.657593 687.8360596 2 17 1.1.1.4701.2 1 38.7565 358.7776 38.7616 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.00462154 1373.652832 687.8337 1373.657593 687.8360596 2 17 1.1.1.4720.4 1 39.1882 325.8372 39.1933 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00233613 1373.659912 687.8372 1373.657593 687.8360596 2 15 1.1.1.4882.5 1 42.7792 329.4865 42.7842 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00160374 1373.659302 687.8369 1373.657593 687.8360596 2 14 1.1.1.4899.7 1 43.166 440.0889 43.2191 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00160374 1373.659302 687.8369 1373.657593 687.8360596 2 13 1.1.1.4907.6 1 43.3578 440.0889 43.2191 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.000227221 1373.657227 687.8359 1373.657593 687.8360596 2 13 1.1.1.4915.7 1 43.5475 357.4651 43.6272 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00343471 1373.661133 687.8378 1373.657593 687.8360596 2 14 1.1.1.4943.5 1 44.2006 284.3291 44.278 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.00120374 1373.65625 687.8354 1373.657593 687.8360596 2 15 1.1.1.4709.3 1 38.9278 457.2246 38.8619 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00880554 1373.666504 687.8405 1373.657593 687.8360596 2 12 1.1.1.4987.6 1 45.2554 211.7756 45.1406 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.00156993 1373.656128 687.8353 1373.657593 687.8360596 2 12 1.1.1.5002.4 1 45.5681 0 -1 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.00181406 1373.65564 687.8351 1373.657593 687.8360596 2 14 1.1.1.4694.7 1 38.5874 662.9659 38.5465 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00477741 1373.662231 687.8384 1373.657593 687.8360596 2 12 1.1.1.4756.6 1 39.9662 0 -1 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00196994 1373.659424 687.837 1373.657593 687.8360596 2 13 1.1.1.4821.6 1 41.3983 281.6646 41.4034 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.00144786 1373.656128 687.8353 1373.657593 687.8360596 2 13 1.1.1.4842.8 1 41.8798 353.3375 41.861 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00184787 1373.659424 687.837 1373.657593 687.8360596 2 13 1.1.1.4849.6 1 42.0471 381.5418 42.0522 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.000993422 1373.658447 687.8365 1373.657593 687.8360596 2 14 1.1.1.4861.4 1 42.3322 364.2715 42.3135 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00563187 1373.66333 687.8389 1373.657593 687.8360596 2 14 1.1.1.4871.4 1 42.5303 422.7691 42.4623 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00258026 1373.660034 687.8373 1373.657593 687.8360596 2 11 1.1.1.5035.9 1 46.3705 133.1367 46.3781 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00514361 1373.66272 687.8386 1373.657593 687.8360596 2 14 1.1.1.4931.2 1 43.9329 255.1989 43.9142 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.000959607 1373.656616 687.8356 1373.657593 687.8360596 2 14 1.1.1.4687.5 1 38.4204 570.8174 38.4014 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.0030347 1373.654419 687.8345 1373.657593 687.8360596 2 14 1.1.1.4801.3 1 40.9541 314.475 40.87 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.000959607 1373.656616 687.8356 1373.657593 687.8360596 2 14 1.1.1.4832.2 1 41.6516 324.3366 41.6413 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.000959607 1373.656616 687.8356 1373.657593 687.8360596 2 13 1.1.1.4680.5 1 38.2513 570.8174 38.4014 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term -0.000959607 1373.656616 687.8356 1373.657593 687.8360596 2 11 1.1.1.4783.6 1 40.5693 341.8559 40.4795 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00319058 1373.660645 687.8376 1373.657593 687.8360596 2 13 1.1.1.4813.4 1 41.2265 308.6887 41.2079 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00514361 1373.66272 687.8386 1373.657593 687.8360596 2 13 1.1.1.5015.3 1 45.8883 213.6385 45.8694 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.54999781 