N Unused Total %Cov %Cov(50) %Cov(95) Accessions Names Used Annotation Contrib Conf Sequence Modifications Cleavages dMass Prec MW Prec m/z Theor MW Theor m/z Theor z Sc Spectrum Specific Time PrecursorSignal PrecursorElution 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 AEAESLYQSK -0.00476176012307405 1124.5302734375 563.2724 1124.53491210938 563.274780273438 2 12 1.1.1.3404.3 1 25.3356 242.4578 25.3492 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 AEAESLYQSKYEELQITAGR missed K-Y@10 -0.00150087999645621 2285.11596679688 762.7126 2285.11767578125 762.713134765625 3 15 1.1.1.4044.10 1 40.6716 1643.357 40.7521 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 AQYEDIAQK -0.00364057999104261 1064.51025390625 533.2624 1064.51379394531 533.264221191406 2 9 1.1.1.3392.6 1 25.0319 2297.868 25.1171 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 DVDGAYMTK -0.00625979993492365 998.431701660156 500.2231 998.437927246094 500.226226806641 2 11 1.1.1.3431.2 1 25.9876 438.1928 26.0953 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 DYQELMNTK -0.00167914002668113 1140.51049804688 571.2625 1140.51208496094 571.263366699219 2 8 1.1.1.3712.7 1 32.6203 328.1264 32.5771 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 FLEQQNQVLQTK -0.00371309998445213 1474.77429199219 738.3944 1474.77795410156 738.396301269531 2 8 1.1.1.3732.16 0 33.103 200.4092 33.0122 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 FLEQQNQVLQTKWELLQQVDTSTR missed K-W@12 0.00630709016695619 2931.51538085938 978.1791 2931.50903320313 978.176940917969 3 16 1.1.1.4448.12 1 51.0979 1580.633 51.1566 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 FSSCGGGGGSFGAGGGFGSR Carbamidomethyl(C)@4 -0.00480502983555198 1764.72265625 883.3686 1764.72741699219 883.370971679688 2 19 1.1.1.3760.12 1 33.8088 390.6076 33.84 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR -0.00117218995001167 2382.943359375 795.3217 2382.94458007813 795.322143554688 3 29 1.1.1.3382.2 1 24.7836 1536.103 24.8521 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 GSGGGSSGGSIGGR -0.00637090997770429 1091.4892578125 546.7519 1091.49560546875 546.755065917969 2 19 1.1.1.1112.2 1 8.1926 268.4049 8.1296 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR 0.010874199680984 3311.31201171875 1104.778 3311.30078125 1104.77416992188 3 22 1.1.1.3448.4 1 26.3913 1086.03 26.4215 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 IEISELNR -0.00631726020947099 972.517700195313 487.2661 972.523986816406 487.269287109375 2 11 1.1.1.3728.6 0 33.0036 2640.597 32.9879 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 IEISELNRVIQR missed R-V@8 -0.00429499009624124 1468.83178710938 490.6179 1468.83618164063 490.619323730469 3 8 1.1.1.4097.10 0 42.0228 1920.315 42.1151 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 LALDLEIATYR -0.0074906200170517 1276.6953125 639.3549 1276.70275878906 639.358642578125 2 16 1.1.1.4419.7 1 50.3279 2282.218 50.2405 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 LLRDYQELMNTK missed R-D@3 0.000911261013243347 1522.78234863281 508.6014 1522.78137207031 508.60107421875 3 16 1.1.1.3926.2 1 37.855 1419.638 37.8602 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 LNDLEDALQQAK 0.00131371000315994 1356.68981933594 679.3522 1356.6884765625 679.351501464844 2 11 1.1.1.4033.6 1 40.3928 419.3282 40.4771 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 LRSEIDNVKK missed R-S@2; missed K-K@9 -0.00697395019233227 1200.67565917969 401.2325 1200.6826171875 401.234832763672 3 12 1.1.1.2247.2 1 16.1943 192.9946 16.2179 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 MSGECAPNVSVSVSTSHTTISGGGSR Oxidation(M)@1; Carbamidomethyl(C)@5 0.0139356004074216 2580.16845703125 861.0634 2580.15454101563 861.058776855469 3 20 1.1.1.3659.7 1 31.3323 414.0612 31.3617 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 NKYEDEINKR missed K-Y@2; missed K-R@9 -0.00521190976724029 1307.64184570313 436.8879 1307.64697265625 436.889587402344 3 12 1.1.1.3176.2 0 22.6664 211.3747 22.6967 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 QISNLQQSISDAEQR 0.00391269009560347 1715.84765625 572.9565 1715.84387207031 572.955200195313 3 17 1.1.1.3883.4 1 36.8375 1457.09 36.9203 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 SGGGFSSGSAGIINYQR 0.00452010985463858 1656.7900390625 829.4023 1656.78564453125 829.400085449219 2 12 1.1.1.3864.11 1 36.4343 288.4201 36.4644 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 SISISVAR -0.0043198699131608 831.47705078125 416.7458 831.4814453125 416.747985839844 2 9 1.1.1.3645.4 1 30.9844 4015.77 30.8551 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 SKAEAESLYQSK missed K-A@2 -0.00591091997921467 1339.65600585938 447.5593 1339.66198730469 447.561248779297 3 13 1.1.1.3309.2 1 23.7964 273.6251 23.7769 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 SKAEAESLYQSKYEELQITAGR missed K-A@2; missed K-Y@12 0.00358725991100073 2500.248046875 626.0693 2500.24462890625 626.068420410156 4 23 1.1.1.3952.5 1 38.437 4676.813 38.5217 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 SLDLDSIIAEVK -0.00889030005782843 1301.69909667969 651.8568 1301.70788574219 651.861206054688 2 9 1.1.1.4298.7 1 47.1983 188.9512 47.1837 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 SLDLDSIIAEVKAQYEDIAQK missed K-A@12 0.046162698417902 2348.25732421875 783.7597 2348.21118164063 783.744323730469 3 14 1.1.1.5014.19 1 65.667 374.9482 65.7522 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 SLNNQFASFIDK -0.00205942988395691 1382.68103027344 692.3478 1382.68298339844 692.348815917969 2 9 1.1.1.4283.15 1 46.8014 799.5189 46.7328 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 SLNNQFASFIDKVR missed K-V@12 0.00571164023131132 1637.85827636719 546.96 1637.8525390625 546.958129882813 3 9 1.1.1.4400.3 1 49.8665 6542.052 49.8068 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 SLVNLGGSKSISISVAR missed K-S@9 -0.00163602002430707 1686.96130371094 563.3277 1686.962890625 563.328247070313 3 7 1.1.1.4096.7 1 41.9946 1098.209 42.0891 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 THNLEPYFESFINNLR 0.00596384005621076 1992.97534179688 665.3324 1992.96936035156 665.330383300781 3 10 1.1.1.4709.8 1 57.7846 377.0392 57.5077 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 THNLEPYFESFINNLRR missed R-R@16 -0.00148463994264603 2149.06884765625 538.2745 2149.07055664063 538.27490234375 4 11 1.1.1.4602.9 1 55.029 1133.613 55.0189 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 TLLEGEESR -0.0047226301394403 1032.50402832031 517.2593 1032.5087890625 517.261657714844 2 11 1.1.1.3476.4 1 27.0305 4358.569 26.9748 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 TNAENEFVTIK -0.00679341005161405 1264.623046875 633.3188 1264.6298828125 633.322265625 2 15 1.1.1.3818.12 1 35.2795 1489.396 35.2848 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 TNAENEFVTIKK missed K-K@11 -0.00603799009695649 1392.71887207031 465.2469 1392.72485351563 465.248901367188 3 16 1.1.1.3589.4 1 29.6545 4938.841 29.7148 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 1.17392539978027 99.0000009536743 EDIAQKSK Deamidated(Q)@5; hexanoyl addition +98(K)@6; hexanoyl addition +98(K)@8 cleaved Y-E@N-term; missed K-S@6 0.0314942002296448 1114.64367675781 558.3291 1114.61218261719 558.313354492188 2 4 1.1.1.4890.12 1 62.3956 82.3371 62.3822 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.331614077091217 53.3500015735626 SGGGFSSGSAGIINYQRR missed R-R@17 -0.000393553986214101 1812.88623046875 605.3027 1812.88671875 605.302856445313 3 8 1.1.1.3741.10 1 33.3254 464.5102 33.3837 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.281498312950134 99.0000009536743 NAENEFVTIK Carbamidomethyl@N-term cleaved T-N@N-term -0.00512176007032394 1220.5986328125 611.3066 1220.60375976563 611.309143066406 2 10 1.1.1.3799.12 0 34.7961 445.8363 34.7784 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.196542873978615 36.3900005817413 QISNLQQSISDAEQRGENALKDAK missed R-G@15; missed K-D@21 -0.000357148994226009 2642.32568359375 661.5887 2642.32592773438 661.588745117188 4 9 1.1.1.4318.8 1 47.7216 1477.469 47.7903 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.159266769886017 30.6600004434586 SDQSRLDSELK missed R-L@5 -0.00347518990747631 1276.62243652344 426.5481 1276.62585449219 426.549255371094 3 9 1.1.1.3433.3 1 26.0329 188.392 26.044 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.136677145957947 27.0000010728836 LDSELKNMQDMVEDYR missed K-N@6 0.00443447008728981 1984.8916015625 662.6378 1984.88708496094 662.636291503906 3 9 1.1.1.4277.7 1 46.6424 300.3276 46.6544 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.134896025061607 26.690000295639 SEIDNVKK missed K-K@7 -0.00709564005956054 931.490478515625 466.7525 931.497436523438 466.756011962891 2 7 1.1.1.1542.2 1 11.2503 103.9435 11.2196 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.0741724297404289 15.6800001859665 SLVNLGGSK -0.00631250999867916 873.485656738281 437.7501 873.492004394531 437.753265380859 2 8 1.1.1.3629.7 1 30.5966 11558.69 30.5652 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.0136762224137783 62.3399972915649 DNNRSLDLDSIIAEVK cleaved M-D@N-term; missed R-S@4 -0.0151819996535778 1800.90637207031 601.3094 1800.92175292969 601.314514160156 3 7 1.1.1.4459.9 0 51.3743 108.3382 51.3879 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.000869458774104714 68.8700020313263 NKLNDLEDALQQAK Methyl(D)@8 missed K-L@2 -0.00122700002975762 1612.84094238281 538.6209 1612.84204101563 538.621276855469 3 11 1.1.1.4166.7 0 43.8211 315.7433 43.8095 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.000434511806815863 73.8600015640259 LLEGEESR Carbamidomethyl@N-term cleaved T-L@N-term -0.00715435994789004 988.475463867188 495.245 988.482543945313 495.24853515625 2 7 1.1.1.3502.6 1 27.6783 632.0281 27.7433 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 AEAESLYQSKYEELQITAGR missed K-Y@10 -0.00150087999645621 2285.11596679688 762.7126 2285.11767578125 762.713134765625 3 20 1.1.1.4051.8 1 40.8466 1643.357 40.7521 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 43.1800007820129 AQYEDIAQK -0.00364057999104261 1064.51025390625 533.2624 1064.51379394531 533.264221191406 2 7 1.1.1.3399.5 1 25.2126 2297.868 25.1171 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 31.4099997282028 AQYEDIAQK Oxidation(Y)@3 -0.0111015001311898 1080.49768066406 541.2561 1080.5087890625 541.261657714844 2 6 1.1.1.3396.4 1 25.1365 91.6835 25.1171 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 DVDGAYMTK -0.00625979993492365 998.431701660156 500.2231 998.437927246094 500.226226806641 2 9 1.1.1.3438.2 1 26.1534 438.1928 26.0953 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 FLEQQNQVLQTKWELLQQVDTSTR missed K-W@12 0.0157273001968861 2931.52490234375 733.8885 2931.50903320313 733.884521484375 4 12 1.1.1.4450.10 0 51.1463 1225.128 51.1818 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 FLEQQNQVLQTKWELLQQVDTSTR missed K-W@12 0.0157273001968861 2931.52490234375 733.8885 2931.50903320313 733.884521484375 4 11 1.1.1.4454.13 1 51.2472 1225.128 51.1818 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 FLEQQNQVLQTKWELLQQVDTSTR missed K-W@12 0.00630709016695619 2931.51538085938 978.1791 2931.50903320313 978.176940917969 3 11 1.1.1.4455.18 0 51.2771 1580.633 51.1566 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 FSSCGGGGGSFGAGGGFGSR Octanoyl(S)@3; Carbamidomethyl(C)@4 0.0318195000290871 1890.86389160156 631.2952 1890.83190917969 631.284545898438 3 12 1.1.1.3678.14 1 31.7915 639.7902 31.7985 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR Ser->LacticAcid(S)@20; Dioxidation(Y)@21 0.0483574010431767 2399.97192382813 800.9979 2399.92358398438 800.981750488281 3 23 1.1.1.3383.3 1 24.8153 930.978 24.8521 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 GSGGGSSGGSIGGR -0.00588263990357518 1091.48962402344 546.7521 1091.49560546875 546.755065917969 2 15 1.1.1.1091.2 1 8.0223 278.3915 8.077 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR Ser->LacticAcid(S)@16; Dioxidation(Y)@17 0.0534938015043736 3328.33325195313 833.0906 3328.27978515625 833.077209472656 4 28 1.1.1.3449.3 1 26.4163 455.5702 26.4215 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 98.989999294281 IEISELNR -0.00631726020947099 972.517700195313 487.2661 972.523986816406 487.269287109375 2 9 1.1.1.3721.4 0 32.8334 2640.597 32.9879 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 57.7600002288818 IEISELNR -0.00631726020947099 972.517700195313 487.2661 972.523986816406 487.269287109375 2 6 1.1.1.3735.4 0 33.1672 2640.597 32.9879 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 LALDLEIATYR -0.0074906200170517 1276.6953125 639.3549 1276.70275878906 639.358642578125 2 13 1.1.1.4412.9 1 50.149 2282.218 50.2405 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 LALDLEIATYR -0.00419487990438938 1276.69848632813 639.3565 1276.70275878906 639.358642578125 2 8 1.1.1.4428.6 1 50.5641 1310.561 50.2925 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 LNDLEDALQQAK 0.00131371000315994 1356.68981933594 679.3522 1356.6884765625 679.351501464844 2 10 1.1.1.4040.9 1 40.5646 419.3282 40.4771 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 LRSEIDNVKK missed R-S@2; missed K-K@9 -0.00660774996504188 1200.67602539063 401.2326 1200.6826171875 401.234832763672 3 10 1.1.1.2273.2 1 16.3639 193.5704 16.3333 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 MSGECAPNVSVSVSTSHTTISGGGSR Carbamidomethyl@N-term; Cation:Na(E)@4; Carbamidomethyl(C)@5 0.0215121991932392 2643.1845703125 661.8034 2643.16284179688 661.798034667969 4 12 1.1.1.3578.9 1 29.3881 383.0631 29.3958 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 QISNLQQSISDAEQR 0.00391269009560347 1715.84765625 572.9565 1715.84387207031 572.955200195313 3 13 1.1.1.3892.3 1 37.0238 1461.4 36.9203 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 SKAEAESLYQSKYEELQITAGR missed K-A@2; missed K-Y@12 0.0148783000186086 2500.25952148438 834.4271 2500.24462890625 834.422119140625 3 23 1.1.1.3955.5 1 38.5164 908.0105 38.5459 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 SKAEAESLYQSKYEELQITAGR missed K-A@2; missed K-Y@12 0.00358725991100073 2500.248046875 626.0693 2500.24462890625 626.068420410156 4 18 1.1.1.3959.7 1 38.6135 4676.813 38.5217 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 SLDLDSIIAEVK -0.00144439004361629 1301.70642089844 651.8605 1301.70788574219 651.861206054688 2 8 1.1.1.4622.15 1 55.5419 5618.366 55.7057 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 SLDLDSIIAEVK -0.00144439004361629 1301.70642089844 651.8605 1301.70788574219 651.861206054688 2 19 1.1.1.4629.16 1 55.722 5618.366 55.7057 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 SLDLDSIIAEVK -0.00144439004361629 1301.70642089844 651.8605 1301.70788574219 651.861206054688 2 14 1.1.1.4636.12 1 55.8995 5618.366 55.7057 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 SLDLDSIIAEVK -0.00461805984377861 1301.70324707031 651.8589 1301.70788574219 651.861206054688 2 10 1.1.1.4643.13 1 56.0838 1858.535 55.8087 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 SLDLDSIIAEVK -0.00168851995840669 1301.70629882813 651.8604 1301.70788574219 651.861206054688 2 7 1.1.1.4650.14 1 56.263 456.5094 56.1725 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 42.1600013971329 SLDLDSIIAEVKAQYEDIAQK missed K-A@12 0.046162698417902 2348.25732421875 783.7597 2348.21118164063 783.744323730469 3 7 1.1.1.5023.19 1 65.9038 374.9482 65.7522 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 31.3899993896484 SLNNQFASFIDK -0.00205942988395691 1382.68103027344 692.3478 1382.68298339844 692.348815917969 2 7 1.1.1.4290.6 1 46.9867 826.1288 46.7065 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 15.3600007295609 SLNNQFASFIDKVR missed K-V@12 -0.00454179011285305 1637.84802246094 546.9566 1637.8525390625 546.958129882813 3 7 1.1.1.4409.4 1 50.0706 419.3291 50.0891 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 27.5499999523163 SLVNLGGSKSISISVAR missed K-S@9 -0.00163602002430707 1686.96130371094 563.3277 1686.962890625 563.328247070313 3 6 1.1.1.4103.5 1 42.1747 1098.209 42.0891 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 THNLEPYFESFINNLR 0.00816098973155022 1992.9775390625 665.3331 1992.96936035156 665.330383300781 3 16 1.1.1.4686.13 1 57.2003 627.4833 57.3342 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 THNLEPYFESFINNLR 0.00816098973155022 1992.9775390625 665.3331 1992.96936035156 665.330383300781 3 16 1.1.1.4695.10 1 57.4243 627.4833 57.3342 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 THNLEPYFESFINNLR 0.00742861023172736 1992.97680664063 665.3329 1992.96936035156 665.330383300781 3 12 1.1.1.4702.8 1 57.6011 632.5046 57.3342 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 THNLEPYFESFINNLRR missed R-R@16 0.00998941995203495 2149.08056640625 538.2774 2149.07055664063 538.27490234375 4 7 1.1.1.4625.10 1 55.6143 277.2543 55.6288 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 21.6600000858307 THNLEPYFESFINNLRR missed R-R@16 0.00486272014677525 2149.07543945313 538.2761 2149.07055664063 538.27490234375 4 7 1.1.1.4610.6 1 55.2264 562.4914 55.2192 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 19.2900002002716 THNLEPYFESFINNLRR missed R-R@16 0.00242143007926643 2149.07299804688 538.2755 2149.07055664063 538.27490234375 4 5 1.1.1.4592.7 1 54.7691 1104.311 55.0189 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 15.3600007295609 THNLEPYFESFINNLRR missed R-R@16 0.0153603004291654 2149.08569335938 538.2787 2149.07055664063 538.27490234375 4 4 1.1.1.4640.9 1 56.0017 232.9781 55.7315 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 TLLEGEESR -0.0047226301394403 1032.50402832031 517.2593 1032.5087890625 517.261657714844 2 11 1.1.1.3469.2 1 26.8608 4358.569 26.9748 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 43.1800007820129 TLLEGEESR -0.0047226301394403 1032.50402832031 517.2593 1032.5087890625 517.261657714844 2 7 1.1.1.3483.4 1 27.2061 4606.808 26.9508 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 29.6099990606308 TNAENEFVTIK -0.00679341005161405 1264.623046875 633.3188 1264.6298828125 633.322265625 2 7 1.1.1.3825.18 0 35.457 1489.396 35.2848 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 22.9699999094009 TNAENEFVTIK -0.00679341005161405 1264.623046875 633.3188 1264.6298828125 633.322265625 2 7 1.1.1.3811.8 0 35.0987 1485.269 35.2848 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 TNAENEFVTIKK missed K-K@11 -0.00603799009695649 1392.71887207031 465.2469 1392.72485351563 465.248901367188 3 9 1.1.1.3596.5 0 29.8231 4938.841 29.7148 1 70.5 70.5 78.4200012683868 59.1600000858307 58.0699980258942 cont|000134 rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 TNAENEFVTIKK Ammonia-loss(N)@2 missed K-K@11 -0.00147002004086971 1375.69689941406 688.8557 1375.69836425781 688.8564453125 2 9 1.1.1.3830.8 1 35.5854 90.5276 35.5669 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AEFVEVTK -0.00548260007053614 921.475280761719 461.7449 921.480773925781 461.747650146484 2 8 1.1.1.3574.5 1 29.2857 2319.285 29.3712 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.000796795007772744 1691.93530273438 564.9857 1691.9345703125 564.985473632813 3 12 1.1.1.4626.10 1 55.6402 1221.296 55.5777 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ALKAWSVAR missed K-A@3 -0.00448634987697005 1000.57727050781 501.2959 1000.58178710938 501.298187255859 2 7 1.1.1.3573.8 1 29.2679 1673.596 29.3221 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1 missed K-F@6 -0.00660932017490268 1194.57482910156 598.2947 1194.58154296875 598.298034667969 2 9 1.1.1.3414.4 1 25.5948 852.2874 25.4765 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCAADDKEACFAVEGPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@10 missed K-E@7 0.0176451001316309 1926.80895996094 643.2769 1926.791015625 643.270935058594 3 12 1.1.1.3596.8 1 29.8306 227.5208 29.8358 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTESLVNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 -0.00477732019498944 1137.48583984375 569.7502 1137.49072265625 569.752624511719 2 15 1.1.1.3404.4 1 25.3397 1388.325 25.3492 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-M@9 0.0226881001144648 2871.32543945313 718.8386 2871.30224609375 718.832885742188 4 11 1.1.1.4476.5 1 51.8224 255.8565 51.8352 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DAFLGSFLYEYSR -0.00397014990448952 1566.7314453125 784.373 1566.73547363281 784.375 2 11 1.1.1.4689.21 1 57.2797 582.3099 57.1809 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 EYEATLEECCAK Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.00750127993524075 1501.61401367188 751.8143 1501.6064453125 751.810546875 2 10 1.1.1.3545.5 1 28.6006 119.5998 28.5816 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HLVDEPQNLIK -0.0089114997535944 1304.69982910156 653.3572 1304.70886230469 653.361694335938 2 14 1.1.1.3769.8 1 34.0404 1009.394 34.1003 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 IETMREKVLTSSAR missed R-E@5; missed K-V@7 -0.00639304984360933 1619.85986328125 540.9606 1619.86645507813 540.962768554688 3 20 1.1.1.3465.4 1 26.7771 1216.588 26.7824 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KQTALVELLK missed K-Q@1 0.000728681974578649 1141.70764160156 571.8611 1141.70703125 571.860778808594 2 11 1.1.1.4018.8 1 40.0204 521.3558 40.057 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KVPQVSTPTLVEVSR Dehydrated(T)@9 missed K-V@1 0.0126007003709674 1620.93249511719 541.3181 1620.919921875 541.313903808594 3 10 1.1.1.3896.5 1 37.1254 532.9863 37.1373 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KVPQVSTPTLVEVSRSLGK missed K-V@1; missed R-S@15 0.00168377999216318 2024.16455078125 507.0484 2024.16296386719 507.048034667969 4 10 1.1.1.4126.8 1 42.7678 950.4491 42.7066 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LCVLHEKTPVSEK Carbamidomethyl(C)@2 missed K-T@7 -0.00218336004763842 1538.81042480469 513.9441 1538.81262207031 513.94482421875 3 11 1.1.1.3492.3 1 27.4232 366.8645 27.4615 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-E@2 -0.00387468002736568 1531.77001953125 511.5973 1531.77380371094 511.598541259766 3 16 1.1.1.3401.3 1 25.2651 1256.071 25.2966 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LRCASIQKFGER Carbamidomethyl(C)@3 missed R-C@2; missed K-F@8 0.00201821001246572 1463.76879882813 488.9302 1463.76672363281 488.929504394531 3 15 1.1.1.3465.2 1 26.7655 820.1332 26.7584 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 -0.000727960024960339 1749.9658203125 584.3292 1749.96655273438 584.329467773438 3 12 1.1.1.3803.13 1 34.8938 1002.442 34.9525 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LVNELTEFAK -0.00342299998737872 1162.6201171875 582.3173 1162.62341308594 582.318969726563 2 10 1.1.1.4103.7 1 42.1764 1206.013 42.2446 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 missed K-L@8 0.007825399748981 2511.193359375 838.0717 2511.18530273438 838.069030761719 3 21 1.1.1.4592.16 1 54.7775 970.8818 54.8125 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QTALVELLK -0.00582718010991812 1013.60626220703 507.8104 1013.61212158203 507.813323974609 2 11 1.1.1.4273.4 1 46.5356 3840.762 46.5023 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QTALVELLKHKPK missed K-H@9 0.00141867995262146 1503.9150390625 502.3123 1503.91369628906 502.311828613281 3 8 1.1.1.3800.10 1 34.8208 398.3576 34.803 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPEYAVSVLLR missed R-H@1 -0.00149056001100689 1438.80310058594 480.6083 1438.80444335938 480.608764648438 3 17 1.1.1.3911.4 1 37.4873 1630.724 37.4993 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 -0.00324619002640247 1879.91088867188 627.6442 1879.91381835938 627.645202636719 3 19 1.1.1.4015.6 1 39.9496 3851.347 39.8841 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SLGKVGTR missed K-V@4 -0.00337801990099251 816.478454589844 409.2465 816.481750488281 409.248138427734 2 9 1.1.1.1481.2 1 10.8018 108.3757 10.807 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 -0.00138849997892976 1418.68505859375 710.3498 1418.68640136719 710.350463867188 2 13 1.1.1.4097.17 1 42.0286 690.2094 42.0115 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -0.0108682997524738 1462.57092285156 488.5309 1462.58166503906 488.534515380859 3 14 1.1.1.1445.2 1 10.5042 291.9413 10.5386 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TPVSEKVTK missed K-V@6 0.000743981974665076 987.560852050781 494.7877 987.56005859375 494.787292480469 2 10 1.1.1.1491.2 1 10.9148 138.6215 10.9255 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.00125941005535424 1414.68151855469 708.348 1414.68029785156 708.347412109375 2 9 1.1.1.4265.6 1 46.3378 145.0204 46.452 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VPQVSTPTLVEVSR -0.00155467004515231 1510.83410644531 756.4243 1510.83544921875 756.425048828125 2 10 1.1.1.4028.17 1 40.2742 929.3394 40.3536 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -0.00516223022714257 1442.62963867188 722.3221 1442.634765625 722.324645996094 2 19 1.1.1.3425.3 1 25.8646 2897.122 25.9531 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 YTRKVPQVSTPTLVEVSR missed R-K@3; missed K-V@4 0.00250993994995952 2059.14501953125 687.389 2059.142578125 687.388122558594 3 11 1.1.1.3802.6 1 34.8688 213.8644 34.9274 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.58502626419067 97.6199984550476 LSQKFPK missed K-F@4 -0.00416566990315914 846.492248535156 424.2534 846.496337890625 424.255432128906 2 10 1.1.1.2956.2 1 20.9682 518.5435 20.987 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.44369733333588 99.0000009536743 MPCTEDYLSLILNR Oxidation(M)@1; Carbamidomethyl(C)@3 -0.00491716014221311 1739.8173828125 580.9464 1739.822265625 580.947998046875 3 6 1.1.1.4617.12 1 55.4097 505.7216 55.5005 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.24412514269352 45.3299999237061 LGEYGFQNALIVR -0.00184637005440891 1478.7861328125 493.936 1478.78820800781 493.936676025391 3 7 1.1.1.4341.8 1 48.3277 437.5836 48.3176 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.189095705747604 37.4900013208389 YICDNQDTISSKLKECCDKPLLEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16; Carbamidomethyl(C)@17 missed K-L@12; missed K-E@14 -0.00045041399425827 2956.39770507813 592.2868 2956.39794921875 592.286865234375 5 11 1.1.1.3853.5 1 36.1594 813.9642 36.1714 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.15058059990406 31.2799990177155 YLYEIAR -0.00405415985733271 926.482055664063 464.2483 926.486145019531 464.250366210938 2 7 1.1.1.3801.7 1 34.8406 2118.884 34.803 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.134303942322731 28.4599989652634 LVVSTQTALA -0.00282769999466836 1001.57287597656 501.7937 1001.57568359375 501.795135498047 2 10 1.1.1.3941.3 1 38.1701 21695.12 38.2801 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.000434511806815863 26.3399988412857 VDEPQNLIKQNCDQFEKLGEYGFQNALIVR acrolein addition +76(K)@9; Carbamidomethyl(C)@12; MDA adduct +54(K)@17 cleaved L-V@N-term; missed K-Q@9; missed K-L@17 0.0793714001774788 3694.88818359375 739.9849 3694.80908203125 739.969055175781 5 9 1.1.1.4342.16 1 48.3605 5212.981 48.0804 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 29.0699988603592 AEFVEVTK -0.00548260007053614 921.475280761719 461.7449 921.480773925781 461.747650146484 2 6 1.1.1.3581.5 1 29.4513 2319.285 29.3712 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 68.8700020313263 ALKAWSVAR Oxidation(W)@5 missed K-A@3 -0.000335744000039995 1016.57647705078 509.2955 1016.57672119141 509.295623779297 2 4 1.1.1.3508.10 1 27.8289 91.9817 27.8433 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 63.7199997901917 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 -0.00900601968169212 