N Unused Total %Cov %Cov(50) %Cov(95) Accessions Names Used Annotation Contrib Conf Sequence Modifications Cleavages dMass Prec MW Prec m/z Theor MW Theor m/z Theor z Sc Spectrum Specific Time PrecursorSignal PrecursorElution 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AEFVEVTK -0.00180416996590793 921.478881835938 461.7467 921.480773925781 461.747650146484 2 10 1.1.1.4195.5 1 33.8467 909.8633 33.9819 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 -3.67772991012316E-05 1691.9345703125 564.9855 1691.9345703125 564.985473632813 3 21 1.1.1.5216.3 1 58.2509 15716.37 58.1971 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@14 missed K-L@5 -0.00723415985703468 2497.17602539063 625.3013 2497.18359375 625.303161621094 4 18 1.1.1.5013.4 1 53.2968 6132.494 53.3874 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 -0.00748074008151889 2866.41357421875 574.29 2866.42114257813 574.29150390625 5 19 1.1.1.4962.9 1 52.0524 5976.807 52.0173 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.00579555006697774 2994.51025390625 749.6348 2994.51611328125 749.636291503906 4 29 1.1.1.4885.3 1 50.1695 2778.971 50.2821 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 -0.0232532992959023 3990.09448242188 666.023 3990.11767578125 666.02685546875 6 15 1.1.1.5125.7 1 55.9909 1243.915 56.0587 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25; missed K-H@34 -0.0230091996490955 4480.396484375 747.74 4480.41943359375 747.743835449219 6 24 1.1.1.5008.7 1 53.1787 856.166 53.215 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ALKAWSVAR missed K-A@3 0.00152340997010469 1000.58349609375 501.299 1000.58178710938 501.298187255859 2 15 1.1.1.4119.4 1 32.128 1535.672 32.1331 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ATEEQLKTVMENFVAFVDK missed K-T@7 0.000672472000587732 2198.09350585938 733.7051 2198.09301757813 733.704895019531 3 32 1.1.1.5533.6 1 65.9945 1546.27 65.9777 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 -0.0130693996325135 4106.85986328125 822.3793 4106.87353515625 822.381958007813 5 35 1.1.1.5429.3 1 63.424 1058.439 63.4653 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1 missed K-F@6 7.16137001290917E-05 1194.58166503906 598.2981 1194.58154296875 598.298034667969 2 16 1.1.1.4000.5 1 29.4077 2225.702 29.3431 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCAADDKEACFAVEGPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@10 missed K-E@7 -0.00445888005197048 1926.78662109375 643.2695 1926.791015625 643.270935058594 3 21 1.1.1.4206.12 1 34.1207 2313.591 34.1976 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTESLVNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 -0.00159813999198377 1137.48901367188 569.7518 1137.49072265625 569.752624511719 2 15 1.1.1.3998.9 1 29.359 13099.8 29.3674 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 -0.00895894039422274 2999.38500976563 750.8535 2999.39404296875 750.855773925781 4 19 1.1.1.4761.9 1 47.1767 6606.787 47.0376 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12; Carbamidomethyl(C)@39 missed R-R@9; missed K-A@25; missed K-L@30 -0.0224195998162031 5478.54443359375 914.098 5478.56689453125 914.101745605469 6 16 1.1.1.5121.14 1 55.8944 575.0011 55.8797 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-M@9 -0.010347000323236 2871.29223632813 718.8303 2871.30224609375 718.832885742188 4 18 1.1.1.5087.3 1 55.034 1830.522 55.0054 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30 -0.0264826994389296 4392.078125 733.0203 4392.1044921875 733.024658203125 6 16 1.1.1.5207.3 1 58.029 1277.08 58.074 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 -0.0270924996584654 4720.2880859375 787.722 4720.3154296875 787.726501464844 6 19 1.1.1.5149.3 1 56.5896 1415.449 56.5851 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DAFLGSFLYEYSR 0.00400365982204676 1566.73950195313 784.377 1566.73547363281 784.375 2 22 1.1.1.5348.3 1 61.4512 406.2365 61.4647 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DAFLGSFLYEYSRRHPEYAVSVLLR missed R-R@13; missed R-H@14 -0.0167468003928661 2987.51245117188 747.8854 2987.529296875 747.8896484375 4 13 1.1.1.5365.5 1 61.8509 807.6016 61.8693 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DAIPENLPPLTADFAEDK 0.0106266997754574 1954.96301269531 978.4888 1954.95239257813 978.483459472656 2 14 1.1.1.5079.6 1 54.8511 860.4998 54.8851 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@21 missed K-D@18 -0.00323431007564068 2457.17016601563 820.064 2457.17333984375 820.065063476563 3 22 1.1.1.4993.6 1 52.8126 4607.725 52.7739 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DAIPENLPPLTADFAEDKDVCKNYQEAK Carbamidomethyl(C)@21 missed K-D@18; missed K-N@22 -0.0019833599217236 3190.51098632813 798.635 3190.51293945313 798.635498046875 4 22 1.1.1.4926.5 1 51.1757 513.6558 51.2296 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DDPHACYSTVFDKLK Carbamidomethyl(C)@6 missed K-L@13 -0.00175292999483645 1794.82299804688 599.2816 1794.82470703125 599.282165527344 3 22 1.1.1.4649.6 1 44.5292 1165.81 44.5138 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ECCDKPLLEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@3 0.00136915000621229 1290.59631347656 646.3054 1290.59484863281 646.3046875 2 13 1.1.1.3965.6 1 28.6031 420.8877 28.6579 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ECCHGDLLECADDRADLAK Carbamidomethyl(C)@2; Carbamidomethyl(C)@3; Carbamidomethyl(C)@10 missed R-A@14 -0.00929195992648602 2246.92602539063 562.7388 2246.935546875 562.741149902344 4 14 1.1.1.4354.15 1 37.6825 2183.222 37.7394 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 EKVLTSSAR missed K-V@2 0.00178895995486528 989.55224609375 495.7834 989.550537109375 495.782562255859 2 13 1.1.1.3543.2 1 21.6256 1050.789 21.5571 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ETYGDMADCCEK Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.00324878003448248 1477.51928710938 739.7669 1477.51599121094 739.765258789063 2 16 1.1.1.4039.7 1 30.3017 771.3379 30.3585 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 EYEATLEECCAK Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.0058946399949491 1501.61242675781 751.8135 1501.6064453125 751.810546875 2 20 1.1.1.4143.5 1 32.6237 1600.776 32.724 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVK Carbamidomethyl(C)@24 missed K-D@2; missed K-G@10 -0.0215969998389483 3721.83862304688 621.3137 3721.8603515625 621.317321777344 6 21 1.1.1.5378.3 1 62.171 485.6755 62.1911 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAK Carbamidomethyl(C)@24 missed K-D@2; missed K-G@10; missed K-L@31 -0.0259282998740673 4866.447265625 812.0818 4866.47314453125 812.086120605469 6 33 1.1.1.5595.3 1 67.4287 690.379 67.4643 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HLVDEPQNLIK 0.000999373034574091 1304.70983886719 653.3622 1304.70886230469 653.361694335938 2 19 1.1.1.4364.7 1 37.9296 22107.27 37.9109 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HLVDEPQNLIKQNCDQFEK Carbamidomethyl(C)@14 missed K-Q@11 0.00586458016186953 2354.13842773438 785.7201 2354.13256835938 785.718078613281 3 29 1.1.1.4538.4 1 41.9202 731.7891 42.02 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@14 missed K-Q@11; missed K-L@19 -0.0201239008456469 3814.89013671875 763.9853 3814.91015625 763.989318847656 5 19 1.1.1.5146.3 1 56.5157 2566.955 56.5851 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HPEYAVSVLLR 0.00401367992162704 1282.70751953125 642.361 1282.70336914063 642.358947753906 2 18 1.1.1.4706.3 1 45.8448 1874.853 45.8343 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HPYFYAPELLYYANK 0.00641976995393634 1887.92590332031 630.3159 1887.91955566406 630.313781738281 3 19 1.1.1.5075.2 1 54.747 638.4885 54.7177 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@23; Carbamidomethyl(C)@24; Carbamidomethyl(C)@32 missed K-Y@15; missed K-G@29 -0.0297625996172428 4355.98193359375 872.2037 4356.01171875 872.209655761719 5 28 1.1.1.5235.4 1 58.7227 1717.518 58.7886 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 IETMREKVLTSSAR Oxidation(M)@4 missed R-E@5; missed K-V@7 -0.00532478978857398 1635.85632324219 546.2927 1635.86145019531 546.29443359375 3 18 1.1.1.3891.3 1 27.1437 680.0102 27.1969 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KQTALVELLK missed K-Q@1 0.00228354008868337 1141.70922851563 571.8619 1141.70703125 571.860778808594 2 17 1.1.1.4578.4 1 42.8677 10766.2 42.6833 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.00102061999496073 1638.92944335938 547.3171 1638.93041992188 547.317443847656 3 23 1.1.1.4510.4 1 41.2925 37666.88 41.3215 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LAKEYEATLEECCAK Carbamidomethyl(C)@12; Carbamidomethyl(C)@13 missed K-E@3 -0.00429147994145751 1813.818359375 605.6134 1813.82263183594 605.614807128906 3 21 1.1.1.4239.9 1 34.91 1449.797 34.8912 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LCVLHEKTPVSEK Carbamidomethyl(C)@2 missed K-T@7 -0.00581779005005956 1538.80676269531 513.9429 1538.81262207031 513.94482421875 3 20 1.1.1.4077.2 1 31.2162 1866.156 31.1265 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LCVLHEKTPVSEKVTK Carbamidomethyl(C)@2 missed K-T@7; missed K-V@13 -0.00638836994767189 1867.01733398438 467.7616 1867.02368164063 467.763214111328 4 20 1.1.1.4083.3 1 31.3135 3078.15 31.3981 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LFTFHADICTLPDTEK Carbamidomethyl(C)@9 0.00258371001109481 1906.91613769531 636.646 1906.91345214844 636.645080566406 3 20 1.1.1.4925.5 1 51.1413 1502.176 51.0586 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LGEYGFQNALIVR 0.00044261000584811 1478.78869628906 740.4016 1478.78820800781 740.4013671875 2 18 1.1.1.4999.5 1 52.9517 816.4841 52.9209 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-E@2 -0.00570486998185515 1531.76794433594 511.5966 1531.77380371094 511.598541259766 3 21 1.1.1.3979.4 1 28.938 9398.192 28.8278 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKHLVDEPQNLIK missed K-H@2 7.23838966223411E-05 1545.88806152344 516.3033 1545.88781738281 516.30322265625 3 12 1.1.1.4327.13 1 37.0114 605.7226 37.0232 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00761483982205391 2665.31298828125 534.0699 2665.32104492188 534.071472167969 5 21 1.1.1.4952.7 1 51.8063 2129.188 51.7195 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0218263994902372 3573.77490234375 596.6364 3573.79663085938 596.640075683594 6 19 1.1.1.5143.3 1 56.4414 2783.995 56.5111 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LRCASIQKFGER Carbamidomethyl(C)@3 missed R-C@2; missed K-F@8 -0.00364878005348146 1463.76306152344 488.9283 1463.76672363281 488.929504394531 3 15 1.1.1.4033.3 1 30.2044 545.0602 30.2486 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 -0.00129398005083203 1749.96508789063 584.329 1749.96655273438 584.329467773438 3 21 1.1.1.4391.6 1 38.5734 2624.285 38.4595 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.0126122003421187 2520.40771484375 631.1092 2520.42041015625 631.112365722656 4 17 1.1.1.5235.2 1 58.7193 843.3934 58.6417 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LVNELTEFAK 0.00380673003382981 1162.62731933594 582.3209 1162.62341308594 582.318969726563 2 15 1.1.1.4751.4 1 46.921 7535.977 46.9159 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LVVSTQTALA 0.00502914004027843 1001.58068847656 501.7976 1001.57568359375 501.795135498047 2 13 1.1.1.4588.5 1 43.1047 10108.7 43.0624 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNR Carbamidomethyl(C)@3 0.00655229017138481 1723.83386230469 862.9242 1723.82727050781 862.920959472656 2 25 1.1.1.5323.3 1 60.8953 1151.071 60.885 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14 -0.00626832991838455 2603.28466796875 651.8284 2603.291015625 651.830017089844 4 18 1.1.1.5461.3 1 64.2061 1293.456 64.3205 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 -0.0128667997196317 3244.61669921875 649.9306 3244.62939453125 649.933166503906 5 23 1.1.1.5382.2 1 62.2734 2180.402 62.3196 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21; missed K-V@27 -0.0226202998310328 3572.81811523438 715.5709 3572.84057617188 715.575378417969 5 14 1.1.1.5310.6 1 60.5768 1243.11 60.6436 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 NECFLSHKDDSPDLPK Carbamidomethyl(C)@3 missed K-D@8 -0.00786911975592375 1900.8544921875 476.2209 1900.86254882813 476.222900390625 4 17 1.1.1.4265.6 1 35.5219 2181.966 35.5353 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 NYQEAKDAFLGSFLYEYSR missed K-D@6 -0.00478373980149627 2300.07006835938 767.6973 2300.07495117188 767.698913574219 3 27 1.1.1.5150.4 1 56.6189 3811.453 56.7067 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 NYQEAKDAFLGSFLYEYSRR missed K-D@6; missed R-R@19 -0.00441156001761556 2456.17138671875 819.7311 2456.17602539063 819.732604980469 3 19 1.1.1.5083.4 1 54.9421 870.2523 54.9572 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QEPERNECFLSHKDDSPDLPK Gln->pyro-Glu@N-term; Carbamidomethyl(C)@8 missed R-N@5; missed K-D@13 -0.0133445002138615 2523.12060546875 631.7874 2523.13354492188 631.790710449219 4 18 1.1.1.4358.13 1 37.7779 1883.445 37.8633 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QNCDQFEK Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 0.00119714997708797 1050.40881347656 526.2117 1050.40771484375 526.211120605469 2 12 1.1.1.4030.6 1 30.1259 677.7266 29.8639 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 missed K-L@8 -0.00508718006312847 2511.18017578125 838.0673 2511.18530273438 838.069030761719 3 13 1.1.1.5218.6 1 58.3028 1848.59 58.0491 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QNCDQFEKLGEYGFQNALIVRYTR Carbamidomethyl(C)@3 missed K-L@8; missed R-Y@21 0.000917812983971089 2948.42504882813 738.1135 2948.423828125 738.11328125 4 18 1.1.1.5060.3 1 54.4089 707.6438 54.4257 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QTALVELLK Gln->pyro-Glu@N-term 0.00543332006782293 996.591064453125 499.3028 996.585571289063 499.300048828125 2 12 1.1.1.5305.3 1 60.4534 1115.235 60.4227 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QTALVELLKHKPK missed K-H@9 -0.00032049001310952 1503.91333007813 502.3117 1503.91369628906 502.311828613281 3 14 1.1.1.4347.7 1 37.5058 3749.752 37.6139 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPEYAVSVLLR missed R-H@1 0.000889646005816758 1438.80541992188 480.6091 1438.80444335938 480.608764648438 3 19 1.1.1.4446.5 1 39.8422 16512.55 39.7555 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPYFYAPELLYYANK missed R-H@1 0.00139193003997207 2044.02221679688 682.348 2044.02062988281 682.347534179688 3 19 1.1.1.4948.10 1 51.7052 2583.051 51.7935 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25 missed R-H@1; missed K-Y@16 -0.0108551997691393 3772.69702148438 755.5467 3772.7080078125 755.548828125 5 19 1.1.1.5097.5 1 55.2833 409.7184 55.3017 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0228822007775307 4512.08984375 753.0223 4512.11279296875 753.026123046875 6 31 1.1.1.5132.4 1 56.1649 3099.552 56.1591 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMR Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30; missed K-I@37 -0.0294797997921705 5142.39990234375 858.0739 5142.4287109375 858.078735351563 6 16 1.1.1.5187.9 1 57.5227 721.0106 57.5633 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 -0.00153244996909052 1879.91235351563 627.6447 1879.91381835938 627.645202636719 3 21 1.1.1.4657.8 1 44.7044 7823.431 44.757 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SHCIAEVEK Carbamidomethyl(C)@3 0.000568101007957011 1071.50244140625 536.7585 1071.501953125 536.758239746094 2 14 1.1.1.3805.4 1 25.5412 299.8829 25.2996 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SHCIAEVEKDAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@3; Carbamidomethyl(C)@30 missed K-D@9; missed K-D@27 -0.014915400184691 3510.64965820313 878.6697 3510.66479492188 878.673461914063 4 24 1.1.1.4940.8 1 51.5094 2009.563 51.5475 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00295363995246589 1418.68933105469 710.3519 1418.68640136719 710.350463867188 2 19 1.1.1.4725.5 1 46.3015 9549.191 46.4332 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SLHTLFGDELCKVASLR Carbamidomethyl(C)@11 missed K-V@12 -0.00243928004056215 1945.00659179688 487.2589 1945.00915527344 487.259552001953 4 22 1.1.1.5072.2 1 54.6738 1750.943 54.6461 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 1.71096999110887E-05 1462.58166503906 488.5345 1462.58166503906 488.534515380859 3 18 1.1.1.3586.2 1 22.4673 13659.6 22.4241 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TPVSEKVTK missed K-V@6 0.000931704009417444 987.561096191406 494.7878 987.56005859375 494.787292480469 2 15 1.1.1.3592.2 1 22.5396 1692.162 22.3509 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.00500877015292645 1414.68530273438 708.3499 1414.68029785156 708.347412109375 2 19 1.1.1.4906.9 1 50.6802 487.7842 50.6676 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 -0.0220624003559351 3323.4384765625 831.8669 3323.46069335938 831.872436523438 4 24 1.1.1.4991.7 1 52.7622 1566.46 52.8471 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VASLRETYGDMADCCEK Carbamidomethyl(C)@14; Carbamidomethyl(C)@15 missed R-E@5 -0.0049230600707233 2003.83349609375 668.9518 2003.83874511719 668.953491210938 3 22 1.1.1.4311.10 1 36.6296 728.3771 36.6603 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VHKECCHGDLLECADDR Carbamidomethyl(C)@5; Carbamidomethyl(C)@6; Carbamidomethyl(C)@13 