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00258026 1373.660034 687.8373 1373.657593 687.8360596 2 8 1.1.1.5043.5 1 46.5611 165.3813 46.5972 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.17000031 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00184787 1373.659424 687.837 1373.657593 687.8360596 2 9 1.1.1.5089.11 1 47.6716 142.1115 47.6554 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 97.11999893 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00196994 1373.659424 687.837 1373.657593 687.8360596 2 11 1.1.1.4822.4 1 41.422 281.6646 41.4034 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 97.11999893 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00123755 1373.658813 687.8367 1373.657593 687.8360596 2 10 1.1.1.4905.6 1 43.3065 440.6097 43.243 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 97.11999893 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00599806 1373.663696 687.8391 1373.657593 687.8360596 2 9 1.1.1.4954.8 1 44.4609 255.5171 44.495 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 95.46999931 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00282439 1373.660522 687.8375 1373.657593 687.8360596 2 9 1.1.1.4964.8 1 44.7038 292.2628 44.663 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 64.38999772 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00184787 1373.659424 687.837 1373.657593 687.8360596 2 6 1.1.1.5025.8 1 46.1276 197.4402 46.1838 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 57.85999894 SVPYQVSLNSGSH cleaved N-S@N-term; cleaved H-F@C-term 0.00258026 1373.660034 687.8373 1373.657593 687.8360596 2 6 1.1.1.5082.14 1 47.4978 145.0045 47.4589 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 TLNNDIMLIK Deamidated(N)@3 cleaved I-T@N-term -0.00561825 1174.621216 588.3179 1174.626709 588.3206787 2 15 1.1.1.5681.11 0 62.3203 7881.058 62.562 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 TLNNDIMLIK Deamidated(N)@3; Delta:H(4)C(2)(K)@10 cleaved I-T@N-term 0.000558809 1202.658691 602.3366 1202.658081 602.3363037 2 11 1.1.1.5736.17 0 63.7274 538.3254 63.6851 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 TLNNDIMLIK Deamidated(N)@3 cleaved I-T@N-term -2.17E-05 1174.626709 588.3206 1174.626709 588.3206787 2 8 1.1.1.5737.13 0 63.7498 311.0402 63.6595 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 TLNNDIMLIK Deamidated(N)@3; Delta:H(4)C(2)(K)@10 cleaved I-T@N-term 0.000558809 1202.658691 602.3366 1202.658081 602.3363037 2 10 1.1.1.5743.17 0 63.9066 538.3254 63.6851 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.8499999 TLNNDIMLIK Deamidated(N)@3; Methyl(K)@10 cleaved I-T@N-term 0.00136858 1188.643921 595.3292 1188.642456 595.3284912 2 10 1.1.1.5729.14 0 63.5466 1373.139 63.2769 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.39000106 TLNNDIMLIK Deamidated(N)@3; Delta:H(4)C(2)(K)@10 cleaved I-T@N-term 0.000558809 1202.658691 602.3366 1202.658081 602.3363037 2 8 1.1.1.5729.16 0 63.5482 538.3254 63.6851 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 96.1499989 TLNNDIMLIK Deamidated(N)@3 cleaved I-T@N-term -0.00769337 1174.619019 588.3168 1174.626709 588.3206787 2 13 1.1.1.5674.10 0 62.1409 5454.972 62.3848 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 96.1499989 TLNNDIMLIK Deamidated(N)@3 cleaved I-T@N-term -0.00561825 1174.621216 588.3179 1174.626709 588.3206787 2 16 1.1.1.5688.12 0 62.498 7728.612 62.5361 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 94.12999749 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 15 1.1.1.5469.13 0 57.0099 6959.281 57.1231 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 94.12999749 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 16 1.1.1.5476.10 0 57.1847 6959.281 57.1231 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.005195 1190.616455 596.3155 1190.621704 596.3181152 2 12 1.1.1.5462.9 0 56.8325 5626.528 57.0216 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 15 