1032.56262207031 517.2886 1032.57165527344 517.293090820313 2 6 1.1.1.3506.10 1 27.7796 1841.695 27.8186 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 17.5999999046326 ALKAWSVAR missed K-A@3 -0.00448634987697005 1000.57727050781 501.2959 1000.58178710938 501.298187255859 2 5 1.1.1.3580.6 1 29.4315 1673.596 29.3221 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1 missed K-F@6 -0.00660932017490268 1194.57482910156 598.2947 1194.58154296875 598.298034667969 2 12 1.1.1.3407.4 1 25.4179 852.2874 25.4765 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 95.1200008392334 CASIQKFGER Carbamidomethyl(C)@1; Acetyl(K)@6 missed K-F@6 -0.00328214000910521 1236.5888671875 619.3017 1236.59216308594 619.303344726563 2 8 1.1.1.3677.7 1 31.7687 75.4674 31.7494 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR -0.00397014990448952 1566.7314453125 784.373 1566.73547363281 784.375 2 12 1.1.1.4682.9 1 57.09 582.3099 57.1809 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 43.1800007820129 IETMREKVLTSSAR Oxidation(M)@4 missed R-E@5; missed K-V@7 -0.00689909001812339 1635.8544921875 546.2921 1635.86145019531 546.29443359375 3 9 1.1.1.3301.2 1 23.6948 698.4136 23.5952 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 25.8799999952316 IETMREKVLTSSAR Oxidation(M)@4 missed R-E@5; missed K-V@7 -0.000821107008960098 1635.86059570313 409.9724 1635.86145019531 409.972625732422 4 11 1.1.1.3286.2 1 23.5272 1193.68 23.5952 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Hex(K)@1 missed K-V@1 -0.00204182998277247 1800.9814453125 601.3344 1800.98327636719 601.335021972656 3 16 1.1.1.3888.3 1 36.9308 3437.395 36.9926 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.0028403599280864 1638.93347167969 547.3184 1638.93041992188 547.317443847656 3 20 1.1.1.3889.3 1 36.9573 62159.62 37.1132 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@8 missed K-V@1 0.00627605011686683 1652.91613769531 551.9793 1652.90979003906 551.977172851563 3 14 1.1.1.3893.2 1 37.0479 604.1025 37.089 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Carbamidomethyl@N-term missed K-V@1 0.00929400976747274 1695.96130371094 566.3277 1695.95190429688 566.324584960938 3 20 1.1.1.3895.3 1 37.1079 1114.313 37.1373 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.0028403599280864 1638.93347167969 547.3184 1638.93041992188 547.317443847656 3 21 1.1.1.3896.6 1 37.1287 62159.62 37.1132 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.023275600746274 1638.95373535156 410.7457 1638.93041992188 410.739898681641 4 15 1.1.1.3898.2 1 37.1685 1308.092 37.089 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.0028403599280864 1638.93347167969 547.3184 1638.93041992188 547.317443847656 3 22 1.1.1.3903.5 1 37.2909 62159.62 37.1132 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00247415993362665 1638.93273925781 547.3182 1638.93041992188 547.317443847656 3 20 1.1.1.3910.4 1 37.4632 32238.78 37.2096 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR reduced acrolein addition +58(K)@1; Deamidated(Q)@4; Dehydrated(S)@6 missed K-V@1 0.00621119001880288 1679.95202636719 560.9913 1679.94580078125 560.989196777344 3 15 1.1.1.3911.5 1 37.4907 2318.295 37.4752 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00247415993362665 1638.93273925781 547.3182 1638.93041992188 547.317443847656 3 18 1.1.1.3917.4 1 37.6318 3783.708 37.3786 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.0141925001516938 1638.94445800781 547.3221 1638.93041992188 547.317443847656 3 18 1.1.1.3928.4 1 37.9031 1475.269 37.6437 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00247415993362665 1638.93273925781 547.3182 1638.93041992188 547.317443847656 3 13 1.1.1.3939.3 1 38.1203 753.8773 37.9617 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 66.32000207901 KVPQVSTPTLVEVSR Formyl@N-term missed K-V@1 -0.00251981010660529 1666.9228515625 834.4687 1666.92541503906 834.469970703125 2 6 1.1.1.4078.13 1 41.5358 172.2927 41.5411 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 15.8000007271767 KVPQVSTPTLVEVSR Acetyl@N-term missed K-V@1 -0.00122047995682806 1680.94006347656 561.3206 1680.94104003906 561.320983886719 3 6 1.1.1.4085.5 1 41.7118 267.6749 41.8033 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSRSLGK missed K-V@1; missed R-S@15 -0.00447033997625113 2024.15856933594 675.7268 2024.16296386719 675.728271484375 3 9 1.1.1.4121.13 1 42.6455 434.8155 42.6812 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.2100009918213 KVPQVSTPTLVEVSRSLGK missed K-V@1; missed R-S@15 0.00168377999216318 2024.16455078125 507.0484 2024.16296386719 507.048034667969 4 8 1.1.1.4119.5 1 42.586 950.4491 42.7066 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 43.1800007820129 LSQKFPK missed K-F@4 -0.00398257002234459 846.492248535156 424.2534 846.496337890625 424.255432128906 2 8 1.1.1.2932.2 1 20.793 156.9116 20.8053 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 18.4499993920326 LSQKFPK missed K-F@4 -0.0067290598526597 846.489685058594 424.2521 846.496337890625 424.255432128906 2 8 1.1.1.2979.2 1 21.1382 499.4148 21.0788 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 -0.000727960024960339 1749.9658203125 584.3292 1749.96655273438 584.329467773438 3 12 1.1.1.3810.12 1 35.0715 1002.442 34.9525 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 30.9700012207031 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 0.000810244004242122 1749.96740722656 438.4991 1749.96655273438 438.498901367188 4 8 1.1.1.3810.4 1 35.059 1853.575 34.9776 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 84.960001707077 LVNELTEFAK -0.00342299998737872 1162.6201171875 582.3173 1162.62341308594 582.318969726563 2 6 1.1.1.4110.7 1 42.3572 1206.013 42.2446 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 0.00804974976927042 2528.22021484375 843.7473 2528.2119140625 843.744567871094 3 14 1.1.1.4446.10 1 51.0481 3610.694 51.1315 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 0.00804974976927042 2528.22021484375 843.7473 2528.2119140625 843.744567871094 3 14 1.1.1.4453.11 1 51.223 3610.694 51.1315 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QTALVELLK Gln->pyro-Glu@N-term 0.00332440994679928 996.5888671875 499.3017 996.585571289063 499.300048828125 2 7 1.1.1.4687.7 1 57.2165 487.1414 57.2592 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 29.4299989938736 QTALVELLK -0.00582718010991812 1013.60626220703 507.8104 1013.61212158203 507.813323974609 2 6 1.1.1.4266.7 1 46.3591 3840.762 46.5023 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 68.8700020313263 RPCFSALTPDETYVPK Carbamidomethyl(C)@3; Ser->Oxoalanine(S)@5 0.00271618994884193 1877.90075683594 626.9742 1877.89819335938 626.973327636719 3 11 1.1.1.3947.3 1 38.3172 488.0665 38.2801 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.979998588562 SLGKVGTR Acetyl(K)@4 missed K-V@4 -0.00554091017693281 858.486877441406 430.2507 858.492309570313 430.253448486328 2 10 1.1.1.3363.2 1 24.5084 117.8558 24.5137 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 -0.00105945998802781 1418.68542480469 473.9024 1418.68640136719 473.902740478516 3 14 1.1.1.4093.7 1 41.9241 3691.765 42.0115 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 -0.00105945998802781 1418.68542480469 473.9024 1418.68640136719 473.902740478516 3 12 1.1.1.4100.4 1 42.0982 3691.765 42.0115 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK -0.00965881999582052 1398.67565917969 700.3451 1398.68530273438 700.349975585938 2 9 1.1.1.4558.3 1 53.9016 232.8821 53.8956 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VPQVSTPTLVEVSR -0.00155467004515231 1510.83410644531 756.4243 1510.83544921875 756.425048828125 2 10 1.1.1.4035.10 1 40.4471 929.3394 40.3536 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 73.8600015640259 VPQVSTPTLVEVSR -0.980018973350525 1509.85534667969 504.2924 1510.83544921875 504.619110107422 3 8 1.1.1.4029.6 1 40.2906 740.9259 40.3536 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -0.00516223022714257 1442.62963867188 722.3221 1442.634765625 722.324645996094 2 13 1.1.1.3433.4 1 26.0387 2897.122 25.9531 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 21.9099998474121 YLYEIAR -0.00405415985733271 926.482055664063 464.2483 926.486145019531 464.250366210938 2 6 1.1.1.3794.6 1 34.6704 2118.884 34.803 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YTRKVPQVSTPTLVEVSR missed R-K@3; missed K-V@4 0.00508794980123639 2059.14770507813 515.7942 2059.142578125 515.792907714844 4 10 1.1.1.3809.4 1 35.0413 570.2805 34.9274 2 67.81 67.81 81.3799977302551 52.3899972438812 52.3899972438812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YTRKVPQVSTPTLVEVSR missed R-K@3; missed K-V@4 0.00508794980123639 2059.14770507813 515.7942 2059.142578125 515.792907714844 4 10 1.1.1.3801.8 1 34.8423 570.2805 34.9274 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 DIENQYETQITQIEHEVSSSGQEVQSSAK 0.00853633042424917 3263.51611328125 1088.846 3263.50659179688 1088.8427734375 3 20 1.1.1.4505.4 1 52.5693 821.7654 52.6032 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 EIETYHNLLEGGQEDFESSGAGK 0.00198809010908008 2509.12670898438 837.3828 2509.12451171875 837.382080078125 3 15 1.1.1.4104.17 1 42.2106 1217.768 42.2702 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 FSSSGGGGGGGRFSSSSGYGGGSSR missed R-F@12 0.00564651004970074 2197.94287109375 733.6549 2197.93725585938 733.653015136719 3 14 1.1.1.3407.5 1 25.422 612.4031 25.4519 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 FSSSSGYGGGSSR -0.00663626985624433 1234.51489257813 618.2647 1234.521484375 618.268005371094 2 14 1.1.1.2466.2 1 17.5067 123.2024 17.4865 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 GGGGGGGLGSGGSIR cleaved S-G@N-term -0.00779849989339709 1144.55090332031 573.2827 1144.55847167969 573.286499023438 2 12 1.1.1.3310.2 1 23.8124 165.7581 23.8428 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR 0.00123723002616316 2704.15502929688 902.3923 2704.15380859375 902.391906738281 3 10 1.1.1.4244.17 1 45.795 3758.771 45.9082 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK 0.00681657018139958 3222.28100585938 1075.101 3222.2744140625 1075.09875488281 3 20 1.1.1.3448.3 1 26.3855 1195.052 26.2981 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 GGSGGSYGGGGSGGGYGGGSGSR -0.00367988995276392 1790.71655273438 597.9128 1790.72045898438 597.9140625 3 14 1.1.1.2117.2 1 15.3015 165.9676 15.2822 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 HGVQELEIELQSQLSK -0.00225533009506762 1836.95593261719 613.3259 1836.95812988281 613.32666015625 3 14 1.1.1.4339.10 1 48.277 3014.657 48.1861 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 HGVQELEIELQSQLSKK missed K-K@16 -0.000703961006365716 1965.05236816406 656.0247 1965.05310058594 656.024963378906 3 14 1.1.1.4243.13 1 45.769 945.0031 45.8297 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 IGLGGRGGSGGSYGR missed R-G@6 -0.00485824001953006 1349.67517089844 450.899 1349.68005371094 450.900604248047 3 11 1.1.1.3399.3 1 25.2043 1213.892 25.2703 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 IKFEMEQNLR missed K-F@2 -0.00176321004983038 1306.66870117188 436.5635 1306.67041015625 436.564056396484 3 9 1.1.1.3827.5 1 35.498 1162.644 35.5409 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 QEYEQLIAK -0.00702288001775742 1120.56945800781 561.292 1120.57641601563 561.295471191406 2 9 1.1.1.3689.7 1 32.0591 465.7534 32.0452 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 QFSSSYLSR -0.00820900965481997 1073.50610351563 537.7603 1073.51416015625 537.764343261719 2 8 1.1.1.3654.6 1 31.2041 532.4473 31.2409 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 QGVDADINGLR -0.00398332020267844 1156.57971191406 579.2971 1156.58361816406 579.299072265625 2 12 1.1.1.3715.10 1 32.6912 1536.607 32.7222 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 QVLDNLTMEK -0.00186029996257275 1189.59948730469 595.807 1189.60131835938 595.807922363281 2 10 1.1.1.3838.12 1 35.7896 384.7904 35.8455 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 SGGGGGGGLGSGGSIR -0.00810097996145487 1231.58251953125 616.7985 1231.59057617188 616.802551269531 2 27 1.1.1.3323.3 1 23.9889 1943.46 23.9144 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 SRSGGGGGGGLGSGGSIR cleaved L-S@N-term; missed R-S@2 -0.00350234005600214 1474.72021484375 492.5807 1474.7236328125 492.581817626953 3 19 1.1.1.2627.2 1 18.7275 141.6191 18.7447 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 STMQELNSR -0.00138984003569931 1064.49072265625 533.2526 1064.49206542969 533.253295898438 2 13 1.1.1.3345.3 1 24.2857 1134.5 24.2022 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 TLLDIDNTR 0.00341242994181812 1059.55944824219 530.787 1059.55603027344 530.785278320313 2 10 1.1.1.3875.3 1 36.6764 1367.512 36.8186 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 TLNDMRQEYEQLIAK Oxidation(M)@5 missed R-Q@6 0.0106886997818947 1866.92517089844 623.3157 1866.91455078125 623.312133789063 3 14 1.1.1.3918.3 1 37.6567 556.8159 37.6678 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0.478861898183823 71.1399972438812 NYSPYYNTIDDLKDQIVDLTVGNNK missed K-D@13 0.0656607002019882 2901.46899414063 968.1636 2901.4033203125 968.141662597656 3 10 1.1.1.4785.17 1 59.7109 584.1422 59.7421 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0.229884713888168 46.0200011730194 FSSSGGGGGGGR -0.00559801002964377 981.4208984375 491.7177 981.426391601563 491.720489501953 2 9 1.1.1.980.2 1 7.2733 136.9497 7.2903 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0.158640518784523 99.0000009536743 SGGSGGNYGGGSGSGG cleaved H-S@N-term; cleaved G-G@C-term -6.92155981063843 1206.53796386719 403.1866 1213.45959472656 405.493804931641 3 6 1.1.1.4835.2 1 60.9621 95.2216 60.9579 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0.108462542295456 25.8100003004074 LASYLDK -0.00583091983571649 808.42724609375 405.2209 808.433044433594 405.223815917969 2 5 1.1.1.3501.3 0 27.646 401.4988 27.5358 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0.101274818181992 24.3399992585182 LASYLDKVQALEEANNDLENK missed K-V@7 0.000895393022801727 2376.18188476563 793.0679 2376.18090820313 793.067565917969 3 8 1.1.1.4262.9 1 46.2656 180.9976 46.2742 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0.000434511806815863 75.1200020313263 LLDIDNTR Carbamidomethyl@N-term cleaved T-L@N-term 0.00539326993748546 1015.53527832031 508.7749 1015.52984619141 508.772186279297 2 9 1.1.1.3951.2 1 38.407 805.5187 38.4006 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 EIETYHNLLEGGQEDFESSGAGK 0.00198809010908008 2509.12670898438 837.3828 2509.12451171875 837.382080078125 3 14 1.1.1.4111.19 1 42.3947 1217.768 42.2702 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 FSSSSGYGGGSSR -0.00273017003200948 1234.51892089844 618.2667 1234.521484375 618.268005371094 2 17 1.1.1.2491.2 1 17.677 176.8392 17.6566 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR 0.00123723002616316 2704.15502929688 902.3923 2704.15380859375 902.391906738281 3 29 1.1.1.4251.15 1 45.9797 3758.771 45.9082 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR 0.00123723002616316 2704.15502929688 902.3923 2704.15380859375 902.391906738281 3 12 1.1.1.4258.9 1 46.1654 3996.334 45.882 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK 0.00975068006664515 3222.2841796875 806.5783 3222.2744140625 806.575866699219 4 30 1.1.1.3443.4 1 26.2871 1316.25 26.2981 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 HGVQELEIELQSQLSK -0.00225533009506762 1836.95593261719 613.3259 1836.95812988281 613.32666015625 3 11 1.1.1.4332.8 1 48.0907 3014.657 48.1861 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 35.3700011968613 HGVQELEIELQSQLSK 0.0123923998326063 1836.97058105469 613.3308 1836.95812988281 613.32666015625 3 7 1.1.1.4346.6 1 48.4556 228.1685 48.448 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 23.7900003790855 HGVQELEIELQSQLSKK missed K-K@16 -0.000703961006365716 1965.05236816406 656.0247 1965.05310058594 656.024963378906 3 7 1.1.1.4250.13 1 45.9485 945.0031 45.8297 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 23.4300002455711 IKFEMEQNLR Oxidation(M)@5 missed K-F@2 -0.000658111996017396 1322.66467285156 441.8955 1322.66528320313 441.895690917969 3 7 1.1.1.3551.3 1 28.7148 423.5046 28.6844 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 23.7900003790855 LASYLDK -0.00583091983571649 808.42724609375 405.2209 808.433044433594 405.223815917969 2 5 1.1.1.3494.2 0 27.4676 401.4988 27.5358 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 68.8700020313263 LKDQIVDLTVGNNK Carbamidomethyl@N-term; HPNE addition +172(K)@2; reduced acrolein addition +96(K)@14 cleaved D-L@N-term; missed K-D@2 -0.00998361967504025 1881.03588867188 628.0192 1881.0458984375 628.022583007813 3 12 1.1.1.3954.4 1 38.4921 49950.54 38.4489 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 23.6699998378754 QFSSSYLSR Gln->pyro-Glu@N-term 0.0281135998666286 1056.515625 529.2651 1056.48767089844 529.251098632813 2 5 1.1.1.4044.5 1 40.6616 117.0822 40.7271 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 QVLDNLTMEK Oxidation(M)@8 -0.0038544898852706 1205.59252929688 603.8035 1205.59619140625 603.805358886719 2 10 1.1.1.3680.9 1 31.8422 475.4927 31.8966 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 SGGGGGGGLGSGGSIR -0.00797890964895487 1231.58251953125 616.7985 1231.59057617188 616.802551269531 2 18 1.1.1.3310.3 1 23.8208 1833.133 23.9088 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 STMQELNSR -0.00138984003569931 1064.49072265625 533.2526 1064.49206542969 533.253295898438 2 12 1.1.1.3332.3 1 24.1182 1134.423 24.2022 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 33.6400002241135 STMQELNSR Oxidation(M)@3 -0.00616530980914831 1080.48083496094 541.2477 1080.48693847656 541.250732421875 2 8 1.1.1.1480.2 1 10.7768 108.4878 10.813 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 30.9700012207031 STMQELNSR Oxidation(M)@3 -0.00030614499701187 1080.48669433594 541.2506 1080.48693847656 541.250732421875 2 9 1.1.1.3334.3 1 24.1669 217.4953 24.1966 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 30.7599991559982 STMQELNSR -0.00456355977803469 1064.48742675781 533.251 1064.49206542969 533.253295898438 2 8 1.1.1.3362.3 1 24.483 190.8413 24.345 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 TLLDIDNTR 0.00536548020318151 1059.5615234375 530.788 1059.55603027344 530.785278320313 2 12 1.1.1.3884.3 1 36.8531 1393.964 36.8186 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 67.4600005149841 TLNDMRQEYEQLIAK missed R-Q@6 0.00060620199656114 1850.92028808594 617.9807 1850.91967773438 617.98046875 3 7 1.1.1.4256.5 1 46.0996 5881.483 45.8297 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 23.7900003790855 TLNDMRQEYEQLIAK missed R-Q@6 0.00060620199656114 1850.92028808594 617.9807 1850.91967773438 617.98046875 3 9 1.1.1.4242.10 1 45.7378 5591.339 45.8557 3 43.13 43.13 78.6499977111816 55.6999981403351 49.5999991893768 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 50.3400027751923 YGGGSGSGGGSGGGYGGGSGSR Carbamidomethyl(S)@11 cleaved N-Y@N-term -0.00367987994104624 1790.71655273438 597.9128 1790.72045898438 597.9140625 3 14 1.1.1.2117.2 1 15.3015 165.9676 15.2822 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 EHNIDVLEGNEQFINAAK Glu->pyro-Glu@N-term; Oxidation(H)@2; Deamidated(N)@3 cleaved G-E@N-term 0.0115630002692342 2038.97106933594 680.6643 2038.95959472656 680.660461425781 3 13 1.1.1.4295.8 1 47.1201 213.8442 47.1036 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 GEHNIDVLEGNEQFINAAK cleaved L-G@N-term 0.00569762988016009 2097.0185546875 700.0134 2097.0126953125 700.011535644531 3 9 1.1.1.4097.16 1 42.0278 271.9135 42.0631 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 GNTLDNDIMLIK cleaved N-G@N-term -0.0046747699379921 1345.6865234375 673.8505 1345.69116210938 673.852844238281 2 15 1.1.1.4275.3 1 46.5846 1407.864 46.5525 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR cleaved N-G@N-term; missed K-L@12 0.000925962987821549 2372.23779296875 791.7532 2372.23706054688 791.7529296875 3 19 1.1.1.4504.2 1 52.5374 2173.431 52.4814 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IDVLEGNEQFINAAK cleaved N-I@N-term -0.00603146990761161 1659.8408203125 830.9277 1659.84680175781 830.9306640625 2 13 1.1.1.4192.13 1 44.4797 2119.184 44.5889 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@14; Oxidation(M)@17 0.00123787997290492 2299.1533203125 767.3917 2299.15185546875 767.391235351563 3 13 1.1.1.4251.13 1 45.9764 630.6193 45.9865 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 -0.00337494001723826 3308.71411132813 1103.912 3308.71875 1103.91357421875 3 21 1.1.1.4557.10 1 53.8903 5130.77 53.7728 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 0.00737268989905715 2706.41625976563 677.6113 2706.40893554688 677.609497070313 4 18 1.1.1.4294.9 1 47.0917 16057.2 47.2365 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGN cleaved N-E@C-term -0.00518424995243549 1308.62585449219 655.3202 1308.63098144531 655.32275390625 2 13 1.1.1.3892.5 1 37.0288 3909.586 36.8668 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00331634003669024 1565.73547363281 783.875 1565.73217773438 783.873352050781 2 15 1.1.1.3861.7 1 36.358 1408.676 36.4644 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQF cleaved F-I@C-term 0.00277349003590643 1712.80322265625 857.4089 1712.80053710938 857.407592773438 2 14 1.1.1.4197.7 1 44.6048 818.4783 44.6676 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.000394406990380958 1939.92810058594 970.9713 1939.92761230469 970.971069335938 2 14 1.1.1.4255.15 1 46.0867 1578.403 46.013 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAK Dehydrated(E)@3; Oxidation(H)@4 -0.00405754987150431 2208.0771484375 737.033 2208.0810546875 737.034301757813 3 13 1.1.1.4134.12 1 42.9843 258.6374 43.021 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LSSPATLNSR -0.00760906981304288 1044.548828125 523.2817 1044.55639648438 523.285461425781 2 11 1.1.1.3491.6 1 27.4038 2192.959 27.1448 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 TLDNDIMLIK cleaved N-T@N-term -0.000411435001296923 1174.62622070313 588.3204 1174.62670898438 588.320678710938 2 12 1.1.1.4221.3 0 45.2097 1425.284 45.2529 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 VATVSLPR -0.00499470019713044 841.497253417969 421.7559 841.502136230469 421.758361816406 2 6 1.1.1.3782.5 1 34.3653 688.6091 34.1003 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 VLEGNEQFINAAK cleaved D-V@N-term -0.0035810200497508 1431.73229980469 716.8734 1431.73583984375 716.875183105469 2 9 1.1.1.3810.13 0 35.0732 399.4935 34.9776 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.56863605976105 99.0000009536743 IITHPNFNGNTLDND cleaved D-I@C-term 0.00382725009694695 1683.7890625 842.9018 1683.78527832031 842.89990234375 2 8 1.1.1.3829.10 1 35.5617 132.1411 35.5409 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.0604807138443 93.5500025749207 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.225821003317833 6053.369140625 865.7743 6053.14306640625 865.742004394531 7 15 1.1.1.4929.19 1 63.4167 527.4554 63.4236 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.92445296049118 99.0000009536743 EQFINAAK cleaved N-E@N-term -0.00557528017088771 919.470703125 460.7426 919.476318359375 460.745452880859 2 7 1.1.1.3481.3 0 27.1506 942.158 27.0717 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.686132848262787 99.0000009536743 SSGSSYPSLLQCLK Carbamidomethyl(S)@8; Carbamidomethyl(C)@12; MDA adduct +62(K)@14 -0.0343474000692368 1644.74743652344 823.381 1644.78173828125 823.398132324219 2 10 1.1.1.4779.19 1 59.5593 729.7679 59.5646 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.422508180141449 99.0000009536743 SPATLNSR cleaved S-S@N-term -0.005413259845227 844.434875488281 423.2247 844.440307617188 423.227416992188 2 9 1.1.1.1609.2 1 11.7103 132.2831 11.7344 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.353596270084381 96.8299984931946 IITHPNFN cleaved N-G@C-term -0.00194979994557798 954.490478515625 478.2525 954.492309570313 478.253448486328 2 8 1.1.1.3611.5 1 30.1856 564.8353 30.1983 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.251037150621414 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.000223213006393053 2229.2041015625 744.0753 2229.20385742188 744.075256347656 3 23 1.1.1.4471.16 1 51.6942 12407.38 51.7036 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.143875554203987 99.0000009536743 KVCNYVNWIQQTIAAN Carbamidomethyl(C)@3 cleaved T-K@N-term; missed K-V@1 -9.07835006713867 1911.87329101563 956.9439 1920.95166015625 961.483093261719 2 10 1.1.1.5004.19 1 65.4027 325.2271 65.4345 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0486624799668789 81.5999984741211 ITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@3 cleaved I-I@N-term; missed K-L@19 0.014665300026536 3353.77954101563 671.7632 3353.76538085938 671.760314941406 5 9 1.1.1.4578.12 1 54.4104 217.1256 54.3206 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0150228748098016 32.7499985694885 IITHPNFNGN cleaved N-T@C-term -0.00126986997202039 1125.55541992188 563.785 1125.55676269531 563.78564453125 2 5 1.1.1.3581.13 1 29.463 224.7835 29.4949 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0101054366677999 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Formyl(K)@40 missed K-I@20; missed K-L@40 0.227280005812645 5557.02197265625 927.1776 5556.794921875 927.139709472656 6 20 1.1.1.4915.21 1 63.0518 2100.606 62.9523 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00348832807503641 29.6999990940094 LGEHNIDVLEGNEQFINAA cleaved A-K@C-term -0.00954398978501558 2081.9921875 695.0047 2082.00170898438 695.007873535156 3 7 1.1.1.4317.8 1 47.6996 282.0573 47.6852 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00174066168256104 22.2000002861023 LGEHNIDVLEG cleaved G-N@C-term -0.000683747988659889 1194.58752441406 598.301 1194.58801269531 598.301330566406 2 9 1.1.1.3925.3 1 37.831 1174.351 37.8843 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000869458774104714 98.7100005149841 IMLIKLSSPATLNSR Delta:H(4)C(2)(K)@5 cleaved D-I@N-term; missed K-L@5 0.00228674989193678 1670.97766113281 557.9998 1670.97534179688 557.9990234375 3 8 1.1.1.4217.6 1 45.1124 335.4074 45.1301 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.1200008392334 EHNIDVLEGNEQFINAAK Glu->pyro-Glu@N-term cleaved G-E@N-term -0.00193270004820079 2021.97875976563 675.0002 2021.98071289063 675.000854492188 3 10 1.1.1.4238.7 1 45.6336 175.503 45.6236 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 EQFINAAK cleaved N-E@N-term -0.00557528017088771 919.470703125 460.7426 919.476318359375 460.745452880859 2 6 1.1.1.3474.5 0 26.9837 942.158 27.0717 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 44.6900010108948 FNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Dethiomethyl(M)@11; acrolein addition +76(K)@14 cleaved N-F@N-term; missed K-L@14 0.0036584900226444 2662.36401367188 888.4619 2662.3603515625 888.460693359375 3 10 1.1.1.4649.13 1 56.2367 1399.759 56.2232 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.4399987459183 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.00828955043107271 2661.3876953125 666.3542 2661.37963867188 666.352172851563 4 10 1.1.1.4600.11 1 54.9799 279.6383 54.9165 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIK cleaved N-G@N-term -0.00125693995505571 1345.68981933594 673.8522 1345.69116210938 673.852844238281 2 10 1.1.1.4286.6 1 46.8779 1197.098 46.6031 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00466868001967669 2400.26391601563 801.0952 2400.26831054688 801.0966796875 3 15 1.1.1.4539.11 1 53.4241 1366.708 53.3106 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 3.16865007334854E-05 2401.25219726563 801.4247 2401.25219726563 801.424682617188 