missed K-E@3 -0.0129327997565269 2112.86450195313 529.2234 2112.87744140625 529.226684570313 4 14 1.1.1.4001.6 1 29.4321 190.0623 29.4405 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VHKECCHGDLLECADDRADLAK Carbamidomethyl(C)@5; Carbamidomethyl(C)@6; Carbamidomethyl(C)@13 missed K-E@3; missed R-A@17 -0.0139455003663898 2611.14379882813 653.7932 2611.15771484375 653.796691894531 4 25 1.1.1.4149.8 1 32.7663 1090.045 32.7951 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VPQVSTPTLVEVSR 0.0060050399042666 1510.84143066406 756.428 1510.83544921875 756.425048828125 2 21 1.1.1.4693.8 1 45.5403 3363.475 45.5479 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VTKCCTESLVNR Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-C@3 -0.00254615000449121 1465.69921875 489.5737 1465.70178222656 489.574523925781 3 14 1.1.1.3947.4 1 28.2148 188.7186 28.2199 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -6.68284992570989E-05 1442.63464355469 722.3246 1442.634765625 722.324645996094 2 21 1.1.1.4023.9 1 29.9533 30514.44 29.8396 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 YICDNQDTISSKLKECCDKPLLEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16; Carbamidomethyl(C)@17 missed K-L@12; missed K-E@14 -0.0103265000507236 2956.38745117188 592.2848 2956.39794921875 592.286865234375 5 21 1.1.1.4502.6 1 41.1209 1510.342 41.126 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.67778015136719 97.8600025177002 KQTALVELLKHKPK missed K-Q@1; missed K-H@10 -0.00614963006228209 1632.00256347656 545.0081 1632.00866699219 545.010192871094 3 11 1.1.1.4196.13 1 33.8806 474.5374 33.7902 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.61978900432587 97.5899994373322 DDSPDLPK 0.00171463005244732 885.40966796875 443.7121 885.407958984375 443.711273193359 2 9 1.1.1.4016.2 1 29.7707 1896.547 29.5705 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.56863605976105 97.2699999809265 LVTDLTKVHK missed K-V@7 0.0029638500418514 1152.68969726563 577.3521 1152.68664550781 577.3505859375 2 10 1.1.1.4058.10 1 30.7649 135.126 30.7458 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.55284202098846 99.0000009536743 AFLGSFLYEYSR cleaved D-A@N-term 0.00362234003841877 1451.71203613281 726.8633 1451.70849609375 726.861511230469 2 10 1.1.1.5195.2 1 57.7208 165.4353 57.6901 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.45593166351318 99.0000009536743 FDEKLFTFHADICTLPDTEK acrolein addition +112(K)@4; Carbamidomethyl(C)@13 cleaved A-F@N-term; missed K-L@4 0.0137297995388508 2538.21264648438 847.0781 2538.19873046875 847.073547363281 3 20 1.1.1.5024.5 1 53.579 252.305 53.5596 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.40893566608429 96.0600018501282 DDPHACYSTVFDK Carbamidomethyl(C)@6 0.00387659994885325 1553.6494140625 777.832 1553.64562988281 777.830078125 2 10 1.1.1.4341.20 1 37.3586 167.322 37.339 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.37675070762634 99.0000009536743 EEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK reduced acrolein addition +58(K)@5; acrolein addition +56(K)@17; Carbamidomethyl(C)@18; Carbamidomethyl(C)@19; Carbamidomethyl(C)@27 cleaved T-E@N-term; missed K-T@5; missed K-C@17; missed K-E@24 -0.000986143015325069 4048.85546875 810.7784 4048.85668945313 810.778625488281 5 15 1.1.1.5397.2 1 62.6441 564.8228 62.639 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.438898593187332 63.6300027370453 EACFAVEGPK Carbamidomethyl(C)@3 0.00812541041523218 1106.5146484375 554.2646 1106.50659179688 554.260620117188 2 9 1.1.1.4192.8 1 33.7852 228.2347 33.8141 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.37263411283493 57.5800001621246 YLYEIAR 0.00225556991063058 926.488464355469 464.2515 926.486145019531 464.250366210938 2 11 1.1.1.4370.2 1 38.0647 10027.33 38.1738 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.353596270084381 55.7299971580505 LCVLHEK Carbamidomethyl(C)@2 0.00161977997049689 897.475891113281 449.7452 897.474243164063 449.744384765625 2 10 1.1.1.3961.2 1 28.5034 1283.729 28.4093 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.251037150621414 95.959997177124 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLL MDA adduct +54(K)@16; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; acrolein addition +112(K)@30; Carbamidomethyl(C)@33 cleaved L-P@C-term; missed R-H@1; missed K-Y@16; missed K-G@30 0.0327007994055748 4453.060546875 891.6194 4453.0283203125 891.612915039063 5 11 1.1.1.5164.7 1 56.9564 869.5781 56.9732 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.236571997404099 41.949999332428 YLYEIARR missed R-R@7 0.00397105002775788 1082.59130859375 542.3029 1082.58728027344 542.300903320313 2 10 1.1.1.4184.9 1 33.5951 881.8209 33.6475 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.23284412920475 97.6199984550476 KECCDKPLLEK ONE addition +154(K)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved L-K@N-term; missed K-E@1 0.00436200015246868 1572.79357910156 525.2718 1572.78918457031 525.270324707031 3 15 1.1.1.3994.4 1 29.2619 678.5355 29.3431 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.21896305680275 91.2899971008301 SQKFPKAEFVEVTK ONE addition +154(K)@6 cleaved L-S@N-term; missed K-F@3; missed K-A@6 0.01700060069561 1790.99890136719 598.0069 1790.98181152344 598.001220703125 3 12 1.1.1.4424.8 1 39.3588 0 -1 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.205511957406998 95.2499985694885 PVSEKVTK cleaved T-P@N-term; missed K-V@5 0.00147268001455814 886.513854980469 444.2642 886.512390136719 444.263458251953 2 9 1.1.1.3573.2 1 22.215 321.7098 22.3016 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.188424989581108 94.8099970817566 EFVEVTKLVTDLTK acrolein addition +112(K)@7 cleaved A-E@N-term; missed K-L@7 0.0183492004871368 1732.96826171875 867.4914 1732.94982910156 867.482238769531 2 9 1.1.1.5210.6 1 58.1059 385.5196 58.148 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.177178353071213 33.4699988365173 ATEEQLK 0.00304405996575952 817.421264648438 409.7179 817.418151855469 409.716339111328 2 7 1.1.1.3551.2 1 21.7723 130.6759 21.7407 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.175223529338837 33.1699997186661 RHPEYAVSVLLRLAKEYEATLEECCAK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25 missed R-H@1; missed R-L@12; missed K-E@15 -0.000728885992430151 3234.6162109375 809.6613 3234.61645507813 809.661437988281 4 11 1.1.1.5379.10 1 62.2029 222.3052 62.1911 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.146301791071892 28.5600006580353 IETMREK missed R-E@5 0.000819794018752873 905.46484375 453.7397 905.464050292969 453.739288330078 2 10 1.1.1.3463.2 1 20.628 485.3379 20.6092 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.120904117822647 24.2899999022484 NECFLSHK Carbamidomethyl(C)@3 0.00301839993335307 1033.46801757813 517.7413 1033.46508789063 517.739807128906 2 9 1.1.1.3964.4 1 28.5782 159.5539 28.5832 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.040958609431982 99.0000009536743 AEFVEVTKLVTDLTKVH Amidated@C-term cleaved H-K@C-term; missed K-L@8; missed K-V@15 0.000212653001653962 1927.07788085938 643.3666 1927.07788085938 643.366577148438 3 11 1.1.1.5203.3 1 57.9278 103.8988 57.9223 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.0250280071049929 70.6700026988983 TCVADESHAG Carbamidomethyl(C)@2 cleaved G-C@C-term 0.00365504994988441 1045.41711425781 523.7158 1045.41345214844 523.713989257813 2 9 1.1.1.3580.3 1 22.3208 108.9342 22.3259 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.0186344906687737 25.9099990129471 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26; missed K-L@36 -0.0251745991408825 5106.40869140625 1022.289 5106.43359375 1022.2939453125 5 12 1.1.1.5364.8 1 61.8401 370.9325 61.8452 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.0159229654818773 90.6599998474121 KAFDEKLFTFHADICTLPDTEKQIK acrolein addition +76(K)@1; acrolein addition +94(K)@6; Carbamidomethyl(C)@15 cleaved P-K@N-term; missed K-A@1; missed K-L@6; missed K-Q@22 -0.0336145982146263 3164.5556640625 792.1462 3164.58935546875 792.154602050781 4 13 1.1.1.4961.12 1 52.0297 657.2726 52.0173 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.0114410435780883 33.9300006628037 SIQKFGER cleaved A-S@N-term; missed K-F@4 0.000506866024807096 963.514282226563 482.7644 963.513793945313 482.76416015625 2 5 1.1.1.3998.4 1 29.3507 108.1776 29.3431 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00966114550828934 93.9599990844727 HAGCEKSLHTLFGDELCK reduced HNE(H)@1; Carbamidomethyl(C)@4; MDA adduct +54(K)@6; Carbamidomethyl(C)@17 cleaved S-H@N-term; missed K-S@6 -0.00105096003971994 2313.1123046875 772.0447 2313.11328125 772.045043945313 3 14 1.1.1.4732.7 1 46.4712 775.1885 46.4813 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00788851175457239 66.2699997425079 VSEKVTK acrolein addition +56(K)@4; acrolein addition +38(K)@7 cleaved P-V@N-term; missed K-V@4 0.0140223996713758 883.515502929688 442.765 883.50146484375 442.758026123047 2 10 1.1.1.4283.5 1 35.9551 17392.01 36.0871 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00436480529606342 24.2200002074242 ICTLPDTEK Carbamidomethyl(C)@2 cleaved D-I@N-term 0.00752753997221589 1075.52941894531 538.772 1075.52197265625 538.768249511719 2 7 1.1.1.4059.9 1 30.7891 151.2759 30.7699 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00392634514719248 87.7300024032593 VDEPQNLIKQNCDQFEKLGEYGFQNALIVR acrolein addition +76(K)@9; Carbamidomethyl(C)@12; MDA adduct +54(K)@17; Deamidated(N)@25 cleaved L-V@N-term; missed K-Q@9; missed K-L@17 0.0704395994544029 3695.86352539063 740.18 3695.79296875 740.165893554688 5 13 1.1.1.4964.8 1 52.1041 4515.183 51.917 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00261361571028829 88.129997253418 LSQKFPK Oxidation(F)@5 missed K-F@4 0.00230476004071534 862.49365234375 432.2541 862.491271972656 432.252899169922 2 10 1.1.1.3821.3 1 25.8517 587.7347 25.939 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00217691925354302 82.6200008392334 KAFDEKLFTFHADICTLPDTEK acrolein addition +76(K)@1; acrolein addition +94(K)@6; Carbamidomethyl(C)@15 cleaved P-K@N-term; missed K-A@1; missed K-L@6 -0.040124598890543 2795.3115234375 932.7778 2795.3515625 932.791137695313 3 9 1.1.1.5016.16 1 53.3782 234.307 53.3874 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00130484171677381 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Dehydrated(E)@8; Deamidated(R)@9; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.016882399097085 3749.71752929688 750.9508 3749.734375 750.954162597656 5 17 1.1.1.5363.5 1 61.8043 465.996 61.8211 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.000869458774104714 67.1899974346161 DTHKSEIAHR acrolein addition +94(K)@4; Phospho(S)@5 missed K-S@4 0.00720081990584731 1366.61022949219 456.544 1366.60302734375 456.541625976563 3 11 1.1.1.3576.2 1 22.2591 232.0479 22.2949 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.000434511806815863 78.1799972057343 LKAWSVAR acrolein addition +112(K)@2; Dioxidation(W)@4 cleaved A-L@N-term; missed K-A@2 0.00788689032196999 1073.59484863281 537.8047 1073.5869140625 537.800720214844 2 11 1.1.1.4095.2 1 31.5954 452.4977 31.636 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.000434511806815863 97.0200002193451 TKCCTESLVNR Acetyl@N-term; hexanoyl addition +98(K)@2; Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved V-T@N-term; missed K-C@2 0.00758477998897433 1506.724609375 503.2488 1506.71704101563 503.246307373047 3 16 1.1.1.3990.4 1 29.1617 365.8067 29.1418 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.2200026512146 AEFVEVTK 0.00356680992990732 921.484252929688 461.7494 921.480773925781 461.747650146484 2 12 1.1.1.4144.2 1 32.6476 20316.77 32.7714 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 92.3099994659424 AEFVEVTK 0.00399404997006059 921.484680175781 461.7496 921.480773925781 461.747650146484 2 9 1.1.1.4185.6 1 33.6137 545.1457 33.4343 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 85.5300009250641 AEFVEVTK Oxidation(F)@3 0.0061273998580873 937.481872558594 469.7482 937.475646972656 469.7451171875 2 10 1.1.1.4148.4 1 32.736 847.3431 32.7951 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 71.2199985980988 AEFVEVTK 0.00179682997986674 921.482482910156 461.7485 921.480773925781 461.747650146484 2 10 1.1.1.4160.9 1 33.0237 20949.4 32.7714 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 48.7100005149841 AEFVEVTK 0.00356680992990732 921.484252929688 461.7494 921.480773925781 461.747650146484 2 11 1.1.1.4152.3 1 32.8316 20316.77 32.7714 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 44.8300004005432 AEFVEVTK Oxidation(F)@3 0.0061273998580873 937.481872558594 469.7482 937.475646972656 469.7451171875 2 9 1.1.1.4153.5 1 32.8578 847.3431 32.7951 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 25.3100007772446 AEFVEVTK 0.00417714985087514 921.48486328125 461.7497 921.480773925781 461.747650146484 2 9 1.1.1.4173.3 1 33.3287 1081.493 33.0794 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.00293978000991046 1691.9375 846.976 1691.9345703125 846.974548339844 2 25 1.1.1.5209.9 1 58.0837 17881.65 58.1971 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.00281770993024111 1691.9375 846.976 1691.9345703125 846.974548339844 2 19 1.1.1.5223.5 1 58.4259 19169.58 58.1725 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.0095315296202898 1691.94409179688 846.9793 1691.9345703125 846.974548339844 2 13 1.1.1.5244.5 1 58.9439 380.4761 59.0126 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.0095315296202898 1691.94409179688 846.9793 1691.9345703125 846.974548339844 2 10 1.1.1.5252.4 1 59.1422 380.4761 59.0126 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.2299993038177 AEFVEVTKLVTDLTK GlyGly(T)@7; reduced acrolein addition +96(K)@8 missed K-L@8 0.0254784002900124 1902.06042480469 635.0274 1902.03503417969 635.018920898438 3 12 1.1.1.5211.2 1 58.1279 1020.762 58.1971 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@14 missed K-L@5 -0.000203340998268686 2497.18310546875 833.4017 2497.18359375 833.401794433594 3 24 1.1.1.5013.7 1 53.3018 6583.667 53.3874 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@14 missed K-L@5 -0.00723415985703468 2497.17602539063 625.3013 2497.18359375 625.303161621094 4 21 1.1.1.5020.6 1 53.4683 6132.494 53.3874 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 75.7700026035309 AFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@14; Dicarbamidomethyl(D)@18; reduced acrolein addition +96(K)@21 missed K-L@5 0.0160015001893044 2707.30004882813 677.8323 2707.28393554688 677.828247070313 4 11 1.1.1.5017.8 1 53.3962 418.7882 53.3874 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 -0.00386505993083119 2866.41723632813 956.4797 2866.42114257813 956.48095703125 3 25 1.1.1.4958.16 1 51.9585 2223.319 52.0423 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 -0.00748074008151889 2866.41357421875 574.29 2866.42114257813 574.29150390625 5 19 1.1.1.4961.7 1 52.0255 5976.807 52.0173 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 -0.00748074008151889 2866.41357421875 574.29 2866.42114257813 574.29150390625 5 17 1.1.1.4959.7 1 51.9753 5976.807 52.0173 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 -0.00748074008151889 2866.41357421875 574.29 2866.42114257813 574.29150390625 5 18 1.1.1.4963.6 1 52.0751 5976.807 52.0173 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 -0.00748074008151889 2866.41357421875 574.29 2866.42114257813 574.29150390625 5 17 1.1.1.4964.5 1 52.099 5976.807 52.0173 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 -0.00748074008151889 2866.41357421875 574.29 2866.42114257813 574.29150390625 5 17 1.1.1.4965.5 1 52.1273 5976.807 52.0173 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 -0.0067048198543489 2866.41455078125 717.6109 2866.42114257813 717.612548828125 4 17 1.1.1.4967.10 1 52.1781 7788.096 52.0173 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 -0.00748074008151889 2866.41357421875 574.29 2866.42114257813 574.29150390625 5 14 1.1.1.4960.4 1 51.998 5976.807 52.0173 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.00579555006697774 2994.51025390625 749.6348 2994.51611328125 749.636291503906 4 18 1.1.1.4894.4 1 50.383 2778.971 50.2821 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 86.4499986171722 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14; Dehydrated(T)@19; Deamidated(Q)@22; reduced acrolein addition +58(K)@25 missed K-L@5; missed K-Q@21; missed K-K@24 0.0147091001272202 3035.54614257813 759.8938 3035.53149414063 759.89013671875 4 13 1.1.1.4903.4 1 50.6024 384.1679 50.5708 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 -0.015463599935174 3990.10205078125 799.0277 3990.11767578125 799.030822753906 5 16 1.1.1.5128.3 1 56.0637 1339.807 56.0332 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 68.8099980354309 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 -0.0232532992959023 3990.09448242188 666.023 3990.11767578125 666.02685546875 6 13 1.1.1.5133.2 1 56.1886 1243.915 56.0587 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR missed K-A@3 0.00292718992568552 1000.58489990234 501.2997 1000.58178710938 501.298187255859 2 15 1.1.1.4110.5 1 31.9444 2028.569 31.9562 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR missed K-A@3 0.00152340997010469 1000.58349609375 501.299 1000.58178710938 501.298187255859 2 15 1.1.1.4128.3 1 32.2987 1535.86 32.1331 