1.1.1.5483.13 0 57.3649 5627.537 57.351 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.005195 1190.616455 596.3155 1190.621704 596.3181152 2 14 1.1.1.5490.12 0 57.5373 5640.586 57.2752 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.00775838 1190.613892 596.3142 1190.621704 596.3181152 2 13 1.1.1.5497.11 0 57.7092 4444.795 57.4516 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7; Methyl(K)@10 cleaved I-T@N-term 0.0118 1204.649048 603.3318 1204.637329 603.3259277 2 12 1.1.1.5506.13 0 57.9366 872.9335 57.8978 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Methyl(K)@10 cleaved I-T@N-term -0.00461168 1188.637817 595.3262 1188.642456 595.3284912 2 13 1.1.1.5715.11 0 63.1861 1396.289 63.2769 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 92.08999872 TLNNDIMLIK Deamidated(N)@3; Methyl(K)@10 cleaved I-T@N-term -0.00461168 1188.637817 595.3262 1188.642456 595.3284912 2 13 1.1.1.5722.12 0 63.366 1396.289 63.2769 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 91.61999822 TLNNDIMLIK Deamidated(N)@3; Deamidated(N)@4; Delta:H(4)C(2)(K)@10 cleaved I-T@N-term 0.0217446 1203.663818 602.8392 1203.64209 602.8283081 2 7 1.1.1.5731.12 0 63.5954 318.0764 63.6851 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 84.85999703 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.00421848 1190.617432 596.316 1190.621704 596.3181152 2 10 1.1.1.5455.13 0 56.6639 2277.4 56.8968 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 84.85999703 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.00421848 1190.617432 596.316 1190.621704 596.3181152 2 10 1.1.1.5525.10 0 58.4089 864.8729 58.2497 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 79.43999767 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 9 1.1.1.5511.13 0 58.0635 912.9232 57.9994 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 79.43999767 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7; Methyl(K)@10 cleaved I-T@N-term 0.0124103 1204.649902 603.3322 1204.637329 603.3259277 2 11 1.1.1.5513.13 0 58.1144 890.1987 57.9994 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 76.6200006 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.00580533 1190.615845 596.3152 1190.621704 596.3181152 2 9 1.1.1.5504.14 0 57.8868 2470.457 57.6236 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 76.6200006 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.00421848 1190.617432 596.316 1190.621704 596.3181152 2 9 1.1.1.5518.5 0 58.2313 864.8729 58.2497 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 76.6200006 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term 0.0586452 1190.680298 596.3474 1190.621704 596.3181152 2 9 1.1.1.5553.12 0 59.11 18514.11 58.9008 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 76.6200006 TLNNDIMLIK Deamidated(N)@3; Dethiomethyl(M)@7; MDA adduct +62(K)@10 cleaved I-T@N-term -0.00148498 1188.637451 595.326 1188.639038 595.3267822 2 8 1.1.1.5708.8 0 63.0049 1252.251 63.2515 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 70.78999877 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.00397435 1190.617676 596.3161 1190.621704 596.3181152 2 7 1.1.1.5532.11 0 58.5848 520.9286 58.5233 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 61.650002 TLNNDIMLIK Deamidated(N)@3; Deamidated(N)@4 cleaved I-T@N-term -0.00615223 1175.604614 588.8096 1175.610718 588.8126831 2 5 1.1.1.5599.15 0 60.2652 191.0884 60.2752 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 58.49999785 TLNNDIMLIK Deamidated(N)@3; Deamidated(N)@4; Oxidation(M)@7 cleaved I-T@N-term 0.0125807 1191.618286 596.8164 1191.605713 596.8101196 2 8 1.1.1.5516.8 0 58.1874 513.9291 58.1761 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 46.02000117 TLNNDIMLIK Deamidated(N)@3 cleaved I-T@N-term -0.00561825 1174.621216 588.3179 1174.626709 588.3206787 2 15 1.1.1.5695.14 0 62.6789 7728.612 62.5361 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 46.02000117 