3 20 1.1.1.4553.2 1 53.7788 1383.184 53.6963 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Methyl(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00205375999212265 2386.25048828125 796.4241 2386.25268554688 796.4248046875 3 19 1.1.1.4508.4 1 52.6426 943.3553 52.701 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00082418997772038 2400.26904296875 801.097 2400.26831054688 801.0966796875 3 19 1.1.1.4511.7 1 52.7203 13409.58 52.8742 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00082418997772038 2400.26904296875 801.097 2400.26831054688 801.0966796875 3 19 1.1.1.4518.16 1 52.89 13409.58 52.8742 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00082418997772038 2400.26904296875 801.097 2400.26831054688 801.0966796875 3 17 1.1.1.4525.15 1 53.0687 13409.58 52.8742 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.000457999005448073 2400.26904296875 801.0969 2400.26831054688 801.0966796875 3 16 1.1.1.4532.6 1 53.2448 7280.101 52.9755 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 GNTLDNDIMLIKLSSPATLNSR cleaved N-G@N-term; missed K-L@12 0.000925962987821549 2372.23779296875 791.7532 2372.23706054688 791.7529296875 3 13 1.1.1.4496.4 1 52.348 2173.431 52.4814 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.2100007534027 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.000151408996316604 2401.251953125 801.4246 2401.25219726563 801.424682617188 3 12 1.1.1.4460.16 1 51.4044 1461.328 51.4665 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.229998588562 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Dethiomethyl(M)@9; acrolein addition +76(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00172416004352272 2401.2470703125 801.423 2401.2490234375 801.423583984375 3 10 1.1.1.4560.7 1 53.9574 1385.718 53.6963 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.4399987459183 GNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@9; MDA adduct +62(K)@12 cleaved N-G@N-term; missed K-L@12 0.00131706998217851 2386.25048828125 796.4241 2386.24926757813 796.423706054688 3 9 1.1.1.4515.7 1 52.8125 943.3553 52.701 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IDVLEGNEQFINAAK Deamidated(N)@12 cleaved N-I@N-term -0.00827725045382977 1660.82250976563 831.4185 1660.83081054688 831.422668457031 2 10 1.1.1.4154.13 1 43.5121 139.6747 43.5224 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IDVLEGNEQFINAAK cleaved N-I@N-term 0.00260937004350126 1659.84936523438 554.2904 1659.84680175781 554.28955078125 3 10 1.1.1.4196.15 1 44.5786 881.2385 44.5889 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IDVLEGNEQFINAAK cleaved N-I@N-term -0.00603146990761161 1659.8408203125 830.9277 1659.84680175781 830.9306640625 2 18 1.1.1.4199.15 1 44.6606 2119.184 44.5889 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 61.0899984836578 IDVLEGNEQFINAAK cleaved N-I@N-term -0.00603146990761161 1659.8408203125 830.9277 1659.84680175781 830.9306640625 2 6 1.1.1.4206.15 1 44.8416 2215.128 44.5889 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@14; Oxidation(M)@17 0.00210574991069734 2300.13793945313 767.7199 2300.1357421875 767.71923828125 3 11 1.1.1.4282.15 1 46.7751 1540.485 46.7328 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@14; Oxidation(M)@17 0.00210574991069734 2300.13793945313 767.7199 2300.1357421875 767.71923828125 3 12 1.1.1.4283.17 1 46.8048 1540.485 46.7328 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.00200144993141294 2298.166015625 767.0626 2298.16772460938 767.063232421875 3 16 1.1.1.4319.18 1 47.7562 13463.98 47.8963 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.00200144993141294 2298.166015625 767.0626 2298.16772460938 767.063232421875 3 23 1.1.1.4326.13 1 47.937 13463.98 47.8963 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK -0.00488972989842296 2282.16796875 761.7299 2282.1728515625 761.731567382813 3 11 1.1.1.4331.15 1 48.0702 742.1852 48.0542 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.00200144993141294 2298.166015625 767.0626 2298.16772460938 767.063232421875 3 17 1.1.1.4333.10 1 48.1214 13463.98 47.8963 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.0133533999323845 2298.15454101563 767.0588 2298.16772460938 767.063232421875 3 19 1.1.1.4340.11 1 48.309 4362.641 48.0279 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@14 -0.00275186006911099 2283.154296875 762.0587 2283.15698242188 762.0595703125 3 17 1.1.1.4342.17 1 48.3614 3627.19 48.4221 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.000786241027526557 2282.17358398438 761.7318 2282.1728515625 761.731567382813 3 25 1.1.1.4399.13 1 49.8481 102744.8 49.9111 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.00456477981060743 2298.16333007813 767.0617 2298.16772460938 767.063232421875 3 18 1.1.1.4406.5 1 50.0062 1027.911 49.9111 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.000786241027526557 2282.17358398438 761.7318 2282.1728515625 761.731567382813 3 24 1.1.1.4407.8 1 50.0242 102744.8 49.9111 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.00591291999444366 2282.1787109375 761.7335 2282.1728515625 761.731567382813 3 24 1.1.1.4414.13 1 50.203 73969.23 49.9412 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.00746071012690663 2282.1806640625 571.5524 2282.1728515625 571.550476074219 4 16 1.1.1.4415.9 1 50.2252 11105.89 49.9655 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.0015186199452728 2282.17456054688 761.7321 2282.1728515625 761.731567382813 3 24 1.1.1.4421.14 1 50.3864 33727.98 50.114 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.0057298201136291 2282.1787109375 761.7335 2282.1728515625 761.731567382813 3 22 1.1.1.4428.11 1 50.5725 13286.33 50.2925 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.00923762004822493 2283.16625976563 571.7988 2283.15698242188 571.796508789063 4 12 1.1.1.4434.8 1 50.7235 2096.312 50.7659 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10 0.005670549813658 2283.16284179688 762.0615 2283.15698242188 762.0595703125 3 19 1.1.1.4440.10 1 50.8898 13677.56 50.7659 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 -0.00363330007530749 2283.1533203125 1142.584 2283.15698242188 1142.58569335938 2 13 1.1.1.4444.18 1 50.9985 2000.52 51.0318 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.0096986498683691 2283.16650390625 762.0628 2283.15698242188 762.0595703125 3 27 1.1.1.4451.15 1 51.1715 39499.64 51.0567 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.00951554998755455 2283.16625976563 762.0627 2283.15698242188 762.0595703125 3 26 1.1.1.4458.12 1 51.3501 37362.28 51.0815 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.0034733999054879 2283.16040039063 762.0607 2283.15698242188 762.0595703125 3 16 1.1.1.4468.13 1 51.616 7985.956 51.3363 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 -0.00787854008376598 2283.14892578125 762.0569 2283.15698242188 762.0595703125 3 17 1.1.1.4475.17 1 51.8002 2808.528 51.7036 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10 -0.00348424003459513 2283.1533203125 762.0584 2283.15698242188 762.0595703125 3 13 1.1.1.4482.15 1 51.9833 2707.468 51.73 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10 0.00383958988822997 2283.16088867188 762.0609 2283.15698242188 762.0595703125 3 15 1.1.1.4496.3 1 52.3447 873.7952 52.36 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10 -0.000371612986782566 2283.15625 762.0594 2283.15698242188 762.0595703125 3 12 1.1.1.4503.8 1 52.5222 661.4014 52.5057 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.00823388993740082 2283.1650390625 762.0623 2283.15698242188 762.0595703125 3 12 1.1.1.4511.6 1 52.7169 561.6948 52.701 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 -0.00132846995256841 2299.15063476563 767.3908 2299.15185546875 767.391235351563 3 22 1.1.1.4374.15 1 49.188 7905.623 49.0685 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@14 0.00249861995689571 2284.1435546875 762.3884 2284.14086914063 762.387573242188 3 21 1.1.1.4378.10 1 49.2928 6869.262 49.2242 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@10 0.0250193998217583 2284.16577148438 762.3959 2284.14086914063 762.387573242188 3 27 1.1.1.4445.10 1 51.0174 29196.16 51.0567 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@14; Oxidation(M)@17 0.00210574991069734 2300.13793945313 767.7199 2300.1357421875 767.71923828125 3 10 1.1.1.4284.13 1 46.8279 1540.485 46.7328 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 -0.00590586988255382 2299.14599609375 767.3893 2299.15185546875 767.391235351563 3 15 1.1.1.4352.19 1 48.6182 2218.583 48.5997 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@14 0.00963934976607561 2284.15063476563 762.3908 2284.14086914063 762.387573242188 3 17 1.1.1.4465.14 1 51.5345 8228.825 51.2591 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.988771021366119 2283.16186523438 762.0612 2282.1728515625 761.731567382813 3 15 1.1.1.4489.12 1 52.1679 1466.903 51.8881 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 IITHPNFNGNTLDNDIMLIK Cation:Na(D)@13 0.00149281998164952 2304.15625 769.0594 2304.15478515625 769.058898925781 3 17 1.1.1.4407.9 1 50.0259 2215.91 49.9111 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 IITHPNFNGNTLDNDIMLIK Ammonia-loss(N)@8 0.0014480099780485 2265.14770507813 756.0565 2265.14624023438 756.056091308594 3 15 1.1.1.4441.13 1 50.9148 5122.125 50.9787 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 IITHPNFNGNTLDNDIMLIK Deamidated(N)@14; Oxidation(M)@17 -0.00169466994702816 2299.15014648438 767.3907 2299.15185546875 767.391235351563 3 9 1.1.1.4355.18 1 48.6945 1733.527 48.6763 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10; Deamidated(N)@14 0.0030479000415653 2284.14404296875 762.3886 2284.14086914063 762.387573242188 3 12 1.1.1.4387.12 1 49.5291 950.6328 49.5418 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 IITHPNFNGNTLDNDIMLIK Methyl(T)@3 -0.00126884004566818 2296.18725585938 766.403 2296.1884765625 766.403442382813 3 11 1.1.1.4417.17 1 50.284 1095.189 50.2664 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.2100007534027 IITHPNFNGNTLDNDIMLIK Ammonia-loss(N)@10; Oxidation(M)@17 -0.00335168000310659 2281.13793945313 761.3866 2281.14135742188 761.3876953125 3 11 1.1.1.4357.9 1 48.7467 545.3621 48.7021 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.2100007534027 IITHPNFNGNTLDNDIMLIK Deamidated(N)@6; Oxidation(M)@17 0.00379820005036891 2299.15576171875 767.3925 2299.15185546875 767.391235351563 3 9 1.1.1.4383.14 1 49.4241 3659.095 49.1458 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.2100007534027 IITHPNFNGNTLDNDIMLIK Cation:Na(D)@15 0.00149281998164952 2304.15625 769.0594 2304.15478515625 769.058898925781 3 13 1.1.1.4399.14 1 49.8489 2210.521 49.9111 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.2100007534027 IITHPNFNGNTLDNDIMLIK Ammonia-loss(N)@10 -0.0023970000911504 2265.14379882813 756.0552 2265.14624023438 756.056091308594 3 9 1.1.1.4455.10 1 51.2704 4629.151 51.0054 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.3000016212463 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@10; Deamidated(N)@14 0.00793218985199928 2285.13305664063 762.7183 2285.125 762.715576171875 3 10 1.1.1.4394.15 1 49.7169 702.8866 49.5681 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.9100003242493 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10; Deamidated(N)@14 0.0124792996793985 2284.15380859375 572.0457 2284.14086914063 572.04248046875 4 6 1.1.1.4379.10 1 49.3149 717.1708 49.2242 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.9100003242493 IITHPNFNGNTLDNDIMLIK Cation:Na(D)@15 0.0029575799126178 2304.15771484375 769.0599 2304.15478515625 769.058898925781 3 9 1.1.1.4421.15 1 50.3872 822.7323 50.114 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.9100003242493 IITHPNFNGNTLDNDIMLIK Ammonia-loss(N)@10 0.0014480099780485 2265.14770507813 756.0565 2265.14624023438 756.056091308594 3 12 1.1.1.4448.9 1 51.0929 5122.125 50.9787 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.229998588562 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10; Oxidation(M)@17 -0.00114537996705621 2299.15087890625 767.3909 2299.15185546875 767.391235351563 3 7 1.1.1.4362.15 1 48.8753 7897.81 49.0685 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 69.5299983024597 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10; Oxidation(M)@17 0.0039813001640141 2299.15600585938 767.3926 2299.15185546875 767.391235351563 3 7 1.1.1.4381.15 1 49.372 6316.191 49.094 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 38.7600004673004 IITHPNFNGNTLDNDIMLIK reduced HNE(H)@4; HexNAc(N)@10 0.0322391018271446 2643.41528320313 882.1457 2643.38305664063 882.134948730469 3 11 1.1.1.4407.11 1 50.0292 3251.066 49.9355 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 35.3700011968613 IITHPNFNGNTLDNDIMLIK 0.00774388015270233 2282.18041992188 761.7341 2282.1728515625 761.731567382813 3 9 1.1.1.4534.4 1 53.2953 237.5734 53.2601 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.5099992752075 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10 -0.00128709001000971 2283.15551757813 762.0591 2283.15698242188 762.0595703125 3 8 1.1.1.4518.15 1 52.8892 520.8644 52.8742 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 24.7099995613098 IITHPNFNGNTLDNDIMLIK Cation:Na(D)@15 0.0044387299567461 2304.15942382813 577.0471 2304.15478515625 577.045959472656 4 11 1.1.1.4406.2 1 49.9962 3304.833 49.9355 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.4400004148483 IITHPNFNGNTLDNDIMLIK 0.0176309999078512 2282.1904296875 761.7374 2282.1728515625 761.731567382813 3 8 1.1.1.4566.9 1 54.1043 176.8683 54.093 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.2900002002716 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.0142689002677798 2298.15356445313 767.0585 2298.16772460938 767.063232421875 3 8 1.1.1.4347.10 1 48.4843 676.1151 48.4734 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.5000002384186 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10; Deamidated(N)@14; Oxidation(M)@17 0.0103302001953125 2300.14624023438 767.7227 2300.1357421875 767.71923828125 3 8 1.1.1.4392.12 1 49.6616 751.2353 49.6743 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.3600007295609 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.0157408006489277 2283.17260742188 762.0648 2283.15698242188 762.0595703125 3 9 1.1.1.4397.14 1 49.7958 59199.55 49.9111 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 0.00159627001266927 3308.72045898438 828.1874 3308.71875 828.186950683594 4 15 1.1.1.4467.15 1 51.5895 605.0894 51.6246 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17 missed K-L@20 0.00238726008683443 3324.71606445313 832.1863 3324.71362304688 832.185668945313 4 18 1.1.1.4484.8 1 52.0385 4638.873 52.284 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14 missed K-L@20 0.00165767001453787 3309.7041015625 828.4333 3309.70263671875 828.432983398438 4 14 1.1.1.4485.14 1 52.0615 4023.235 52.2044 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14 missed K-L@20 0.0249464008957148 3309.72778320313 662.9528 3309.70263671875 662.947814941406 5 11 1.1.1.4488.5 1 52.1364 554.5486 52.2044 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17 missed K-L@20 0.00238726008683443 3324.71606445313 832.1863 3324.71362304688 832.185668945313 4 26 1.1.1.4491.9 1 52.2175 4908.394 52.284 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14 missed K-L@20 0.00165767001453787 3309.7041015625 828.4333 3309.70263671875 828.432983398438 4 18 1.1.1.4492.16 1 52.2483 4023.235 52.2044 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14 missed K-L@20 0.00165767001453787 3309.7041015625 828.4333 3309.70263671875 828.432983398438 4 17 1.1.1.4493.16 1 52.2746 4023.235 52.2044 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14 missed K-L@20 0.00165767001453787 3309.7041015625 828.4333 3309.70263671875 828.432983398438 4 17 1.1.1.4495.7 1 52.3183 4023.235 52.2044 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17 missed K-L@20 0.00238726008683443 3324.71606445313 832.1863 3324.71362304688 832.185668945313 4 28 1.1.1.4498.2 1 52.395 4908.394 52.284 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17 missed K-L@20 0.00263139000162482 3324.71606445313 832.1863 3324.71362304688 832.185668945313 4 20 1.1.1.4505.2 1 52.561 4167.672 52.3104 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14 missed K-L@20 0.0148405004292727 3309.71728515625 828.4366 3309.70263671875 828.432983398438 4 14 1.1.1.4508.5 1 52.6467 1015.284 52.7996 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17 missed K-L@20 0.00311964005231857 3324.71704101563 832.1865 3324.71362304688 832.185668945313 4 16 1.1.1.4513.5 1 52.7621 759.1151 52.7501 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 0.0157556999474764 3308.73461914063 828.1909 3308.71875 828.186950683594 4 12 1.1.1.4545.16 1 53.5836 69468.16 53.7728 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 0.0184118002653122 3308.73706054688 662.7547 3308.71875 662.751037597656 5 17 1.1.1.4549.6 1 53.6785 9972.95 53.7974 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17 missed K-L@20 0.00580503977835178 3324.71923828125 832.1871 3324.71362304688 832.185668945313 4 14 1.1.1.4553.4 1 53.7854 865.8984 53.7974 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 0.00965247023850679 3308.728515625 828.1894 3308.71875 828.186950683594 4 31 1.1.1.4556.3 1 53.8558 71606.16 53.7974 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 -0.00337494001723826 3308.71411132813 1103.912 3308.71875 1103.91357421875 3 19 1.1.1.4558.8 1 53.9124 5130.77 53.7728 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 0.00965247023850679 3308.728515625 828.1894 3308.71875 828.186950683594 4 26 1.1.1.4563.9 1 54.0298 73986.16 53.7728 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 0.00916421972215176 3308.72802734375 828.1893 3308.71875 828.186950683594 4 25 1.1.1.4570.15 1 54.2084 37764.45 53.9448 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 0.00208452995866537 3308.72094726563 828.1875 3308.71875 828.186950683594 4 25 1.1.1.4577.12 1 54.3848 22510.77 54.1179 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8 missed K-L@20 0.00995799992233515 3309.71264648438 828.4354 3309.70263671875 828.432983398438 4 35 1.1.1.4598.10 1 54.9277 38522.14 55.0694 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.00785741023719311 3309.71069335938 662.9494 3309.70263671875 662.947814941406 5 19 1.1.1.4599.8 1 54.9517 5352.86 55.0443 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.00995799992233515 3309.71264648438 828.4354 3309.70263671875 828.432983398438 4 26 1.1.1.4606.16 1 55.135 38522.14 55.0694 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.00971386954188347 3309.71264648438 828.4354 3309.70263671875 828.432983398438 4 28 1.1.1.4613.15 1 55.3096 39657.12 55.0443 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14 missed K-L@20 0.0027852701023221 3309.7041015625 1104.242 3309.70263671875 1104.24157714844 3 10 1.1.1.4614.10 1 55.3383 3019.805 55.0694 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.00971386954188347 3309.71264648438 828.4354 3309.70263671875 828.432983398438 4 25 1.1.1.4621.16 1 55.5171 16611.67 55.2441 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.00190180004574358 3309.70458984375 828.4334 3309.70263671875 828.432983398438 4 14 1.1.1.4628.16 1 55.6964 7759.084 55.4225 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.0131317004561424 3309.7158203125 828.4362 3309.70263671875 828.432983398438 4 14 1.1.1.4635.19 1 55.8793 4158.172 55.6032 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.00116941996384412 3309.70385742188 828.4332 3309.70263671875 828.432983398438 4 11 1.1.1.4642.18 1 56.0619 3034.847 55.7829 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.00507545005530119 3309.70776367188 828.4342 3309.70263671875 828.432983398438 4 17 1.1.1.4649.12 1 56.2358 2272.771 55.9644 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.0167935993522406 3309.71923828125 828.4371 3309.70263671875 828.432983398438 4 20 1.1.1.4666.13 1 56.6839 993.0251 56.4037 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.0131317004561424 3309.7158203125 828.4362 3309.70263671875 828.432983398438 4 12 1.1.1.4673.9 1 56.8606 479.0797 56.8683 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.0224085003137589 3309.72485351563 828.4385 3309.70263671875 828.432983398438 4 12 1.1.1.4682.10 1 57.0917 567.5153 57.1284 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.00165767001453787 3309.7041015625 828.4333 3309.70263671875 828.432983398438 4 14 1.1.1.4695.12 1 57.4276 442.9045 57.3835 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.0137996003031731 3338.74340820313 835.6931 3338.72924804688 835.689575195313 4 22 1.1.1.4501.2 1 52.4762 808.9961 52.5057 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00275130989030004 3352.74780273438 839.1942 3352.74487304688 839.193481445313 4 25 1.1.1.4506.4 1 52.5937 884.3409 52.6032 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Oxidation(M)@17 missed K-L@20 0.00537808984518051 3325.70288085938 832.433 3325.69775390625 832.431701660156 4 20 1.1.1.4537.14 1 53.3755 1598.666 53.3358 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Oxidation(M)@17 missed K-L@20 0.00415745005011559 3325.70166015625 832.4327 3325.69775390625 832.431701660156 4 21 1.1.1.4544.14 1 53.5559 1972.447 53.5152 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 0.00934781972318888 3322.74365234375 831.6932 3322.734375 831.690856933594 4 25 1.1.1.4570.16 1 54.2092 11981.96 54.1431 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.00830984022468328 3336.75805664063 835.1968 3336.75 835.194763183594 4 23 1.1.1.4573.17 1 54.2864 15702.19 54.3206 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.00830984022468328 3336.75805664063 835.1968 3336.75 835.194763183594 4 29 1.1.1.4576.11 1 54.3583 15702.19 54.3206 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 0.00934781972318888 3322.74365234375 831.6932 3322.734375 831.690856933594 4 22 1.1.1.4577.13 1 54.3856 12427.51 54.1179 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.00830984022468328 3336.75805664063 835.1968 3336.75 835.194763183594 4 22 1.1.1.4577.14 1 54.3864 15702.19 54.3206 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 -0.00432329997420311 3322.73022460938 831.6898 3322.734375 831.690856933594 4 24 1.1.1.4584.7 1 54.5644 6036.944 54.295 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.00830984022468328 3336.75805664063 835.1968 3336.75 835.194763183594 4 25 1.1.1.4584.8 1 54.5661 16172.46 54.295 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 0.994462013244629 3309.712890625 828.4355 3308.71875 828.186950683594 4 23 1.1.1.4585.18 1 54.5962 12932.79 54.5005 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Formyl(K)@20 missed K-L@20 0.0388363003730774 3336.75244140625 835.1954 3336.71362304688 835.185668945313 4 25 1.1.1.4591.13 1 54.748 7869.532 54.4746 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 0.993973970413208 3309.71264648438 828.4354 3308.71875 828.186950683594 4 22 1.1.1.4592.15 1 54.7758 12765.11 54.5005 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.00355009990744293 3323.7216796875 831.9377 3323.71826171875 831.936889648438 4 22 1.1.1.4619.14 1 55.4636 6022.235 55.3708 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.00355009990744293 3323.7216796875 831.9377 3323.71826171875 831.936889648438 4 24 1.1.1.4621.17 1 55.518 6022.235 55.3708 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.00355009990744293 3323.7216796875 831.9377 3323.71826171875 831.936889648438 4 24 1.1.1.4622.17 1 55.5435 6022.235 55.3708 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10; Methyl(K)@20 missed K-L@20 0.00355009990744293 3323.7216796875 831.9377 3323.71826171875 831.936889648438 4 22 1.1.1.4624.17 1 55.5945 6022.235 55.3708 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00470919022336602 3337.73901367188 835.442 3337.73413085938 835.440795898438 4 25 1.1.1.4626.19 1 55.6477 7517.317 55.6032 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00519745005294681 3337.7392578125 835.4421 3337.73413085938 835.440795898438 4 21 1.1.1.4635.20 1 55.8802 7410.094 55.6032 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00145524996332824 3336.74853515625 835.1944 3336.75 835.194763183594 4 18 1.1.1.4598.12 1 54.9294 4189.211 54.6818 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 0.0156951006501913 3322.75024414063 831.6948 3322.734375 831.690856933594 4 20 1.1.1.4605.6 1 55.1058 1193.242 54.9935 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.0142483003437519 3336.76416015625 668.3601 3336.75 668.357299804688 5 17 1.1.1.4569.9 1 54.1782 4115.967 54.3206 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 0.00251226010732353 3322.73706054688 831.6915 3322.734375 831.690856933594 4 19 1.1.1.4589.13 1 54.6992 3067.393 54.4232 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Oxidation(M)@17; Formyl(K)@20 missed K-L@20 0.0326066017150879 3353.72485351563 839.4385 3353.69262695313 839.430419921875 4 16 1.1.1.4547.7 1 53.6345 464.1914 53.5931 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Cation:Na(D)@15 missed K-L@20 0.0250934008508921 3330.7255859375 667.1524 3330.70068359375 667.147399902344 5 18 1.1.1.4557.4 1 53.8786 1640.734 53.7974 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0127186002209783 3322.74365234375 831.6932 3322.73095703125 831.690002441406 4 18 1.1.1.4559.3 1 53.9336 12035.61 54.1431 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 0.00837131030857563 3322.74243164063 831.6929 3322.734375 831.690856933594 4 16 1.1.1.4587.17 1 54.6472 3945.48 54.3719 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Dehydrated(T)@3; Deamidated(N)@10 missed K-L@20 0.00710391020402312 3291.69946289063 823.9321 3291.69213867188 823.930297851563 4 14 1.1.1.4590.13 1 54.722 1133.52 54.5005 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.00845026969909668 3336.75805664063 668.3589 3336.75 668.357299804688 5 14 1.1.1.4594.13 1 54.8283 1406.283 54.5522 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0137103004381061 3323.73217773438 665.7537 3323.71826171875 665.7509765625 5 15 1.1.1.4610.8 1 55.2289 1138.459 55.3708 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.00355009990744293 3323.7216796875 831.9377 3323.71826171875 831.936889648438 4 18 1.1.1.4612.6 1 55.2808 6022.235 55.3708 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00121112994384021 3336.7490234375 835.1945 3336.75 835.194763183594 4 18 1.1.1.4612.7 1 55.2825 2361.377 55.0944 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00470919022336602 3337.73901367188 835.442 3337.73413085938 835.440795898438 4 17 1.1.1.4619.15 1 55.4645 7517.317 55.6032 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.00355009990744293 3323.7216796875 831.9377 3323.71826171875 831.936889648438 4 17 1.1.1.4623.18 1 55.57 6022.235 55.3708 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 [trypsin fragment, 30 aa] Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00109353999141604 3353.72778320313 839.4392 3353.72900390625 839.439514160156 4 17 1.1.1.4555.4 1 53.8321 643.7894 53.7974 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 [trypsin fragment, 30 aa] Deamidated(N)@14; Methyl(D)@15; Oxidation(M)@17 missed K-L@20 0.0294850002974272 3339.74291992188 835.943 3339.71337890625 835.935607910156 4 17 1.1.1.4563.10 1 54.0315 357.3064 54.0187 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.0142483003437519 3336.76416015625 668.3601 3336.75 668.357299804688 5 15 1.1.1.4583.13 1 54.5402 4115.967 54.3206 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 [trypsin fragment, 30 aa] Ammonia-loss(N)@10 missed K-L@20 0.00710391020402312 3291.69946289063 823.9321 3291.69213867188 823.930297851563 4 13 1.1.1.4583.17 1 