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.7699995040894 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 -0.000939623976591975 1032.57067871094 517.2926 1032.57165527344 517.293090820313 2 15 1.1.1.4072.3 1 31.0977 8015.439 31.0554 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.7699995040894 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 -0.000939623976591975 1032.57067871094 517.2926 1032.57165527344 517.293090820313 2 15 1.1.1.4080.3 1 31.269 8024.45 31.0317 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.17999792099 ALKAWSVAR Trp->Kynurenin(W)@5 missed K-A@3 -0.000853432982694358 1004.57586669922 503.2952 1004.57672119141 503.295623779297 2 13 1.1.1.4096.6 1 31.6234 1609.592 31.6121 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.1900014877319 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 -0.000939623976591975 1032.57067871094 517.2926 1032.57165527344 517.293090820313 2 13 1.1.1.4064.4 1 30.9039 8015.439 31.0554 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 87.3099982738495 ALKAWSVAR Oxidation(W)@5 missed K-A@3 -0.00126640999224037 1016.57550048828 509.295 1016.57672119141 509.295623779297 2 9 1.1.1.3911.3 1 27.5877 97.5146 27.5202 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 85.5300009250641 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 -0.00191617000382394 1032.56970214844 517.2921 1032.57165527344 517.293090820313 2 10 1.1.1.4121.3 0 32.167 265.8476 32.1568 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 80.1100015640259 ALKAWSVAR Oxidation(W)@5 missed K-A@3 0.00331113999709487 1016.580078125 509.2973 1016.57672119141 509.295623779297 2 9 1.1.1.4042.8 1 30.3768 167.2272 30.3843 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 51.800000667572 ALKAWSVAR Trp->Kynurenin(W)@5 missed K-A@3 -0.00164687004871666 1004.57507324219 503.2948 1004.57672119141 503.295623779297 2 8 1.1.1.4017.3 1 29.8044 243.059 29.8639 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 51.800000667572 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 -0.00191617000382394 1032.56970214844 517.2921 1032.57165527344 517.293090820313 2 7 1.1.1.4122.5 1 32.1991 265.8476 32.1568 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 37.5900000333786 ALKAWSVAR Trp->Hydroxykynurenin(W)@5 missed K-A@3 0.000324930995702744 1020.57189941406 511.2932 1020.57165527344 511.293090820313 2 7 1.1.1.4039.4 1 30.2925 480.6423 30.3325 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 23.0100005865097 ATEEQLK 0.000602710002567619 817.418701171875 409.7166 817.418151855469 409.716339111328 2 9 1.1.1.3434.2 1 20.374 319.0776 20.4015 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 22.4600002169609 ATEEQLK 0.00304405996575952 817.421264648438 409.7179 817.418151855469 409.716339111328 2 9 1.1.1.3515.2 1 21.2381 283.1168 21.1099 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 17.6100000739098 ATEEQLK 0.00279993005096912 817.4208984375 409.7177 817.418151855469 409.716339111328 2 9 1.1.1.3451.2 1 20.5423 400.357 20.553 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK Oxidation(M)@10 missed K-T@7 0.00372116989456117 2214.09155273438 739.0378 2214.087890625 739.036560058594 3 23 1.1.1.5118.4 1 55.8093 1178.147 55.8285 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK Oxidation(M)@10 missed K-T@7 -0.000124009005958214 2214.08764648438 739.0365 2214.087890625 739.036560058594 3 18 1.1.1.5131.4 1 56.1399 886.7576 56.2095 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK missed K-T@7 0.000672472000587732 2198.09350585938 733.7051 2198.09301757813 733.704895019531 3 27 1.1.1.5526.9 1 65.8225 1546.27 65.9777 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK missed K-T@7 0.000672472000587732 2198.09350585938 733.7051 2198.09301757813 733.704895019531 3 27 1.1.1.5540.6 1 66.1703 1546.27 65.9777 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK missed K-T@7 0.00872903969138861 2198.1015625 733.7078 2198.09301757813 733.704895019531 3 28 1.1.1.5548.3 1 66.374 500.7007 66.1036 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 0.00167232996318489 4106.87451171875 1027.726 4106.87353515625 1027.7255859375 4 31 1.1.1.5432.7 1 63.5083 561.4241 63.4893 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 42.9199993610382 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 -0.027267299592495 4122.84130859375 825.5755 4122.8681640625 825.580932617188 5 13 1.1.1.5173.5 1 57.1745 822.6584 57.3152 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 32.7199995517731 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 -0.027267299592495 4122.84130859375 825.5755 4122.8681640625 825.580932617188 5 12 1.1.1.5183.5 1 57.4197 822.6584 57.3152 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1 missed K-F@6 7.16137001290917E-05 1194.58166503906 598.2981 1194.58154296875 598.298034667969 2 14 1.1.1.3993.5 1 29.2334 2225.702 29.3431 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 35.1500004529953 CASIQKFGER Carbamidomethyl(C)@1; Oxidation(F)@7 missed K-F@6 -0.00415997020900249 1210.57238769531 404.5314 1210.57641601563 404.532775878906 3 9 1.1.1.3996.2 1 29.3002 208.0763 29.3431 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 25.4200011491776 CASIQKFGER Carbamidomethyl(C)@1; Deamidated(Q)@5; acrolein addition +56(K)@6 missed K-F@6 0.00849977042526007 1251.60034179688 418.2074 1251.591796875 418.204528808594 3 8 1.1.1.3995.2 1 29.2755 293.8152 29.3431 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCAADDKEACFAVEGPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@10 missed K-E@7 0.00827065017074347 1926.79931640625 964.4069 1926.791015625 964.402770996094 2 21 1.1.1.4207.7 1 34.1446 1187.601 34.2216 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCAADDKEACFAVEGPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@10 missed K-E@7 -0.00372647005133331 1926.78735351563 643.2697 1926.791015625 643.270935058594 3 25 1.1.1.4214.8 1 34.3124 2641.888 34.3175 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 -0.00159813999198377 1137.48901367188 569.7518 1137.49072265625 569.752624511719 2 13 1.1.1.4005.6 1 29.5312 13099.8 29.3674 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.8900005817413 CCTESLVNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 -0.00159813999198377 1137.48901367188 569.7518 1137.49072265625 569.752624511719 2 12 1.1.1.3991.3 1 29.1808 13183.11 29.3674 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 37.5900000333786 CCTESLVNR Carbamidomethyl(C)@1; No Carbamidomethyl(C)@2 0.0052530700340867 1080.47448730469 541.2445 1080.46923828125 541.241882324219 2 10 1.1.1.3996.4 1 29.3085 239.449 29.3674 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 -0.00895894039422274 2999.38500976563 750.8535 2999.39404296875 750.855773925781 4 18 1.1.1.4748.7 1 46.8573 6589.469 47.0376 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 -0.00895894039422274 2999.38500976563 750.8535 2999.39404296875 750.855773925781 4 16 1.1.1.4762.6 1 47.196 6606.787 47.0376 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.8200008869171 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 -0.000911316019482911 2982.36669921875 995.1295 2982.36743164063 995.129760742188 3 18 1.1.1.4920.15 1 51.0273 9995.569 50.9848 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.580002784729 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12; Ser->Oxoalanine(S)@14 missed R-R@9 -0.0113477995619178 2997.36694335938 750.349 2997.37841796875 750.351867675781 4 18 1.1.1.4690.5 1 45.4711 2375.977 45.5479 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.4799990653992 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 -0.00976505037397146 2982.35766601563 746.5967 2982.36743164063 746.59912109375 4 16 1.1.1.4916.6 1 50.9256 927.8187 50.9603 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.5300023555756 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12; Ser->Oxoalanine(S)@14 missed R-R@9 -0.0113477995619178 2997.36694335938 750.349 2997.37841796875 750.351867675781 4 16 1.1.1.4697.5 1 45.6348 2375.977 45.5479 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.650000333786 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 -0.000840749009512365 2999.39306640625 1000.805 2999.39404296875 1000.80523681641 3 13 1.1.1.4757.11 1 47.0815 2892.814 47.0376 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 76.1099994182587 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 -0.00976505037397146 2982.35766601563 746.5967 2982.36743164063 746.59912109375 4 12 1.1.1.4917.9 1 50.9452 927.8187 50.9603 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 76.1099994182587 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 -0.00976505037397146 2982.35766601563 746.5967 2982.36743164063 746.59912109375 4 12 1.1.1.4918.6 1 50.9672 927.8187 50.9603 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 62.4400019645691 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 -0.00976505037397146 2982.35766601563 746.5967 2982.36743164063 746.59912109375 4 11 1.1.1.4920.9 1 51.019 927.8187 50.9603 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 48.7100005149841 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 -0.000840749009512365 2999.39306640625 1000.805 2999.39404296875 1000.80523681641 3 12 1.1.1.4750.12 1 46.9108 2892.814 47.0376 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 44.1500008106232 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 -0.00895894039422274 2999.38500976563 750.8535 2999.39404296875 750.855773925781 4 12 1.1.1.4763.14 1 47.2261 6606.787 47.0376 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12 missed R-M@9 -0.00785276014357805 2887.28979492188 722.8297 2887.29736328125 722.831604003906 4 16 1.1.1.5030.9 1 53.7172 2723.076 53.7818 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12 missed R-M@9 -0.00785276014357805 2887.28979492188 722.8297 2887.29736328125 722.831604003906 4 15 1.1.1.5037.9 1 53.8926 2723.076 53.7818 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 36.4399999380112 CCTKPESERMPCTEDYLSLILNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-M@9 0.00265294988639653 2871.30493164063 958.1089 2871.30224609375 958.108032226563 3 11 1.1.1.5083.5 1 54.9446 1099.751 55.0054 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Dehydrated(T)@3; Deamidated(R)@9; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.0063245901837945 3733.73315429688 747.7539 3733.73950195313 747.755187988281 5 15 1.1.1.5383.3 1 62.2995 694.0944 62.3196 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 46.6699987649918 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.0193489007651806 3766.74145507813 754.3556 3766.76098632813 754.359436035156 5 13 1.1.1.5228.3 1 58.5478 746.3067 58.5679 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 39.4699990749359 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.0213043000549078 3750.74462890625 751.1562 3750.76611328125 751.160461425781 5 12 1.1.1.5292.6 1 60.1296 699.2602 60.1983 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 18.0399999022484 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.0213043000549078 3750.74462890625 751.1562 3750.76611328125 751.160461425781 5 10 1.1.1.5290.5 1 60.0776 699.2602 60.1983 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 -0.0286049991846085 4736.28173828125 790.3876 4736.310546875 790.392333984375 6 16 1.1.1.5122.6 1 55.9135 1671.023 55.8797 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 90.3699994087219 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Dehydrated(T)@3; Deamidated(R)@9; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 -0.0207918006926775 4703.26806640625 784.8853 4703.2890625 784.888793945313 6 12 1.1.1.5215.5 1 58.228 409.4675 58.2957 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 22.1699997782707 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 -0.0220874007791281 4736.28857421875 948.265 4736.310546875 948.269348144531 5 11 1.1.1.5120.11 1 55.8663 885.1208 55.8797 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.00424779020249844 1566.73962402344 784.3771 1566.73547363281 784.375 2 12 1.1.1.5295.2 1 60.2028 8579.357 60.3981 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.00424779020249844 1566.73962402344 784.3771 1566.73547363281 784.375 2 22 1.1.1.5302.2 1 60.3772 8600.433 60.3981 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.00424779020249844 1566.73962402344 784.3771 1566.73547363281 784.375 2 22 1.1.1.5309.3 1 60.5497 8600.433 60.3981 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.00400365982204676 1566.73950195313 784.377 1566.73547363281 784.375 2 22 1.1.1.5316.2 1 60.7213 5881.367 60.4718 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.00717746000736952 1566.74267578125 784.3786 1566.73547363281 784.375 2 22 1.1.1.5323.2 1 60.8912 2249.732 60.6436 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.00778781017288566 1566.74328613281 784.3789 1566.73547363281 784.375 2 22 1.1.1.5333.2 1 61.1096 932.0947 60.9852 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.00839815009385347 1566.74389648438 784.3792 1566.73547363281 784.375 2 15 1.1.1.5368.6 1 61.9267 161.0291 61.9418 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.00766573986038566 1566.74304199219 784.3788 1566.73547363281 784.375 2 10 1.1.1.5375.3 1 62.0944 172.375 62.0643 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR Oxidation(Y)@9 0.0127446996048093 1582.74304199219 792.3788 1582.73034667969 792.372436523438 2 18 1.1.1.5301.5 1 60.355 157.9817 60.3981 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@21 missed K-D@18 -0.00323431007564068 2457.17016601563 820.064 2457.17333984375 820.065063476563 3 24 1.1.1.4986.3 1 52.6379 4607.725 52.7739 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@21 missed K-D@18 -0.00323431007564068 2457.17016601563 820.064 2457.17333984375 820.065063476563 3 23 1.1.1.5000.6 1 52.9846 4607.725 52.7739 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 71.2199985980988 DAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@21 missed K-D@18 -0.00707946997135878 2457.16625976563 820.0627 2457.17333984375 820.065063476563 3 12 1.1.1.5009.8 1 53.205 2634.424 52.9455 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 60.5199992656708 DDPHACYSTVFDK Carbamidomethyl(C)@6 -0.00260490993969142 1553.64306640625 518.8883 1553.64562988281 518.88916015625 3 10 1.1.1.4346.9 1 37.4764 294.7843 37.339 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.7199981212616 DDSPDLPK 0.00171463005244732 885.40966796875 443.7121 885.407958984375 443.711273193359 2 12 1.1.1.4009.2 1 29.6022 1896.547 29.5705 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 23.8499999046326 ECCDKPLLEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@3 -0.00107064994517714 1290.59375 431.2052 1290.59484863281 431.205535888672 3 10 1.1.1.3962.2 1 28.5199 1478.119 28.6331 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 21.8500003218651 EKDAIPENLPPLTADFAEDKDVCK Glu->pyro-Glu@N-term; reduced acrolein addition +58(K)@2; Deamidated(N)@8; Carbamidomethyl(C)@23 cleaved V-E@N-term; missed K-D@2; missed K-D@20 -0.00936768017709255 2755.31689453125 919.4462 2755.326171875 919.449340820313 3 11 1.1.1.4997.16 1 52.9125 418.0641 52.8226 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 20.6699997186661 EKDAIPENLPPLTADFAEDKDVCK Glu->pyro-Glu@N-term; reduced acrolein addition +58(K)@2; Deamidated(N)@8; Carbamidomethyl(C)@23 cleaved V-E@N-term; missed K-D@2; missed K-D@20 -0.0139453001320362 2755.31225585938 919.4447 2755.326171875 919.449340820313 3 11 1.1.1.4990.13 1 52.7428 450.111 52.7982 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.7500011920929 EKVLTSSAR missed K-V@2 0.00221620011143386 989.552856445313 495.7837 989.550537109375 495.782562255859 2 12 1.1.1.3528.2 1 21.4433 754.0227 21.5204 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.4300026893616 EKVLTSSAR Glu->pyro-Glu@N-term missed K-V@2 0.00233111996203661 971.542297363281 486.7784 971.539978027344 486.777282714844 2 12 1.1.1.3921.2 1 27.7402 259.998 27.7761 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.1900014877319 EKVLTSSAR Formyl(K)@2 missed K-V@2 0.00175738998223096 1017.54730224609 509.7809 1017.54547119141 509.779998779297 2 10 1.1.1.3940.5 1 28.0617 132.6456 28.0914 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 92.3099994659424 EKVLTSSAR missed K-V@2 0.00178895995486528 989.55224609375 495.7834 989.550537109375 495.782562255859 2 11 1.1.1.3552.2 1 21.7996 1033.381 21.5812 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 87.3099982738495 EKVLTSSAR Glu->pyro-Glu@N-term; Hydroxytrimethyl(K)@2 missed K-V@2 -0.0124877002090216 1030.57727050781 516.2959 1030.58972167969 516.302124023438 2 13 1.1.1.3646.2 1 23.3322 480.3839 23.2077 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 83.5300028324127 EKVLTSSAR Carbamyl@N-term missed K-V@2 0.0039407298900187 1032.56030273438 517.2874 1032.55639648438 517.285461425781 2 9 1.1.1.3910.4 1 27.5593 140.2155 27.5686 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 83.1700026988983 EKVLTSSAR missed K-V@2 0.00197206996381283 989.552490234375 495.7835 989.550537109375 495.782562255859 2 11 1.1.1.3570.2 1 22.1506 191.9496 22.0653 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 62.4400019645691 EKVLTSSAR Glu->pyro-Glu@N-term; Hydroxytrimethyl(K)@2 missed K-V@2 -0.0124877002090216 1030.57727050781 516.2959 1030.58972167969 516.302124023438 2 11 1.1.1.3637.2 1 23.139 480.3839 