TLNNDIMLIK Deamidated(N)@3 cleaved I-T@N-term -0.0036652 1174.623047 588.3188 1174.626709 588.3206787 2 13 1.1.1.5702.14 0 62.8582 6183.781 62.5873 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 46.02000117 TLNNDIMLIK Deamidated(N)@3 cleaved I-T@N-term -0.0040314 1174.622925 588.3187 1174.626709 588.3206787 2 12 1.1.1.5709.15 0 63.0361 3368.827 62.7666 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 36.25999987 TLNNDIMLIK Deamidated(N)@3 cleaved I-T@N-term 0.00266368 1174.629517 588.322 1174.626709 588.3206787 2 7 1.1.1.5730.9 0 63.5676 483.2747 63.3023 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 31.56000078 TLNNDIMLIK Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term -0.00495087 1190.616699 596.3156 1190.621704 596.3181152 2 6 1.1.1.5491.15 0 57.5642 5627.537 57.351 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 16.84000045 TLNNDIMLIK Deamidated(N)@3 cleaved I-T@N-term 0.00400639 1174.630615 588.3226 1174.626709 588.3206787 2 5 1.1.1.5744.14 0 63.9294 230.6157 63.915 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 TLNNDIMLIKL Deamidated(N)@3; Dethiomethyl(M)@7; acrolein addition +76(K)@10 cleaved I-T@N-term; cleaved L-S@C-term; missed K-L@10 0.024647599 1315.763428 658.889 1315.73877 658.8766479 2 13 1.1.1.6097.20 0 73.0804 1434.18 73.1128 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 94.84000206 TLNNDIMLIKL Deamidated(N)@3; Oxidation(M)@7 cleaved I-T@N-term; cleaved L-S@C-term; missed K-L@10 0.000510719 1303.706299 652.8604 1303.705688 652.8601685 2 8 1.1.1.5904.18 0 68.0282 272.2945 68.0357 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 VLEGNEQFINAAK cleaved E-V@N-term 0.00323453 1431.739014 716.8768 1431.73584 716.8751831 2 14 1.1.1.5018.7 0 45.9582 166.7555 45.9175 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.00000095 VLEGNEQFINAAK cleaved E-V@N-term 0.00201389 1431.737915 716.8762 1431.73584 716.8751831 2 10 1.1.1.5028.11 0 46.1997 156.8162 46.1595 8 4.75 11.05 46.1499989 41.29999876 32.39000142 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 22.10000008 VLEGNEQFINAAK cleaved E-V@N-term 0.00347866 1431.739258 716.8769 1431.73584 716.8751831 2 8 1.1.1.4949.4 0 44.3452 103.4832 44.3262 9 2.02 2.02 52.43999958 1.052000001 0.219199993 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.000434512 17.15999991 AGKLKFIIPSPKR acrolein addition +76(K)@3; MDA adduct +62(K)@5; MDA adduct +62(K)@12 cleaved R-P@C-term; missed K-L@3; missed K-F@5; missed K-R@12 0.0089271 1653.984863 552.3356 1653.975952 552.3325806 3 5 1.1.1.5695.12 1 62.6772 1724.458 62.6638 9 2.02 2.02 52.43999958 1.052000001 0.219199993 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 28.00000012 ENLCLNLHKFNE acrolein addition +76(K)@9 cleaved E-F@C-term; missed K-F@9 0.00934525 1605.770508 803.8925 1605.760986 803.8877563 2 5 1.1.1.5519.20 1 58.2684 261.1338 58.2497 9 2.02 2.02 52.43999958 1.052000001 0.219199993 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 85.01999974 INDVLEHVK ONE addition +154(K)@9 -0.00326859 1525.703247 763.8589 1525.706543 763.8605347 2 10 1.1.1.5201.9 1 50.4105 579.3953 50.6365 9 2.02 2.02 52.43999958 1.052000001 0.219199993 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 64.38999772 INDVLEHVK ONE addition +154(K)@9 -0.00265827 1525.703857 763.8592 1525.706543 763.8605347 2 10 1.1.1.5208.11 1 50.5819 592.4392 50.6365 9 2.02 2.02 52.43999958 1.052000001 0.219199993 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 57.85999894 INDVLEHVK ONE addition +154(K)@9 -9.49E-05 1525.706421 763.8605 1525.706543 763.8605347 2 10 1.1.1.5222.9 1 50.9254 639.7594 50.7856 9 2.02 2.02 52.43999958 1.052000001 0.219199993 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 57.85999894 INDVLEHVK ONE addition +154(K)@9 0.00100365 1525.70752 763.861 1525.706543 763.8605347 2 9 1.1.1.5262.8 1 51.8903 197.5444 51.9004 9 2.02 2.02 52.43999958 1.052000001 0.219199993 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 