54.5436 1133.52 54.5005 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 [trypsin fragment, 30 aa] Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0117421001195908 3322.74243164063 831.6929 3322.73095703125 831.690002441406 4 13 1.1.1.4588.13 1 54.6698 3410.585 54.3975 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 [trypsin fragment, 30 aa] Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.00428248010575771 3323.72265625 831.9379 3323.71826171875 831.936889648438 4 15 1.1.1.4596.16 1 54.8813 2468.572 54.8647 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 [trypsin fragment, 30 aa] Deamidated(N)@6; Methyl(K)@20 missed K-L@20 0.010385699570179 3323.72900390625 831.9395 3323.71826171875 831.936889648438 4 13 1.1.1.4639.16 1 55.9813 1364.81 55.7057 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00114985997788608 3337.73291015625 835.4405 3337.73413085938 835.440795898438 4 15 1.1.1.4642.19 1 56.0628 3968.01 55.7829 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00837109982967377 3337.74243164063 835.4429 3337.73413085938 835.440795898438 4 13 1.1.1.4650.16 1 56.2647 2190.936 55.9907 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 [trypsin fragment, 30 aa] Cation:Na(D)@15 missed K-L@20 0.0196665991097689 3330.72045898438 833.6874 3330.70068359375 833.682434082031 4 13 1.1.1.4557.6 1 53.882 1463.629 53.7974 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 [trypsin fragment, 30 aa] Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0175653006881475 3322.74853515625 665.557 3322.73095703125 665.553466796875 5 11 1.1.1.4574.13 1 54.3087 2326.918 54.1179 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 [trypsin fragment, 30 aa] Deamidated(N)@14; Oxidation(D)@15; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0274692997336388 3353.75659179688 839.4464 3353.72900390625 839.439514160156 4 14 1.1.1.4576.12 1 54.3592 408.9255 54.295 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 [trypsin fragment, 30 aa] Methyl(D)@15 missed K-L@20 0.0156951006501913 3322.75024414063 831.6948 3322.734375 831.690856933594 4 13 1.1.1.4606.17 1 55.1359 1193.242 54.9935 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 [trypsin fragment, 30 aa] Deamidated(N)@10; Cation:Na(D)@15 missed K-L@20 -0.00126708997413516 3331.68334960938 833.9281 3331.6845703125 833.928466796875 4 10 1.1.1.4611.15 1 55.259 967.0097 55.0694 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 [trypsin fragment, 30 aa] Deamidated(N)@8; Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0120476000010967 3323.72705078125 831.939 3323.71508789063 831.93603515625 4 11 1.1.1.4646.18 1 56.1648 899.049 55.8862 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 [trypsin fragment, 30 aa] Deamidated(N)@10; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0203332994133234 3337.75463867188 835.4459 3337.73413085938 835.440795898438 4 11 1.1.1.4670.11 1 56.7867 512.0145 56.5088 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.2100007534027 [trypsin fragment, 30 aa] Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0175653006881475 3322.74853515625 665.557 3322.73095703125 665.553466796875 5 11 1.1.1.4573.12 1 54.2823 2326.918 54.1179 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.2100007534027 [trypsin fragment, 30 aa] Deamidated(N)@14; Cation:Na(D)@15 missed K-L@20 0.0273557007312775 3331.7119140625 667.3497 3331.6845703125 667.34423828125 5 11 1.1.1.4573.13 1 54.2831 982.6351 54.0187 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.2100007534027 [trypsin fragment, 30 aa] Deamidated(N)@10; Cation:Na(D)@15 missed K-L@20 0.00233250996097922 3331.68725585938 667.3447 3331.6845703125 667.34423828125 5 12 1.1.1.4601.12 1 55.0062 1144.579 55.0694 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.2100007534027 [trypsin fragment, 30 aa] Deamidated(N)@10; Cation:Na(D)@15 missed K-L@20 0.00233250996097922 3331.68725585938 667.3447 3331.6845703125 667.34423828125 5 12 1.1.1.4610.9 1 55.2305 1144.579 55.0694 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.2100007534027 [trypsin fragment, 30 aa] Deamidated(N)@8; Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0170811004936695 3323.73217773438 665.7537 3323.71508789063 665.750305175781 5 11 1.1.1.4617.14 1 55.4114 1138.459 55.3708 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.9100003242493 [trypsin fragment, 30 aa] Met->Hcy(M)@17; reduced acrolein addition +58(K)@20 missed K-L@20 0.00421606982126832 3352.74926757813 839.1946 3352.74487304688 839.193481445313 4 9 1.1.1.4495.8 1 52.3192 696.9343 52.36 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.9100003242493 [trypsin fragment, 30 aa] Oxidation(M)@17; Formyl(K)@20 missed K-L@20 0.0330335982143879 3352.74169921875 839.1927 3352.70849609375 839.184387207031 4 10 1.1.1.4584.9 1 54.5677 237.7547 54.5005 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.9100003242493 [trypsin fragment, 30 aa] Deamidated(N)@10; Cation:Na(D)@15 missed K-L@20 -0.00126708997413516 3331.68334960938 833.9281 3331.6845703125 833.928466796875 4 13 1.1.1.4604.6 1 55.0816 967.0097 55.0694 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.9100003242493 [trypsin fragment, 30 aa] Deamidated(N)@8; Formyl(K)@20 missed K-L@20 0.0470979996025562 3337.74462890625 668.5562 3337.69775390625 668.546813964844 5 11 1.1.1.4626.14 1 55.6436 1818.297 55.6032 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.229998588562 [trypsin fragment, 30 aa] Deamidated(N)@10; Methyl(T)@11; Oxidation(M)@17 missed K-L@20 0.00214275997132063 3339.7158203125 835.9362 3339.71337890625 835.935607910156 4 10 1.1.1.4551.8 1 53.7321 697.1315 53.7482 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.229998588562 [trypsin fragment, 30 aa] Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0316025987267494 3322.7626953125 665.5598 3322.73095703125 665.553466796875 5 7 1.1.1.4592.10 1 54.7716 280.659 54.8125 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.229998588562 [trypsin fragment, 30 aa] Delta:H(2)C(2)(H)@4 missed K-L@20 0.0169900003820658 3334.75146484375 834.6951 3334.734375 834.690856933594 4 9 1.1.1.4740.9 1 58.5716 189.4433 58.454 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 74.3900001049042 [trypsin fragment, 30 aa] Cation:Na(D)@15 missed K-L@20 0.0140516003593802 3330.71484375 833.686 3330.70068359375 833.682434082031 4 11 1.1.1.4564.7 1 54.053 1472.193 53.7974 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 69.5299983024597 [trypsin fragment, 30 aa] Deamidated(N)@10; Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.00580465979874134 3339.71923828125 835.9371 3339.71337890625 835.935607910156 4 8 1.1.1.4535.8 1 53.3197 257.6718 53.3358 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.9999985694885 [trypsin fragment, 30 aa] Deamidated(N)@14 missed K-L@20 0.00165767001453787 3309.7041015625 828.4333 3309.70263671875 828.432983398438 4 10 1.1.1.4654.16 1 56.3682 1538.933 56.0957 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 50.9999990463257 [trypsin fragment, 30 aa] Deamidated(N)@6; Ammonia-loss(N)@14; acrolein addition +38(K)@20 missed K-L@20 0.0339214988052845 3330.7255859375 667.1524 3330.69189453125 667.145629882813 5 10 1.1.1.4550.6 1 53.7047 1640.734 53.7974 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.6699995994568 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.00830984022468328 3336.75805664063 835.1968 3336.75 835.194763183594 4 7 1.1.1.4574.17 1 54.312 15702.19 54.3206 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 38.7600004673004 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 0.00931936036795378 3322.7451171875 1108.589 3322.734375 1108.58544921875 3 8 1.1.1.4570.17 1 54.2101 668.0451 54.1431 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 38.7600004673004 [trypsin fragment, 30 aa] Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0151239996775985 3322.74609375 665.5565 3322.73095703125 665.553466796875 5 9 1.1.1.4582.9 1 54.5144 1419.829 54.2441 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.4399987459183 [trypsin fragment, 30 aa] Deamidated(N)@14; Cation:Na(D)@15 missed K-L@20 0.029491800814867 3331.71411132813 667.3501 3331.6845703125 667.34423828125 5 10 1.1.1.4565.7 1 54.0761 2045.083 53.822 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.1199992895126 [trypsin fragment, 30 aa] missed K-L@20 0.0112725999206305 3308.72924804688 1103.917 3308.71875 1103.91357421875 3 7 1.1.1.4578.17 1 54.4146 620.9515 54.3719 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.1199992895126 [trypsin fragment, 30 aa] Deamidated(N)@14 missed K-L@20 0.00846773013472557 3309.71118164063 662.9495 3309.70263671875 662.947814941406 5 10 1.1.1.4625.14 1 55.6177 852.0655 55.4747 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.0000001192093 [trypsin fragment, 30 aa] Deamidated(N)@14; Formyl(K)@20 missed K-L@20 0.035479798913002 3337.7333984375 835.4406 3337.69775390625 835.431701660156 4 8 1.1.1.4493.17 1 52.2755 1105.594 52.36 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.0000001192093 [trypsin fragment, 30 aa] Deamidated(N)@14; Cation:Na(D)@15 missed K-L@20 0.00233250996097922 3331.68725585938 667.3447 3331.6845703125 667.34423828125 5 8 1.1.1.4609.9 1 55.2039 1144.579 55.0694 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.0000001192093 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.00306184007786214 3323.72143554688 831.9376 3323.71826171875 831.936889648438 4 9 1.1.1.4631.15 1 55.7727 3390.758 55.5005 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 26.4200001955032 [trypsin fragment, 30 aa] missed K-L@20 0.00285027991048992 3308.71997070313 1103.914 3308.71875 1103.91357421875 3 7 1.1.1.4572.19 1 54.2626 2224.946 53.994 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 24.7099995613098 [trypsin fragment, 30 aa] Deamidated(N)@14; Oxidation(M)@17 missed K-L@20 0.0127018997445703 3325.71044921875 832.4349 3325.69775390625 832.431701660156 4 7 1.1.1.4521.16 1 52.9661 891.0223 52.9246 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 21.5399995446205 [trypsin fragment, 30 aa] Cation:Na(D)@15 missed K-L@20 0.0196665991097689 3330.72045898438 833.6874 3330.70068359375 833.682434082031 4 9 1.1.1.4550.11 1 53.7088 1463.629 53.7974 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 21.5399995446205 [trypsin fragment, 30 aa] Ammonia-loss(N)@10 missed K-L@20 0.00710391020402312 3291.69946289063 823.9321 3291.69213867188 823.930297851563 4 7 1.1.1.4576.10 1 54.3575 1133.52 54.5005 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 20.8399996161461 [trypsin fragment, 30 aa] acrolein addition +38(K)@20 missed K-L@20 -0.0554465986788273 3346.67895507813 670.3431 3346.734375 670.354125976563 5 7 1.1.1.4599.9 1 54.9525 159.1236 54.8907 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.2900002002716 [trypsin fragment, 30 aa] Oxidation(M)@17 missed K-L@20 0.00189901003614068 3324.7158203125 832.1862 3324.71362304688 832.185668945313 4 10 1.1.1.4603.13 1 55.0575 1372.168 55.0189 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.2900002002716 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.0414250008761883 3309.744140625 662.9561 3309.70263671875 662.947814941406 5 9 1.1.1.4633.14 1 55.8234 399.812 55.7829 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.5000002384186 [trypsin fragment, 30 aa] Deamidated(N)@14; Oxidation(M)@17 missed K-L@20 0.00415745005011559 3325.70166015625 832.4327 3325.69775390625 832.431701660156 4 7 1.1.1.4530.10 1 53.1973 1608.065 53.3866 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.2000005841255 [trypsin fragment, 30 aa] Deamidated(N)@10 missed K-L@20 0.00450064009055495 3309.70727539063 662.9487 3309.70263671875 662.947814941406 5 7 1.1.1.4645.14 1 56.1359 327.7377 55.9382 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.5699998140335 [trypsin fragment, 30 aa] Ammonia-loss(N)@14 missed K-L@20 0.00124484999105334 3291.693359375 823.9306 3291.69213867188 823.930297851563 4 8 1.1.1.4597.10 1 54.9021 533.3629 54.8385 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.5699998140335 [trypsin fragment, 30 aa] Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.011056499555707 3337.74487304688 835.4435 3337.73413085938 835.440795898438 4 8 1.1.1.4660.16 1 56.5266 1003.063 56.2486 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 0.00132002995815128 2706.41064453125 677.6099 2706.40893554688 677.609497070313 4 23 1.1.1.4301.11 1 47.2745 16057.32 47.2365 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 -0.0124556003138423 2706.396484375 903.1394 2706.40893554688 903.143615722656 3 26 1.1.1.4302.16 1 47.307 3335.892 47.2365 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 0.00132002995815128 2706.41064453125 677.6099 2706.40893554688 677.609497070313 4 23 1.1.1.4308.6 1 47.4588 16057.32 47.2365 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.8299996852875 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.226383998990059 6053.3681640625 1009.902 6053.14306640625 1009.86450195313 6 11 1.1.1.4929.21 1 63.4184 670.1802 63.4502 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGN cleaved N-E@C-term -0.00518424995243549 1308.62585449219 655.3202 1308.63098144531 655.32275390625 2 13 1.1.1.3875.4 1 36.6822 3737.186 36.8668 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGN cleaved N-E@C-term -0.00518424995243549 1308.62585449219 655.3202 1308.63098144531 655.32275390625 2 14 1.1.1.3884.4 1 36.8573 3909.586 36.8668 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGN Deamidated(N)@12 cleaved N-E@C-term 0.00392511999234557 1309.61901855469 655.8168 1309.61499023438 655.814758300781 2 12 1.1.1.3937.3 1 38.0821 404.2635 38.1115 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.979998588562 LGEHNIDVLEGN Dehydrated(E)@10 cleaved N-E@C-term -0.00172454002313316 1290.61889648438 646.3167 1290.62048339844 646.317504882813 2 13 1.1.1.3907.2 1 37.3975 4634.592 37.5716 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 LGEHNIDVLEGN Dehydrated(E)@10 cleaved N-E@C-term -0.00416585011407733 1290.61633300781 646.3154 1290.62048339844 646.317504882813 2 12 1.1.1.3914.3 1 37.5663 4697.705 37.5716 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 LGEHNIDVLEGN Dehydrated(E)@10 cleaved N-E@C-term -0.00416585011407733 1290.61633300781 646.3154 1290.62048339844 646.317504882813 2 11 1.1.1.3921.6 1 37.7348 4697.705 37.5716 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00331634003669024 1565.73547363281 783.875 1565.73217773438 783.873352050781 2 19 1.1.1.3868.3 1 36.5324 1408.676 36.4644 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.000394406990380958 1939.92810058594 970.9713 1939.92761230469 970.971069335938 2 14 1.1.1.4248.12 1 45.9013 1578.403 46.013 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00405634986236691 1939.931640625 970.9731 1939.92761230469 970.971069335938 2 12 1.1.1.4282.17 1 46.7784 447.8093 46.8381 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -0.00229403004050255 1939.92517089844 647.649 1939.92761230469 647.649780273438 3 9 1.1.1.4247.9 1 45.8702 1663.394 46.013 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9199984073639 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term -0.0215371008962393 1921.8955078125 961.955 1921.9169921875 961.965759277344 2 14 1.1.1.4320.10 1 47.7851 2072.855 47.7376 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.9100003242493 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term -0.0215371008962393 1921.8955078125 961.955 1921.9169921875 961.965759277344 2 11 1.1.1.4313.10 1 47.6003 2072.855 47.7376 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 38.7600004673004 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term -0.00884256046265364 1921.90832519531 961.9614 1921.9169921875 961.965759277344 2 8 1.1.1.4306.10 1 47.4117 496.426 47.4716 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00636240001767874 2210.09057617188 737.7041 2210.0966796875 737.706176757813 3 21 1.1.1.4137.7 1 43.0661 1526.059 43.1001 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.000735812005586922 2211.08129882813 1106.548 2211.08081054688 1106.54760742188 2 13 1.1.1.4143.16 1 43.2268 666.2126 43.2849 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.0045763598755002 2211.08520507813 738.0357 2211.08081054688 738.0341796875 3 24 1.1.1.4150.10 1 43.4096 11961.29 43.3112 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(H)@4; Deamidated(N)@17 -0.0147516001015902 2239.09716796875 747.373 2239.11206054688 747.377990722656 3 20 1.1.1.4167.15 0 43.8561 1246.029 43.9164 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00757742021232843 2210.1044921875 553.5334 2210.0966796875 553.531494140625 4 18 1.1.1.4170.5 1 43.9245 9455.271 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.025815699249506 2211.1064453125 738.0428 2211.08081054688 738.0341796875 3 21 1.1.1.4170.16 1 43.9337 84610.28 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00446113990619779 2210.09130859375 1106.053 2210.0966796875 1106.0556640625 2 24 1.1.1.4171.5 1 43.9622 12771.81 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(N)@12 -0.00989194959402084 2224.1025390625 742.3748 2224.1123046875 742.378051757813 3 16 1.1.1.4172.2 0 43.9748 996.2357 43.9674 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00446113990619779 2210.09130859375 1106.053 2210.0966796875 1106.0556640625 2 23 1.1.1.4172.4 1 43.9865 12771.81 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00446113990619779 2210.09130859375 1106.053 2210.0966796875 1106.0556640625 2 24 1.1.1.4173.4 1 44.0108 12771.81 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Acetyl@N-term; Dehydrated(E)@3 -0.0296854991465807 2234.06713867188 745.6963 2234.0966796875 745.706176757813 3 15 1.1.1.4174.2 1 44.0218 3381.363 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00446113990619779 2210.09130859375 1106.053 2210.0966796875 1106.0556640625 2 22 1.1.1.4174.6 1 44.0351 12771.81 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00446113990619779 2210.09130859375 1106.053 2210.0966796875 1106.0556640625 2 25 1.1.1.4175.4 1 44.0595 12771.81 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00446113990619779 2210.09130859375 1106.053 2210.0966796875 1106.0556640625 2 27 1.1.1.4176.5 1 44.0838 12771.81 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0101164001971483 2210.10693359375 737.7096 2210.0966796875 737.706176757813 3 24 1.1.1.4177.3 1 44.0981 125785.2 43.9674 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:K(E)@10 -0.00164596003014594 2248.05102539063 750.3576 2248.052734375 750.358154296875 3 16 1.1.1.4178.3 1 44.1325 933.6218 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(H)@4 -0.00604688981547952 2224.10620117188 742.376 2224.1123046875 742.378051757813 3 23 1.1.1.4179.3 0 44.1511 1563.597 44.2354 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@10 0.00395430997014046 2232.0830078125 745.0349 2232.07861328125 745.033508300781 3 27 1.1.1.4179.4 1 44.1569 3819.544 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00757742021232843 2210.1044921875 553.5334 2210.0966796875 553.531494140625 4 21 1.1.1.4180.2 1 44.1688 9455.271 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@13 -0.00446819001808763 2232.07421875 745.032 2232.07861328125 745.033508300781 3 20 1.1.1.4183.4 1 44.2546 3765.237 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00975021999329329 2210.10668945313 737.7095 2210.0966796875 737.706176757813 3 23 1.1.1.4184.6 1 44.2716 122543.3 44.016 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@13 -0.00117242999840528 2232.07739257813 745.0331 2232.07861328125 745.033508300781 3 21 1.1.1.4184.7 1 44.2741 3359.955 44.016 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(H)@4 -0.00604688981547952 2224.10620117188 742.376 2224.1123046875 742.378051757813 3 23 1.1.1.4186.2 0 44.32 1563.597 44.2354 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.000253467005677521 2210.09741210938 553.5316 2210.0966796875 553.531494140625 4 13 1.1.1.4189.6 1 44.3932 5502.394 44.1378 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00791923981159925 2210.10498046875 737.7089 2210.0966796875 737.706176757813 3 22 1.1.1.4191.7 1 44.4473 65719.78 44.1865 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.0210551992058754 2211.10180664063 738.0412 2211.08081054688 738.0341796875 3 19 1.1.1.4191.8 1 44.4489 39598.32 44.1865 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.0108073996379972 2224.10180664063 742.3745 2224.1123046875 742.378051757813 3 22 1.1.1.4193.8 1 44.5004 1751.506 44.4849 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.000555069011170417 2210.09545898438 1106.055 2210.0966796875 1106.0556640625 2 8 1.1.1.4195.19 1 44.5575 1649.734 44.2843 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00370799005031586 2210.10083007813 737.7075 2210.0966796875 737.706176757813 3 24 1.1.1.4198.10 1 44.6343 21957.39 44.3585 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(Q)@14 0.0045763598755002 2211.08520507813 738.0357 2211.08081054688 738.0341796875 3 21 1.1.1.4199.13 1 44.6573 9566.925 44.7991 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term 0.000675869989208877 2238.12866210938 747.0502 2238.12817382813 747.049987792969 3 26 1.1.1.4202.13 1 44.7362 8534.541 44.7728 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(Q)@14 0.0045763598755002 2211.08520507813 738.0357 2211.08081054688 738.0341796875 3 21 1.1.1.4206.14 1 44.8407 9566.925 44.7991 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(H)@4 0.000675869989208877 2238.12866210938 747.0502 2238.12817382813 747.049987792969 3 21 1.1.1.4209.4 0 44.9124 8534.541 44.7728 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00407418003305793 2210.10083007813 737.7076 2210.0966796875 737.706176757813 3 19 1.1.1.4213.18 1 45.0209 5141.883 44.7464 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.981085002422333 2211.07788085938 738.0332 2210.0966796875 737.706176757813 3 22 1.1.1.4242.12 1 45.7411 3156.86 45.8036 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 -0.00293066003359854 2211.07788085938 738.0332 2211.08081054688 738.0341796875 3 15 1.1.1.4248.10 1 45.8979 3156.86 45.8036 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.981085002422333 2211.07788085938 738.0332 2210.0966796875 737.706176757813 3 17 1.1.1.4249.13 1 45.9241 3156.86 45.8036 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4; Deamidated(N)@17 0.0161167997866869 2237.11254882813 746.7115 2237.09643554688 746.706115722656 3 15 1.1.1.4255.12 1 46.0817 308.9954 45.9343 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.987676024436951 2211.08447265625 738.0354 2210.0966796875 737.706176757813 3 16 1.1.1.4259.8 1 46.189 8897.309 46.2996 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.00366087001748383 2211.08447265625 738.0354 2211.08081054688 738.0341796875 3 21 1.1.1.4268.7 1 46.4098 8897.309 46.2996 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.00347776990383863 2211.083984375 738.0353 2211.08081054688 738.0341796875 3 15 1.1.1.4275.5 1 46.5879 8438.516 46.3251 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00407418003305793 2210.10083007813 737.7076 2210.0966796875 737.706176757813 3 13 1.1.1.4282.11 1 46.7717 577.8807 46.8381 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 0.00188243994489312 2236.1142578125 746.3787 2236.1123046875 746.378051757813 3 12 1.1.1.4282.13 1 46.7734 2885.727 46.8907 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 0.00243173004128039 2236.11499023438 746.3789 2236.1123046875 746.378051757813 3 22 1.1.1.4289.8 1 46.9598 3410.788 47.0234 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.992802977561951 2211.08959960938 738.0371 2210.0966796875 737.706176757813 3 19 1.1.1.4290.8 1 46.9917 793.2241 46.8381 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)@N-term 0.00243173004128039 2236.11499023438 746.3789 2236.1123046875 746.378051757813 3 21 1.1.1.4296.4 1 47.1426 3410.788 47.0234 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 -0.00353405997157097 2211.0771484375 738.033 2211.08081054688 738.0341796875 3 22 1.1.1.4298.9 1 47.2024 2753.913 47.2365 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00310913007706404 2210.09350585938 737.7051 2210.0966796875 737.706176757813 3 12 1.1.1.4312.9 1 47.5685 306.4857 47.5787 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.031122799962759 2210.06567382813 737.6958 2210.0966796875 737.706176757813 3 11 1.1.1.4530.7 1 53.1923 280.3769 53.2347 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@3 0.00731363985687494 2232.0859375 745.0359 2232.07861328125 745.033508300781 3 21 1.1.1.4493.14 1 52.273 3434.98 52.3353 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Oxidation(H)@4; Ammonia-loss(N)@5 -0.00102236995007843 2209.06420898438 737.362 2209.06518554688 737.3623046875 3 24 1.1.1.4552.4 1 53.7634 3884.14 53.7482 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Formyl(K)@20 0.000251066987402737 2238.091796875 747.0379 2238.091796875 747.037841796875 3 18 1.1.1.4322.8 1 47.8297 643.8156 47.8698 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.0195877999067307 2210.07690429688 737.6996 2210.0966796875 737.706176757813 3 10 1.1.1.4322.7 1 47.8281 309.4056 47.8433 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Formyl@N-term 0.00427917018532753 2238.095703125 747.0392 2238.091796875 747.037841796875 3 16 1.1.1.4419.11 1 50.3313 1404.673 50.3712 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@3 0.00901405978947878 2232.08740234375 1117.051 2232.07861328125 1117.04663085938 2 15 1.1.1.4496.5 1 52.3514 369.3192 52.3353 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Oxidation(H)@4; Ammonia-loss(N)@5 -0.00102236995007843 2209.06420898438 737.362 2209.06518554688 737.3623046875 3 20 1.1.1.4559.2 1 53.9278 3884.14 53.7482 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term; Deamidated(N)@17 0.0258542001247406 2239.1376953125 560.7917 2239.11206054688 560.785278320313 4 10 1.1.1.4205.7 0 44.812 720.4553 44.7728 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.98048198223114 2211.0771484375 738.033 2210.0966796875 737.706176757813 3 15 1.1.1.4305.7 1 47.3803 2753.913 47.2365 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@3 0.00901405978947878 2232.08740234375 1117.051 2232.07861328125 1117.04663085938 2 11 1.1.1.4494.20 1 52.3044 369.3192 52.3353 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Dimethyl(N)@12; Cation:Na(E)@13 -0.0126307001337409 2260.09716796875 754.373 2260.11010742188 754.377258300781 3 15 1.1.1.4177.4 0 44.1015 1170.842 43.9674 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.979998588562 LGEHNIDVLEGNEQFINAAK reduced acrolein addition +58(K)@20 -0.0400552004575729 2268.09887695313 757.0402 2268.138671875 757.053466796875 3 9 1.1.1.4296.5 1 47.1451 430.1733 47.2102 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 LGEHNIDVLEGNEQFINAAK Oxidation(H)@4; Ammonia-loss(N)@5 -0.00102236995007843 2209.06420898438 737.362 2209.06518554688 737.3623046875 3 14 1.1.1.4545.13 1 53.5811 3884.14 53.7482 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 LGEHNIDVLEGNEQFINAAK Oxidation(H)@4; Ammonia-loss(N)@5 -0.00216536992229521 2209.06323242188 1105.539 2209.06518554688 1105.53979492188 2 11 1.1.1.4550.19 1 53.7155 969.9105 53.7482 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 0.00119517999701202 2296.134765625 766.3855 2296.13354492188 766.385131835938 3 17 1.1.1.4590.12 1 54.7212 8379.836 54.6558 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@3 0.00901405978947878 2232.08740234375 1117.051 2232.07861328125 1117.04663085938 2 9 1.1.1.4495.16 1 52.3267 369.3192 52.3353 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 0.00119517999701202 2296.134765625 766.3855 2296.13354492188 766.385131835938 3 13 1.1.1.4583.15 1 54.5419 8379.836 54.6558 