23.2077 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.4700008630753 EKVLTSSAR missed K-V@2 1.89792008313816E-05 989.550659179688 495.7826 989.550537109375 495.782562255859 2 10 1.1.1.3560.2 1 21.9822 475.9008 21.7407 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ETYGDMADCCEK Oxidation(M)@6; Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 -0.00152924994472414 1493.50952148438 747.762 1493.51086425781 747.7626953125 2 16 1.1.1.3801.2 1 25.4448 534.0429 25.4981 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ETYGDMADCCEK Oxidation(M)@6; Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 -0.00152924994472414 1493.50952148438 747.762 1493.51086425781 747.7626953125 2 16 1.1.1.3808.4 1 25.6134 534.0429 25.4981 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 89.0900015830994 ETYGDMADCCEK Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.00324878003448248 1477.51928710938 739.7669 1477.51599121094 739.765258789063 2 9 1.1.1.4046.16 1 30.4775 771.3379 30.3585 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.0700000524521 ETYGDMADCCEK Oxidation(M)@6; Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.00213280995376408 1493.51306152344 747.7638 1493.51086425781 747.7626953125 2 9 1.1.1.4041.9 1 30.3535 121.4523 30.3585 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 EYEATLEECCAK Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.0058946399949491 1501.61242675781 751.8135 1501.6064453125 751.810546875 2 21 1.1.1.4151.4 1 32.8137 1600.776 32.724 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVK Carbamidomethyl(C)@24 missed K-D@2; missed K-G@10 -0.003805180080235 3721.8564453125 931.4714 3721.8603515625 931.472351074219 4 24 1.1.1.5378.13 1 62.1794 811.8129 62.1911 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 59.3999981880188 GCEKSLHTLFGDELCK Delta:H(4)C(2)@N-term; Carbamidomethyl(C)@2; acrolein addition +94(K)@4; Carbamidomethyl(C)@15 cleaved A-G@N-term; missed K-S@4 0.0213959999382496 2014.97058105469 672.6641 2014.94921875 672.657043457031 3 12 1.1.1.4728.8 1 46.3776 1689.81 46.4572 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 20.6699997186661 GCEKSLHTLFGDELCK Delta:H(4)C(2)@N-term; Carbamidomethyl(C)@2; acrolein addition +94(K)@4; Carbamidomethyl(C)@15 cleaved A-G@N-term; missed K-S@4 0.0213959999382496 2014.97058105469 672.6641 2014.94921875 672.657043457031 3 11 1.1.1.4733.5 1 46.4935 1689.81 46.4572 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK 0.000999373034574091 1304.70983886719 653.3622 1304.70886230469 653.361694335938 2 15 1.1.1.4357.11 1 37.7595 22107.27 37.9109 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK 0.000999373034574091 1304.70983886719 653.3622 1304.70886230469 653.361694335938 2 18 1.1.1.4371.5 1 38.097 22107.27 37.9109 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK 0.000266963004833087 1304.70910644531 653.3618 1304.70886230469 653.361694335938 2 15 1.1.1.4406.6 1 38.93 0 -1 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK -0.0021981499157846 1304.70666503906 435.9095 1304.70886230469 435.910217285156 3 14 1.1.1.4366.4 1 37.9683 9002.926 37.9109 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.7699995040894 HLVDEPQNLIK Oxidation(P)@6 -0.00771082006394863 1320.69604492188 661.3553 1320.70373535156 661.359130859375 2 15 1.1.1.4363.7 1 37.9033 595.1429 37.9347 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.4300026893616 HLVDEPQNLIK Deamidated(N)@8 0.0187389999628067 1305.71166992188 436.2445 1305.69287109375 436.238220214844 3 13 1.1.1.4368.3 1 38.0152 3854.888 37.9109 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.17999792099 HLVDEPQNLIK Pro->pyro-Glu(P)@6 0.00357537996023893 1318.69165039063 660.3531 1318.68811035156 660.351318359375 2 15 1.1.1.4363.6 1 37.9008 588.7175 37.9347 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 87.3099982738495 HLVDEPQNLIK Dioxidation(K)@11 0.00469944020733237 1336.70324707031 669.3589 1336.69873046875 669.356628417969 2 13 1.1.1.4365.9 1 37.9536 684.4652 37.9109 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@14 missed K-Q@11; missed K-L@19 -0.00798218045383692 3814.90209960938 954.7328 3814.91015625 954.734802246094 4 32 1.1.1.5152.7 1 56.6707 4082.194 56.5851 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HPEYAVSVLLR 0.00401367992162704 1282.70751953125 642.361 1282.70336914063 642.358947753906 2 17 1.1.1.4699.3 1 45.68 1874.853 45.8343 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HPEYAVSVLLR 0.00401367992162704 1282.70751953125 642.361 1282.70336914063 642.358947753906 2 14 1.1.1.4714.5 1 46.0446 1874.853 45.8343 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 41.5499985218048 HPEYAVSVLLR 0.00922104995697737 1282.71276855469 428.5782 1282.70336914063 428.575073242188 3 11 1.1.1.4704.3 1 45.7953 475.778 45.7865 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HPYFYAPELLYYANK 0.0094955200329423 1887.92907714844 944.9718 1887.91955566406 944.967041015625 2 17 1.1.1.5072.7 1 54.6838 780.295 54.7177 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@17; Carbamidomethyl(C)@23; Carbamidomethyl(C)@24; Carbamidomethyl(C)@32 missed K-Y@15; missed K-G@29 -0.0158599000424147 4356.97998046875 872.4033 4356.99609375 872.406433105469 5 19 1.1.1.5188.8 1 57.5474 425.6693 57.5378 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@23; Carbamidomethyl(C)@24; Carbamidomethyl(C)@32 missed K-Y@15; missed K-G@29 -0.0108671998605132 4356.0029296875 1090.008 4356.01171875 1090.01025390625 4 24 1.1.1.5237.12 1 58.776 1620.484 58.7886 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@23; Carbamidomethyl(C)@24; Carbamidomethyl(C)@32 missed K-Y@15; missed K-G@29 -0.0108671998605132 4356.0029296875 1090.008 4356.01171875 1090.01025390625 4 18 1.1.1.5239.10 1 58.8292 1620.484 58.7886 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 26.8200010061264 IETMREK missed R-E@5 0.0028339100535959 905.466857910156 453.7407 905.464050292969 453.739288330078 2 10 1.1.1.3480.2 1 20.7974 460.7849 20.8024 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 23.8499999046326 IETMREK missed R-E@5 0.000575657992158085 905.464660644531 453.7396 905.464050292969 453.739288330078 2 9 1.1.1.3446.2 1 20.4592 386.0178 20.5585 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 IETMREKVLTSSAR Oxidation(M)@4 missed R-E@5; missed K-V@7 -0.00671500014141202 1635.8544921875 409.9709 1635.86145019531 409.972625732422 4 16 1.1.1.3891.2 1 27.1354 1195.438 27.1969 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.4200000762939 IETMREKVLTSSAR missed R-E@5; missed K-V@7 -0.00621477980166674 1619.86022949219 540.9607 1619.86645507813 540.962768554688 3 13 1.1.1.4047.4 1 30.4926 841.2612 30.3843 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 92.7200019359589 IETMREKVLTSSAR Carbamidomethyl(K)@7 missed R-E@5; missed K-V@7 -0.00537384999915957 1676.88256835938 420.2279 1676.88793945313 420.229278564453 4 12 1.1.1.4040.3 1 30.3191 195.0395 30.3325 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 51.800000667572 IETMREKVLTSSAR Carbamidomethyl@N-term missed R-E@5; missed K-V@7 -0.00220010010525584 1676.8857421875 420.2287 1676.88793945313 420.229278564453 4 10 1.1.1.3927.2 1 27.8696 820.3257 27.9308 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.17999792099 KECCDKPLLEK ONE addition +154(K)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved L-K@N-term; missed K-E@1 0.00436200015246868 1572.79357910156 525.2718 1572.78918457031 525.270324707031 3 14 1.1.1.4001.5 1 29.4288 678.5355 29.3431 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 95.0500011444092 KECCDKPLLEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved L-K@N-term; missed K-E@1 -0.0026172399520874 1418.68725585938 473.903 1418.68981933594 473.903869628906 3 12 1.1.1.3974.3 1 28.811 296.0759 28.8278 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 83.5300028324127 KECCDKPLLEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@4; ONE addition +154(K)@6 cleaved L-K@N-term; missed K-E@1 0.0071085300296545 1572.79626464844 525.2727 1572.78918457031 525.270324707031 3 11 1.1.1.4013.3 1 29.7113 787.1976 29.7661 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KQTALVELLK missed K-Q@1 0.00228354008868337 1141.70922851563 571.8619 1141.70703125 571.860778808594 2 17 1.1.1.4570.3 1 42.6782 10766.2 42.6833 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KQTALVELLK missed K-Q@1 0.00667800009250641 1141.71362304688 571.8641 1141.70703125 571.860778808594 2 17 1.1.1.4611.6 1 43.6451 868.0915 43.6552 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KQTALVELLK missed K-Q@1 0.00411455985158682 1141.71130371094 571.8629 1141.70703125 571.860778808594 2 15 1.1.1.4562.3 1 42.4887 10969.55 42.707 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.000654413015581667 1638.92980957031 547.3172 1638.93041992188 547.317443847656 3 21 1.1.1.4494.7 1 40.931 35823.41 41.1022 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.000471311010187492 1638.93017578125 547.3173 1638.93041992188 547.317443847656 3 22 1.1.1.4502.4 1 41.1142 36222.75 41.1022 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@8 missed K-V@1 -0.000799252011347562 1652.90893554688 551.9769 1652.90979003906 551.977172851563 3 21 1.1.1.4515.2 1 41.4115 794.3437 41.2978 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.00102061999496073 1638.92944335938 547.3171 1638.93041992188 547.317443847656 3 22 1.1.1.4518.3 1 41.4743 37666.88 41.3215 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.000654413015581667 1638.92980957031 547.3172 1638.93041992188 547.317443847656 3 22 1.1.1.4526.4 1 41.6682 32062.05 41.4165 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.000471311010187492 1638.93017578125 547.3173 1638.93041992188 547.317443847656 3 22 1.1.1.4535.4 1 41.8491 23254.72 41.6301 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.00010510699939914 1638.93029785156 547.3174 1638.93041992188 547.317443847656 3 22 1.1.1.4543.6 1 42.0335 11018.6 41.7831 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.00010510699939914 1638.93029785156 547.3174 1638.93041992188 547.317443847656 3 20 1.1.1.4560.7 1 42.4413 1055.87 42.4464 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.00010510699939914 1638.93029785156 547.3174 1638.93041992188 547.317443847656 3 18 1.1.1.4568.6 1 42.6308 1055.87 42.4464 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 1.00567996501923 1639.93591308594 547.6526 1638.93041992188 547.317443847656 3 19 1.1.1.4551.5 1 42.2214 578.1537 42.1857 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@8 missed K-V@1 -0.000799252011347562 1652.90893554688 551.9769 1652.90979003906 551.977172851563 3 19 1.1.1.4507.4 1 41.2171 794.3437 41.2978 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.8200008869171 KVPQVSTPTLVEVSR Butyryl(K)@1; Oxidation(P)@3 missed K-V@1 0.00569865014404058 1724.97302246094 863.4938 1724.96728515625 863.490905761719 2 19 1.1.1.4961.13 1 52.0305 3680.634 52.0423 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.0499982833862 KVPQVSTPTLVEVSR Butyryl(K)@1; Oxidation(P)@3 missed K-V@1 0.00569865014404058 1724.97302246094 863.4938 1724.96728515625 863.490905761719 2 18 1.1.1.4968.15 1 52.2076 3680.634 52.0423 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.7699995040894 KVPQVSTPTLVEVSR Formyl(K)@1 missed K-V@1 0.00712910993024707 1666.93249511719 834.4735 1666.92541503906 834.469970703125 2 15 1.1.1.4739.6 1 46.6364 894.5158 46.6982 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.4799990653992 KVPQVSTPTLVEVSR reduced acrolein addition +58(K)@1; Deamidated(Q)@4; Dehydrated(S)@6 missed K-V@1 0.0133902002125978 1679.95935058594 560.9937 1679.94580078125 560.989196777344 3 16 1.1.1.4541.5 1 41.9879 3009.684 41.8779 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.4799990653992 KVPQVSTPTLVEVSR Acetyl@N-term missed K-V@1 0.0060775401070714 1680.94702148438 841.4808 1680.94104003906 841.477783203125 2 14 1.1.1.4745.12 1 46.7898 957.9705 46.8917 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.1700012683868 KVPQVSTPTLVEVSR reduced acrolein addition +58(K)@1; Deamidated(Q)@4; Dehydrated(S)@6 missed K-V@1 0.0133902002125978 1679.95935058594 560.9937 1679.94580078125 560.989196777344 3 16 1.1.1.4532.6 1 41.7781 3009.684 41.8779 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.17999792099 KVPQVSTPTLVEVSR Dioxidation(P)@3 missed K-V@1 0.00113336998037994 1670.92138671875 557.9811 1670.92028808594 557.980712890625 3 15 1.1.1.4518.4 1 41.4784 540.4512 41.5115 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 93.2399988174438 KVPQVSTPTLVEVSR Acetyl@N-term missed K-V@1 0.0060775401070714 1680.94702148438 841.4808 1680.94104003906 841.477783203125 2 12 1.1.1.4752.12 1 46.9595 957.9705 46.8917 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 92.7200019359589 KVPQVSTPTLVEVSR Oxidation(P)@8 missed K-V@1 -0.00871349964290857 1654.91662597656 828.4656 1654.92541503906 828.469970703125 2 12 1.1.1.4506.8 1 41.1976 425.5968 41.2263 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 90.9799993038177 KVPQVSTPTLVEVSR Dioxidation(P)@8 missed K-V@1 -0.0088305901736021 1670.91149902344 836.463 1670.92028808594 836.467407226563 2 13 1.1.1.4501.7 1 41.0972 533.479 41.0785 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 80.1100015640259 KVPQVSTPTLVEVSR Dioxidation(P)@3 missed K-V@1 -0.0088305901736021 1670.91149902344 836.463 1670.92028808594 836.467407226563 2 12 1.1.1.4499.6 1 41.0497 533.479 41.0785 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 71.4999973773956 KVPQVSTPTLVEVSR Oxidation(P)@3; Methyl+Deamidated(Q)@4 missed K-V@1 -0.00939819030463696 1669.91564941406 557.6458 1669.92504882813 557.648986816406 3 13 1.1.1.4501.6 1 41.0938 476.5103 41.0548 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 69.8300004005432 KVPQVSTPTLVEVSR Oxidation(P)@3; Methyl+Deamidated(Q)@4 missed K-V@1 -0.0145250996574759 1669.91052246094 557.6441 1669.92504882813 557.648986816406 3 13 1.1.1.4509.4 1 41.2687 461.4585 41.3215 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 62.4400019645691 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@8 missed K-V@1 -0.00390272005461156 1652.90588378906 827.4602 1652.90979003906 827.462158203125 2 11 1.1.1.4499.5 1 41.0464 0 -1 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 51.800000667572 KVPQVSTPTLVEVSR Oxidation(P)@3 missed K-V@1 -0.00871349964290857 1654.91662597656 828.4656 1654.92541503906 828.469970703125 2 10 1.1.1.4516.4 1 41.4352 425.5968 41.2263 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 41.5499985218048 LCVLHEK Carbamidomethyl(C)@2 0.00137564004398882 897.475646972656 449.7451 897.474243164063 449.744384765625 2 10 1.1.1.3968.2 1 28.677 1276.288 28.4093 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.0700000524521 LCVLHEK Carbamidomethyl(C)@2 0.00161977997049689 897.475891113281 449.7452 897.474243164063 449.744384765625 2 10 1.1.1.3954.3 1 28.3305 1283.729 28.4093 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LCVLHEKTPVSEK Carbamidomethyl(C)@2 missed K-T@7 -0.00581779005005956 1538.80676269531 513.9429 1538.81262207031 513.94482421875 3 18 1.1.1.4069.3 1 31.0183 1866.156 31.1265 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LCVLHEKTPVSEKVTK Carbamidomethyl(C)@2 missed K-T@7; missed K-V@13 -0.00638836994767189 1867.01733398438 467.7616 1867.02368164063 467.763214111328 4 16 1.1.1.4091.3 1 31.5018 3078.15 31.3981 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LFTFHADICTLPDTEK Carbamidomethyl(C)@9 0.00258371001109481 1906.91613769531 636.646 1906.91345214844 636.645080566406 3 16 1.1.1.4918.4 1 50.9656 1502.176 51.0586 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.00427250983193517 1478.79248046875 493.9381 1478.78820800781 493.936676025391 3 19 1.1.1.4969.2 1 52.2225 1762.939 52.2928 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.0036163900513202 1478.79162597656 740.4031 1478.78820800781 740.4013671875 2 23 1.1.1.4971.12 1 52.2802 36990.79 52.2677 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Oxidation(Y)@4 0.00359920994378626 1494.78662109375 748.4006 1494.78308105469 748.398803710938 2 22 1.1.1.4974.3 1 52.3549 987.3154 52.2928 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.0036163900513202 1478.79162597656 740.4031 1478.78820800781 740.4013671875 2 23 1.1.1.4978.3 1 52.4461 36990.79 52.2677 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.00105295004323125 1478.78930664063 740.4019 1478.78820800781 740.4013671875 2 21 1.1.1.4985.3 1 52.6105 18934.95 52.3658 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.000564678979571909 1478.78869628906 740.4016 1478.78820800781 740.4013671875 2 20 1.1.1.4992.3 1 52.7797 647.8956 52.7254 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.0072248000651598 1478.79553222656 740.405 1478.78820800781 740.4013671875 2 20 1.1.1.5014.5 1 53.3231 389.8423 53.2397 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR -9.93510984699242E-05 1478.7880859375 740.4013 1478.78820800781 740.4013671875 2 13 1.1.1.5022.6 1 53.5216 181.5323 53.4859 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.00337225990369916 1478.79150390625 740.403 1478.78820800781 740.4013671875 2 13 1.1.1.5007.6 1 53.1484 303.0903 53.1413 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Delta:H(2)C(2)@N-term 0.00538324005901814 1504.80932617188 753.4119 1504.80383300781 753.4091796875 2 22 1.1.1.5079.2 1 54.8411 1030.106 54.9813 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Delta:H(2)C(2)@N-term 