50.69000125 INDVLEHVK ONE addition +154(K)@9 0.000149202 1525.706665 763.8606 1525.706543 763.8605347 2 9 1.1.1.5236.10 1 51.2665 326.1822 51.371 9 2.02 2.02 52.43999958 1.052000001 0.219199993 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 26.75999999 INDVLEHVK ONE addition +154(K)@9 -0.000461118 1525.706055 763.8603 1525.706543 763.8605347 2 8 1.1.1.5255.8 1 51.7223 202.9313 51.7058 9 2.02 2.02 52.43999958 1.052000001 0.219199993 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 70.03999949 NIQEYLSILTDPDGKGKEK MDA adduct +62(K)@15; acrolein addition +56(K)@17 missed K-G@15; missed K-E@17 -0.00602991 2281.141846 761.3879 2281.147705 761.3898926 3 8 1.1.1.6030.21 1 71.3093 1386.451 71.4196 10 2 4.03 45.21000087 7.801000029 3.900999948 sp|P04259|K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 2 99.00000095 SLYGLGGSKR missed K-R@9 -0.00097919 1036.56543 519.29 1036.566528 519.2905273 2 7 1.1.1.5733.5 1 63.6411 312.2676 63.6851 10 2 4.03 45.21000087 7.801000029 3.900999948 sp|P04259|K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 0 99.00000095 NLDLDSIIAEVK 0.00300263 1328.721924 665.3682 1328.71875 665.3666382 2 13 1.1.1.6012.17 0 70.8338 618.6852 70.7907 10 2 4.03 45.21000087 7.801000029 3.900999948 sp|P04259|K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 0 36.25999987 SLYGLGGSKR missed K-R@9 -0.00097919 1036.56543 519.29 1036.566528 519.2905273 2 5 1.1.1.5740.6 1 63.8206 312.2676 63.6851 10 2 4.03 45.21000087 7.801000029 3.900999948 sp|P04259|K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 0 61.650002 TAAENEFVTLKK Carbamyl@N-term missed K-K@11 -0.0191314 1392.705688 465.2425 1392.724854 465.2489014 3 7 1.1.1.5611.5 0 60.5602 477.7891 60.7514 10 2 4.03 45.21000087 7.801000029 3.900999948 sp|P04259|K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 0 58.49999785 TAAENEFVTLKK Carbamyl@N-term missed K-K@11 -0.00896942 1392.715942 465.2459 1392.724854 465.2489014 3 5 1.1.1.5589.5 0 60.0065 290.4011 59.975 10 2 4.03 45.21000087 7.801000029 3.900999948 sp|P04259|K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 0 42.01000035 TAAENEFVTLKK Carbamyl@N-term missed K-K@11 -0.0104342 1392.714355 465.2454 1392.724854 465.2489014 3 5 1.1.1.5640.5 0 61.2787 744.5291 61.0742 10 2 4.03 45.21000087 7.801000029 3.900999948 sp|P04259|K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 0 28.00000012 TAAENEFVTLKK Carbamyl@N-term missed K-K@11 -0.0104342 1392.714355 465.2454 1392.724854 465.2489014 3 5 1.1.1.5626.2 0 60.9295 744.5291 61.0742 10 2 4.03 45.21000087 7.801000029 3.900999948 sp|P04259|K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 0 60.50000191 YEELQITAGR 0.00392447 1178.597046 590.3058 1178.59314 590.303833 2 9 1.1.1.5014.5 0 45.8643 114.5927 45.821 10 2 4.03 45.21000087 7.801000029 3.900999948 sp|P04259|K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 0 26.96999907 YEELQITAGR 0.00807467 1178.601318 590.3079 1178.59314 590.303833 2 6 1.1.1.5155.6 0 49.2806 47.2733 49.1943 11 2 2 33.7500006 11.2499997 11.2499997 cont|000119; cont|000111; cont|000076; cont|000066; cont|000065; cont|000057; cont|000052; cont|000046 gi|8099322|gb|AAF72097.1|AF105260_1 kappa-casein precursor [Bos taurus (contaminant)]; gi|4887004|gb|AAD32139.1|AF123250_1 kappa-casein precursor [Bos taurus (contaminant)]; gi|27881412|ref|NP_776719.1| casein kappa [Bos taurus (contaminant)]; gi|22552663|gb|AAM25910.1| kappa-casein short form [Bos grunniens (contaminant)]; gi|22552661|gb|AAM25909.1| kappa-casein long form [Bos grunniens (contaminant)]; gi|8099320|gb|AAF72096.1|AF092513_1 kappa-casein [Bos indicus x Bos taurus (contaminant)]; gi|7528205|gb|AAF63191.1| kappa-casein [Bos grunniens (contaminant)]; gi|4887006|gb|AAD32140.1|AF123251_1 kappa-casein precursor [Bos taurus (contaminant)] 2 99.00000095 SPAQILQWQVLSNTVPAK -0.000212792 1979.083862 660.7019 1979.083984 660.7019653 3 12 1.1.1.5903.16 1 68.0013 360.8653 68.0357