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 0.00119517999701202 2296.134765625 766.3855 2296.13354492188 766.385131835938 3 13 1.1.1.4597.9 1 54.9012 8613.283 54.6558 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.1200008392334 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@13 0.0052878400310874 2232.08422851563 559.0283 2232.07861328125 559.026977539063 4 9 1.1.1.4184.4 1 44.2674 2702.434 44.016 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.229998588562 LGEHNIDVLEGNEQFINAAK Carbamyl(K)@20 -0.00961294025182724 2253.09326171875 752.0383 2253.1025390625 752.041442871094 3 8 1.1.1.4300.18 1 47.2548 473.1043 47.2625 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.229998588562 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 -0.00451009022071958 2236.10791015625 746.3766 2236.1123046875 746.378051757813 3 7 1.1.1.4303.14 1 47.3287 2914.466 47.0498 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 73.8600015640259 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5; Deamidated(N)@12; Deamidated(Q)@14; Deamidated(N)@17 0.0297024995088577 2214.0625 739.0281 2214.03271484375 739.018188476563 3 12 1.1.1.4144.11 1 43.2498 2017.332 43.2849 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 LGEHNIDVLEGNEQFINAAK HexNAc(N)@17; reduced acrolein addition +96(K)@20 -0.0136054996401072 2509.2197265625 837.4139 2509.23364257813 837.418518066406 3 12 1.1.1.4144.13 1 43.2532 976.3484 43.3112 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@13 -0.0015478499699384 2232.07739257813 559.0266 2232.07861328125 559.026977539063 4 9 1.1.1.4170.7 1 43.9262 3214.692 43.9917 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 LGEHNIDVLEGNEQFINAAK Cation:K(E)@3; Oxidation(H)@4; Deamidated(N)@12 -0.01380779966712 2265.01782226563 756.0132 2265.03149414063 756.017822265625 3 13 1.1.1.4176.4 1 44.0797 1352.101 44.016 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@13 -0.00135552999563515 2232.07739257813 745.0331 2232.07861328125 745.033508300781 3 9 1.1.1.4191.9 1 44.4506 1573.045 44.1865 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term; Deamidated(N)@17 0.0176567006856203 2239.1298828125 747.3839 2239.11206054688 747.377990722656 3 9 1.1.1.4236.16 0 45.5899 322.9665 45.5238 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 LGEHNIDVLEGNEQFINAAK reduced HNE(H)@4; HexNAc(N)@5; Deamidated(N)@12 0.0367463007569313 2572.32763671875 858.4498 2572.29077148438 858.437561035156 3 10 1.1.1.4261.12 1 46.24 498.1317 46.2996 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.32000207901 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(H)@4 -0.00719734001904726 2238.12060546875 747.0475 2238.12817382813 747.049987792969 3 8 1.1.1.4282.14 1 46.7742 1056.568 46.8907 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 61.0899984836578 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@12; Deamidated(Q)@14 -0.00410785991698503 2241.08740234375 748.0364 2241.09130859375 748.037719726563 3 12 1.1.1.4173.2 0 43.9991 1935.631 43.9674 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 47.6300001144409 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(H)@4; Deamidated(N)@12 0.0154595002532005 2239.12744140625 747.3831 2239.11206054688 747.377990722656 3 8 1.1.1.4243.15 0 45.7723 204.7092 45.7513 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 30.5599987506866 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.00171233003493398 2211.08129882813 1106.548 2211.08081054688 1106.54760742188 2 7 1.1.1.4261.14 1 46.2434 473.2646 46.2996 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.3400005102158 LGEHNIDVLEGNEQFINAAK Ammonia-loss(N)@12 0.00635675992816687 2193.07641601563 732.0328 2193.0703125 732.030700683594 3 7 1.1.1.4170.14 1 43.932 460.475 43.9674 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.3500001430511 LGEHNIDVLEGNEQFINAAK Deamidated(Q)@14 0.0087876096367836 2211.08959960938 738.0371 2211.08081054688 738.0341796875 3 7 1.1.1.4282.12 1 46.7726 793.2241 46.8381 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 36.8699997663498 LGEHNIDVLEGNEQFINAAKIITHPN Delta:H(4)C(2)(H)@24 cleaved N-F@C-term; missed K-I@20 0.00160608999431133 2913.50024414063 729.3823 2913.49853515625 729.381896972656 4 10 1.1.1.4488.7 1 52.1397 497.5651 52.0725 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.211768001317978 5557.04296875 927.1811 5556.8310546875 927.145812988281 6 21 1.1.1.4901.20 1 62.6872 1751.864 62.9264 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.21586500108242 5558.02783203125 927.3452 5557.8115234375 927.309265136719 6 12 1.1.1.4922.21 1 63.2348 1651.859 62.9523 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR -0.00162783998530358 1044.55493164063 523.2847 1044.55639648438 523.285461425781 2 8 1.1.1.3397.4 1 25.1615 106.3047 25.1418 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR -0.00480156019330025 1044.55163574219 523.2831 1044.55639648438 523.285461425781 2 16 1.1.1.3463.3 1 26.7289 183395.3 26.6513 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR -0.0063884099945426 1044.55004882813 523.2823 1044.55639648438 523.285461425781 2 15 1.1.1.3470.5 1 26.8906 158656.5 26.6754 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Deamidated(N)@8 -0.00301286997273564 1045.53723144531 523.7759 1045.54040527344 523.777465820313 2 15 1.1.1.3484.9 1 27.2346 19019.66 27.1936 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR -0.00406916020438075 1044.55224609375 523.2834 1044.55639648438 523.285461425781 2 9 1.1.1.3498.5 1 27.5711 738.4581 27.4368 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Deamidated(N)@8 -0.00325699988752604 1045.537109375 523.7758 1045.54040527344 523.777465820313 2 14 1.1.1.3505.10 1 27.7558 4557.629 27.7433 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR -0.00443535996600986 1044.55212402344 523.2833 1044.55639648438 523.285461425781 2 10 1.1.1.3443.2 1 26.2754 569.8367 26.2981 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Methyl(L)@1 -0.00716478982940316 1058.56481933594 530.2897 1058.57202148438 530.293273925781 2 10 1.1.1.3487.4 1 27.3032 478.6083 27.2666 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Delta:H(2)C(2)@N-term -0.00235247006639838 1070.56970214844 536.2921 1070.57202148438 536.293273925781 2 12 1.1.1.3577.7 1 29.3634 1378.671 29.3221 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Oxidation(P)@4 -0.00627662008628249 1060.54504394531 531.2798 1060.55126953125 531.282897949219 2 12 1.1.1.3466.6 1 26.7928 3158.348 26.7343 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Pro->pyro-Glu(P)@4; Deamidated(N)@8 0.00317817996256053 1059.52282714844 530.7687 1059.51965332031 530.76708984375 2 9 1.1.1.3504.8 1 27.7356 166.9279 27.7433 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Delta:H(2)C(2)@N-term -0.00479379016906023 1070.56726074219 536.2909 1070.57202148438 536.293273925781 2 9 1.1.1.3563.9 1 29.0195 1937.272 29.1016 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Oxidation(P)@4 -0.0118917003273964 1060.53942871094 531.277 1060.55126953125 531.282897949219 2 10 1.1.1.3457.9 1 26.6115 3153.997 26.6513 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Delta:H(2)C(2)@N-term -0.00479379016906023 1070.56726074219 536.2909 1070.57202148438 536.293273925781 2 10 1.1.1.3570.7 1 29.1894 1937.272 29.1016 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR -0.0327546000480652 1044.52368164063 523.2691 1044.55639648438 523.285461425781 2 8 1.1.1.3546.2 1 28.6123 404.0252 28.7089 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.979998588562 LSSPATLNSR Dioxidation(P)@4 -0.00677888002246618 1076.53942871094 539.277 1076.54614257813 539.280395507813 2 12 1.1.1.3464.4 1 26.7464 4012.645 26.7824 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.1200008392334 LSSPATLNSR Dehydrated(S)@3 -0.00677290000021458 1026.5390625 514.2768 1026.54577636719 514.280151367188 2 10 1.1.1.3471.2 1 26.9214 247.2544 26.7343 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.1200008392334 LSSPATLNSR Oxidation(P)@4 -0.00615456001833081 1060.54504394531 531.2798 1060.55126953125 531.282897949219 2 9 1.1.1.3473.6 1 26.9621 3191.958 26.71 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.1200008392334 LSSPATLNSR -0.00406914995983243 1044.55224609375 523.2834 1044.55639648438 523.285461425781 2 9 1.1.1.3520.2 1 28.1021 434.8777 27.8925 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.5099973678589 LSSPATLNSR Pro->pyro-Glu(P)@4; Deamidated(N)@8 -0.00146031996700913 1059.51831054688 530.7664 1059.51965332031 530.76708984375 2 10 1.1.1.3480.3 1 27.1312 636.1525 27.1936 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 LSSPATLNSR Dioxidation(P)@4 -0.00738921016454697 1076.53881835938 539.2767 1076.54614257813 539.280395507813 2 11 1.1.1.3457.11 1 26.6149 4809.475 26.6513 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 LSSPATLNSR Dioxidation(P)@4 -0.00677888002246618 1076.53942871094 539.277 1076.54614257813 539.280395507813 2 11 1.1.1.3466.7 1 26.7945 4012.645 26.7824 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 LSSPATLNSR Oxidation(P)@4; Deamidated(N)@8 -0.00680741993710399 1061.52844238281 531.7715 1061.53527832031 531.77490234375 2 8 1.1.1.3481.7 1 27.159 455.2966 27.1692 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 LSSPATLNSR Acetyl@N-term -0.00566451996564865 1086.56127929688 544.2879 1086.56689453125 544.290771484375 2 7 1.1.1.3602.4 1 29.9715 278.5844 30.0051 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.32000207901 LSSPATLNSR Pro->pyro-Glu(P)@4 -0.00593425007537007 1058.52990722656 530.2722 1058.53564453125 530.275085449219 2 8 1.1.1.3473.5 1 26.9596 4313.528 26.71 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 57.7600002288818 LSSPATLNSR -0.0063884099945426 1044.55004882813 523.2823 1044.55639648438 523.285461425781 2 11 1.1.1.3477.8 1 27.0598 121710.7 26.8064 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 53.0499994754791 LSSPATLNSR Pro->pyro-Glu(P)@4 -0.00923002976924181 1058.52648925781 530.2705 1058.53564453125 530.275085449219 2 9 1.1.1.3457.8 1 26.6107 4628.66 26.6754 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 44.9099987745285 LSSPATLNSR Pro->pyro-Glu(P)@4 -0.00923002976924181 1058.52648925781 530.2705 1058.53564453125 530.275085449219 2 10 1.1.1.3466.5 1 26.7912 4624.093 26.6754 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.1800007820129 LSSPATLNSR -0.00480156019330025 1044.55163574219 523.2831 1044.55639648438 523.285461425781 2 8 1.1.1.3454.3 1 26.5382 183395.3 26.6513 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 38.9800012111664 LSSPATLNSR -0.00504569010809064 1044.55151367188 523.283 1044.55639648438 523.285461425781 2 5 1.1.1.3681.9 0 31.8617 111.6523 31.9213 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.4099997282028 LSSPATLNSR Formyl@N-term -0.0048824897967279 1072.54650878906 537.2805 1072.55126953125 537.282897949219 2 6 1.1.1.3503.5 1 27.7086 587.0438 27.794 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.3899993896484 LSSPATLNSR -0.00724287983030081 1044.54931640625 523.2819 1044.55639648438 523.285461425781 2 6 1.1.1.3584.11 1 29.5383 156.2349 29.4204 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.0699988603592 LSSPATLNSR -0.000163053002324887 1044.55627441406 523.2854 1044.55639648438 523.285461425781 2 6 1.1.1.3596.6 1 29.8256 128.45 29.7874 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.5499999523163 LSSPATLNSR -0.00760906981304288 1044.548828125 523.2817 1044.55639648438 523.285461425781 2 6 1.1.1.3561.9 1 28.9657 175.7461 28.9792 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.199999332428 LSSPATLNSR -0.00504569010809064 1044.55151367188 523.283 1044.55639648438 523.285461425781 2 6 1.1.1.3577.6 1 29.3609 168.7406 29.3221 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 57.6900005340576 SCAAAGTECLISGWGNTK Phospho(S)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@9 -0.0455288998782635 1961.75561523438 981.8851 1961.80126953125 981.907897949219 2 9 1.1.1.4378.13 1 49.2978 325.1779 49.3031 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.4100029468536 SHFCGGSLINSQWVVSAAHCYK Oxidation(H)@2; Carbamidomethyl(C)@4; Deamidated(N)@10; reduced HNE(H)@19; Carbamidomethyl(C)@20; acrolein addition +56(K)@22 cleaved G-S@N-term -0.00543694011867046 2738.27783203125 685.5767 2738.283203125 685.578063964844 4 11 1.1.1.4288.12 1 46.9365 748.3233 46.9434 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 SPATLNSR cleaved S-S@N-term -0.0080376798287034 844.432250976563 423.2234 844.440307617188 423.227416992188 2 5 1.1.1.3464.2 1 26.7397 293.8436 26.7343 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 59.7699999809265 SRVATVSLPRSCAAAGTECLISGWGNTK Dioxidation(R)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@19 cleaved N-S@N-term; missed R-V@2; missed R-S@10 -0.0282684005796909 2980.42114257813 994.481 2980.44946289063 994.490417480469 3 10 1.1.1.4213.21 1 45.0234 1757.621 44.954 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.00260346010327339 2229.20654296875 744.0761 2229.20385742188 744.075256347656 3 21 1.1.1.4500.2 1 52.4402 646.6755 52.4086 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.000223213006393053 2229.2041015625 744.0753 2229.20385742188 744.075256347656 3 18 1.1.1.4478.13 1 51.8762 12407.38 51.7036 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7999985218048 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.00113869004417211 2229.205078125 744.0756 2229.20385742188 744.075256347656 3 14 1.1.1.4485.13 1 52.0606 8005.401 51.7824 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 TLDNDIMLIKLSSPATLNSR cleaved N-T@N-term; missed K-L@10 -0.00410499004647136 2201.16845703125 734.7301 2201.17260742188 734.7314453125 3 12 1.1.1.4461.17 1 51.4316 1487.873 51.4138 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 TLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@7; acrolein addition +76(K)@10 cleaved N-T@N-term; missed K-L@10 -0.00757479993626475 2229.19287109375 744.0716 2229.20043945313 744.074096679688 3 11 1.1.1.4492.15 1 52.2475 2590.443 51.9673 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.9100003242493 TLDNDIMLIKLSSPATLNSR Methyl(K)@10 cleaved N-T@N-term; missed K-L@10 -0.00267249997705221 2215.18579101563 739.4025 2215.18823242188 739.4033203125 3 10 1.1.1.4467.10 1 51.5837 866.0797 51.5981 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR -0.00401816982775927 841.498046875 421.7563 841.502136230469 421.758361816406 2 8 1.1.1.3726.5 1 32.9484 1032.975 32.8911 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR -0.0048115998506546 841.497497558594 421.756 841.502136230469 421.758361816406 2 8 1.1.1.3740.5 1 33.2904 1027.443 33.259 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR -0.0048115998506546 841.497497558594 421.756 841.502136230469 421.758361816406 2 8 1.1.1.3775.4 1 34.1857 681.8271 34.1003 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR -0.00420127017423511 841.498046875 421.7563 841.502136230469 421.758361816406 2 8 1.1.1.3859.3 1 36.3017 552.3932 36.317 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR -0.00420127017423511 841.498046875 421.7563 841.502136230469 421.758361816406 2 8 1.1.1.3866.3 1 36.4707 520.9351 36.4149 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR -0.00182097998913378 841.500244140625 421.7574 841.502136230469 421.758361816406 2 7 1.1.1.4168.4 1 43.8753 306.6262 43.9674 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR 7.66753000789322E-05 841.502258300781 421.7584 841.502136230469 421.758361816406 2 6 1.1.1.4309.2 1 47.4771 236.6465 47.445 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR -0.0048115998506546 841.497497558594 421.756 841.502136230469 421.758361816406 2 8 1.1.1.3761.2 1 33.8197 928.8314 33.634 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR 0.00281753996387124 841.505065917969 421.7598 841.502136230469 421.758361816406 2 9 1.1.1.3789.2 1 34.5414 649.1252 34.5835 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR -0.00200407998636365 841.500244140625 421.7574 841.502136230469 421.758361816406 2 7 1.1.1.3838.3 1 35.7745 515.8309 35.6699 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.0032402400393039 857.493896484375 429.7542 857.4970703125 429.755798339844 2 11 1.1.1.3629.4 1 30.5941 8055.979 30.4685 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.00562052987515926 857.491455078125 429.753 857.4970703125 429.755798339844 2 11 1.1.1.3636.3 1 30.764 6037.599 30.686 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(2)C(2)@N-term -0.00172315002419055 867.516052246094 434.7653 867.517822265625 434.766174316406 2 7 1.1.1.4110.3 1 42.3539 1451.364 42.2446 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 -0.00306346989236772 823.488464355469 412.7515 823.491577148438 412.753082275391 2 11 1.1.1.3625.3 1 30.4991 27404.95 30.4927 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR -0.00218718010000885 841.500061035156 421.7573 841.502136230469 421.758361816406 2 8 1.1.1.3845.3 1 35.9572 496.6656 36.0742 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR -0.00700879981741309 841.495300292969 421.7549 841.502136230469 421.758361816406 2 6 1.1.1.4104.3 1 42.199 314.2238 42.2446 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.0032402400393039 857.493896484375 429.7542 857.4970703125 429.755798339844 2 10 1.1.1.3622.5 1 30.4256 8055.979 30.4685 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR 0.000620350008830428 841.502868652344 421.7587 841.502136230469 421.758361816406 2 6 1.1.1.4273.2 1 46.5323 254.0029 46.5525 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.00745153008028865 857.489685058594 429.7521 857.4970703125 429.755798339844 2 10 1.1.1.3643.3 1 30.9329 6068.35 30.686 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Formyl@N-term 0.0101573001593351 869.507263183594 435.7609 869.4970703125 435.755798339844 2 7 1.1.1.4046.3 1 40.7069 671.0355 40.6769 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR -0.00200407998636365 841.500244140625 421.7574 841.502136230469 421.758361816406 2 9 1.1.1.3630.5 1 30.6208 662478.6 30.4685 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR -0.00438437005504966 841.497863769531 421.7562 841.502136230469 421.758361816406 2 8 1.1.1.3768.3 1 34.0051 825.2475 33.944 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.989999294281 VATVSLPR -0.00261440989561379 841.499450683594 421.757 841.502136230469 421.758361816406 2 8 1.1.1.3705.6 1 32.4424 2596.999 32.2628 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.989999294281 VATVSLPR -0.00761912995949388 841.494445800781 421.7545 841.502136230469 421.758361816406 2 7 1.1.1.4012.3 1 39.8655 370.7557 39.9088 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.2100009918213 VATVSLPR -0.00420127017423511 841.498046875 421.7563 841.502136230469 421.758361816406 2 5 1.1.1.4203.3 1 44.7525 230.5847 44.7728 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.979998588562 VATVSLPR Dehydrated(T)@3 -0.00306346989236772 823.488464355469 412.7515 823.491577148438 412.753082275391 2 10 1.1.1.3632.2 1 30.6674 27404.95 30.4927 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.979998588562 VATVSLPR Delta:H(4)C(2)@N-term -0.0018149099778384 869.531677246094 435.7731 869.533447265625 435.774017333984 2 12 1.1.1.3688.6 1 32.0275 687044.1 32.0936 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.979998588562 VATVSLPR Delta:H(4)C(2)@N-term 0.000199186004465446 869.53369140625 435.7741 869.533447265625 435.774017333984 2 12 1.1.1.3702.2 1 32.3633 523129.5 32.2145 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.979998588562 VATVSLPR Delta:H(4)C(2)@N-term -0.00504965987056494 869.528503417969 435.7715 869.533447265625 435.774017333984 2 9 1.1.1.3723.4 1 32.8766 7986.148 32.7463 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.979998588562 VATVSLPR Delta:H(4)C(2)@N-term -0.00462243007495999 869.528869628906 435.7717 869.533447265625 435.774017333984 2 7 1.1.1.3765.5 1 33.9253 1775.912 33.8659 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.1200008392334 VATVSLPR Pro->pyro-Glu(P)@7 -0.00455272011458874 855.476867675781 428.7457 855.4814453125 428.747985839844 2 9 1.1.1.3621.2 1 30.4023 14475.16 30.4685 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.960001707077 VATVSLPR -0.00121064996346831 841.501098632813 421.7578 841.502136230469 421.758361816406 2 8 1.1.1.3967.2 1 38.7956 443.7957 38.7646 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.960001707077 VATVSLPR -0.00499470019713044 841.497253417969 421.7559 841.502136230469 421.758361816406 2 6 1.1.1.4147.3 1 43.3171 264.8424 43.1793 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.9299976825714 VATVSLPR Deamidated(R)@8 0.0113233998417854 842.497497558594 422.256 842.486145019531 422.250366210938 2 8 1.1.1.3700.2 1 32.3176 1260.708 32.287 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 73.8600015640259 VATVSLPR Delta:H(2)C(2)@N-term -0.00172315002419055 867.516052246094 434.7653 867.517822265625 434.766174316406 2 7 1.1.1.4103.2 1 42.1722 1451.364 42.2446 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 71.3800013065338 VATVSLPR Delta:H(2)C(2)@N-term -0.000929714005906135 867.516845703125 434.7657 867.517822265625 434.766174316406 2 11 1.1.1.3865.3 1 36.4508 12925.36 36.4149 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 VATVSLPR Pro->pyro-Glu(P)@7 -0.00455272011458874 855.476867675781 428.7457 855.4814453125 428.747985839844 2 11 1.1.1.3628.2 1 30.5708 14475.16 30.4685 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 VATVSLPR Dehydrated(T)@3 -0.00306346989236772 823.488464355469 412.7515 823.491577148438 412.753082275391 2 10 1.1.1.3639.3 1 30.8439 20969.74 30.5894 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 VATVSLPR Dehydrated(T)@3 -0.00342966988682747 823.488098144531 412.7513 823.491577148438 412.753082275391 2 7 1.1.1.3646.2 1 31.0053 15336.89 30.7585 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 VATVSLPR Deamidated(R)@8 0.0143750002607703 842.50048828125 422.2575 842.486145019531 422.250366210938 2 7 1.1.1.3672.3 1 31.6333 4219.068 31.3859 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 VATVSLPR Delta:H(4)C(2)@N-term -0.0018149099778384 869.531677246094 435.7731 869.533447265625 435.774017333984 2 11 1.1.1.3695.2 1 32.1934 687044.1 32.0936 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 -0.00446368008852005 885.523864746094 443.7692 885.528381347656 443.771453857422 2 10 1.1.1.3695.4 1 32.195 12006.73 32.1178 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 VATVSLPR Pro->pyro-Glu(P)@7 0.0302971992641687 855.511657714844 428.7631 855.4814453125 428.747985839844 2 9 1.1.1.3698.4 1 32.275 2388.15 32.0209 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 VATVSLPR Delta:H(2)C(2)@N-term 0.0168919991701841 867.53466796875 434.7746 867.517822265625 434.766174316406 2 9 1.1.1.3883.2 1 36.8258 2258.95 37.0407 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 VATVSLPR Delta:H(2)C(2)@N-term -0.000502481998410076 867.517272949219 434.7659 867.517822265625 434.766174316406 2 10 1.1.1.3901.3 1 37.2401 5432.882 37.2338 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8700020313263 VATVSLPR Delta:H(4)C(2)@N-term -0.00462243007495999 869.528869628906 435.7717 869.533447265625 435.774017333984 2 6 1.1.1.4032.4 1 40.3598 298.0767 40.2794 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 61.0899984836578 VATVSLPR Pro->pyro-Glu(P)@7 -0.00455272011458874 855.476867675781 428.7457 855.4814453125 428.747985839844 2 10 1.1.1.3635.5 1 30.7465 13588.08 30.4927 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 61.0899984836578 VATVSLPR Pro->pyro-Glu(P)@7 -0.00473581999540329 855.476684570313 428.7456 855.4814453125 428.747985839844 2 10 1.1.1.3642.3 1 30.9122 10473.09 30.6619 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 61.0899984836578 VATVSLPR Dehydrated(T)@3 -0.00288038002327085 823.488647460938 412.7516 823.491577148438 412.753082275391 2 5 1.1.1.3653.2 1 31.1732 4673.743 30.9274 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 61.0899984836578 VATVSLPR Delta:H(4)C(2)@N-term -0.00504965987056494 869.528503417969 435.7715 869.533447265625 435.774017333984 2 9 1.1.1.3716.3 1 32.7044 7986.148 32.7463 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 61.0899984836578 VATVSLPR Formyl@N-term 0.031580001115799 869.528686523438 435.7716 869.4970703125 435.755798339844 2 6 1.1.1.3751.4 1 33.5666 1704.265 33.5584 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 57.7600002288818 VATVSLPR -0.00462849996984005 841.497497558594 421.756 841.502136230469 421.758361816406 2 6 1.1.1.3824.2 1 35.4175 593.29 35.4386 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 53.0499994754791 VATVSLPR Amidated@C-term -0.00373522005975246 840.514465332031 421.2645 840.518127441406 421.266357421875 2 5 1.1.1.3579.4 1 29.4035 571.0063 29.4699 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 53.0499994754791 VATVSLPR Pro->pyro-Glu(P)@7 -0.00510202022269368 855.476257324219 428.7454 855.4814453125 428.747985839844 2 7 1.1.1.3640.3 1 30.8639 11295.67 30.6135 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 53.0499994754791 VATVSLPR Delta:H(4)C(2)@N-term -0.0018149099778384 869.531677246094 435.7731 869.533447265625 435.774017333984 2 10 1.1.1.3709.2 1 32.5351 452122.1 32.287 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 53.0499994754791 VATVSLPR Formyl@N-term 0.031580001115799 869.528686523438 435.7716 869.4970703125 435.755798339844 2 6 1.1.1.3730.5 1 33.0423 2496.3 33.234 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 47.6300001144409 VATVSLPR Deamidated(R)@8 0.0143750002607703 842.50048828125 422.2575 842.486145019531 422.250366210938 2 6 1.1.1.3655.3 1 31.2224 6201.364 31.2409 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.1800007820129 VATVSLPR -0.00298060989007354 841.499267578125 421.7569 841.502136230469 421.758361816406 2 8 1.1.1.3712.4 1 32.6111 2217.404 32.3595 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.1800007820129 VATVSLPR -0.00700879981741309 841.495300292969 421.7549 841.502136230469 421.758361816406 2 6 1.1.1.3803.2 1 34.8813 691.4153 34.6807 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.1800007820129 VATVSLPR -0.00499470019713044 841.497253417969 421.7559 841.502136230469 421.758361816406 2 6 1.1.1.3810.2 1 35.0573 582.7912 35.1039 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.1800007820129 VATVSLPR -0.00200407998636365 841.500244140625 421.7574 841.502136230469 421.758361816406 2 7 1.1.1.4003.4 1 39.6464 306.7536 39.6333 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.1800007820129 VATVSLPR -0.00243131001479924 841.499694824219 421.7571 841.502136230469 421.758361816406 2 5 1.1.1.4196.6 1 44.5711 250.8313 44.5889 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 38.5199993848801 VATVSLPR 0.00404379982501268 841.506286621094 421.7604 841.502136230469 421.758361816406 2 4 1.1.1.4766.2 1 59.2147 154.2988 59.2358 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 35.3700011968613 VATVSLPR 0.0138699999079108 841.516052246094 421.7653 841.502136230469 421.758361816406 2 4 1.1.1.4423.2 1 50.4288 269.523 50.3187 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.6400002241135 VATVSLPR -0.00438437005504966 841.497863769531 421.7562 841.502136230469 421.758361816406 2 6 1.1.1.3831.4 1 35.5999 578.5908 35.3879 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.6199988126755 VATVSLPR -0.00499470019713044 841.497253417969 421.7559 841.502136230469 421.758361816406 2 7 1.1.1.3817.4 1 35.2418 548.6051 35.2587 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.6199988126755 VATVSLPR 0.00281753996387124 841.505065917969 421.7598 841.502136230469 421.758361816406 2 6 1.1.1.3989.3 1 39.2909 340.921 39.2376 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.4999997615814 VATVSLPR -0.0048115998506546 