0.00538324005901814 1504.80932617188 753.4119 1504.80383300781 753.4091796875 2 22 1.1.1.5086.5 1 55.0114 1030.106 54.9813 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.5300023555756 LGEYGFQNALIVR Carbamidomethyl(Y)@4; Deamidated(N)@8 0.00272152991965413 1536.79650878906 769.4055 1536.79370117188 769.404113769531 2 15 1.1.1.4930.7 1 51.2734 4961.856 51.4495 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.17999792099 LGEYGFQNALIVR Carbamidomethyl(Y)@4; Deamidated(N)@8 0.00296567007899284 1536.79663085938 769.4056 1536.79370117188 769.404113769531 2 15 1.1.1.4937.8 1 51.4395 4984.976 51.4495 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.1900014877319 LGEYGFQNALIVR Carbamidomethyl(Y)@4; Deamidated(N)@8 0.00296567007899284 1536.79663085938 769.4056 1536.79370117188 769.404113769531 2 13 1.1.1.4944.14 1 51.6102 4984.976 51.4495 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.1900014877319 LGEYGFQNALIVR Carbamidomethyl(Y)@4; Deamidated(N)@8 0.00638358993455768 1536.80004882813 769.4073 1536.79370117188 769.404113769531 2 11 1.1.1.4951.13 1 51.7817 3002.564 51.5228 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 91.3399994373322 LGEYGFQNALIVR Deamidated(N)@8 0.00615946017205715 1479.7783203125 740.8964 1479.77221679688 740.893371582031 2 10 1.1.1.4950.10 1 51.7546 577.9142 51.8181 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 47.189998626709 LGEYGFQNALIVR Oxidation(F)@6 0.00359920994378626 1494.78662109375 748.4006 1494.78308105469 748.398803710938 2 8 1.1.1.4967.13 1 52.1807 987.3154 52.2928 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 30.2700012922287 LGEYGFQNALIVR Dioxidation(Y)@4 0.00468281982466578 1510.78271484375 756.3986 1510.77795410156 756.396301269531 2 8 1.1.1.4973.9 1 52.3269 506.9531 52.2928 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-E@2 -0.00570486998185515 1531.76794433594 511.5966 1531.77380371094 511.598541259766 3 20 1.1.1.3972.6 1 28.7637 9398.192 28.8278 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-E@2 -0.00597951980307698 1531.76794433594 511.5966 1531.77380371094 511.598541259766 3 17 1.1.1.3989.2 1 29.1367 5361.349 28.9253 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 85.5300009250641 LKECCDKPLLEK Carbamidomethyl(C)@4; No Carbamidomethyl(C)@5 missed K-E@2 0.000379000994144008 1474.75268554688 492.5915 1474.75231933594 492.591400146484 3 8 1.1.1.3976.6 1 28.8632 206.8462 28.8033 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 25.4200011491776 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5; Oxidation(D)@6 missed K-E@2 -0.00345505005680025 1547.76525878906 516.929 1547.76879882813 516.93017578125 3 9 1.1.1.3972.7 1 28.7654 476.4009 28.8278 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00748175987973809 2697.30346679688 675.3331 2697.31079101563 675.3349609375 4 20 1.1.1.4912.4 1 50.823 1151.54 50.8868 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00374210998415947 2665.3173828125 667.3366 2665.32104492188 667.337524414063 4 18 1.1.1.4948.7 1 51.7027 2146.734 51.6948 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00761483982205391 2665.31298828125 534.0699 2665.32104492188 534.071472167969 5 17 1.1.1.4949.7 1 51.7274 2129.188 51.7195 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00761483982205391 2665.31298828125 534.0699 2665.32104492188 534.071472167969 5 18 1.1.1.4950.5 1 51.7504 2129.188 51.7195 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00761483982205391 2665.31298828125 534.0699 2665.32104492188 534.071472167969 5 18 1.1.1.4953.6 1 51.8275 2129.188 51.7195 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00374210998415947 2665.3173828125 667.3366 2665.32104492188 667.337524414063 4 18 1.1.1.4955.5 1 51.8738 2146.734 51.6948 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00761483982205391 2665.31298828125 534.0699 2665.32104492188 534.071472167969 5 15 1.1.1.4951.5 1 51.775 2129.188 51.7195 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00761483982205391 2665.31298828125 534.0699 2665.32104492188 534.071472167969 5 15 1.1.1.4956.5 1 51.8986 2129.188 51.7195 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00748175987973809 2697.30346679688 675.3331 2697.31079101563 675.3349609375 4 18 1.1.1.4919.4 1 50.9927 1151.54 50.8868 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.85999751091 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00748175987973809 2697.30346679688 675.3331 2697.31079101563 675.3349609375 4 15 1.1.1.4926.4 1 51.1715 1079.685 50.9113 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 92.7200019359589 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00967898964881897 2697.30126953125 675.3326 2697.31079101563 675.3349609375 4 13 1.1.1.4905.5 1 50.6525 1096.336 50.8381 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 86.3699972629547 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00761483982205391 2665.31298828125 534.0699 2665.32104492188 534.071472167969 5 12 1.1.1.4957.4 1 51.9227 2129.188 51.7195 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 76.1099994182587 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00457666022703052 2669.31127929688 668.3351 2669.31591796875 668.336242675781 4 11 1.1.1.4935.8 1 51.3847 1354.114 51.4006 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 64.7000014781952 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00761483982205391 2665.31298828125 534.0699 2665.32104492188 534.071472167969 5 12 1.1.1.4954.5 1 51.849 2129.188 51.7195 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 38.2699996232986 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00935725960880518 2665.31176757813 667.3352 2665.32104492188 667.337524414063 4 10 1.1.1.4962.13 1 52.0558 1725.876 51.7935 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 15.9899994730949 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00644817994907498 2665.31469726563 445.2264 2665.32104492188 445.227447509766 6 8 1.1.1.4951.4 1 51.7742 401.6005 51.7935 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0165548007935286 3573.78002929688 715.7633 3573.79663085938 715.7666015625 5 17 1.1.1.5149.2 1 56.5887 3740.762 56.5111 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0169386006891727 3605.76953125 722.1612 3605.78637695313 722.16455078125 5 27 1.1.1.5072.3 1 54.6754 1629.271 54.6939 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.00973721034824848 3577.7822265625 716.5637 3577.79150390625 716.565612792969 5 17 1.1.1.5111.5 1 55.6339 956.3375 55.6027 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.00973721034824848 3577.7822265625 716.5637 3577.79150390625 716.565612792969 5 14 1.1.1.5112.5 1 55.6588 956.3375 55.6027 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0100766997784376 3577.78149414063 597.3042 3577.79150390625 597.305847167969 6 13 1.1.1.5108.5 1 55.5592 728.5739 55.5776 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.00182352005504072 3577.78979492188 895.4547 3577.79150390625 895.455139160156 4 11 1.1.1.5108.12 1 55.5651 415.388 55.6027 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 68.8099980354309 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0165548007935286 3573.78002929688 715.7633 3573.79663085938 715.7666015625 5 13 1.1.1.5141.2 1 56.3909 3740.762 56.5111 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 56.2300026416779 LSQKFPK Oxidation(F)@5 missed K-F@4 -0.000258660991676152 862.491088867188 432.2528 862.491271972656 432.252899169922 2 7 1.1.1.3835.5 1 26.1924 219.7903 26.1798 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 53.9900004863739 LSQKFPK missed K-F@4 0.00318415998481214 846.499450683594 424.257 846.496337890625 424.255432128906 2 11 1.1.1.3828.3 1 26.02 20479.16 25.939 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 53.1499981880188 LSQKFPK missed K-F@4 0.00318415998481214 846.499450683594 424.257 846.496337890625 424.255432128906 2 11 1.1.1.3832.2 1 26.1264 20479.16 25.939 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 51.5699982643127 LSQKFPK missed K-F@4 0.00318415998481214 846.499450683594 424.257 846.496337890625 424.255432128906 2 11 1.1.1.3821.2 1 25.8475 20479.16 25.939 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 44.8300004005432 LSQKFPK Oxidation(F)@5 missed K-F@4 0.00230476004071534 862.49365234375 432.2541 862.491271972656 432.252899169922 2 8 1.1.1.3828.4 1 26.0233 587.7347 25.939 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.8899990320206 LSQKFPK missed K-F@4 0.00239071995019913 846.498901367188 424.2567 846.496337890625 424.255432128906 2 9 1.1.1.3870.2 1 26.8826 241.5509 26.7986 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 32.710000872612 LSQKFPK Dioxidation(P)@6 missed K-F@4 0.000881003972608596 878.487060546875 440.2508 878.486145019531 440.250366210938 2 9 1.1.1.3821.4 1 25.8559 718.5008 25.939 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 28.7200003862381 LSQKFPK missed K-F@4 0.00257382006384432 846.498901367188 424.2567 846.496337890625 424.255432128906 2 10 1.1.1.3845.3 1 26.367 6698.812 26.1798 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 28.4000009298325 LSQKFPK missed K-F@4 0.00318415998481214 846.499450683594 424.257 846.496337890625 424.255432128906 2 10 1.1.1.3835.4 1 26.1898 20248.52 25.939 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 25.4200011491776 LSQKFPK Deamidated(Q)@3 missed K-F@4 0.0217710006982088 847.502075195313 424.7583 847.480346679688 424.747467041016 2 8 1.1.1.3847.3 1 26.4225 420.6573 26.3275 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 -0.00129398005083203 1749.96508789063 584.329 1749.96655273438 584.329467773438 3 24 1.1.1.4383.5 1 38.3832 2624.285 38.4595 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 -0.00716661009937525 1749.95935058594 438.4971 1749.96655273438 438.498901367188 4 16 1.1.1.4381.4 1 38.3356 2374.612 38.4833 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 -0.00716661009937525 1749.95935058594 438.4971 1749.96655273438 438.498901367188 4 17 1.1.1.4390.4 1 38.5454 2374.612 38.4833 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 93.9499974250793 LSQKFPKAEFVEVTK Deamidated(Q)@3 missed K-F@4; missed K-A@7 0.00879636034369469 1750.95935058594 438.7471 1750.95056152344 438.744903564453 4 13 1.1.1.4389.3 1 38.5175 1345.416 38.4833 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 82.4500024318695 LSQKFPKAEFVEVTK Formyl(K)@4; reduced acrolein addition +58(K)@7 missed K-F@4; missed K-A@7 -0.00630478980019689 1835.9970703125 613.0063 1836.00329589844 613.008361816406 3 10 1.1.1.4973.6 1 52.3244 526.1114 52.3658 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00187013996765018 2520.41845703125 631.1119 2520.42041015625 631.112365722656 4 16 1.1.1.5215.2 1 58.2255 494.4678 58.2957 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00650876015424728 2520.41381835938 631.1107 2520.42041015625 631.112365722656 4 13 1.1.1.5225.2 1 58.4729 734.9804 58.4691 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00650876015424728 2520.41381835938 631.1107 2520.42041015625 631.112365722656 4 19 1.1.1.5226.4 1 58.4992 734.9804 58.4691 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00877620000392199 2520.41162109375 841.1445 2520.42041015625 841.147399902344 3 15 1.1.1.5236.5 1 58.7521 346.6631 58.7394 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00699703022837639 2520.41333007813 631.1106 2520.42041015625 631.112365722656 4 17 1.1.1.5242.2 1 58.8908 1245.269 58.9623 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.000536507985088974 2520.419921875 841.1472 2520.42041015625 841.147399902344 3 18 1.1.1.5243.10 1 58.9226 640.555 58.9623 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00699703022837639 2520.41333007813 631.1106 2520.42041015625 631.112365722656 4 24 1.1.1.5250.3 1 59.0954 1245.269 58.9623 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00650876015424728 2520.41381835938 631.1107 2520.42041015625 631.112365722656 4 12 1.1.1.5227.2 1 58.5223 734.9804 58.4691 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LVNELTEFAK 0.00380673003382981 1162.62731933594 582.3209 1162.62341308594 582.318969726563 2 14 1.1.1.4758.5 1 47.0943 7535.977 46.9159 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LVNELTEFAK 0.00380673003382981 1162.62731933594 582.3209 1162.62341308594 582.318969726563 2 13 1.1.1.4744.7 1 46.7574 7535.977 46.9159 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 66.8600022792816 LVVSTQTALA 0.00484604015946388 1001.58044433594 501.7975 1001.57568359375 501.795135498047 2 11 1.1.1.4637.2 1 44.2345 863.7907 44.2292 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 22.4600002169609 LVVSTQTALA 0.00502914004027843 1001.58068847656 501.7976 1001.57568359375 501.795135498047 2 10 1.1.1.4580.4 1 42.9059 10108.7 43.0624 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 22.4600002169609 LVVSTQTALA 0.00722636003047228 1001.58288574219 501.7987 1001.57568359375 501.795135498047 2 10 1.1.1.4612.6 1 43.6739 3204.218 43.4181 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNR Oxidation(M)@1; Carbamidomethyl(C)@3 0.00591551978141069 1739.828125 870.9213 1739.822265625 870.918395996094 2 17 1.1.1.5227.6 1 58.5281 1559.11 58.617 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNR Oxidation(M)@1; Carbamidomethyl(C)@3 0.00591551978141069 1739.828125 870.9213 1739.822265625 870.918395996094 2 18 1.1.1.5234.5 1 58.6966 1559.11 58.617 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNR Carbamidomethyl(C)@3 0.00655229017138481 1723.83386230469 862.9242 1723.82727050781 862.920959472656 2 11 1.1.1.5316.4 1 60.723 1151.071 60.885 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 23.1600001454353 MPCTEDYLSLILNR Met->Hcy(M)@1; Carbamidomethyl(C)@3 0.00948034971952438 1709.82104492188 855.9178 1709.81164550781 855.9130859375 2 7 1.1.1.5311.3 1 60.5991 199.7945 60.5453 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNRLCVLHEK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14 -0.00331008993089199 2619.28247070313 655.8279 2619.28588867188 655.828735351563 4 21 1.1.1.5407.2 1 62.8922 1502.32 62.9345 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14 -0.00626832991838455 2603.28466796875 651.8284 2603.291015625 651.830017089844 4 15 1.1.1.5468.5 1 64.3748 1293.456 64.3205 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 22.1699997782707 MPCTEDYLSLILNRLCVLHEKTPVSEK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 -0.0155496001243591 3260.60888671875 816.1595 3260.62426757813 816.163391113281 4 11 1.1.1.5364.3 1 61.8276 404.4281 61.7491 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21; missed K-V@27 -0.0185509007424116 3572.82202148438 596.4776 3572.84057617188 596.480712890625 6 14 1.1.1.5310.3 1 60.5743 1071.633 60.6436 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 37.4300003051758 MPCTEDYLSLILNRLCVLHEKTPVSEKVTK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21; missed K-V@27 -0.00938524957746267 3588.826171875 718.7725 3588.83544921875 718.774353027344 5 11 1.1.1.5245.3 1 58.9675 585.9148 59.0626 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 NECFLSHKDDSPDLPK Carbamidomethyl(C)@3 missed K-D@8 -0.00237774010747671 1900.86010742188 634.6273 1900.86254882813 634.628112792969 3 17 1.1.1.4261.11 1 35.4329 1427.514 35.4637 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 NECFLSHKDDSPDLPK Carbamidomethyl(C)@3 missed K-D@8 -0.00786911975592375 1900.8544921875 476.2209 1900.86254882813 476.222900390625 4 17 1.1.1.4264.6 1 35.5063 2181.966 35.5353 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 NECFLSHKDDSPDLPK Carbamidomethyl(C)@3 missed K-D@8 -0.00786911975592375 1900.8544921875 476.2209 1900.86254882813 476.222900390625 4 16 1.1.1.4263.5 1 35.475 2181.966 35.5353 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 NECFLSHKDDSPDLPK Carbamidomethyl(C)@3 missed K-D@8 -0.00786911975592375 1900.8544921875 476.2209 1900.86254882813 476.222900390625 4 16 1.1.1.4268.9 1 35.5988 2181.966 35.5353 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 NYQEAKDAFLGSFLYEYSR missed K-D@6 -0.00478373980149627 2300.07006835938 767.6973 2300.07495117188 767.698913574219 3 28 1.1.1.5157.2 1 56.7837 3811.453 56.7067 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 NYQEAKDAFLGSFLYEYSR Deamidated(Q)@3; Dehydrated(E)@4; reduced acrolein addition +58(K)@6 missed K-D@6 0.00965080037713051 2341.09985351563 781.3739 2341.09033203125 781.370727539063 3 17 1.1.1.5191.9 1 57.6244 207.7557 57.6648 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 76.1099994182587 PVSEKVTK cleaved T-P@N-term; missed K-V@5 0.00147268001455814 886.513854980469 444.2642 886.512390136719 444.263458251953 2 5 1.1.1.3583.2 1 22.3815 321.5296 22.3016 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QEPERNECFLSHKDDSPDLPK Carbamidomethyl(C)@8 missed R-N@5; missed K-D@13 -0.0157497003674507 2540.14453125 636.0434 2540.16015625 636.047302246094 4 17 1.1.1.4214.7 1 34.3099 1199.377 34.3414 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 95.2600002288818 QNCDQFEK Carbamidomethyl(C)@3 0.00228808005340397 1067.4365234375 534.7255 1067.43420410156 534.724365234375 2 12 1.1.1.3712.4 1 24.2789 1667.705 24.2527 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.650000333786 QNCDQFEK Carbamidomethyl(C)@3 0.0019218799425289 1067.43603515625 534.7253 1067.43420410156 534.724365234375 2 12 1.1.1.3699.3 1 24.1061 2525.521 24.1668 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 86.3699972629547 QNCDQFEK Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 0.00119714997708797 1050.40881347656 526.2117 1050.40771484375 526.211120605469 2 12 1.1.1.4019.4 1 29.8496 693.8941 29.8639 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 53.1499981880188 QNCDQFEK Carbamidomethyl(C)@3 -0.000153276996570639 1067.43408203125 534.7243 1067.43420410156 534.724365234375 2 11 1.1.1.3728.3 1 24.4501 842.8504 24.4066 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 26.8200010061264 QNCDQFEK Carbamidomethyl(C)@3 9.08595029613934E-05 1067.43432617188 534.7244 1067.43420410156 534.724365234375 2 10 1.1.1.3744.3 1 24.6213 677.7392 24.553 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3; Deamidated(N)@16 missed K-L@8 0.000882691994775087 2529.19653320313 844.0728 2529.19580078125 844.072570800781 3 18 1.1.1.5026.10 1 53.6233 251.3029 53.6086 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 0.000347115012118593 2528.21215820313 843.7447 2528.2119140625 843.744567871094 3 32 1.1.1.5065.2 1 54.5065 17005.13 54.5982 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 -0.0090158199891448 2528.20288085938 633.058 2528.2119140625 633.060241699219 4 25 1.1.1.5069.2 1 54.6029 1999.069 54.6222 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 0.000347115012118593 2528.21215820313 843.7447 2528.2119140625 843.744567871094 3 33 1.1.1.5072.4 1 54.6771 17005.13 54.5982 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3; reduced acrolein addition +58(K)@8 missed K-L@8 0.0137379998341203 2569.24096679688 857.4209 2569.22705078125 857.416320800781 3 23 1.1.1.5074.3 1 54.7265 1189.384 54.7416 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 missed K-L@8 -0.00508718006312847 2511.18017578125 838.0673 2511.18530273438 838.069030761719 3 28 1.1.1.5209.7 1 58.0821 1736.67 58.074 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3; Carbamidomethyl(Y)@12; Deamidated(N)@16 missed K-L@8 0.00520956004038453 2586.22241210938 863.0814 2586.21728515625 863.079711914063 3 21 1.1.1.5025.12 1 53.5986 2739.853 53.6579 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3; Deamidated(Q)@5 missed K-L@8 0.0155897997319698 2512.18481445313 838.4022 2512.16918945313 838.397033691406 3 13 1.1.1.5205.7 1 57.9824 1087.075 58.074 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 missed K-L@8 -0.0279751997441053 2511.1572265625 838.0597 2511.18530273438 838.069030761719 3 12 1.1.1.5233.6 1 58.6739 136.1028 58.6906 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QTALVELLK 0.004606360103935 1013.61669921875 507.8156 1013.61212158203 507.813323974609 2 14 1.1.1.4874.2 1 49.9061 36235.76 49.875 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.7699995040894 QTALVELLK Dehydrated(T)@2 -0.000290294992737472 995.601257324219 498.8079 995.601501464844 498.808044433594 2 14 1.1.1.4870.3 1 49.8121 716.4742 49.8511 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.650000333786 QTALVELLK 0.004606360103935 1013.61669921875 507.8156 1013.61212158203 507.813323974609 2 12 1.1.1.4881.2 1 50.0736 36235.76 49.875 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 91.3399994373322 QTALVELLK 0.00539981015026569 1013.61749267578 507.816 1013.61212158203 507.813323974609 2 9 1.1.1.4914.5 1 50.8684 912.255 51.1075 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 81.4000010490417 QTALVELLK 0.00759703014045954 1013.61968994141 507.8171 1013.61212158203 507.813323974609 2 8 1.1.1.4957.3 1 51.9218 522.1921 51.8674 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 71.2199985980988 QTALVELLK 0.00521670002490282 1013.61724853516 507.8159 1013.61212158203 507.813323974609 2 10 1.1.1.4942.2 1 51.5519 1161.323 51.5228 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 38.2699996232986 QTALVELLK 0.00521670002490282 1013.61724853516 507.8159 1013.61212158203 507.813323974609 2 8 1.1.1.4921.4 1 51.0393 999.944 51.1319 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 37.720000743866 QTALVELLK 0.004606360103935 1013.61669921875 507.8156 1013.61212158203 507.813323974609 2 10 1.1.1.4867.2 1 49.7353 36235.76 49.875 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 30.3900003433228 QTALVELLK 0.00521670002490282 1013.61724853516 507.8159 1013.61212158203 507.813323974609 2 8 1.1.1.4935.5 1 51.3822 1161.323 51.5228 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 28.4000009298325 QTALVELLK 0.00521670002490282 1013.61724853516 507.8159 1013.61212158203 507.813323974609 2 8 1.1.1.4928.3 1 51.2096 1040.661 51.2296 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 27.7599990367889 QTALVELLK 0.004606360103935 1013.61669921875 507.8156 1013.61212158203 507.813323974609 2 7 1.1.1.4949.3 1 51.724 652.3488 51.7195 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 25.3100007772446 QTALVELLK 0.00698669021949172 1013.61907958984 507.8168 1013.61212158203 507.813323974609 2 8 1.1.1.4906.6 1 50.6752 553.8298 50.6192 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QTALVELLKHKPK missed K-H@9 -0.00032049001310952 1503.91333007813 502.3117 1503.91369628906 502.311828613281 3 14 1.1.1.4354.10 1 37.675 3749.752 37.6139 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.2200026512146 QTALVELLKHKPK Gln->pyro-Glu@N-term missed K-H@9 0.00397526985034347 1486.89123535156 496.6377 1486.88720703125 496.636322021484 3 13 1.1.1.4835.4 1 48.967 1136.642 48.9106 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPEYAVSVLLR missed R-H@1 0.00628925999626517 1438.81091308594 720.4127 1438.80444335938 720.409545898438 2 19 1.1.1.4454.3 1 40.0357 5201.637 39.7793 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPEYAVSVLLR missed R-H@1 0.000889646005816758 1438.80541992188 480.6091 1438.80444335938 480.608764648438 3 18 1.1.1.4438.4 1 39.6737 16512.55 39.7555 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 25.4200011491776 RHPEYAVSVLLR Oxidation(Y)@5 missed R-H@1 -0.00438319006934762 1454.794921875 485.9389 1454.79943847656 485.940399169922 3 10 1.1.1.4443.5 1 39.7709 625.8468 39.7317 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANK missed R-H@1 0.00139193003997207 2044.02221679688 682.348 2044.02062988281 682.347534179688 3 18 1.1.1.4955.6 1 51.8746 2583.051 51.7935 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANK missed R-H@1 0.00268653989769518 2044.0234375 512.0131 2044.02062988281 512.012451171875 4 13 1.1.1.4949.4 1 51.7249 1144.138 51.7935 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25 missed R-H@1; missed K-Y@16 -0.00915998034179211 3772.69848632813 944.1819 3772.7080078125 944.184265136719 4 21 1.1.1.5091.9 1 55.1374 739.7626 55.2768 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25 missed R-H@1; missed K-Y@16 -0.00915998034179211 3772.69848632813 944.1819 3772.7080078125 944.184265136719 4 24 1.1.1.5098.16 1 55.3178 739.7626 55.2768 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0165835991501808 4513.08056640625 903.6234 4513.09716796875 903.626647949219 5 22 1.1.1.5095.8 1 55.2358 2199.348 55.352 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0265596006065607 4513.07080078125 753.1857 4513.09716796875 753.190124511719 6 25 1.1.1.5098.9 1 55.3119 895.991 55.352 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0165835991501808 4513.08056640625 903.6234 4513.09716796875 903.626647949219 5 19 1.1.1.5103.9 1 55.4374 2199.348 55.352 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0168887991458178 4513.080078125 903.6233 4513.09716796875 903.626647949219 5 16 1.1.1.5111.13 1 55.6406 493.7807 55.6027 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0228822007775307 4512.08984375 753.0223 4512.11279296875 753.026123046875 6 21 1.1.1.5125.8 1 55.9917 3099.552 56.1591 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0118711004033685 4512.10107421875 903.4275 4512.11279296875 903.429870605469 5 29 1.1.1.5125.12 1 55.995 5933.562 56.1591 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0118711004033685 4512.10107421875 903.4275 4512.11279296875 903.429870605469 5 41 1.1.1.5132.7 1 56.1674 5933.562 56.1591 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0118711004033685 4512.10107421875 903.4275 4512.11279296875 903.429870605469 5 28 1.1.1.5135.9 1 56.2452 5933.562 56.1591 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0251283999532461 4513.0712890625 903.6216 4513.09716796875 903.626647949219 5 29 1.1.1.5179.7 1 57.328 714.3222 57.3398 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK ONE addition +154(K)@16; Carbamidomethyl(Y)@17; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.0180973000824451 4723.251953125 945.6577 4723.23388671875 945.654052734375 5 16 1.1.1.5127.6 1 56.0411 17996.11 56.2095 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Deamidated(Q)@26; Dehydrated(D)@29; reduced acrolein addition +58(K)@30; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.00601198012009263 4553.1220703125 911.6317 4553.12841796875 911.632934570313 5 21 1.1.1.5138.5 1 56.3183 888.8202 56.3367 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 42.9199993610382 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.00705166021361947 4512.10693359375 1129.034 4512.11279296875 1129.03552246094 4 12 1.1.1.5126.18 1 56.0256 2257.541 56.1591 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 40.5299991369247 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Deamidated(Q)@26; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.00571887986734509 4513.0908203125 1129.28 4513.09716796875 1129.28149414063 4 12 1.1.1.5097.15 1 55.2917 663.4121 55.352 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMR Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30; missed K-I@37 -0.0294797997921705 5142.39990234375 858.0739 5142.4287109375 858.078735351563 6 17 1.1.1.5186.9 1 57.4974 721.0106 57.5633 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMR Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33; reduced acrolein addition +58(K)@37; Dehydrated(T)@40; Deamidated(R)@42 missed R-H@1; missed K-Y@16; missed K-G@30; missed K-I@37 -0.023955199867487 5183.419921875 864.9106 5183.4443359375 864.914672851563 6 20 1.1.1.5194.9 1 57.7009 502.3471 57.6901 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.9799976348877 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMR Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30; missed K-I@37 -0.0445078983902931 5143.36865234375 858.2354 5143.4130859375 858.242736816406 6 11 1.1.1.5140.7 1 56.3703 251.8312 56.3619 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 -0.00153244996909052 1879.91235351563 627.6447 1879.91381835938 627.645202636719 3 22 1.1.1.4665.7 1 44.8945 7823.431 44.757 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 -0.000800042995251715 1879.91320800781 627.645 1879.91381835938 627.645202636719 3 16 1.1.1.4673.8 1 45.0638 5948.345 44.8282 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 -0.00153244996909052 1879.91235351563 627.6447 1879.91381835938 627.645202636719 3 15 1.1.1.4649.7 1 44.5325 6486.428 44.7332 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 88.129997253418 RPCFSALTPDETYVPK Deamidated(R)@1; Carbamidomethyl(C)@3 0.0196093991398811 1880.91748046875 941.466 1880.89782714844 941.456176757813 2 12 1.1.1.4663.7 1 44.8444 963.702 44.7332 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SHCIAEVEK Carbamidomethyl(C)@3 0.000934306008275598 1071.5029296875 536.7587 1071.501953125 536.758239746094 2 15 1.1.1.3797.2 1 25.3669 477.0523 25.2341 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SHCIAEVEK Carbamidomethyl(C)@3 0.00069016998168081 1071.50244140625 536.7585 1071.501953125 536.758239746094 2 15 1.1.1.3774.2 1 25.0262 4079.705 25.0805 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SHCIAEVEK Carbamidomethyl(C)@3 0.00069016998168081 1071.50244140625 536.7585 1071.501953125 536.758239746094 2 14 1.1.1.3784.2 1 25.1993 4079.705 25.0805 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.7699995040894 SHCIAEVEK Acetyl@N-term; Carbamidomethyl(C)@3 0.00157722004223615 1113.51403808594 557.7643 1113.51245117188 557.763488769531 2 15 1.1.1.4052.7 1 30.6189 701.6323 30.6265 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.4799990653992 SHCIAEVEK Oxidation(H)@2; Carbamidomethyl(C)@3 -0.000740404997486621 1087.49609375 544.7553 1087.49682617188 544.755676269531 2 14 1.1.1.3776.3 1 25.0696 176.3195 25.1053 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SHCIAEVEKDAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@3; Carbamidomethyl(C)@30 missed K-D@9; missed K-D@27 -0.00767506984993815 3510.65698242188 703.1387 3510.66479492188 703.140197753906 5 27 1.1.1.4940.5 1 51.5044 1720.572 51.5475 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 93.7200009822845 SHCIAEVEKDAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@3; hexanoyl addition +98(K)@9; Cation:K(E)@14; Hex(N)@15; Carbamidomethyl(C)@30 missed K-D@9; missed K-D@27 0.0448848009109497 3808.79125976563 953.2051 3808.74658203125 953.193908691406 4 16 1.1.1.4941.15 1 51.5424 299.1199 51.5719 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00295363995246589 1418.68933105469 710.3519 1418.68640136719 710.350463867188 2 19 1.1.1.4732.5 1 46.4662 9549.191 46.4332 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00295363995246589 1418.68933105469 710.3519 1418.68640136719 710.350463867188 2 19 1.1.1.4739.4 1 46.6331 9549.191 46.4332 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00881006009876728 1418.6953125 473.9057 1418.68640136719 473.902740478516 3 17 1.1.1.4728.4 1 46.3684 7012.301 46.4091 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00881006009876728 1418.6953125 473.9057 1418.68640136719 473.902740478516 3 17 1.1.1.4729.4 1 46.3974 7012.301 46.4091 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00881006009876728 1418.6953125 473.9057 1418.68640136719 473.902740478516 3 16 1.1.1.4730.4 1 46.4164 7012.301 46.4091 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00881006009876728 1418.6953125 473.9057 1418.68640136719 473.902740478516 3 18 1.1.1.4731.3 1 46.4421 7012.301 46.4091 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00380812003277242 1418.69030761719 710.3524 1418.68640136719 710.350463867188 2 18 1.1.1.4746.6 1 46.8057 5193.681 46.5534 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Acetyl@N-term; Carbamidomethyl(C)@11 0.00862094014883041 1460.70544433594 731.36 1460.69702148438 731.355773925781 2 13 1.1.1.5039.3 1 53.9384 139.0399 53.9307 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Formyl@N-term; Carbamidomethyl(C)@11 0.00816479045897722 1446.689453125 724.352 1446.68127441406 724.347961425781 2 10 1.1.1.5026.6 1 53.6167 111.5147 53.584 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 87.3099982738495 SLHTLFGDELCK Oxidation(D)@8; Carbamidomethyl(C)@11 0.00622382014989853 1434.68762207031 718.3511 1434.68127441406 718.347961425781 2 12 1.1.1.4729.5 1 46.4007 396.1122 46.4332 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 87.3099982738495 SLHTLFGDELCK Carbamidomethyl(C)@11 1.00635004043579 1419.69274902344 474.2382 1418.68640136719 473.902740478516 3 12 1.1.1.4738.5 1 46.6089 2975.802 46.4332 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 44.1500008106232 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00258742994628847 1418.68884277344 710.3517 1418.68640136719 710.350463867188 2 8 1.1.1.4753.9 1 46.9738 2336.688 46.7224 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCKVASLR Carbamidomethyl(C)@11 missed K-V@12 -0.000834295991808176 1945.00830078125 649.3434 1945.00915527344 649.343627929688 3 25 1.1.1.5069.3 1 54.6054 1850.539 54.6461 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 0.00029176298994571 1462.58203125 488.5346 1462.58166503906 488.534515380859 3 15 1.1.1.3609.3 1 22.8279 2889.43 22.5998 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 1.71096999110887E-05 1462.58166503906 488.5345 1462.58166503906 488.534515380859 3 14 1.1.1.3578.2 1 22.2899 13659.6 22.4241 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 0.00029176298994571 1462.58203125 488.5346 1462.58166503906 488.534515380859 3 14 1.1.1.3601.3 1 22.6504 6535.151 22.496 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.7699995040894 TCVADESHAGCEK Delta:H(2)C(2)@N-term; Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -0.00198199995793402 1488.59521484375 497.2057 1488.59729003906 497.206390380859 3 15 1.1.1.3807.2 1 25.5809 121.4809 25.5462 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.17999792099 TCVADESHAGCEK Carbamidomethyl(C)@2; No Carbamidomethyl(C)@11 0.00275569991208613 1405.56298828125 469.5283 1405.56018066406 469.52734375 3 15 1.1.1.3583.3 1 22.3849 260.1403 22.4 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.17999792099 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -9.038330078125 1453.54321289063 727.7789 1462.58166503906 732.298095703125 2 16 1.1.1.3584.2 1 22.4107 129.87 22.4 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.1900014877319 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(H)@8; Carbamidomethyl(C)@11 -0.00277812010608613 1519.60034179688 507.5407 1519.60314941406 507.541656494141 3 14 1.1.1.3568.2 1 22.1019 178.4349 22.1315 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 90.9799993038177 TCVADESHAGCEK Carbamidomethyl(C)@2; Oxidation(D)@5; Carbamidomethyl(C)@11 -0.00406146980822086 1478.57263183594 493.8648 1478.57653808594 493.866149902344 3 13 1.1.1.3591.2 1 22.5066 723.5197 22.4241 