841.497497558594 421.756 841.502136230469 421.758361816406 2 7 1.1.1.3754.4 1 33.6426 928.8314 33.634 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.3899993896484 VATVSLPR -0.0048115998506546 841.497497558594 421.756 841.502136230469 421.758361816406 2 8 1.1.1.3747.6 1 33.4697 929.1552 33.4584 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.3899993896484 VATVSLPR -0.00102754996623844 841.501098632813 421.7578 841.502136230469 421.758361816406 2 8 1.1.1.3921.2 1 37.7214 434.0222 37.6919 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.3899993896484 VATVSLPR 0.00336684007197618 841.505493164063 421.76 841.502136230469 421.758361816406 2 8 1.1.1.3928.2 1 37.8914 484.777 37.9859 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.3899993896484 VATVSLPR -0.00157683994621038 841.500671386719 421.7576 841.502136230469 421.758361816406 2 6 1.1.1.4295.2 1 47.1101 230.5156 47.1036 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 30.7599991559982 VATVSLPR -0.00462849996984005 841.497497558594 421.756 841.502136230469 421.758361816406 2 8 1.1.1.3719.3 1 32.7794 1221.246 32.7463 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 30.5599987506866 VATVSLPR -0.00279751000925899 841.499450683594 421.757 841.502136230469 421.758361816406 2 7 1.1.1.3733.6 1 33.1177 1043.944 33.1099 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 30.1800012588501 VATVSLPR -0.00737500004470348 841.494873046875 421.7547 841.502136230469 421.758361816406 2 6 1.1.1.3498.3 1 27.5678 304.6024 27.6384 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.4299989938736 VATVSLPR -0.00401816982775927 841.498046875 421.7563 841.502136230469 421.758361816406 2 7 1.1.1.3980.2 1 39.0725 441.2084 39.1153 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.0699988603592 VATVSLPR -0.0048115998506546 841.497497558594 421.756 841.502136230469 421.758361816406 2 6 1.1.1.4040.3 1 40.5563 357.3999 40.4771 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.889998793602 VATVSLPR -0.00218718010000885 841.500061035156 421.7573 841.502136230469 421.758361816406 2 8 1.1.1.3683.4 1 31.9044 6659.934 31.7494 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.0400007963181 VATVSLPR -0.00462849996984005 841.497497558594 421.756 841.502136230469 421.758361816406 2 4 1.1.1.4264.2 1 46.304 256.2754 46.2996 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.7099996805191 VATVSLPR -0.00218718010000885 841.500061035156 421.7573 841.502136230469 421.758361816406 2 8 1.1.1.3637.4 1 30.7915 565729.8 30.541 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 26.7699986696243 VATVSLPR -0.00499470019713044 841.497253417969 421.7559 841.502136230469 421.758361816406 2 8 1.1.1.3669.3 1 31.5605 17466.77 31.3134 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 24.4000002741814 VATVSLPR -0.00700879981741309 841.495300292969 421.7549 841.502136230469 421.758361816406 2 6 1.1.1.3796.3 1 34.7092 691.4153 34.6807 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.7900003790855 VATVSLPR -0.00200407998636365 841.500244140625 421.7574 841.502136230469 421.758361816406 2 10 1.1.1.3641.2 1 30.8847 499504.3 30.6376 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.4400004148483 VATVSLPR 0.0030672699213028 841.505249023438 421.7599 841.502136230469 421.758361816406 2 4 1.1.1.4440.2 1 50.8772 192.7799 50.9251 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.199999332428 VATVSLPR -0.00401816982775927 841.498046875 421.7563 841.502136230469 421.758361816406 2 4 1.1.1.4250.4 1 45.941 251.8391 45.9343 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.7500006556511 VATVSLPR -0.00243131001479924 841.499694824219 421.7571 841.502136230469 421.758361816406 2 4 1.1.1.4154.3 1 43.5021 282.3357 43.6513 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.6400002837181 VATVSLPR -0.00200407998636365 841.500244140625 421.7574 841.502136230469 421.758361816406 2 8 1.1.1.3620.3 1 30.3791 662478.6 30.4685 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.5299999117851 VATVSLPR -0.00200407998636365 841.500244140625 421.7574 841.502136230469 421.758361816406 2 8 1.1.1.3623.4 1 30.4532 662478.6 30.4685 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.2100004553795 VATVSLPR -0.00438437005504966 841.497863769531 421.7562 841.502136230469 421.758361816406 2 5 1.1.1.4060.2 1 41.0633 321.79 41.0052 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 21.4100003242493 VATVSLPR -0.00200407998636365 841.500244140625 421.7574 841.502136230469 421.758361816406 2 10 1.1.1.3627.3 1 30.5474 662478.6 30.4685 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 21.2400004267693 VATVSLPR 0.000687001971527934 841.502868652344 421.7587 841.502136230469 421.758361816406 2 5 1.1.1.4485.4 1 52.0531 158.547 52.0462 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 20.3999996185303 VATVSLPR -0.00279751000925899 841.499450683594 421.757 841.502136230469 421.758361816406 2 4 1.1.1.4257.4 1 46.125 229.9739 46.1445 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 20.0599998235703 VATVSLPR -0.0048115998506546 841.497497558594 421.756 841.502136230469 421.758361816406 2 5 1.1.1.4287.3 1 46.8993 227.0378 46.8645 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.8100000619888 VATVSLPR -0.00542192999273539 841.496704101563 421.7556 841.502136230469 421.758361816406 2 5 1.1.1.4212.3 1 44.9859 286.0353 45.0286 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.2900002002716 VATVSLPR -0.00834583025425673 841.493896484375 421.7542 841.502136230469 421.758361816406 2 5 1.1.1.4330.3 0 48.0339 421.2508 48.0542 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.2900002002716 VATVSLPR 0.00544755021110177 841.507690429688 421.7611 841.502136230469 421.758361816406 2 4 1.1.1.4458.2 1 51.3409 169.4466 51.3105 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.2900002002716 VATVSLPR 0.00886537041515112 841.511047363281 421.7628 841.502136230469 421.758361816406 2 4 1.1.1.4723.2 1 58.1237 194.1389 58.1709 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.5900002717972 VATVSLPR -0.00218718010000885 841.500061035156 421.7573 841.502136230469 421.758361816406 2 8 1.1.1.3676.4 1 31.7325 6659.934 31.7494 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.5599997639656 VATVSLPR -0.00212049996480346 841.500061035156 421.7573 841.502136230469 421.758361816406 2 4 1.1.1.4302.3 1 47.2937 221.597 47.2881 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.4499993920326 VATVSLPR -0.0048115998506546 841.497497558594 421.756 841.502136230469 421.758361816406 2 9 1.1.1.3662.3 1 31.3931 27342.18 31.1444 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.9899994730949 VATVSLPR -0.00737500004470348 841.494873046875 421.7547 841.502136230469 421.758361816406 2 4 1.1.1.3505.4 1 27.75 304.6024 27.6384 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.3600007295609 VATVSLPR -0.0051111001521349 841.4970703125 421.7558 841.502136230469 421.758361816406 2 4 1.1.1.4316.2 1 47.6641 237.9965 47.6589 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.3600007295609 VATVSLPR -0.00834583025425673 841.493896484375 421.7542 841.502136230469 421.758361816406 2 4 1.1.1.4323.3 1 47.8496 415.9405 48.0542 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.3600007295609 VATVSLPR 0.00367760006338358 841.505859375 421.7602 841.502136230469 421.758361816406 2 4 1.1.1.4581.6 1 54.4828 201.9934 54.5522 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.0000005960464 VATVSLPR -0.00401816982775927 841.498046875 421.7563 841.502136230469 421.758361816406 2 9 1.1.1.3648.2 1 31.0526 327823.8 30.8068 4 39.49 39.49 72.2000002861023 59.1899991035461 41.2600010633469 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VLEGNEQFINAAK cleaved D-V@N-term -0.0035810200497508 1431.73229980469 716.8734 1431.73583984375 716.875183105469 2 9 1.1.1.3803.14 0 34.8955 399.4935 34.9776 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 ALEESNYELEGK 0.00146568997297436 1380.64233398438 691.3284 1380.64086914063 691.327697753906 2 12 1.1.1.3607.9 1 30.0967 1244.84 30.1983 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 DAEAWFNEK -0.000320869992719963 1108.48229980469 555.2484 1108.48254394531 555.24853515625 2 13 1.1.1.3950.9 1 38.3928 1069.869 38.4006 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 GSLGGGFSSGGFSGGSFSR 0.00127340003382415 1706.76611328125 854.3903 1706.76489257813 854.389709472656 2 31 1.1.1.4074.10 1 41.4295 3872.896 41.3896 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 LENEIQTYR -0.00143246003426611 1164.57604980469 583.2953 1164.57751464844 583.296020507813 2 14 1.1.1.3551.9 1 28.7282 637.2126 28.7335 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 NVQALEIELQSQLALK -0.00704158004373312 1795.99731445313 899.0059 1796.00439453125 899.009460449219 2 14 1.1.1.4605.9 1 55.1108 201.7413 55.0944 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 NVSTGDVNVEMNAAPGVDLTQLLNNMR Oxidation(M)@11 -0.00541866989806294 2887.375 963.4656 2887.38037109375 963.467407226563 3 18 1.1.1.4707.18 1 57.7375 442.0234 57.7689 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 QSVEADINGLR -0.00171533995307982 1200.60803222656 601.3113 1200.60986328125 601.312194824219 2 9 1.1.1.3818.11 1 35.2778 458.4683 35.3624 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 QSVEADINGLRR Gln->pyro-Glu@N-term missed R-R@11 0.00534013984724879 1339.68981933594 670.8522 1339.68444824219 670.849487304688 2 11 1.1.1.3961.5 1 38.662 811.3347 38.6672 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 SLLEGEGSSGGGGR -0.00346664991229773 1261.58642578125 631.8005 1261.58984375 631.802185058594 2 14 1.1.1.3458.19 1 26.6444 1996.26 26.6754 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 SQYEQLAEQNR -0.00724809989333153 1364.62487792969 683.3197 1364.63208007813 683.323303222656 2 15 1.1.1.3470.7 1 26.8973 650.8118 26.9508 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 SQYEQLAEQNRK missed R-K@11 0.00239685992710292 1492.72924804688 498.5837 1492.72705078125 498.582946777344 3 12 1.1.1.3384.4 1 24.8377 3194.209 24.8848 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 SSSKGSLGGGFSSGGFSGGSFSR cleaved I-S@N-term; missed K-G@4 -0.00259737996384501 2095.95336914063 699.6584 2095.95581054688 699.659240722656 3 19 1.1.1.3905.5 1 37.3492 1493.554 37.2578 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 VLDELTLTK -0.000745358993299305 1030.59033203125 516.3024 1030.59106445313 516.302795410156 2 12 1.1.1.3953.4 1 38.4612 2639.019 38.5217 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 2 99.0000009536743 YENEVALR 0.0059095099568367 992.498657226563 497.2566 992.492736816406 497.253631591797 2 7 1.1.1.3502.7 1 27.6808 606.5783 27.7433 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0.651695132255554 92.849999666214 LAADDFR -0.00481978012248874 806.387451171875 404.201 806.392272949219 404.203399658203 2 6 1.1.1.3551.2 0 28.7132 1128.479 28.6301 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0.35852587223053 82.7000021934509 TIDDLKNQILNLTTDNANILLQIDNAR missed K-N@6 0.0892686992883682 3051.71020507813 1018.244 3051.6201171875 1018.21392822266 3 10 1.1.1.4919.21 1 63.1571 526.3662 63.24 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0.0362121723592281 24.4699999690056 LAADDFRLKYENEVALR missed R-L@7; missed K-Y@9 0.0168453995138407 2022.0703125 675.0307 2022.05346679688 675.025085449219 3 9 1.1.1.4079.14 1 41.5598 525.086 41.5924 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0.00921730790287256 26.8400013446808 VTMQNLNDR Oxidation(M)@3 -0.00551733002066612 1105.51306152344 553.7638 1105.5185546875 553.7666015625 2 7 1.1.1.3455.7 0 26.5672 222.6923 26.6008 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 99.0000009536743 ALEESNYELEGK 0.00146568997297436 1380.64233398438 691.3284 1380.64086914063 691.327697753906 2 16 1.1.1.3614.4 1 30.2611 1244.84 30.1983 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 99.0000009536743 GSLGGGFSSGGFSGGSFSR 0.00127340003382415 1706.76611328125 854.3903 1706.76489257813 854.389709472656 2 9 1.1.1.4067.8 1 41.2539 3872.896 41.3896 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 99.0000009536743 GSLGGGFSSGGFSGGSFSR 0.00127340003382415 1706.76611328125 854.3903 1706.76489257813 854.389709472656 2 9 1.1.1.4082.17 1 41.6361 4075.853 41.3646 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 43.1800007820129 LAADDFR -0.00481978012248874 806.387451171875 404.201 806.392272949219 404.203399658203 2 7 1.1.1.3543.2 0 28.5397 1128.751 28.6301 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 25.8100003004074 LASYLDK -0.00583091983571649 808.42724609375 405.2209 808.433044433594 405.223815917969 2 5 1.1.1.3501.3 0 27.646 401.4988 27.5358 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 23.7900003790855 LASYLDK -0.00583091983571649 808.42724609375 405.2209 808.433044433594 405.223815917969 2 5 1.1.1.3494.2 0 27.4676 401.4988 27.5358 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 99.0000009536743 NVSTGDVNVEMNAAPGVDLTQLLNNMR 0.0682047009468079 2871.45361328125 958.1585 2871.38549804688 958.135803222656 3 17 1.1.1.4805.21 1 60.2159 772.8267 60.2733 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 99.0000009536743 NVSTGDVNVEMNAAPGVDLTQLLNNMR Oxidation(M)@11; Oxidation(M)@26 0.0177324004471302 2903.39282226563 968.8049 2903.37524414063 968.799072265625 3 18 1.1.1.4453.13 1 51.2263 1065.695 51.2848 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 15.6599998474121 QSVEADINGLRR missed R-R@11 0.00187194999307394 1356.712890625 453.2449 1356.7109375 453.244262695313 3 9 1.1.1.3691.8 1 32.1042 2703.13 32.1178 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 43.1800007820129 SQYEQLAEQNRK missed R-K@11 -0.000898925005458295 1492.72595214844 498.5826 1492.72705078125 498.582946777344 3 11 1.1.1.3359.2 1 24.4261 175.6368 24.4313 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 99.0000009536743 SSSKGSLGGGFSSGGFSGGSFSR cleaved I-S@N-term; missed K-G@4 -0.00259737996384501 2095.95336914063 699.6584 2095.95581054688 699.659240722656 3 27 1.1.1.3898.4 1 37.1802 1493.554 37.2578 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 99.0000009536743 VLDELTLTK -0.000745358993299305 1030.59033203125 516.3024 1030.59106445313 516.302795410156 2 10 1.1.1.3960.3 1 38.6294 2639.019 38.5217 5 29.07 29.11 72.6000010967255 29.6499997377396 24.1999998688698 cont|000136 cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)] 0 61.0899984836578 VLDELTLTK Didehydro(T)@8 0.00777454022318125 1028.58312988281 515.2988 1028.57531738281 515.294982910156 2 7 1.1.1.4006.10 0 39.7202 901.8159 39.7844 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 AQYEEIAQR -0.00537326978519559 1106.5302734375 554.2724 1106.53564453125 554.275085449219 2 13 1.1.1.3436.3 0 26.1158 509.6634 26.1458 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 GFSSGSAVVSGGSR 0.000832833989989012 1253.60083007813 627.8077 1253.59997558594 627.807312011719 2 18 1.1.1.3474.9 1 26.9938 1350.406 27.0231 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 HGGGGGGFGGGGFGSR -0.0029309201054275 1319.57263183594 440.8648 1319.57556152344 440.865783691406 3 15 1.1.1.3452.2 1 26.4797 1716.146 26.5236 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 LALDVEIATYR -0.000240412002312951 1262.68688964844 632.3507 1262.68701171875 632.350830078125 2 6 1.1.1.4282.7 0 46.7684 290.4982 46.8907 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 NLDLDSIIAEVK -0.00297190994024277 1328.7158203125 665.3652 1328.71875 665.366638183594 2 18 1.1.1.4624.12 0 55.5904 1327.877 55.6032 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 NVQDAIADAEQR -0.00886769965291023 1328.623046875 665.3188 1328.63208007813 665.323303222656 2 16 1.1.1.3729.4 1 33.0313 256.7732 33.0122 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 SISISVAGGGGGFGAAGGFGGR -0.00126430997624993 1837.90588378906 919.9602 1837.90710449219 919.960815429688 2 18 1.1.1.4233.7 1 45.516 363.5574 45.5486 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 YLDGLTAER -0.00405118986964226 1036.51489257813 519.2647 1036.51892089844 519.266723632813 2 8 1.1.1.3740.9 1 33.2938 2851.923 33.234 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0.809668362140656 95.8299994468689 RSTSSFSCLSR Carbamidomethyl(C)@8 missed R-S@1 -0.00485122017562389 1286.59899902344 429.8736 1286.60375976563 429.875183105469 3 8 1.1.1.3450.2 1 26.4288 175.0903 26.4215 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0.209714829921722 72.350001335144 GFSSGSAVVSGGSRR missed R-R@14 -0.0013895999873057 1409.69970703125 470.9072 1409.701171875 470.907653808594 3 8 1.1.1.3392.5 1 25.0294 759.8143 25.0678 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0.0443122498691082 99.0000009536743 NKLNDLEEALQQAK missed K-L@2 -0.00122702005319297 1612.84094238281 538.6209 1612.84204101563 538.621276855469 3 11 1.1.1.4166.7 0 43.8211 315.7433 43.8095 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0.0227337870746851 98.6199975013733 SLVGLGGTKSISISVAGGGGGFGAAGGFGGR missed K-S@9 -1.02955996990204 2649.35327148438 884.125 2650.3828125 884.468200683594 3 12 1.1.1.4383.16 1 49.4258 345.4737 49.4352 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0.0150228748098016 86.8099987506866 SSTISSNVASKA cleaved T-S@N-term; cleaved A-A@C-term; missed K-A@11 -0.00467594992369413 1150.57824707031 576.2964 1150.5830078125 576.298767089844 2 7 1.1.1.3390.3 1 24.9727 169.08 24.9896 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 62.3399972915649 DNSRNLDLDSIIAEVK cleaved M-D@N-term; missed R-N@4 -0.0151819996535778 1800.90637207031 601.3094 1800.92175292969 601.314514160156 3 7 1.1.1.4459.9 0 51.3743 108.3382 51.3879 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 99.0000009536743 FLEQQNQVLQTK -0.00371309998445213 1474.77429199219 738.3944 1474.77795410156 738.396301269531 2 8 1.1.1.3732.16 0 33.103 200.4092 33.0122 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 69.5299983024597 FLEQQNQVLQTKWELLQQMNVGTR Deamidated(N)@20 cleaved R-P@C-term; missed K-W@12 0.024065600708127 2931.51538085938 978.1791 2931.4912109375 978.171020507813 3 10 1.1.1.4455.18 0 51.2771 1580.633 51.1566 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 18.5000002384186 FLEQQNQVLQTKWELLQQMNVGTR Deamidated(N)@20 cleaved R-P@C-term; missed K-W@12 0.0334858000278473 2931.52490234375 733.8885 2931.4912109375 733.880065917969 4 10 1.1.1.4450.10 0 51.1463 1225.128 51.1818 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 96.7299997806549 GGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGR Hex(R)@3 cleaved F-G@N-term; missed R-G@3 -0.0163336005061865 2830.19165039063 944.4045 2830.2080078125 944.409912109375 3 15 1.1.1.4385.10 1 49.483 1525.418 49.3293 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 83.9100003242493 GGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGR Hex(S)@12 cleaved F-G@N-term; missed R-G@3 -0.0163336005061865 2830.19165039063 944.4045 2830.2080078125 944.409912109375 3 11 1.1.1.4376.19 1 49.2437 1525.418 49.3293 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 99.0000009536743 IEISELNR -0.00631726020947099 972.517700195313 487.2661 972.523986816406 487.269287109375 2 11 1.1.1.3728.6 0 33.0036 2640.597 32.9879 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 98.989999294281 IEISELNR -0.00631726020947099 972.517700195313 487.2661 972.523986816406 487.269287109375 2 9 1.1.1.3721.4 0 32.8334 2640.597 32.9879 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 57.7600002288818 IEISELNR -0.00631726020947099 972.517700195313 487.2661 972.523986816406 487.269287109375 2 6 1.1.1.3735.4 0 33.1672 2640.597 32.9879 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 99.0000009536743 IEISELNRVIQR missed R-V@8 -0.00429499009624124 1468.83178710938 490.6179 1468.83618164063 490.619323730469 3 8 1.1.1.4097.10 0 42.0228 1920.315 42.1151 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 99.0000009536743 LALDVEIATYR -0.000240412002312951 1262.68688964844 632.3507 1262.68701171875 632.350830078125 2 11 1.1.1.4289.6 0 46.9565 290.4982 46.8907 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 99.0000009536743 SISISVAGGGGGFGAAGGFGGR 0.00308667006902397 1837.91015625 613.644 1837.90710449219 613.643005371094 3 13 1.1.1.4232.5 1 45.4838 905.7034 45.5486 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 21.9099998474121 SISISVAGGGGGFGAAGGFGGR 0.00326976994983852 1837.91015625 613.644 1837.90710449219 613.643005371094 3 8 1.1.1.4240.7 1 45.6879 883.8531 45.5735 6 17.1 25.08 76.6799986362457 34.5899999141693 30.1999986171722 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 99.0000009536743 YLDGLTAER -0.00405118986964226 1036.51489257813 519.2647 1036.51892089844 519.266723632813 2 7 1.1.1.3733.11 1 33.126 2851.923 33.234 7 16.33 16.33 70.660001039505 32.8099995851517 31.2299996614456 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 AATVGSLAGQPLQER -0.00570541014894843 1496.7890625 749.4018 1496.79467773438 749.404602050781 2 16 1.1.1.3770.9 1 34.069 464.5799 34.1003 7 16.33 16.33 70.660001039505 32.8099995851517 31.2299996614456 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 AKLEEQAQQIR missed K-L@2 0.000410845997976139 1312.71032714844 438.5774 1312.7099609375 438.577239990234 3 13 1.1.1.3386.2 1 24.8795 203.2286 24.9115 7 16.33 16.33 70.660001039505 32.8099995851517 31.2299996614456 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 AKLEEQAQQIRLQAEAFQAR missed K-L@2; missed R-L@11 0.00258048996329308 2327.2373046875 582.8166 2327.23461914063 582.81591796875 4 10 1.1.1.4055.6 1 40.9399 383.1995 40.9535 7 16.33 16.33 70.660001039505 32.8099995851517 31.2299996614456 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 LAVYQAGAR -0.0064679398201406 947.512451171875 474.7635 947.518859863281 474.766723632813 2 8 1.1.1.3477.6 1 27.0564 315.1444 27.0717 7 16.33 16.33 70.660001039505 32.8099995851517 31.2299996614456 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 LGADMEDVCGR Carbamidomethyl(C)@9 0.000571232987567782 1221.51245117188 611.7635 1221.51184082031 611.76318359375 2 12 1.1.1.3605.5 1 30.0416 253.5659 30.0293 7 16.33 16.33 70.660001039505 32.8099995851517 31.2299996614456 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 LSKELQAAQAR missed K-E@3 -0.00571815017610788 1213.67224121094 405.5647 1213.67785644531 405.566558837891 3 12 1.1.1.3214.2 1 22.9525 234.4816 22.976 7 16.33 16.33 70.660001039505 32.8099995851517 31.2299996614456 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 TRDRLDEVKEQVAEVR missed R-D@2; missed R-L@4; missed K-E@9 -0.00248190993443131 1942.02099609375 486.5125 1942.02319335938 486.513092041016 4 8 1.1.1.3670.6 1 31.5906 607.7211 31.6275 7 16.33 16.33 70.660001039505 32.8099995851517 31.2299996614456 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 VQAAVGTSAAPVPSDNH -0.00825127959251404 1619.78186035156 540.9346 1619.79040527344 540.937377929688 3 11 1.1.1.3509.4 1 27.856 307.412 27.868 7 16.33 16.33 70.660001039505 32.8099995851517 31.2299996614456 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.284832656383514 81.2300026416779 LAVYQAGAREGAER missed R-E@9 -0.00510434014722705 1489.75866699219 497.5935 1489.76379394531 497.595184326172 3 8 1.1.1.3450.3 1 26.433 112.2541 26.4215 7 16.33 16.33 70.660001039505 32.8099995851517 31.2299996614456 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.0241088643670082 21.170000731945 LGPLVEQGRVR missed R-V@9 -0.00546463020145893 1222.70910644531 408.577 1222.71459960938 408.578796386719 3 9 1.1.1.3572.2 1 29.2317 1260.693 29.2732 7 16.33 16.33 70.660001039505 32.8099995851517 31.2299996614456 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.0222763959318399 19.8500007390976 LQAEAFQAR -0.00509006017819047 1032.53002929688 517.2723 1032.53527832031 517.27490234375 2 6 1.1.1.3556.14 1 28.8461 530.5087 28.7826 7 16.33 16.33 70.660001039505 32.8099995851517 31.2299996614456 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0 99.0000009536743 LGADMEDVCGR Oxidation(M)@5; Carbamidomethyl(C)@9 -0.00533510977402329 1237.50146484375 619.758 1237.50671386719 619.760620117188 2 15 1.1.1.3374.3 1 24.6783 276.7823 24.7023 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 2 99.0000009536743 AARLEALKENGGAR Deamidated(N)@10 cleaved L-A@N-term; missed R-L@3; missed K-E@8 0.000915921002160758 1455.78039550781 486.2674 1455.77941894531 486.267059326172 3 10 1.1.1.3551.6 1 28.7207 234.1813 28.7335 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 2 99.0000009536743 AHVDALRTHLAPYSDELR missed R-T@7 0.00480934977531433 2063.05981445313 516.7722 2063.05493164063 516.77099609375 4 10 1.1.1.3805.10 1 34.9423 234.8288 34.9525 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 2 99.0000009536743 AHVDALRTHLAPYSDELRQR missed R-T@7; missed R-Q@18 0.0036423800047487 2347.21801757813 470.4509 2347.21459960938 470.4501953125 5 19 1.1.1.3733.9 1 33.1227 7653.791 33.0608 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 2 99.0000009536743 ATEHLSTLSEK 0.00313703995198011 1214.61755371094 405.8798 1214.6142578125 405.878692626953 3 14 1.1.1.3322.2 1 23.9643 3163.579 24.0057 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 2 99.0000009536743 LAARLEALKENGGAR missed R-L@4; missed K-E@9 -0.00402370980009437 1567.87536621094 523.6324 1567.87939453125 523.633728027344 3 15 1.1.1.3512.9 1 27.9338 2836.745 27.868 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 2 99.0000009536743 LAEYHAKATEHLSTLSEK missed K-A@7 -0.00341994990594685 2027.02893066406 676.6836 2027.03234863281 676.684753417969 3 17 1.1.1.3479.6 1 27.1151 608.2986 27.1448 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 2 99.0000009536743 THLAPYSDELRQR missed R-Q@11 -0.00051425100537017 1584.80017089844 529.274 1584.80090332031 529.274230957031 3 14 1.1.1.3515.3 1 28.003 1265.374 28.0916 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 0.982966780662537 98.6500024795532 QKVEPLRAELQEGAR Gln->pyro-Glu@N-term missed K-V@2; missed R-A@7 -0.00673254998400807 1705.90441894531 569.6421 1705.9111328125 569.644348144531 3 9 1.1.1.3763.8 1 33.8816 601.1387 33.944 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 0.0438315682113171 34.5699995756149 LLDNWDSVTSTFSK -0.00749516999348998 1611.77062988281 806.8926 1611.77807617188 806.896301269531 2 6 1.1.1.4389.15 1 49.5842 239.0047 49.5418 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 0 21.9099998474121 AHVDALRTHLAPYSDELRQR missed R-T@7; missed R-Q@18 0.0108855003491044 2347.2255859375 783.4158 2347.21459960938 783.412109375 3 7 1.1.1.3734.10 1 33.1541 547.9496 33.0608 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 0 16.2900000810623 AHVDALRTHLAPYSDELRQR missed R-T@7; missed R-Q@18 -0.00203315005637705 2347.21264648438 587.8104 2347.21459960938 587.810913085938 4 10 1.1.1.3726.9 1 32.9584 4453.36 33.0365 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 0 99.0000009536743 LAARLEALKENGGAR Deamidated(N)@11 missed R-L@4; missed K-E@9 -0.00479841977357864 1568.8583984375 523.9601 1568.86340332031 523.961730957031 3 20 1.1.1.3550.5 1 28.7003 3049.285 28.7335 8 15.03 15.03 78.2800018787384 25.4700005054474 25.4700005054474 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 0 99.0000009536743 THLAPYSDELRQR missed R-Q@11 -0.000331151997670531 1584.80053710938 529.2741 1584.80090332031 529.274230957031 3 13 1.1.1.3526.2 1 28.2172 1274.791 28.0916 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 DALSSVQESQVAQQAR 0.00244789989665151 1715.84655761719 572.9561 1715.84387207031 572.955200195313 3 21 1.1.1.3704.5 1 32.4266 6009.113 32.3112 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 HATKTAKDALSSVQESQVAQQAR missed K-T@4; missed K-D@7 -0.00328479008749127 2453.25903320313 818.7603 2453.26220703125 818.761352539063 3 25 1.1.1.3518.3 1 28.0622 426.3241 28.0675 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term -0.00144313997589052 1937.83728027344 969.9259 