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 86.3699972629547 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -0.0053843897767365 1462.57629394531 488.5327 1462.58166503906 488.534515380859 3 12 1.1.1.3625.3 1 23 271.5334 23.0051 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 18.350000679493 TCVADESHAGCEK Carbamidomethyl(C)@2; Oxidation(D)@5; Carbamidomethyl(C)@11 -0.000765634991694242 1478.57592773438 493.8659 1478.57653808594 493.866149902344 3 10 1.1.1.3522.2 1 21.2979 142.7787 21.2783 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TPVSEKVTK missed K-V@6 0.000931704009417444 987.561096191406 494.7878 987.56005859375 494.787292480469 2 15 1.1.1.3572.3 1 22.199 2270.176 22.2949 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TPVSEKVTK missed K-V@6 0.000931704009417444 987.561096191406 494.7878 987.56005859375 494.787292480469 2 15 1.1.1.3582.4 1 22.3616 2270.176 22.2949 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TPVSEKVTK missed K-V@6 0.00111481000203639 987.561279296875 494.7879 987.56005859375 494.787292480469 2 15 1.1.1.3605.2 1 22.7301 300.0571 22.5812 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.1700012683868 TPVSEKVTK Formyl(K)@6 missed K-V@6 0.000899271981325001 1015.55584716797 508.7852 1015.55499267578 508.784759521484 2 13 1.1.1.3953.4 1 28.306 90.4484 28.2867 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 77.5099992752075 TPVSEKVTK Acetyl(K)@6 missed K-V@6 -0.00341997994109988 1029.56726074219 515.7909 1029.57067871094 515.792602539063 2 10 1.1.1.3973.7 1 28.7899 238.5229 28.8278 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 51.800000667572 TPVSEKVTK Acetyl(K)@6 missed K-V@6 -0.00341997994109988 1029.56726074219 515.7909 1029.57067871094 515.792602539063 2 10 1.1.1.3981.4 1 28.9935 238.5229 28.8278 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK 0.00240277010016143 1398.68762207031 700.3511 1398.68530273438 700.349975585938 2 18 1.1.1.5150.3 1 56.6164 2119.261 56.6825 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.00415429007261992 1414.68444824219 708.3495 1414.68029785156 708.347412109375 2 17 1.1.1.4892.3 1 50.3374 405.0944 50.3541 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.00720599992200732 1414.6875 708.351 1414.68029785156 708.347412109375 2 18 1.1.1.4899.3 1 50.5041 444.3248 50.4745 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.0119666997343302 1414.69226074219 708.3534 1414.68029785156 708.347412109375 2 16 1.1.1.4928.10 1 51.2196 285.5142 51.2541 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.00415429007261992 1414.68444824219 708.3495 1414.68029785156 708.347412109375 2 15 1.1.1.4913.5 1 50.8456 452.6354 50.8137 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.00745014008134604 1414.68762207031 708.3511 1414.68029785156 708.347412109375 2 12 1.1.1.4920.8 1 51.0182 477.5061 50.7649 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 69.0400004386902 TVMENFVAFVDK Oxidation(M)@3 0.00745014008134604 1414.68762207031 708.3511 1414.68029785156 708.347412109375 2 12 1.1.1.4884.3 1 50.1439 249.2458 50.1383 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 -0.0135175995528698 3323.447265625 831.8691 3323.46069335938 831.872436523438 4 32 1.1.1.4980.6 1 52.4964 1723.143 52.533 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 -0.0220624003559351 3323.4384765625 831.8669 3323.46069335938 831.872436523438 4 23 1.1.1.4998.5 1 52.9371 1566.46 52.8471 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 1.48289000208024E-05 3307.46606445313 1103.496 3307.4658203125 1103.49584960938 3 20 1.1.1.5152.8 1 56.6724 822.5895 56.7067 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VASLRETYGDMADCCEK Oxidation(M)@11; Carbamidomethyl(C)@14; Carbamidomethyl(C)@15 missed R-E@5 -0.0105769000947475 2019.82299804688 674.2816 2019.83361816406 674.28515625 3 20 1.1.1.4061.7 1 30.8367 783.999 30.8895 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VHKECCHGDLLECADDRADLAK Carbamidomethyl(C)@5; Carbamidomethyl(C)@6; Carbamidomethyl(C)@13 missed K-E@3; missed R-A@17 -0.0224060993641615 2611.13525390625 523.2343 2611.15771484375 523.238830566406 5 14 1.1.1.4149.7 1 32.7638 2073.255 32.8188 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VPQVSTPTLVEVSR 0.0060050399042666 1510.84143066406 756.428 1510.83544921875 756.425048828125 2 20 1.1.1.4686.3 1 45.3657 3332.187 45.5479 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VPQVSTPTLVEVSR 0.0060050399042666 1510.84143066406 756.428 1510.83544921875 756.425048828125 2 21 1.1.1.4700.5 1 45.7097 3363.475 45.5479 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VPQVSTPTLVEVSR 0.00563882989808917 1510.84130859375 756.4279 1510.83544921875 756.425048828125 2 14 1.1.1.4707.9 1 45.8771 2510.053 45.6194 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.1900014877319 VPQVSTPTLVEVSR -0.993106007575989 1509.84240722656 504.2881 1510.83544921875 504.619110107422 3 13 1.1.1.4696.5 1 45.6111 490.7472 45.5956 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 87.3099982738495 VPQVSTPTLVEVSR -0.996401011943817 1509.83911132813 504.287 1510.83544921875 504.619110107422 3 12 1.1.1.4688.3 1 45.4151 588.4897 45.5 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 52.9299974441528 YGFQNALIVRYTRKVPQVSTPTLVEVSR Carbamidomethyl@N-term cleaved E-Y@N-term; missed R-Y@10; missed R-K@13; missed K-V@14 0.0675043985247612 3277.8623046875 1093.628 3277.79345703125 1093.60510253906 3 11 1.1.1.4507.5 1 41.2213 571.61 41.2263 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 0.000543513975571841 1442.63549804688 722.325 1442.634765625 722.324645996094 2 21 1.1.1.3991.4 1 29.1866 197.2958 29.2167 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -6.68284992570989E-05 1442.63464355469 722.3246 1442.634765625 722.324645996094 2 21 1.1.1.4016.6 1 29.7782 30514.44 29.8396 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Oxidation(Y)@1; Carbamidomethyl(C)@3 -0.00143180997110903 1458.62829589844 730.3214 1458.62963867188 730.322143554688 2 20 1.1.1.4021.3 1 29.9014 1542.411 29.8153 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -6.68284992570989E-05 1442.63464355469 722.3246 1442.634765625 722.324645996094 2 20 1.1.1.4030.7 1 30.1293 23717.08 29.8639 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -6.68284992570989E-05 1442.63464355469 722.3246 1442.634765625 722.324645996094 2 15 1.1.1.4039.6 1 30.2983 572.1224 30.0847 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -0.000677170988637954 1442.63403320313 722.3243 1442.634765625 722.324645996094 2 15 1.1.1.4046.15 1 30.4759 266.9038 30.5069 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3; Deamidated(N)@5 0.00662626000121236 1443.62524414063 722.8199 1443.61877441406 722.816650390625 2 17 1.1.1.4066.8 1 30.9556 240.644 30.9607 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -0.000310965988319367 1442.63452148438 722.3245 1442.634765625 722.324645996094 2 15 1.1.1.4009.3 1 29.6081 30657.15 29.8396 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 0.0062807397916913 1442.64111328125 722.3278 1442.634765625 722.324645996094 2 15 1.1.1.4092.3 1 31.5355 136.2691 31.5169 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.0499982833862 YICDNQDTISSK Dioxidation(Y)@1; Carbamidomethyl(C)@3 0.000623387983068824 1474.62524414063 738.3199 1474.62463378906 738.319580078125 2 17 1.1.1.4015.12 1 29.7577 968.086 29.8153 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.7699995040894 YICDNQDTISSK Carbamidomethyl(C)@3; Cation:Na(D)@4 -0.00673381984233856 1464.61010742188 733.3123 1464.61669921875 733.315612792969 2 12 1.1.1.4019.5 1 29.8521 157.1125 29.8396 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 90.9799993038177 YICDNQDTISSK Carbamidomethyl(C)@3 4.98326015472412 1447.61804199219 724.8163 1442.634765625 722.324645996094 2 12 1.1.1.4018.2 1 29.8229 167.5697 29.8396 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 88.9100015163422 YICDNQDTISSK Oxidation(Y)@1; Carbamidomethyl(C)@3 -0.00143180997110903 1458.62829589844 730.3214 1458.62963867188 730.322143554688 2 11 1.1.1.4015.11 1 29.756 1542.411 29.8153 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 83.5300028324127 YICDNQDTISSK Dioxidation(Y)@1; Carbamidomethyl(C)@3 0.000623387983068824 1474.62524414063 738.3199 1474.62463378906 738.319580078125 2 10 1.1.1.4022.15 1 29.9282 968.086 29.8153 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 83.1700026988983 YICDNQDTISSK Carbamidomethyl(C)@3 0.000543513975571841 1442.63549804688 722.325 1442.634765625 722.324645996094 2 8 1.1.1.3998.11 1 29.3624 197.2958 29.2167 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 51.800000667572 YICDNQDTISSK Trioxidation(Y)@1; Carbamidomethyl(C)@3 0.00170424999669194 1490.62121582031 746.3179 1490.61950683594 746.317016601563 2 10 1.1.1.4015.13 1 29.7594 523.4366 29.8396 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 47.189998626709 YICDNQDTISSK Carbamidomethyl(C)@3; Oxidation(D)@4 0.00161991000641137 1458.63122558594 730.3229 1458.62963867188 730.322143554688 2 8 1.1.1.3970.6 1 28.7219 96.4636 28.7303 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 44.8300004005432 YICDNQDTISSK Trioxidation(Y)@1; Carbamidomethyl(C)@3 0.00170424999669194 1490.62121582031 746.3179 1490.61950683594 746.317016601563 2 9 1.1.1.4022.16 1 29.9298 523.4366 29.8396 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSKLKECCDKPLLEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16; Carbamidomethyl(C)@17 missed K-L@12; missed K-E@14 -0.00732439989224076 2956.39086914063 740.105 2956.39794921875 740.106811523438 4 16 1.1.1.4506.7 1 41.1951 1117.124 41.1315 1 189.97 189.97 94.4000005722046 94.4000005722046 92.7500009536743 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 48.7100005149841 YLYEIAR 0.00268280995078385 926.488891601563 464.2517 926.486145019531 464.250366210938 2 11 1.1.1.4384.2 1 38.4069 9939.212 38.3406 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IDVLEGNEQFINAAK cleaved N-I@N-term 0.00718792015686631 1659.85412597656 830.9343 1659.84680175781 830.9306640625 2 23 1.1.1.4837.11 1 49.0194 739.7821 49.0328 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.00186350999865681 2298.166015625 767.0626 2298.16772460938 767.063232421875 3 22 1.1.1.4956.13 1 51.9053 3535.684 51.992 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.0206765998154879 3308.6982421875 828.1818 3308.71875 828.186950683594 4 18 1.1.1.5174.3 1 57.1989 1541.527 57.2907 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 -0.00779230007901788 2706.40087890625 677.6075 2706.40893554688 677.609497070313 4 20 1.1.1.4950.8 1 51.7529 21408.99 51.6457 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0402049012482166 6035.09228515625 863.1633 6035.1328125 863.169067382813 7 17 1.1.1.5398.5 1 62.6728 2657.393 62.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IVGGYTCAANSIPYQVSLNSG Carbamidomethyl(C)@7 cleaved G-S@C-term 0.00441164011135697 2170.04125976563 1086.028 2170.03637695313 1086.02551269531 2 21 1.1.1.4951.18 1 51.7884 1442.727 51.8674 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; ONE addition +154(K)@43 -0.000979247037321329 4814.25537109375 963.8584 4814.2568359375 963.858642578125 5 23 1.1.1.5071.5 1 54.6648 7873.813 54.5504 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00427005020901561 1939.93188476563 970.9732 1939.92761230469 970.971069335938 2 23 1.1.1.4920.14 1 51.0257 5787.755 50.8137 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00901553966104984 2210.08764648438 737.7032 2210.0966796875 737.706176757813 3 24 1.1.1.4852.3 1 49.3782 5379.666 49.3488 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 [trypsin fragment, 50 aa] missed K-I@20; missed K-L@40 -0.0319110006093979 5500.77294921875 917.8028 5500.8046875 917.80810546875 6 24 1.1.1.5402.10 1 62.7715 1273.117 62.761 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LSSPATLNSR Deamidated(N)@8 0.000272842997219414 1045.54064941406 523.7776 1045.54040527344 523.777465820313 2 16 1.1.1.4068.2 1 30.9947 3523.414 30.9844 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.00769462017342448 1773.8974609375 887.956 1773.88977050781 887.9521484375 2 23 1.1.1.4910.7 1 50.7776 451.6639 50.6676 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 VLEGNEQFINAAK cleaved D-V@N-term 0.00159202003851533 1431.73742675781 716.876 1431.73583984375 716.875183105469 2 22 1.1.1.4425.4 1 39.3784 603.1435 39.3876 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.95860815048218 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN acrolein addition +56(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.015981400385499 5313.7138671875 886.6263 5313.69775390625 886.623596191406 6 14 1.1.1.5542.3 1 66.2152 308.0966 66.1283 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.72124660015106 99.0000009536743 YVNWIQQTIAAN cleaved N-Y@N-term 0.00314623001031578 1419.71789550781 710.8662 1419.71472167969 710.864624023438 2 13 1.1.1.5119.4 1 55.8346 2143.33 55.9311 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.69897043704987 99.0000009536743 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00461333990097046 1565.73681640625 783.8757 1565.73217773438 783.873352050781 2 19 1.1.1.4513.4 1 41.3639 451.399 41.369 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.60206043720245 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATL acrolein addition +56(K)@40 cleaved L-N@C-term; missed K-I@20; missed K-L@40 0.0309964008629322 5199.68359375 1040.944 5199.6552734375 1040.93823242188 5 14 1.1.1.5584.13 1 67.1766 649.1048 67.1833 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.60206043720245 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN acrolein addition +56(K)@2; acrolein addition +76(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 -0.0155798001214862 2813.369140625 938.797 2813.384765625 938.802185058594 3 19 1.1.1.5412.3 1 63.0199 1170.591 63.0309 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.55284202098846 99.0000009536743 IDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@35 cleaved N-I@N-term; missed K-I@15; missed K-L@35 0.0280613992363214 5006.6083984375 1002.329 5006.5810546875 1002.32348632813 5 18 1.1.1.5527.4 1 65.8475 1151.344 65.7269 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.27572429180145 99.0000009536743 LGEHNIDVLEGNEQFINA cleaved A-A@C-term 0.00694712018594146 2010.97143554688 1006.493 2010.96472167969 1006.48962402344 2 18 1.1.1.4951.16 1 51.7851 1096.835 51.8674 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.0043648481369 99.0000009536743 SGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGN Carbamidomethyl(C)@11; Carbamidomethyl(C)@22; acrolein addition +56(K)@23 cleaved S-S@N-term; cleaved N-M@C-term; missed K-A@13; missed K-S@23 0.0179807990789413 3542.72021484375 886.6873 3542.7021484375 886.682800292969 4 13 1.1.1.5143.8 1 56.4456 1542.652 56.4119 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.982966780662537 99.0000009536743 EGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@31 cleaved L-E@N-term; missed K-I@11; missed K-L@31 0.0185365006327629 4566.33447265625 1142.591 4566.31787109375 1142.58666992188 4 13 1.1.1.5362.5 1 61.7919 2082.85 61.797 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.950782001018524 99.0000009536743 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Deamidated(N)@21; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term -0.00517908995971084 3807.79736328125 762.5668 3807.80249023438 762.567810058594 5 20 1.1.1.4989.4 1 52.7136 12742.18 52.7495 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.853872001171112 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKII acrolein addition +94(K)@24 cleaved I-T@C-term; missed R-L@4; missed K-I@24 -0.0470599010586739 3026.572265625 757.6503 3026.61889648438 757.661987304688 4 13 1.1.1.5385.4 1 62.351 1892.965 62.469 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.79587996006012 98.6999988555908 LGEHNIDVLEGNEQF cleaved F-I@C-term 0.00796473026275635 1712.80871582031 857.4116 1712.80053710938 857.407592773438 2 15 1.1.1.4836.11 1 48.9947 723.8887 49.0082 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.595166265964508 99.0000009536743 VNWIQQTIAAN cleaved Y-V@N-term 0.00336106005124748 1256.65466308594 629.3346 1256.6513671875 629.332946777344 2 16 1.1.1.5001.4 1 53.0023 488.8481 52.9455 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.555955231189728 97.9099988937378 GNTLDNDIMLIK cleaved N-G@N-term 0.00733123021200299 1345.69848632813 673.8565 1345.69116210938 673.852844238281 2 14 1.1.1.4905.4 1 50.6508 364.4789 50.6676 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.522878706455231 99.0000009536743 KIITHPNFNGNTLDNDIMLIK ONE addition +154(K)@1 cleaved A-K@N-term; missed K-I@1 -0.037788599729538 2564.32958984375 855.7838 2564.3671875 855.79638671875 3 14 1.1.1.5031.9 1 53.7452 307.7688 53.7818 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.492144078016281 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +62(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.02107759937644 2895.48046875 724.8774 2895.50170898438 724.882751464844 4 16 1.1.1.5116.7 1 55.761 3999.855 55.8539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.480172038078308 99.0000009536743 NIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@36 cleaved H-N@N-term; missed K-I@16; missed K-L@36 0.0130294002592564 5120.63720703125 854.4468 5120.6240234375 854.444641113281 6 13 1.1.1.5528.5 1 65.8693 266.887 65.8526 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.478861898183823 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Formyl(K)@24 missed R-L@4; missed K-I@24 -0.00498293992131948 4998.5615234375 834.1008 4998.56640625 834.101623535156 6 21 1.1.1.5369.4 1 61.9478 344.3594 61.9662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.473660677671433 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24 missed K-I@20 -0.0017612399533391 4488.27490234375 1123.076 4488.27490234375 1123.07592773438 4 17 1.1.1.5377.16 1 62.156 1208.884 62.1652 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.435333967208862 99.0000009536743 VLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@33 cleaved D-V@N-term; missed K-I@13; missed K-L@33 0.0158302001655102 4778.486328125 956.7045 4778.47021484375 956.701293945313 5 12 1.1.1.5380.12 1 62.2308 1233.972 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.387216120958328 97.5600004196167 FNGNTLDNDIMLIK cleaved N-F@N-term 0.00391330989077687 1606.80651855469 804.4105 1606.80249023438 804.408508300781 2 10 1.1.1.5035.6 1 53.8417 155.6984 53.8814 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.289882630109787 92.4499988555908 SSPATLNSR cleaved L-S@N-term 0.000814863014966249 931.473083496094 466.7438 931.472290039063 466.743438720703 2 11 1.1.1.3682.2 1 23.8914 621.0975 23.9755 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.263603508472443 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00081462599337101 869.534301757813 435.7744 869.533447265625 435.774017333984 2 8 1.1.1.5107.2 1 55.5317 397.6035 55.6273 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.213958784937859 95.9999978542328 LGEHNIDVLEGNEQFINAA cleaved A-K@C-term 0.00623372988775373 2082.00732421875 1042.011 2082.00170898438 1042.00817871094 2 12 1.1.1.4966.19 1 52.1607 1207.306 52.0675 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.204119980335236 85.8399987220764 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPR acrolein addition +56(K)@40; Deamidated(N)@48 missed K-I@20; missed K-L@40; missed R-V@50 0.00716421008110046 6381.3134765625 912.6235 6381.306640625 912.622497558594 7 14 1.1.1.5482.5 1 64.7222 318.0601 64.