1937.83862304688 969.926635742188 2 17 1.1.1.4161.15 1 43.6979 476.8205 43.6001 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12 cleaved A-S@N-term; missed K-H@17 0.00387706002220511 2359.08642578125 590.7789 2359.08251953125 590.777893066406 4 12 1.1.1.4105.7 1 42.2278 1520.831 42.2446 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.000311770010739565 2016.02319335938 673.015 2016.02355957031 673.01513671875 3 25 1.1.1.3611.7 1 30.1906 13523.06 30.1259 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 1.63827216625214 99.0000009536743 PEVRPTSAVAA cleaved D-P@N-term -0.00418537016957998 1096.58349609375 549.299 1096.58764648438 549.301086425781 2 8 1.1.1.3450.4 1 26.4372 223.5706 26.472 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.0433514192700386 90.3299987316132 SEAEDASLLSFMQGYMKHATKTAK cleaved A-S@N-term; missed K-H@17; missed K-T@21 0.0163141004741192 2643.28369140625 661.8282 2643.26733398438 661.824096679688 4 7 1.1.1.4485.8 1 52.0565 406.5976 52.0725 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR 0.00244789989665151 1715.84655761719 572.9561 1715.84387207031 572.955200195313 3 21 1.1.1.3697.6 1 32.2492 6009.113 32.3112 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Cation:Na(E)@8 0.0102779995650053 1737.83581542969 580.2859 1737.82580566406 580.282531738281 3 11 1.1.1.3701.5 1 32.3542 258.8826 32.3353 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 31.6199988126755 DALSSVQESQVAQQAR Deamidated(Q)@7 0.0179676003754139 1716.845703125 573.2892 1716.82788085938 573.283203125 3 11 1.1.1.3697.7 1 32.2508 2060.704 32.3353 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 HATKTAKDALSSVQESQVAQQAR missed K-T@4; missed K-D@7 0.00404299981892109 2453.2666015625 614.3239 2453.26220703125 614.322814941406 4 21 1.1.1.3518.2 1 28.0538 2701.752 28.0916 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 97.979998588562 PEVRPTSAVAA Dehydrated(T)@6 cleaved D-P@N-term 0.00337798008695245 1078.58044433594 540.2975 1078.5771484375 540.295837402344 2 9 1.1.1.3544.3 1 28.5764 160.3 28.5816 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term -0.00144313997589052 1937.83728027344 969.9259 1937.83862304688 969.926635742188 2 18 1.1.1.4160.11 1 43.6719 476.8205 43.6001 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term 0.00238823005929589 1937.84106445313 646.9543 1937.83862304688 646.953491210938 3 16 1.1.1.4162.6 1 43.7243 981.3293 43.6001 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@12 cleaved A-S@N-term 0.00544086983427405 1921.84924316406 961.9319 1921.84375 961.929138183594 2 17 1.1.1.4327.18 1 47.9676 859.8277 48.0279 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term -0.00200499990023673 1921.84191894531 961.9282 1921.84375 961.929138183594 2 20 1.1.1.4539.17 1 53.4291 1535.857 53.4891 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term -0.00200499990023673 1921.84191894531 961.9282 1921.84375 961.929138183594 2 22 1.1.1.4540.14 1 53.4523 1535.857 53.4891 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term -0.00200499990023673 1921.84191894531 961.9282 1921.84375 961.929138183594 2 21 1.1.1.4541.13 1 53.4772 1535.857 53.4891 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term -0.00200499990023673 1921.84191894531 961.9282 1921.84375 961.929138183594 2 23 1.1.1.4542.18 1 53.5074 1535.857 53.4891 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term -0.00200499990023673 1921.84191894531 961.9282 1921.84375 961.929138183594 2 18 1.1.1.4543.15 1 53.5308 1535.857 53.4891 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK cleaved A-S@N-term -0.00874069985002279 1905.84008789063 953.9273 1905.84887695313 953.931701660156 2 24 1.1.1.4750.15 1 58.8288 2105.826 58.9103 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK cleaved A-S@N-term -0.00874069985002279 1905.84008789063 953.9273 1905.84887695313 953.931701660156 2 24 1.1.1.4753.12 1 58.9051 2105.826 58.9103 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK cleaved A-S@N-term -0.00874069985002279 1905.84008789063 953.9273 1905.84887695313 953.931701660156 2 23 1.1.1.4758.12 1 59.0286 2105.826 58.9103 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term -0.00200499990023673 1921.84191894531 961.9282 1921.84375 961.929138183594 2 16 1.1.1.4538.16 1 53.4027 1535.857 53.4891 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK cleaved A-S@N-term -0.000762324023526162 1905.84814453125 636.29 1905.84887695313 636.290222167969 3 13 1.1.1.4756.21 1 58.9793 2289.943 58.9103 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 97.7999985218048 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term -0.000568992982152849 1921.84326171875 641.6217 1921.84375 641.621887207031 3 13 1.1.1.4544.11 1 53.5534 2528.624 53.4891 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 95.4299986362457 SEAEDASLLSFMQGYMK cleaved A-S@N-term -0.000762324023526162 1905.84814453125 636.29 1905.84887695313 636.290222167969 3 8 1.1.1.4749.18 1 58.8001 2289.943 58.9103 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 95.4299986362457 SEAEDASLLSFMQGYMK cleaved A-S@N-term -0.000762324023526162 1905.84814453125 636.29 1905.84887695313 636.290222167969 3 9 1.1.1.4763.20 1 59.1523 2399.633 58.8857 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 83.9100003242493 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term -0.000568992982152849 1921.84326171875 641.6217 1921.84375 641.621887207031 3 7 1.1.1.4537.8 1 53.3704 2528.624 53.4891 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 83.9100003242493 SEAEDASLLSFMQGYMK cleaved A-S@N-term -0.00117277004756033 1905.84765625 953.9311 1905.84887695313 953.931701660156 2 6 1.1.1.4770.21 1 59.3352 203.4073 59.3143 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 0.0120171001181006 2375.08935546875 594.7796 2375.07739257813 594.776611328125 4 22 1.1.1.3922.3 1 37.7588 1102.821 37.764 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 0.0151907997205853 2375.09252929688 594.7804 2375.07739257813 594.776611328125 4 17 1.1.1.3932.3 1 37.9722 1562.098 37.9378 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 0.00835508015006781 2375.08569335938 594.7787 2375.07739257813 594.776611328125 4 18 1.1.1.3940.4 1 38.1502 1641.199 38.0874 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMKHATK Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 0.000949957990087569 2359.08325195313 590.7781 2359.08251953125 590.777893066406 4 17 1.1.1.4345.12 1 48.4352 5812.724 48.5239 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 95.4299986362457 SEAEDASLLSFMQGYMKHATK Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 -0.00362728000618517 2359.07885742188 787.3669 2359.08251953125 787.368103027344 3 11 1.1.1.4339.19 1 48.2845 2189.178 48.3438 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 95.4299986362457 SEAEDASLLSFMQGYMKHATK Oxidation(Y)@15 cleaved A-S@N-term; missed K-H@17 0.000949957990087569 2359.08325195313 590.7781 2359.08251953125 590.777893066406 4 12 1.1.1.4353.9 1 48.6354 5812.724 48.5239 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 83.9100003242493 SEAEDASLLSFMQGYMKHATK cleaved A-S@N-term; missed K-H@17 0.00282946997322142 2343.09033203125 782.0374 2343.08740234375 782.036437988281 3 8 1.1.1.4562.6 1 54.0051 1716.506 54.1179 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 83.9100003242493 SEAEDASLLSFMQGYMKHATK cleaved A-S@N-term; missed K-H@17 -0.00262520997785032 2343.0849609375 586.7785 2343.08740234375 586.779174804688 4 7 1.1.1.4576.7 1 54.355 6066.202 54.093 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 79.229998588562 SEAEDASLLSFMQGYMKHATK cleaved A-S@N-term; missed K-H@17 0.00282946997322142 2343.09033203125 782.0374 2343.08740234375 782.036437988281 3 8 1.1.1.4569.14 1 54.1823 1716.506 54.1179 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 71.3800013065338 SEAEDASLLSFMQGYMKHATK Oxidation(M)@12 cleaved A-S@N-term; missed K-H@17 -0.00455108983442187 2359.07788085938 787.3666 2359.08251953125 787.368103027344 3 8 1.1.1.4108.12 1 42.3135 474.8274 42.2446 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 24.7099995613098 SEAEDASLLSFMQGYMKHATK Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 -0.00271179992705584 2359.07983398438 787.3672 2359.08251953125 787.368103027344 3 8 1.1.1.4346.18 1 48.4657 1580.041 48.5239 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.000311770010739565 2016.02319335938 673.015 2016.02355957031 673.01513671875 3 21 1.1.1.3604.6 1 30.0208 13523.06 30.1259 9 11.68 11.68 71.7199981212616 51.5200018882751 51.5200018882751 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 0.00379391992464662 2016.02734375 505.0141 2016.02355957031 505.01318359375 4 21 1.1.1.3609.3 1 30.139 2091.656 30.1259 10 10.04 10.04 64.6099984645844 1.66599992662668 1.44600002095103 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 KYTYNYEAESSSGVPGTADSR missed K-Y@1 0.0262620002031326 2281.03979492188 761.3539 2281.01342773438 761.345092773438 3 19 1.1.1.3595.7 1 29.8064 291.5002 29.7874 10 10.04 10.04 64.6099984645844 1.66599992662668 1.44600002095103 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 MTSNFPVDLSDYPK Oxidation(M)@1 -0.000164269004017115 1628.73901367188 815.3768 1628.7392578125 815.376892089844 2 8 1.1.1.4169.13 1 43.9078 135.8884 43.9164 10 10.04 10.04 64.6099984645844 1.66599992662668 1.44600002095103 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 QSFDLSVK -0.00754034006968141 922.468444824219 462.2415 922.476013183594 462.245269775391 2 7 1.1.1.3776.3 1 34.2135 86.2922 34.2051 10 10.04 10.04 64.6099984645844 1.66599992662668 1.44600002095103 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 QTEATMTFKYNR missed K-Y@9 0.000688704021740705 1488.70385742188 497.2419 1488.703125 497.241638183594 3 7 1.1.1.3581.8 1 29.4547 195.9741 29.4699 10 10.04 10.04 64.6099984645844 1.66599992662668 1.44600002095103 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 TEVIPPLIENR -0.00450386991724372 1279.70910644531 640.8618 1279.71362304688 640.864074707031 2 8 1.1.1.4149.7 1 43.3781 298.8161 43.3635 10 10.04 10.04 64.6099984645844 1.66599992662668 1.44600002095103 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.0236500203609467 29.2499989271164 TGISPLALIK -0.00185761996544898 1011.63110351563 506.8228 1011.6328125 506.823699951172 2 6 1.1.1.4398.5 1 49.8148 966.7374 49.7537 10 10.04 10.04 64.6099984645844 1.66599992662668 1.44600002095103 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.0163737125694752 22.0599994063377 IAELSATAQEIIK 0.000929892994463444 1385.77770996094 693.8961 1385.77661132813 693.895568847656 2 6 1.1.1.4155.14 1 43.5376 198.3858 43.5746 10 10.04 10.04 64.6099984645844 1.66599992662668 1.44600002095103 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.0048037082888186 26.9600003957748 TLQGIPQMIGEVIR Oxidation(M)@8 -0.00708656990900636 1569.84790039063 785.9312 1569.85485839844 785.934692382813 2 6 1.1.1.4353.18 1 48.6429 227.1556 48.7544 10 10.04 10.04 64.6099984645844 1.66599992662668 1.44600002095103 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 51.7000019550323 KIKGVISIPR acrolein addition +56(K)@1; acrolein addition +112(K)@3; Deamidated(R)@10 missed K-I@1; missed K-G@3 -0.0162642002105713 1278.77490234375 427.2656 1278.79113769531 427.27099609375 3 8 1.1.1.4052.5 1 40.8584 43689.94 40.7271 11 10.02 10.02 56.0000002384186 49.0000009536743 49.0000009536743 sp|P02652|APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens GN=APOA2 PE=1 SV=1 2 99.0000009536743 AGTELVNFLSYFVELGTQPAT cleaved T-Q@C-term 0.0437772981822491 2256.17529296875 753.0657 2256.13134765625 753.051086425781 3 13 1.1.1.5389.21 1 75.4337 542.9412 75.4106 11 10.02 10.02 56.0000002384186 49.0000009536743 49.0000009536743 sp|P02652|APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens GN=APOA2 PE=1 SV=1 2 99.0000009536743 AGTELVNFLSYFVELGTQPATQ 0.0469673983752728 2384.23706054688 795.7529 2384.18994140625 795.737243652344 3 18 1.1.1.5377.21 1 75.0958 1433.742 75.1294 11 10.02 10.02 56.0000002384186 49.0000009536743 49.0000009536743 sp|P02652|APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens GN=APOA2 PE=1 SV=1 2 99.0000009536743 SKEQLTPLIKK missed K-E@2; missed K-K@10 -0.013030800037086 1283.76818847656 428.93 1283.78125 428.934387207031 3 11 1.1.1.3458.4 1 26.6319 1645.76 26.6268 11 10.02 10.02 56.0000002384186 49.0000009536743 49.0000009536743 sp|P02652|APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens GN=APOA2 PE=1 SV=1 2 99.0000009536743 SYFEKSKEQLTPLIK missed K-S@5; missed K-E@7 0.00790509954094887 1809.99548339844 604.3391 1809.98767089844 604.336486816406 3 20 1.1.1.3913.4 1 37.5381 1366.661 37.5234 11 10.02 10.02 56.0000002384186 49.0000009536743 49.0000009536743 sp|P02652|APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens GN=APOA2 PE=1 SV=1 2 99.0000009536743 VKSPELQAEAK missed K-S@2 -0.0101164998486638 1198.6455078125 400.5558 1198.65576171875 400.559204101563 3 10 1.1.1.3262.2 1 23.3028 200.0966 23.3395 11 10.02 10.02 56.0000002384186 49.0000009536743 49.0000009536743 sp|P02652|APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens GN=APOA2 PE=1 SV=1 0.0168249271810055 23.6100003123283 SYFEKSKEQLTPLIKK missed K-S@5; missed K-E@7; missed K-K@15 0.00184182997327298 1938.08459472656 485.5284 1938.08264160156 485.527923583984 4 9 1.1.1.3734.3 1 33.1407 3022.941 33.1841 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 GGKYAATSQVLLPSK ONE addition +154(K)@3; Amino(Y)@4 missed K-Y@3 0.000706302002072334 1687.95153808594 563.6578 1687.95092773438 563.657592773438 3 13 1.1.1.4064.7 1 41.1727 616.2142 41.1097 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTC Oxidation(M)@18; Carbamidomethyl(C)@25 cleaved C-Y@C-term; missed K-S@4 0.00145980005618185 2660.2685546875 887.7635 2660.26733398438 887.763061523438 3 17 1.1.1.4070.13 1 41.3326 4312.559 41.3144 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 -0.000199294998310506 2823.33032226563 942.1174 2823.33056640625 942.117492675781 3 19 1.1.1.4164.6 1 43.7774 3502.639 43.8897 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 -0.00473508983850479 1318.7451171875 660.3798 1318.74963378906 660.382080078125 2 12 1.1.1.4028.15 1 40.2708 14277.22 40.5019 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0.0127807697281241 19.6600005030632 STGKPTLYNVSLVMSDTAGTC Carbamidomethyl(C)@21 cleaved C-Y@C-term -0.00217981007881463 2201.0322265625 734.6847 2201.03442382813 734.685424804688 3 8 1.1.1.4383.13 1 49.4233 982.9435 49.4618 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0.000869458774104714 81.4999997615814 QTISRPKGVALHRPDVYLLPPAR Gln->pyro-Glu@N-term; acrolein addition +56(K)@7; Oxidation(P)@14 missed K-G@7 0.00559662003070116 2638.47607421875 528.7025 2638.470703125 528.701416015625 5 10 1.1.1.3735.8 1 33.1739 1109.247 33.1593 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 GGKYAATSQVLLPSK Formyl@N-term; HPNE addition +172(K)@3 missed K-Y@3 0.0144282002002001 1718.95983886719 573.9939 1718.94543457031 573.989074707031 3 14 1.1.1.3901.7 1 37.2501 1239.694 37.2578 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 GGKYAATSQVLLPSK Lys-add@N-term; acrolein addition +56(K)@3 missed K-Y@3 0.00682550016790628 1702.96875 568.6635 1702.96179199219 568.661193847656 3 14 1.1.1.3940.3 1 38.1461 3759.016 38.232 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 GGKYAATSQVLLPSK Lys-add@N-term; acrolein addition +56(K)@3 missed K-Y@3 0.00682550016790628 1702.96875 568.6635 1702.96179199219 568.661193847656 3 17 1.1.1.3948.6 1 38.3439 3759.016 38.232 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 GGKYAATSQVLLPSK ONE addition +154(K)@3; Chloro(Y)@4 missed K-Y@3 0.014653000049293 1706.91577148438 569.9792 1706.90100097656 569.974304199219 3 11 1.1.1.4054.11 1 40.9143 914.2938 40.8518 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 GGKYAATSQVLLPSK ONE addition +154(K)@3; Amino(Y)@4 missed K-Y@3 0.000706302002072334 1687.95153808594 563.6578 1687.95092773438 563.657592773438 3 10 1.1.1.4057.9 1 41 616.2142 41.1097 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTC Carbamidomethyl(C)@25 cleaved C-Y@C-term; missed K-S@4 -0.00491575011983514 2644.26733398438 882.4297 2644.2724609375 882.431396484375 3 17 1.1.1.4304.7 1 47.3607 7995.231 47.3139 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 98.989999294281 TVDKSTGKPTLYNVSLVMSDTAGTC Oxidation(M)@18; Carbamidomethyl(C)@25 cleaved C-Y@C-term; missed K-S@4 0.00145980005618185 2660.2685546875 887.7635 2660.26733398438 887.763061523438 3 12 1.1.1.4063.18 1 41.1553 4312.559 41.3144 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 38.5199993848801 TVDKSTGKPTLYNVSLVMSDTAGTC Carbamidomethyl(C)@25 cleaved C-Y@C-term; missed K-S@4 -0.000521466019563377 2644.27172851563 882.4312 2644.2724609375 882.431396484375 3 11 1.1.1.4312.10 1 47.5702 8391.421 47.2881 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 -0.000199294998310506 2823.33032226563 942.1174 2823.33056640625 942.117492675781 3 17 1.1.1.4171.4 1 43.958 3502.639 43.8897 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Carbamidomethyl(C)@25 missed K-S@4 -0.00130735000129789 2807.33447265625 936.7854 2807.33569335938 936.785888671875 3 15 1.1.1.4384.14 1 49.4532 4549.607 49.5418 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Carbamidomethyl(C)@25 missed K-S@4 -0.00130735000129789 2807.33447265625 936.7854 2807.33569335938 936.785888671875 3 16 1.1.1.4391.17 1 49.639 4549.607 49.5418 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 -0.00473508983850479 1318.7451171875 660.3798 1318.74963378906 660.382080078125 2 17 1.1.1.4035.9 1 40.4446 14170.51 40.4771 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 -0.00473508983850479 1318.7451171875 660.3798 1318.74963378906 660.382080078125 2 15 1.1.1.4042.17 1 40.6182 14170.51 40.4771 12 8.01 8.01 37.389999628067 14.1599997878075 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 -0.00510127982124686 1318.74462890625 660.3796 1318.74963378906 660.382080078125 2 10 1.1.1.4056.10 1 40.974 841.3226 40.702 13 8 14 49.66000020504 14.5799994468689 12.8800004720688 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 2 99.0000009536743 AQYEEIANR -0.0058079999871552 1092.51403808594 547.2643 1092.52001953125 547.267272949219 2 10 1.1.1.3426.3 1 25.8864 136.0109 25.9016 13 8 14 49.66000020504 14.5799994468689 12.8800004720688 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 2 99.0000009536743 ISISTSGGSFR -0.00679318001493812 1110.56030273438 556.2874 1110.56689453125 556.290771484375 2 8 1.1.1.3731.7 1 33.0717 925.4423 33.1593 13 8 14 49.66000020504 14.5799994468689 12.8800004720688 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 2 99.0000009536743 QLDSIVGER -0.00663023022934794 1015.52325439453 508.7689 1015.52984619141 508.772186279297 2 8 1.1.1.3634.8 0 30.7291 373.2589 30.7343 13 8 14 49.66000020504 14.5799994468689 12.8800004720688 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 2 99.0000009536743 SFSTASAITPSVSR -0.0117384996265173 1409.70324707031 705.8589 1409.71508789063 705.864807128906 2 11 1.1.1.3777.16 1 34.2519 154.3022 34.2826 13 8 14 49.66000020504 14.5799994468689 12.8800004720688 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0.00217691925354302 53.0499994754791 NMQDLVEDFKNKYEDEINKR MDA adduct +62(K)@12 missed K-N@10; missed K-Y@12; missed K-R@19 -0.0606635995209217 2589.15625 648.2963 2589.21704101563 648.3115234375 4 7 1.1.1.4126.12 1 42.772 346.506 42.7839 13 8 14 49.66000020504 14.5799994468689 12.8800004720688 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0 68.8700020313263 AQYEEIANR Methyl(N)@8 -0.00537326000630856 1106.5302734375 554.2724 1106.53564453125 554.275085449219 2 13 1.1.1.3436.3 0 26.1158 509.6634 26.1458 13 8 14 49.66000020504 14.5799994468689 12.8800004720688 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0 19.4900006055832 ISISTSGGSFR -0.00679318001493812 1110.56030273438 556.2874 1110.56689453125 556.290771484375 2 6 1.1.1.3738.10 1 33.2471 925.4423 33.1593 13 8 14 49.66000020504 14.5799994468689 12.8800004720688 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0 99.0000009536743 LALDVEIATYR -0.000240412002312951 1262.68688964844 632.3507 1262.68701171875 632.350830078125 2 6 1.1.1.4282.7 0 46.7684 290.4982 46.8907 13 8 14 49.66000020504 14.5799994468689 12.8800004720688 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0 99.0000009536743 LALDVEIATYR -0.000240412002312951 1262.68688964844 632.3507 1262.68701171875 632.350830078125 2 11 1.1.1.4289.6 0 46.9565 290.4982 46.8907 13 8 14 49.66000020504 14.5799994468689 12.8800004720688 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0 99.0000009536743 NKYEDEINKR missed K-Y@2; missed K-R@9 -0.00521190976724029 1307.64184570313 436.8879 1307.64697265625 436.889587402344 3 12 1.1.1.3176.2 0 22.6664 211.3747 22.6967 13 8 14 49.66000020504 14.5799994468689 12.8800004720688 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0 99.0000009536743 NLDLDSIIAEVK -0.00297190994024277 1328.7158203125 665.3652 1328.71875 665.366638183594 2 18 1.1.1.4624.12 0 55.5904 1327.877 55.6032 14 6.06 8.47 50.8499979972839 14.190000295639 10.3799998760223 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 2 99.0000009536743 ALEEANADLEVK -0.00259825005196035 1300.6484375 651.3315 1300.65100097656 651.332824707031 2 11 1.1.1.3681.11 1 31.8651 359.2789 31.872 14 6.06 8.47 50.8499979972839 14.190000295639 10.3799998760223 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 2 99.0000009536743 APSTYGGGLSVSSSR -4.21264012402389E-05 1424.68969726563 713.3521 1424.68957519531 713.35205078125 2 11 1.1.1.3562.8 1 28.9985 275.1832 29.0281 14 6.06 8.47 50.8499979972839 14.190000295639 10.3799998760223 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 2 99.0000009536743 EVATNSELVQSGK -0.00132856995332986 1360.68212890625 681.3483 1360.68347167969 681.348999023438 2 13 1.1.1.3437.4 1 26.1405 195.4044 26.1458 14 6.06 8.47 50.8499979972839 14.190000295639 10.3799998760223 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0.0245681907981634 99.0000009536743 VLDELTLAR -0.00345887010917068 1028.58312988281 515.2988 1028.58666992188 515.300598144531 2 7 1.1.1.4006.10 0 39.7202 901.8159 39.7844 14 6.06 8.47 50.8499979972839 14.190000295639 10.3799998760223 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0.0195421073585749 33.270001411438 QRPAEIKDYSPYFK missed K-D@7 -0.0127815995365381 1740.87060546875 581.2975 1740.88354492188 581.3017578125 3 7 1.1.1.3758.11 1 33.752 132.8642 33.7365 14 6.06 8.47 50.8499979972839 14.190000295639 10.3799998760223 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0.0101054366677999 83.9100003242493 TLARADLEMQIESLK MDA adduct +54(K)@15 cleaved L-T@N-term; missed R-A@4 0.0133672999218106 1770.93212890625 886.4733 1770.91857910156 886.466552734375 2 10 1.1.1.4647.13 1 56.1894 1167.27 56.1214 14 6.06 8.47 50.8499979972839 14.190000295639 10.3799998760223 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 92.849999666214 LAADDFR -0.00481978012248874 806.387451171875 404.201 806.392272949219 404.203399658203 2 6 1.1.1.3551.2 0 28.7132 1128.479 28.6301 14 6.06 8.47 50.8499979972839 14.190000295639 10.3799998760223 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 43.1800007820129 LAADDFR -0.00481978012248874 806.387451171875 404.201 806.392272949219 404.203399658203 2 7 1.1.1.3543.2 0 28.5397 1128.751 28.6301 14 6.06 8.47 50.8499979972839 14.190000295639 10.3799998760223 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 25.8100003004074 LASYLDK -0.00583091983571649 808.42724609375 405.2209 808.433044433594 405.223815917969 2 5 1.1.1.3501.3 0 27.646 401.4988 27.5358 14 6.06 8.47 50.8499979972839 14.190000295639 10.3799998760223 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 23.7900003790855 LASYLDK -0.00583091983571649 808.42724609375 405.2209 808.433044433594 405.223815917969 2 5 1.1.1.3494.2 0 27.4676 401.4988 27.5358 14 6.06 8.47 50.8499979972839 14.190000295639 10.3799998760223 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 26.8400013446808 VTMQNLNDR Oxidation(M)@3 -0.00551733002066612 1105.51306152344 553.7638 1105.5185546875 553.7666015625 2 7 1.1.1.3455.7 0 26.5672 222.6923 26.6008 15 6.03 6.03 24.779999256134 24.779999256134 24.779999256134 sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1 2 99.0000009536743 ASGVPDRFSGSGSGTDFTLK Delta:H(4)C(2)@N-term; Oxidation(P)@5; Oxidation(D)@6; Oxidation(R)@7 missed R-F@7 0.0157626997679472 2060.98095703125 688.0009 2060.96508789063 687.99560546875 3 18 1.1.1.4097.15 1 42.0269 6656.379 42.0371 15 6.03 6.03 24.779999256134 24.779999256134 24.779999256134 sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1 2 99.0000009536743 FSGSGSGTDFTLK -0.00194813997950405 1302.60729980469 652.3109 1302.60925292969 652.311889648438 2 10 1.1.1.3792.8 1 34.6269 1515.602 34.705 15 6.03 6.03 24.779999256134 24.779999256134 24.779999256134 sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1 2 99.0000009536743 FSGSGSGTDFTLKISR missed K-I@13 0.0132210999727249 1658.83959960938 553.9538 1658.82641601563 553.949401855469 3 19 1.1.1.3937.2 1 38.0738 929.4117 38.0874 15 6.03 6.03 24.779999256134 24.779999256134 24.779999256134 sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1 0.0282604098320007 99.0000009536743 ALSNRASGVPDRFSGSGSGTDFTLK cleaved Y-A@N-term; missed R-A@5; missed R-F@12 -9.01832962036133 2517.22802734375 630.3143 2526.24633789063 632.56884765625 4 13 1.1.1.4021.11 1 40.0996 19284.98 40.0076 15 6.03 6.03 24.779999256134 24.779999256134 24.779999256134 sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1 0 79.5099973678589 ALSNRASGVPDRFSGSGSGTDFTLK cleaved Y-A@N-term; missed R-A@5; missed R-F@12 -9.01832962036133 2517.22802734375 630.3143 2526.24633789063 632.56884765625 4 12 1.1.1.4014.7 1 39.9282 19284.98 40.0076 16 5.14 5.14 44.2999988794327 4.88499999046326 3.18900011479855 sp|P01023|A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=2 2 99.0000009536743 ATVLNYLPK -0.00215412001125515 1017.58367919922 509.7991 1017.58587646484 509.800231933594 2 8 1.1.1.4167.9 1 43.8477 231.0986 43.8364 16 5.14 5.14 44.2999988794327 4.88499999046326 3.18900011479855 sp|P01023|A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=2 2 99.0000009536743 YGAATFTRTG cleaved G-K@C-term; missed R-T@8 -0.00400169007480145 1043.49963378906 522.7571 1043.50366210938 522.759094238281 2 10 1.1.1.3549.7 1 28.6767 797.8438 28.7089 16 5.14 5.14 44.2999988794327 4.88499999046326 3.18900011479855 sp|P01023|A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=2 1.05061006546021 99.0000009536743 QTVSWAVTPK -0.00312772998586297 1115.59423828125 558.8044 1115.59753417969 558.806030273438 2 8 1.1.1.3785.11 1 34.4515 551.1798 34.5103 16 5.14 5.14 44.2999988794327 4.88499999046326 3.18900011479855 sp|P01023|A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=2 0.0904439687728882 99.0000009536743 SEELSLKLPPNVVEESAR Carbamidomethyl@N-term cleaved V-S@N-term; missed K-L@7 0.0393870994448662 2053.1083984375 685.3768 2053.06909179688 685.363647460938 3 12 1.1.1.4187.7 1 44.3465 522.5726 44.3834 16 5.14 5.14 44.2999988794327 4.88499999046326 3.18900011479855 sp|P01023|A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=2 0 61.0899984836578 MVSGFIPLKPTVK Oxidation(M)@1; Dehydrated(S)@3 -0.000835006998386234 1413.8046875 472.2755 1413.80541992188 472.275726318359 3 6 1.1.1.4045.4 1 40.6851 353.9104 40.777 16 5.14 5.14 44.2999988794327 4.88499999046326 3.18900011479855 sp|P01023|A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=2 0 16.3699999451637 MVSGFIPLKPTVK Oxidation(M)@1 0.00592203019186854 1431.82214355469 478.2813 1431.81591796875 478.279266357422 3 6 1.1.1.3998.4 1 39.5181 399.3898 39.3851 16 5.14 5.14 44.2999988794327 4.88499999046326 3.18900011479855 sp|P01023|A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=2 0 97.979998588562 QTVSWAVTPK Dioxidation(W)@5 -0.00574675993993878 1147.58166503906 574.7981 1147.58728027344 574.800964355469 2 9 1.1.1.3680.8 1 31.8397 639.6146 31.8475 16 5.14 5.14 44.2999988794327 4.88499999046326 3.18900011479855 sp|P01023|A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=2 0 97.979998588562 SEELSLKLPPNVVEESAR Carbamidomethyl@N-term cleaved V-S@N-term; missed K-L@7 0.0452461987733841 2053.1142578125 685.3787 2053.06909179688 685.363647460938 3 13 1.1.1.4179.2 1 44.1452 915.6171 44.0891 16 5.14 5.14 44.2999988794327 4.88499999046326 3.18900011479855 sp|P01023|A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=2 0 97.979998588562 SEELSLKLPPNVVEESAR Carbamidomethyl@N-term cleaved V-S@N-term; missed K-L@7 0.0393870994448662 2053.1083984375 685.3768 2053.06909179688 685.363647460938 3 11 1.1.1.4194.10 1 44.5263 522.5726 44.3834 16 5.14 5.14 44.2999988794327 4.88499999046326 3.18900011479855 sp|P01023|A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=2 0 47.6300001144409 SEELSLKLPPNVVEESAR Carbamidomethyl@N-term cleaved V-S@N-term; missed K-L@7 0.0403026007115841 2053.109375 685.3771 2053.06909179688 685.363647460938 3 8 1.1.1.4201.8 1 44.7065 401.7426 44.6676 16 5.14 5.14 44.2999988794327 4.88499999046326 3.18900011479855 sp|P01023|A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=2 0 72.6199984550476 VTAAPQSVCALR Oxidation(P)@5; Carbamidomethyl(C)@9; Methyl(L)@11 -0.0039441199041903 1301.67224121094 651.8434 1301.67614746094 651.845336914063 2 11 1.1.1.3799.13 1 34.7977 1558.206 34.8277 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 2 99.0000009536743 ADTLTDEINFLR -0.0125388000160456 1406.69165039063 704.3531 1406.7041015625 704.359375 2 10 1.1.1.4436.15 1 50.7854 237.6724 50.8189 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 2 99.0000009536743 SGFSSVSVSR -0.0010045999661088 1011.49749755859 506.756 1011.49853515625 506.756530761719 2 11 1.1.1.3550.4 1 28.6969 264.6286 28.7335 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0.728158473968506 99.0000009536743 KNKLEGLEDALQKAKQDLARLLK MDA adduct +54(K)@13; ONE addition +154(K)@15; acrolein addition +94(K)@23 cleaved A-K@N-term; missed K-N@1; missed K-L@3; missed K-A@13; missed K-Q@15; missed R-L@20 0.0984698012471199 2923.77319335938 488.3028 2923.67456054688 488.286376953125 6 6 1.1.1.5148.5 1 69.0866 25550.61 69.2309 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 99.0000009536743 AQYEEIAQR -0.00537326978519559 1106.5302734375 554.2724 1106.53564453125 554.275085449219 2 13 1.1.1.3436.3 0 26.1158 509.6634 26.1458 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 18.5000002384186 DAKNKLEGLEDALQ acrolein addition +38(K)@3; MDA adduct +54(K)@5 cleaved Q-K@C-term; missed K-N@3; missed K-L@5 -0.0109508000314236 1634.80432128906 818.4094 1634.81518554688 818.414855957031 2 8 1.1.1.4433.12 1 50.7028 4192.524 50.5549 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 99.0000009536743 LALDVEIATYR -0.000240412002312951 1262.68688964844 632.3507 1262.68701171875 632.350830078125 2 6 1.1.1.4282.7 0 46.7684 290.4982 46.8907 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 99.0000009536743 LALDVEIATYR -0.000240412002312951 1262.68688964844 632.3507 1262.68701171875 632.350830078125 2 11 1.1.1.4289.6 0 46.9565 290.4982 46.8907 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 99.0000009536743 NKYEDEINKR missed K-Y@2; missed K-R@9 -0.00521190976724029 1307.64184570313 436.8879 1307.64697265625 436.889587402344 3 12 1.1.1.3176.2 0 22.6664 211.3747 22.6967 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 99.0000009536743 NLDLDSIIAEVK -0.00297190994024277 1328.7158203125 665.3652 1328.71875 665.366638183594 2 18 1.1.1.4624.12 0 55.5904 1327.877 55.6032 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 99.0000009536743 QLDSIVGER -0.00663023022934794 1015.52325439453 508.7689 1015.52984619141 508.772186279297 2 8 1.1.1.3634.8 0 30.7291 373.2589 30.7343 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 95.1200008392334 TAAENEFVTLK -1.02551996707916 1220.5986328125 611.3066 1221.62414550781 611.8193359375 2 9 1.1.1.3799.12 0 34.7961 445.8363 34.7784 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 68.8700020313263 TAAENEFVTLK Carbamyl@N-term -0.00679339980706573 1264.623046875 633.3188 1264.6298828125 633.322265625 2 7 1.1.1.3825.18 0 35.457 1489.396 35.2848 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 53.0499994754791 TAAENEFVTLK Carbamyl@N-term -0.00679339980706573 1264.623046875 633.3188 1264.6298828125 633.322265625 2 7 1.1.1.3811.8 0 35.0987 1485.269 35.2848 17 4.73 15.15 43.4399992227554 19.1499993205071 18.970000743866 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 71.3800013065338 TAAENEFVTLKK Carbamyl@N-term missed K-K@11 -0.00603797985240817 1392.71887207031 465.2469 1392.72485351563 465.248901367188 3 9 1.1.1.3596.5 0 29.8231 4938.841 29.7148 18 4 4 51.8700003623962 12.6200005412102 12.6200005412102 cont|000081 gi|115646|sp|P02662|CAS1_BOVIN Alpha-S1-casein precursor [Bos taurus (contaminant)] 2 99.0000009536743 FFVAPFPEVFGK -0.00170071003958583 1383.72106933594 692.8678 1383.72265625 692.86865234375 2 9 1.1.1.4753.10 1 58.9017 566.8038 58.7816 18 4 4 51.8700003623962 12.6200005412102 12.6200005412102 cont|000081 gi|115646|sp|P02662|CAS1_BOVIN Alpha-S1-casein precursor [Bos taurus (contaminant)] 2 99.0000009536743 HQGLPQEVLNENLLR 0.00982879009097815 1758.94750976563 587.3231 1758.93762207031 587.31982421875 3 9 1.1.1.4192.8 1 44.4713 125.7415 44.4085 18 4 4 51.8700003623962 12.6200005412102 12.6200005412102 cont|000081 gi|115646|sp|P02662|CAS1_BOVIN Alpha-S1-casein precursor [Bos taurus (contaminant)] 0 99.0000009536743 FFVAPFPEVFGK -0.00170071003958583 1383.72106933594 692.8678 1383.72265625 692.86865234375 2 12 1.1.1.4746.15 1 58.7222 566.8038 58.7816 19 3.24 3.24 50.8499979972839 0.884700007736683 0.712700001895428 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 2 99.0000009536743 VKEPLSSAK acrolein addition +76(K)@2; MDA adduct +54(K)@9 missed K-E@2 -0.00974006019532681 1087.58166503906 544.7981 1087.59130859375 544.802978515625 2 11 1.1.1.3586.3 1 29.5827 805.3402 29.4451 19 3.24 3.24 50.8499979972839 0.884700007736683 0.712700001895428 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 1.23657178878784 99.0000009536743 THKSKHGSPSLRRKGNRKRN reduced HNE(H)@2; reduced acrolein addition +96(K)@14; HPNE addition +172(K)@18 cleaved N-S@C-term; missed K-S@3; missed K-H@5; missed R-R@12; missed R-K@13; missed K-G@14; missed R-K@17; missed K-R@18; missed R-N@19 0.0522821992635727 2769.67236328125 554.9418 2769.6201171875 554.931335449219 5 6 1.1.1.5096.11 1 67.7918 548.9789 67.8055 19 3.24 3.24 50.8499979972839 0.884700007736683 0.712700001895428 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 0.00174066168256104 42.0199990272522 KLSKNEPEVIKPYSPLKETSLSGPEALSAVKMEMK acrolein addition +112(K)@1; ONE addition +154(K)@4; hexanoyl addition +98(K)@31; reduced acrolein addition +96(K)@35 missed K-L@1; missed K-N@4; missed K-E@17; missed K-M@31 -0.170633003115654 4318.1640625 720.7013 4318.3349609375 720.729736328125 6 7 1.1.1.5419.15 1 76.2981 1943.637 76.3083 19 3.24 3.24 50.8499979972839 0.884700007736683 0.712700001895428 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 0.000869458774104714 68.8700020313263 ITKETVK acrolein addition +38(K)@7 cleaved D-I@N-term; missed K-E@3 0.00709816999733448 855.513671875 428.7641 855.506591796875 428.760559082031 2 6 1.1.1.3766.6 1 33.953 291.144 33.8141 19 3.24 3.24 50.8499979972839 0.884700007736683 0.712700001895428 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 0.000434511806815863 44.4599986076355 PTNKKGSPLTSASQVLTTEKEKSYTGIYDKARKKK acrolein addition +112(K)@5; MDA adduct +54(K)@33; acrolein addition +76(K)@35 cleaved V-P@N-term; missed K-K@4; missed K-G@5; missed K-E@20; missed K-S@22; missed K-A@30; missed R-K@32; missed K-K@33; missed K-K@34 0.199185997247696 4124.4150390625 590.2094 4124.2158203125 590.180969238281 7 6 1.1.1.5381.12 1 75.2007 373.207 75.2134 19 3.24 3.24 50.8499979972839 0.884700007736683 0.712700001895428 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 0.000434511806815863 28.7499994039536 SWPSKEDSQEK reduced acrolein addition +96(K)@5; reduced acrolein addition +96(K)@11 cleaved L-S@N-term; missed K-E@5 0.00392642989754677 1511.71850585938 756.8665 1511.71435546875 756.864440917969 2 9 1.1.1.4067.7 1 41.2522 13596.03 41.188 19 3.24 3.24 50.8499979972839 0.884700007736683 0.712700001895428 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 0 35.4299992322922 DITKESMKEGFPSKESER reduced acrolein addition +58(K)@4; acrolein addition +38(K)@14 cleaved V-D@N-term; missed K-E@4; missed K-E@8; missed K-E@14 0.00964188016951084 2193.07202148438 732.0313 2193.06225585938 732.028076171875 3 6 1.1.1.4264.8 1 46.309 238.2769 46.3506 19 3.24 3.24 50.8499979972839 0.884700007736683 0.712700001895428 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 0 31.4399987459183 IGTKQAK reduced acrolein addition +58(K)@4; Deamidated(Q)@5; acrolein addition +38(K)@7 cleaved S-I@N-term; missed K-Q@4 0.00288757006637752 841.493896484375 421.7542 841.490905761719 421.752746582031 2 5 1.1.1.4330.3 0 48.0339 421.2508 48.0542 19 3.24 3.24 50.8499979972839 0.884700007736683 0.712700001895428 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 0 17.849999666214 PTNKKGSPLTSASQVLTTEKEKSYTGIYDKARKKK acrolein addition +56(K)@5; Oxidation(P)@8; acrolein addition +94(K)@33; reduced acrolein addition +96(K)@35 cleaved V-P@N-term; missed K-K@4; missed K-G@5; missed K-E@20; missed K-S@22; missed K-A@30; missed R-K@32; missed K-K@33; missed K-K@34 -0.197633996605873 4144.04443359375 593.0136 4144.2421875 593.041870117188 7 6 1.1.1.5420.2 1 76.317 1713.763 76.3083 19 3.24 3.24 50.8499979972839 0.884700007736683 0.712700001895428 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 0 15.8000007271767 SLSPSTTEK reduced acrolein addition +96(K)@9 cleaved S-S@N-term 0.0174211002886295 1044.55151367188 523.283 1044.53393554688 523.274230957031 2 4 1.1.1.3681.9 0 31.8617 111.6523 31.9213 19 3.24 3.24 50.8499979972839 0.884700007736683 0.712700001895428 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 0 99.0000009536743 VKEPLSSAK acrolein addition +76(K)@2; MDA adduct +54(K)@9 missed K-E@2 -0.00974006019532681 1087.58166503906 544.7981 1087.59130859375 544.802978515625 2 10 1.1.1.3579.9 0 29.4119 805.3402 29.4451 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 2 99.0000009536743 LGEHNIEVLEGNEQFINAAK Cation:K(E)@7; Deamidated(N)@12 -0.0326907001435757 2263.01977539063 755.3472 2263.05224609375 755.358032226563 3 16 1.1.1.4173.3 1 44.0049 2565.553 43.9917 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 1.14266729354858 99.0000009536743 PGVYTKVYNYVKWIKNTIAAN hexanoyl addition +98(K)@6; hexanoyl addition +98(K)@12; acrolein addition +94(K)@15 cleaved K-P@N-term; cleaved N-S@C-term; missed K-V@6; missed K-W@12; missed K-N@15 -0.1353649944067 2731.36352539063 911.4618 2731.4990234375 911.506896972656 3 11 1.1.1.4824.17 1 60.6983 1026.817 60.8071 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 99.0000009536743 EQFINAAK cleaved N-E@N-term -0.00557528017088771 919.470703125 460.7426 919.476318359375 460.745452880859 2 7 1.1.1.3481.3 0 27.1506 942.158 27.0717 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 68.8700020313263 EQFINAAK cleaved N-E@N-term -0.00557528017088771 919.470703125 460.7426 919.476318359375 460.745452880859 2 6 1.1.1.3474.5 0 26.9837 942.158 27.0717 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 99.0000009536743 LGEHNIEVLEGNEQFINAAK Methyl(E)@7; Deamidated(N)@17 -0.0147516001015902 2239.09716796875 747.373 2239.11206054688 747.377990722656 3 20 1.1.1.4167.15 0 43.8561 1246.029 43.9164 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 79.5099973678589 LGEHNIEVLEGNEQFINAAK Oxidation(H)@4; Deamidated(N)@5 -0.00410785991698503 2241.08740234375 748.0364 2241.09130859375 748.037719726563 3 12 1.1.1.4173.2 0 43.9991 1935.631 43.9674 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 68.8700020313263 LGEHNIEVLEGNEQFINAAK Deamidated(N)@5; Cation:K(E)@7 -0.0326907001435757 2263.01977539063 755.3472 2263.05224609375 755.358032226563 3 12 1.1.1.4174.3 1 44.0251 2565.553 43.9917 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 68.8700020313263 LGEHNIEVLEGNEQFINAAK Cation:K(E)@10; Deamidated(N)@12 -0.0380689986050129 2263.0146484375 566.7609 2263.05224609375 566.770324707031 4 12 1.1.1.4176.2 1 44.0713 4774.882 43.9917 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 68.8700020313263 LGEHNIEVLEGNEQFINAAK Oxidation(H)@4; Deamidated(N)@5 -0.00410785991698503 2241.08740234375 748.0364 2241.09130859375 748.037719726563 3 11 1.1.1.4180.3 1 44.1729 1935.631 43.9674 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 68.8700020313263 LGEHNIEVLEGNEQFINAAK Methyl(E)@7; Deamidated(N)@12 0.0176567006856203 2239.1298828125 747.3839 2239.11206054688 747.377990722656 3 9 1.1.1.4236.16 0 45.5899 322.9665 45.5238 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 61.0899984836578 LGEHNIEVLEGNEQFINAAK Methyl(H)@4 0.000675869989208877 2238.12866210938 747.0502 2238.12817382813 747.049987792969 3 19 1.1.1.4209.4 0 44.9124 8534.541 44.7728 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 61.0899984836578 LGEHNIEVLEGNEQFINAAK Methyl(H)@4; Deamidated(N)@12 0.0154595002532005 2239.12744140625 747.3831 2239.11206054688 747.377990722656 3 8 1.1.1.4243.15 0 45.7723 204.7092 45.7513 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 28.7499994039536 LGEHNIEVLEGNEQFINAAK Deamidated(N)@5; Cation:K(E)@7 -0.0326907001435757 2263.01977539063 755.3472 2263.05224609375 755.358032226563 3 11 1.1.1.4180.4 1 44.1771 2565.553 43.9917 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 28.7499994039536 LGEHNIEVLEGNEQFINAAK Methyl(H)@4; Deamidated(N)@17 0.0258542001247406 2239.1376953125 560.7917 2239.11206054688 560.785278320313 4 8 1.1.1.4205.7 0 44.812 720.4553 44.7728 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 23.7900003790855 LGEHNIEVLEGNEQFINAAK -0.00604692008346319 2224.10620117188 742.376 2224.1123046875 742.378051757813 3 21 1.1.1.4179.3 0 44.1511 1563.597 44.2354 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 23.7900003790855 LGEHNIEVLEGNEQFINAAK -0.00604692008346319 2224.10620117188 742.376 2224.1123046875 742.378051757813 3 21 1.1.1.4186.2 0 44.32 1563.597 44.2354 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 20.3999996185303 LGEHNIEVLEGNEQFINAAK -0.00989197008311749 2224.1025390625 742.3748 2224.1123046875 742.378051757813 3 13 1.1.1.4172.2 0 43.9748 996.2357 43.9674 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 38.1300002336502 NEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAK Carbamidomethyl(C)@11 cleaved I-N@N-term; missed K-S@13; missed R-I@15; missed R-L@19 -2.06166005134583 4520.1943359375 754.373 4522.25634765625 754.716674804688 6 12 1.1.1.4177.4 0 44.1015 1170.842 43.9674 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 99.0000009536743 TLNNDIMLIK Deamidated(N)@3 -0.000411446992075071 1174.62622070313 588.3204 1174.62670898438 588.320678710938 2 12 1.1.1.4221.3 0 45.2097 1425.284 45.2529 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 99.0000009536743 VLEGNEQFINAAK cleaved E-V@N-term -0.0035810200497508 1431.73229980469 716.8734 1431.73583984375 716.875183105469 2 9 1.1.1.3803.14 0 34.8955 399.4935 34.9776 20 3.14 7.65 62.3499989509583 20.6499993801117 20.6499993801117 sp|P07477|TRY1_HUMAN Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1 0 99.0000009536743 VLEGNEQFINAAK cleaved E-V@N-term -0.0035810200497508 1431.73229980469 716.8734 1431.73583984375 716.875183105469 2 9 1.1.1.3810.13 0 35.0732 399.4935 34.9776 21 2.39 2.39 81.6299974918365 15.6499996781349 15.6499996781349 sp|P69892|HBG2_HUMAN; sp|P69891|HBG1_HUMAN Hemoglobin subunit gamma-2 OS=Homo sapiens GN=HBG2 PE=1 SV=2; Hemoglobin subunit gamma-1 OS=Homo sapiens GN=HBG1 PE=1 SV=2 2 99.0000009536743 LLVVYPWTQR 0.00111604004632682 1273.71948242188 637.867 1273.71826171875 637.866394042969 2 8 1.1.1.4417.12 1 50.2798 132.9888 50.2925 21 2.39 2.39 81.6299974918365 15.6499996781349 15.6499996781349 sp|P69892|HBG2_HUMAN; sp|P69891|HBG1_HUMAN Hemoglobin subunit gamma-2 OS=Homo sapiens GN=HBG2 PE=1 SV=2; Hemoglobin subunit gamma-1 OS=Homo sapiens GN=HBG1 PE=1 SV=2 0.390405595302582 99.0000009536743 IMGNPKVKAHGKK MDA adduct +54(K)@6; hexanoyl addition +98(K)@8; MDA adduct +62(K)@12; acrolein addition +38(K)@13 cleaved A-I@N-term; missed K-V@6; missed K-A@8; missed K-K@12 0.0469959005713463 1658.98010253906 415.7523 1658.93310546875 415.740539550781 4 7 1.1.1.4795.3 1 59.9508 2026.514 59.9217 22 2.01 2.01 47.299998998642 4.95500005781651 4.95500005781651 cont|000071 gi|27806963|ref|NP_776953.1| casein alpha-S2 [Bos taurus (contaminant)] 2 99.0000009536743 NAVPITPTLNR -0.00143939000554383 1194.67065429688 598.3426 1194.67211914063 598.343322753906 2 6 1.1.1.3780.10 1 34.3247 252.112 34.3839 22 2.01 2.01 47.299998998642 4.95500005781651 4.95500005781651 cont|000071 gi|27806963|ref|NP_776953.1| casein alpha-S2 [Bos taurus (contaminant)] 0.00788851175457239 31.9999992847443 FALPQYLK -0.00255857990123332 978.55126953125 490.2829 978.553833007813 490.284210205078 2 6 1.1.1.4231.2 1 45.454 756.4822 45.351 22 2.01 2.01 47.299998998642 4.95500005781651 4.95500005781651 cont|000071 gi|27806963|ref|NP_776953.1| casein alpha-S2 [Bos taurus (contaminant)] 0 31.3899993896484 FALPQYLK -0.00255857990123332 978.55126953125 490.2829 978.553833007813 490.284210205078 2 6 1.1.1.4224.2 1 45.2818 756.4822 45.351 23 2 2 78.10999751091 1.33100003004074 1.33100003004074 sp|Q8WYA0|IFT81_HUMAN Intraflagellar transport protein 81 homolog OS=Homo sapiens GN=IFT81 PE=1 SV=1 2 99.0000009536743 KLYSLVSEK acrolein addition +38(K)@9 missed K-L@1 -0.00969580002129078 1103.61303710938 552.8138 1103.62268066406 552.818603515625 2 8 1.1.1.4725.13 1 58.1902 872.1794 57.9201 23 2 2 78.10999751091 1.33100003004074 1.33100003004074 sp|Q8WYA0|IFT81_HUMAN Intraflagellar transport protein 81 homolog OS=Homo sapiens GN=IFT81 PE=1 SV=1 0.000869458774104714 18.4900000691414 SKSTVFKK acrolein addition +56(K)@2; MDA adduct +54(K)@7; MDA adduct +54(K)@8 missed K-S@2; missed K-K@7 -0.00974006019532681 1087.58166503906 544.7981 1087.59130859375 544.802978515625 2 9 1.1.1.3579.9 0 29.4119 805.3402 29.4451 23 2 2 78.10999751091 1.33100003004074 1.33100003004074 sp|Q8WYA0|IFT81_HUMAN Intraflagellar transport protein 81 homolog OS=Homo sapiens GN=IFT81 PE=1 SV=1 0 35.3700011968613 KLYSLVSEK acrolein addition +38(K)@9 missed K-L@1 -0.00896340981125832 1103.61364746094 552.8141 1103.62268066406 552.818603515625 2 5 1.1.1.4742.19 1 58.6196 276.7506 58.5768 23 2 2 78.10999751091 1.33100003004074 1.33100003004074 sp|Q8WYA0|IFT81_HUMAN Intraflagellar transport protein 81 homolog OS=Homo sapiens GN=IFT81 PE=1 SV=1 0 27.5099992752075 KLYSLVSEK acrolein addition +38(K)@9 missed K-L@1 -0.00835308991372585 1103.61450195313 552.8145 1103.62268066406 552.818603515625 2 6 1.1.1.4732.20 1 58.3739 571.03 58.0935 23 2 2 78.10999751091 1.33100003004074 1.33100003004074 sp|Q8WYA0|IFT81_HUMAN Intraflagellar transport protein 81 homolog OS=Homo sapiens GN=IFT81 PE=1 SV=1 0 24.8699992895126 KLYSLVSEK acrolein addition +38(K)@9 missed K-L@1 -0.00932960025966167 1103.61352539063 552.814 1103.62268066406 552.818603515625 2 8 1.1.1.4704.15 1 57.6535 16050.48 57.3835 23 2 2 78.10999751091 1.33100003004074 1.33100003004074 sp|Q8WYA0|IFT81_HUMAN Intraflagellar transport protein 81 homolog OS=Homo sapiens GN=IFT81 PE=1 SV=1 0 18.2099997997284 KLYSLVSEK acrolein addition +38(K)@9 missed K-L@1 -0.00969580002129078 1103.61303710938 552.8138 1103.62268066406 552.818603515625 2 7 1.1.1.4711.14 1 57.8351 4526.357 57.5592 23 2 2 78.10999751091 1.33100003004074 1.33100003004074 sp|Q8WYA0|IFT81_HUMAN Intraflagellar transport protein 81 homolog OS=Homo sapiens GN=IFT81 PE=1 SV=1 0 15.8700004220009 SEMVKKLYSLVSEKKSALASVIKELRQLR Oxidation(M)@3; acrolein addition +76(K)@15 cleaved M-S@N-term; missed K-K@5; missed K-L@6; missed K-K@14; missed K-S@15; missed K-E@23; missed R-Q@26 0.156919002532959 3425.10498046875 571.8581 3424.94799804688 571.831970214844 6 5 1.1.1.5252.11 1 71.7511 26628.07 71.4779 24 2 2 72.1300005912781 1.79800000041723 1.79800000041723 sp|Q96Q35|AL2SB_HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein OS=Homo sapiens GN=ALS2CR12 PE=1 SV=2 2 99.0000009536743 LASITVSK MDA adduct +54(K)@8 0.00707818008959293 871.508666992188 436.7616 871.50146484375 436.758026123047 2 9 1.1.1.3670.3 1 31.5847 2484.399 31.3375 24 2 2 72.1300005912781 1.79800000041723 1.79800000041723 sp|Q96Q35|AL2SB_HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein OS=Homo sapiens GN=ALS2CR12 PE=1 SV=2 0.000434511806815863 24.3900001049042 WSKQKAKWKKDEKFERENILLQQKKKMTK MDA adduct +62(K)@10; MDA adduct +62(K)@13; acrolein addition +56(K)@26; reduced acrolein addition +58(K)@29 missed K-Q@3; missed K-A@5; missed K-W@7; missed K-K@9; missed K-D@10; missed K-F@13; missed R-E@16; missed K-K@24; missed K-K@25; missed K-M@26 0.274628013372421 3942.4453125 658.0815 3942.17065429688 658.035705566406 6 6 1.1.1.5312.21 1 73.3612 507.8737 73.4471 24 2 2 72.1300005912781 1.79800000041723 1.79800000041723 sp|Q96Q35|AL2SB_HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein OS=Homo sapiens GN=ALS2CR12 PE=1 SV=2 0 99.0000009536743 LASITVSK MDA adduct +54(K)@8 0.00286689004860818 871.504455566406 436.7595 871.50146484375 436.758026123047 2 10 1.1.1.3663.4 0 31.4172 2496.615 31.3375 24 2 2 72.1300005912781 1.79800000041723 1.79800000041723 sp|Q96Q35|AL2SB_HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein OS=Homo sapiens GN=ALS2CR12 PE=1 SV=2 0 68.8700020313263 LASITVSK Dehydrated(S)@3; acrolein addition +38(K)@8 0.00988904014229774 837.505859375 419.7602 837.496032714844 419.755279541016 2 6 1.1.1.3657.3 1 31.2706 594.2272 31.3134 24 2 2 72.1300005912781 1.79800000041723 1.79800000041723 sp|Q96Q35|AL2SB_HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein OS=Homo sapiens GN=ALS2CR12 PE=1 SV=2 0 57.7600002288818 LASITVSK MDA adduct +54(K)@8 0.00286689004860818 871.504455566406 436.7595 871.50146484375 436.758026123047 2 10 1.1.1.3656.4 1 31.2532 2496.615 31.3375 24 2 2 72.1300005912781 1.79800000041723 1.79800000041723 sp|Q96Q35|AL2SB_HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein OS=Homo sapiens GN=ALS2CR12 PE=1 SV=2 0 47.6300001144409 LASITVSK acrolein addition +56(K)@8 -0.0314645990729332 873.485656738281 437.7501 873.517150878906 437.765838623047 2 6 1.1.1.3663.5 1 31.4189 589.1926 31.41 24 2 2 72.1300005912781 1.79800000041723 1.79800000041723 sp|Q96Q35|AL2SB_HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein OS=Homo sapiens GN=ALS2CR12 PE=1 SV=2 0 43.1800007820129 LASITVSK MDA adduct +54(K)@8 0.00286689004860818 871.504455566406 436.7595 871.50146484375 436.758026123047 2 10 1.1.1.3649.5 1 31.0876 2110.06 31.2651 24 2 2 72.1300005912781 1.79800000041723 1.79800000041723 sp|Q96Q35|AL2SB_HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein OS=Homo sapiens GN=ALS2CR12 PE=1 SV=2 0 17.9800003767014 LASITVSK acrolein addition +38(K)@8 0.012346999719739 855.518859863281 428.7667 855.506591796875 428.760559082031 2 6 1.1.1.3723.3 1 32.8741 404.5322 32.9394 24 2 2 72.1300005912781 1.79800000041723 1.79800000041723 sp|Q96Q35|AL2SB_HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein OS=Homo sapiens GN=ALS2CR12 PE=1 SV=2 0 17.7499994635582 LASITVSK acrolein addition +38(K)@8 0.00752539001405239 855.514099121094 428.7643 855.506591796875 428.760559082031 2 6 1.1.1.3691.4 1 32.0983 20825.55 31.8475 24 2 2 72.1300005912781 1.79800000041723 1.79800000041723 sp|Q96Q35|AL2SB_HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein OS=Homo sapiens GN=ALS2CR12 PE=1 SV=2 0 16.0400003194809 LASITVSK acrolein addition +38(K)@8 0.00813572015613317 855.5146484375 428.7646 855.506591796875 428.760559082031 2 5 1.1.1.3744.3 1 33.39 440.8268 33.1841 25 2 2 57.4199974536896 2.3259999230504 2.3259999230504 sp|P02748|CO9_HUMAN Complement component C9 OS=Homo sapiens GN=C9 PE=1 SV=2 2 99.0000009536743 AIEDYINEFSVRK missed R-K@12 -0.000968613021541387 1582.79821777344 528.6067 1582.79907226563 528.606994628906 3 8 1.1.1.4249.4 1 45.9149 289.2541 45.9082 26 2 2 58.1799983978271 10.9099999070168 10.9099999070168 sp|P81605|DCD_HUMAN; cont|000124 Dermcidin OS=Homo sapiens GN=DCD PE=1 SV=2; spt|P81605| Dermcidin precursor (Preproteolysin) (Contains: Survival-promoting peptide; DCD-1) [Homo sapiens (contaminant)] 2 99.0000009536743 SSLLEKGLDGAK missed K-G@6 -0.00678837997838855 1216.65966796875 406.5605 1216.66625976563 406.562713623047 3 8 1.1.1.3685.3 1 31.9522 323.6546 31.9213 27 2 2 29.6400010585785 1.31700001657009 1.31700001657009 sp|P19827|ITIH1_HUMAN Inter-alpha-trypsin inhibitor heavy chain H1 OS=Homo sapiens GN=ITIH1 PE=1 SV=3 2 99.0000009536743 AAISGENAGLVR -0.000575407990254462 1156.61950683594 579.317 1156.61999511719 579.317321777344 2 11 1.1.1.3564.6 1 29.0422 252.8991 29.077 28 2 2 48.7300008535385 2.53800004720688 2.53800004720688 sp|P07358|CO8B_HUMAN Complement component C8 beta chain OS=Homo sapiens GN=C8B PE=1 SV=3 2 99.0000009536743 SQVRCEGFVCAQTGR Carbamidomethyl(C)@5; Carbamidomethyl(C)@10 missed R-C@4 -0.00828184001147747 1753.79052734375 585.6041 1753.798828125 585.606872558594 3 17 1.1.1.3496.2 1 27.5306 114.3264 27.5109 28 2 2 48.7300008535385 2.53800004720688 2.53800004720688 sp|P07358|CO8B_HUMAN Complement component C8 beta chain OS=Homo sapiens GN=C8B PE=1 SV=3 0 17.849999666214 TPQTQGK reduced acrolein addition +96(K)@7 cleaved Y-T@N-term 0.0610555000603199 854.510864257813 428.2627 854.449768066406 428.232177734375 2 4 1.1.1.5531.2 1 79.3066 207.7467 79.2735 29 2 2 100 10.8400002121925 10.8400002121925 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 2 99.0000009536743 IKQSELSAK missed K-Q@2 -0.00690085999667645 1002.56408691406 502.2893 1002.57098388672 502.292755126953 2 12 1.1.1.1692.2 1 12.3202 308.8871 12.2491 29 2 2 100 10.8400002121925 10.8400002121925 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 0.000434511806815863 48.8499999046326 TPDVSSALDKLKEFGNTLEDKAR cleaved G-T@N-term; missed K-L@10; missed K-E@12; missed K-A@21 -0.00178613001480699 2533.30102539063 634.3325 2533.30249023438 634.332885742188 4 6 1.1.1.4518.10 1 52.885 376.3936 52.9246 29 2 2 100 10.8400002121925 10.8400002121925 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 0 99.0000009536743 IKQSELSAK missed K-Q@2 -0.00671776011586189 1002.56427001953 502.2894 1002.57098388672 502.292755126953 2 12 1.1.1.1673.2 1 12.1507 347.9855 12.2101 30 2 2 97.8500008583069 11.8299998342991 11.8299998342991 sp|P05109|S10A8_HUMAN Protein S100-A8 OS=Homo sapiens GN=S100A8 PE=1 SV=1 2 99.0000009536743 LLETECPQYIR Carbamidomethyl(C)@6 0.00143438996747136 1420.70349121094 711.359 1420.70202636719 711.358276367188 2 10 1.1.1.3831.17 1 35.614 168.5231 35.6193 31 2 2 58.1300020217896 11.2499997019768 11.2499997019768 cont|000052 gi|7528205|gb|AAF63191.1| kappa-casein [Bos grunniens (contaminant)] 2 99.0000009536743 SPAQILQWQVLSNTVPAK 0.00238612992689013 1979.08666992188 660.7028 1979.083984375 660.701965332031 3 11 1.1.1.4520.10 1 52.9355 931.5985 53.001 31 2 2 58.1300020217896 11.2499997019768 11.2499997019768 cont|000052 gi|7528205|gb|AAF63191.1| kappa-casein [Bos grunniens (contaminant)] 0 35.3700011968613 SPAQILQWQVLSNTVPAK 0.00238612992689013 1979.08666992188 660.7028 1979.083984375 660.701965332031 3 7 1.1.1.4527.8 1 53.1151 931.5985 53.001 32 2 2 16.329999268055 16.329999268055 16.329999268055 sp|P02766|TTHY_HUMAN Transthyretin OS=Homo sapiens GN=TTR PE=1 SV=1 2 99.0000009536743 RYTIAALLSPYSYSTTAVVTNPKE missed R-Y@1; missed K-E@23 -0.00900845043361187 2644.36572265625 882.4625 2644.37475585938 882.465576171875 3 13 1.1.1.4524.15 1 53.0443 341.9344 53.1311