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.20273245871067 99.0000009536743 IITHPNFNGNTLDNDIMLIKLS hexanoyl addition +98(K)@20 cleaved S-S@C-term; missed K-L@20 -0.0456907004117966 2580.31665039063 861.1128 2580.36206054688 861.127990722656 3 14 1.1.1.5031.10 1 53.7469 987.7074 53.7818 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.164309427142143 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKS Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; MDA adduct +54(K)@43 cleaved S-R@C-term; missed K-S@43 0.0419875010848045 4800.2587890625 1201.072 4800.2158203125 1201.06127929688 4 13 1.1.1.5033.18 1 53.8018 1765.332 53.8319 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.145693957805634 84.0499997138977 IITHPNFNGN cleaved N-T@C-term -0.00101288000587374 1125.5556640625 563.7851 1125.55676269531 563.78564453125 2 10 1.1.1.4176.8 1 33.4056 281.6526 33.458 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.133122190833092 96.3599979877472 LGEHNIDVLEGN cleaved N-E@C-term 0.00359987001866102 1308.63464355469 655.3246 1308.63098144531 655.32275390625 2 14 1.1.1.4518.5 1 41.4826 644.6963 41.464 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.128427073359489 99.0000009536743 KPGVYTKVCNYVNWIQQTIAAN MDA adduct +62(K)@1; acrolein addition +112(K)@7; Carbamidomethyl(C)@9; Deamidated(N)@10 cleaved N-K@N-term; missed K-V@7 -0.0053229802288115 2741.34692382813 914.7896 2741.35229492188 914.791381835938 3 21 1.1.1.5581.2 1 67.095 334.3445 67.0585 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0690509676933289 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSRVA Deamidated(N)@8; MDA adduct +54(K)@20; Deamidated(N)@28 cleaved A-T@C-term; missed K-L@20; missed R-V@30 0.0247527994215488 3534.82763671875 884.7142 3534.802734375 884.7080078125 4 13 1.1.1.5207.9 1 58.0341 291.4998 58.074 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0629838928580284 99.0000009536743 NTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@8; acrolein addition +76(K)@11 cleaved G-N@N-term; missed K-L@11 0.00779280019924045 2343.25122070313 782.091 2343.24340820313 782.088439941406 3 17 1.1.1.5121.7 1 55.8886 1231.395 55.9565 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0599818415939808 60.5199992656708 TLDNDIMLIK cleaved N-T@N-term 0.00706778978928924 1174.63391113281 588.3242 1174.62670898438 588.320678710938 2 10 1.1.1.4843.7 1 49.1638 594.0195 49.2048 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0589857585728168 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl@N-term; acrolein addition +38(K)@2 cleaved A-A@N-term; missed K-I@2; missed K-L@22 -0.0240084994584322 3588.8486328125 898.2194 3588.87231445313 898.225341796875 4 15 1.1.1.5146.7 1 56.519 1209.636 56.4863 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0540392957627773 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 -0.0348199009895325 3156.58984375 790.1547 3156.62451171875 790.163391113281 4 15 1.1.1.5210.3 1 58.1034 3884.041 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.049148540943861 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0326258987188339 5933.02099609375 989.8441 5933.05322265625 989.849487304688 6 20 1.1.1.5403.15 1 62.8006 8701.148 62.9099 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0467236638069153 89.9900019168854 EQFINAAK cleaved N-E@N-term 0.00124997005332261 919.477661132813 460.7461 919.476318359375 460.745452880859 2 8 1.1.1.4050.3 1 30.5586 647.0266 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0457574911415577 89.2799973487854 SPATLNSR cleaved S-S@N-term 0.00270818988792598 844.443054199219 423.2288 844.440307617188 423.227416992188 2 11 1.1.1.3608.2 1 22.8035 179.8486 22.7351 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0433514192700386 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20 cleaved N-T@C-term; missed K-I@20 -0.00841950997710228 3345.66577148438 837.4237 3345.67431640625 837.425842285156 4 20 1.1.1.5172.4 1 57.1491 1526.704 57.0707 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0385789051651955 99.0000009536743 SSGSSYPSLLQCLK Phospho(S)@8; Deamidated(Q)@11; Carbamidomethyl(C)@12; acrolein addition +38(K)@14 0.0178426001220942 1644.728515625 823.3715 1644.71069335938 823.362609863281 2 13 1.1.1.5381.4 1 62.2497 1647.351 62.3196 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0282604098320007 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20 cleaved N-G@C-term; missed K-I@20 -0.00426251022145152 3174.60571289063 794.6587 3174.60986328125 794.659729003906 4 24 1.1.1.5196.4 1 57.7482 2454.997 57.8448 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0259490963071585 91.4799988269806 AAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@13; acrolein addition +56(K)@23 cleaved N-A@N-term; missed K-I@3; missed K-L@23 0.0175905991345644 3635.91577148438 728.1904 3635.89819335938 728.186889648438 5 11 1.1.1.5124.3 1 55.9621 1789.038 56.0076 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0254883076995611 99.0000009536743 TKVCNYVNWIQQTIAAN Carbamyl@N-term; MDA adduct +62(K)@2; Carbamidomethyl(C)@4 cleaved Y-T@N-term; missed K-V@2 -0.0252564996480942 2126.99560546875 710.0058 2127.02075195313 710.014221191406 3 14 1.1.1.5379.3 1 62.1971 181.8326 62.1911 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0227337870746851 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@24; Delta:H(2)C(2)(H)@28 cleaved F-N@C-term; missed R-L@4; missed K-I@24 -0.0199621003121138 3652.91650390625 731.5906 3652.9365234375 731.594604492188 5 13 1.1.1.5205.2 1 57.9782 304.75 57.9737 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0222763959318399 99.0000009536743 DNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@8 cleaved L-D@N-term; missed K-L@8 0.00585603015497327 2015.07824707031 672.7 2015.07214355469 672.697998046875 3 15 1.1.1.5012.5 1 53.2772 387.1777 53.1904 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.021819481626153 99.0000009536743 GGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@5; Hex(N)@17; Carbamidomethyl(C)@23; reduced HNE(H)@38; Carbamidomethyl(C)@39; acrolein addition +56(K)@41 cleaved V-G@N-term -0.0435173995792866 4823.1865234375 1206.804 4823.23046875 1206.81494140625 4 14 1.1.1.5092.11 1 55.1655 6008.67 55.2019 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0195421073585749 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 -0.00615260982885957 2661.37329101563 666.3506 2661.37963867188 666.352172851563 4 20 1.1.1.5200.2 1 57.8496 372.9997 57.8188 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0190880633890629 99.0000009536743 TLDNDIMLIKLSSPATLNSR Methyl(K)@10 cleaved N-T@N-term; missed K-L@10 -5.27689990121871E-05 2215.18823242188 739.4033 2215.18823242188 739.4033203125 3 21 1.1.1.5086.4 1 55.0105 1326.279 55.0785 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0186344906687737 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN Delta:H(4)C(2)(K)@20 cleaved N-F@C-term; missed K-I@20 -0.00885654985904694 2913.48974609375 729.3797 2913.49853515625 729.381896972656 4 23 1.1.1.5090.4 1 55.1086 4138.181 55.2019 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0168249271810055 68.970000743866 LGEHNIDVLEG cleaved G-N@C-term 0.00416640983894467 1194.59228515625 598.3034 1194.58801269531 598.301330566406 2 10 1.1.1.4551.6 1 42.2248 727.3555 42.3279 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0168249271810055 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHP acrolein addition +94(K)@20; Oxidation(P)@25 cleaved P-N@C-term; missed K-I@20 -0.00138508004602045 2881.45971679688 721.3722 2881.4609375 721.37255859375 4 12 1.1.1.5119.5 1 55.8355 276.7424 55.8285 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0168249271810055 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNG Formyl(K)@20 cleaved G-N@C-term; missed K-I@20 0.0180277992039919 3231.61303710938 808.9105 3231.59497070313 808.906005859375 4 14 1.1.1.5194.7 1 57.6993 353.2524 57.7417 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.013228265568614 99.0000009536743 GCAQKNKPGVYTKVCNYVNWIQQTIAAN Carbamidomethyl(C)@2; hexanoyl addition +98(K)@5; MDA adduct +62(K)@7; Delta:H(4)C(2)(K)@13; Carbamidomethyl(C)@15 cleaved Y-G@N-term; missed K-N@5; missed K-V@13 -0.00874240975826979 3412.697265625 854.1816 3412.7060546875 854.183776855469 4 16 1.1.1.5368.7 1 61.9284 988.0168 61.9662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0127807697281241 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATL Methyl(K)@20 cleaved L-N@C-term; missed K-L@20 0.0070958100259304 2965.5654296875 989.5291 2965.55834960938 989.526733398438 3 17 1.1.1.5376.12 1 62.1273 1829.114 62.1399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0109953843057156 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Methyl(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00362839992158115 2386.2490234375 796.4236 2386.25268554688 796.4248046875 3 20 1.1.1.5117.7 1 55.7863 2981.711 55.8539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00833099242299795 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@23; Delta:H(4)C(2)(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 -0.0584845989942551 5573.82421875 797.2679 5573.8828125 797.276245117188 7 21 1.1.1.5474.7 1 64.5248 397.2453 64.4177 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00656376918777823 98.3299970626831 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; MDA adduct +54(K)@43; Arg-loss@C-term missed K-S@43 0.0419875010848045 4800.2587890625 1201.072 4800.2158203125 1201.06127929688 4 13 1.1.1.5033.18 1 53.8018 1765.332 53.8319 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00524305552244186 52.4900019168854 FINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@26 cleaved Q-F@N-term; missed K-I@6; missed K-L@26 0.0293581001460552 4009.138671875 802.835 4009.10961914063 802.829162597656 5 10 1.1.1.5210.5 1 58.105 765.4519 58.0988 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00436480529606342 96.6899991035461 RIQVRLGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)@N-term cleaved S-R@N-term; missed R-I@1; missed R-L@5 -0.0193638000637293 2888.50634765625 963.8427 2888.52563476563 963.849182128906 3 15 1.1.1.4822.12 1 48.6566 535.0829 48.6692 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00305075151845813 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKI Hex(N)@21; MDA adduct +54(K)@24 cleaved I-I@C-term; missed R-L@4; missed K-I@24 0.0154034001752734 3035.57177734375 759.9002 3035.55639648438 759.896362304688 4 13 1.1.1.5394.3 1 62.5721 353.892 62.5905 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00305075151845813 29.0499985218048 LGEHNIDVL cleaved L-E@C-term 0.0113695003092289 1008.53546142578 505.275 1008.52398681641 505.269287109375 2 9 1.1.1.4560.5 1 42.4346 1963.853 42.4227 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00217691925354302 67.0000016689301 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPA reduced acrolein addition +96(K)@20; reduced HNE(H)@24; acrolein addition +112(K)@40 cleaved A-T@C-term; missed K-I@20; missed K-L@40 -0.0423195995390415 5295.69580078125 883.6232 5295.73779296875 883.630249023438 6 11 1.1.1.5564.2 1 66.7427 274.739 66.7347 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00217691925354302 99.0000009536743 PGVYTKVCNYVNWIQQTIAAN Octanoyl(T)@5; HPNE addition +172(K)@6; Carbamidomethyl(C)@8 cleaved K-P@N-term; missed K-V@6 -0.010266900062561 2736.4091796875 913.1437 2736.41967773438 913.147155761719 3 12 1.1.1.5292.8 1 60.1313 481.4553 60.1729 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00174066168256104 55.1400005817413 IQQTIAAN cleaved W-I@N-term 0.00259049003943801 857.463256835938 429.7389 857.460693359375 429.737609863281 2 7 1.1.1.3973.3 1 28.7832 968.3036 28.7062 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00174066168256104 78.2599985599518 NSRVATVSLPR Carbamidomethyl@N-term cleaved L-N@N-term; missed R-V@3 0.0136254001408815 1255.71350097656 628.864 1255.69970703125 628.857116699219 2 9 1.1.1.6214.5 1 78.7918 365.0532 78.8245 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00174066168256104 98.8499999046326 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAH Carbamidomethyl(C)@6; Deamidated(N)@9; Carbamidomethyl(C)@24; Dehydrated(S)@27 cleaved I-V@N-term; cleaved H-C@C-term 0.0336190015077591 4077.90698242188 1020.484 4077.87377929688 1020.47570800781 4 13 1.1.1.5143.13 1 56.4498 1879.165 56.4863 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00130484171677381 27.3299992084503 EQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@28 cleaved N-E@N-term; missed K-I@8; missed K-L@28 0.0158437993377447 4266.2265625 854.2526 4266.21044921875 854.249389648438 5 10 1.1.1.5291.11 1 60.1082 3403.486 60.1472 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00130484171677381 44.310000538826 PNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@13; reduced acrolein addition +58(K)@16 cleaved H-P@N-term; missed K-L@16 0.00990283954888582 2918.49072265625 973.8375 2918.48071289063 973.834228515625 3 10 1.1.1.5403.13 1 62.7989 272.7531 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000869458774104714 94.8400020599365 CYKSRIQVRLGEHNIDVLEGNEQFINAAK Carbamidomethyl(C)@1; Deamidated(Q)@7; Deamidated(R)@9 cleaved H-C@N-term; missed K-S@3; missed R-I@5; missed R-L@9 -0.00771573977544904 3402.6923828125 1135.238 3402.69897460938 1135.240234375 3 15 1.1.1.4828.15 1 48.8083 355.9278 48.7891 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000869458774104714 99.0000009536743 IMLIKLSSPATLNSR Methyl(K)@5 cleaved D-I@N-term; missed K-L@5 0.00645228009670973 1656.96606445313 553.3293 1656.95971679688 553.3271484375 3 19 1.1.1.4842.4 1 49.1368 390.5802 49.1314 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000434511806815863 60.1100027561188 IITHPNFNGNTLDNDIMLIKLSSPATLN Dethiomethyl(M)@17; acrolein addition +76(K)@20 cleaved N-S@C-term; missed K-L@20 0.00222678994759917 3093.61572265625 774.4112 3093.61352539063 774.41064453125 4 10 1.1.1.5288.4 1 60.0273 165.9167 60.096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000434511806815863 93.3399975299835 IQVRLGEHNIDVLEGNEQFINAAKIIT Deamidated(Q)@18; Deamidated(N)@21 cleaved T-H@C-term; missed R-L@4; missed K-I@24 -0.0192731004208326 3035.5732421875 759.9006 3035.5927734375 759.905456542969 4 12 1.1.1.5378.9 1 62.176 252.1204 62.1399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000434511806815863 63.4299993515015 IVGGY cleaved Y-T@C-term -0.000567779992707074 507.268737792969 508.276 507.269287109375 508.276580810547 1 7 1.1.1.4053.5 1 30.6352 424.6674 30.5547 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000434511806815863 85.0499987602234 SLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAK Carbamidomethyl(C)@9; Carbamidomethyl(C)@25 cleaved V-S@N-term; missed K-S@27; missed R-I@29; missed R-L@33 0.992794990539551 5897.88330078125 1180.584 5896.8916015625 1180.38562011719 5 11 1.1.1.4822.19 1 48.6625 468.0735 48.6447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000434511806815863 99.0000009536743 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@6; Ammonia-loss(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@40; Delta:H(4)C(2)(K)@42 cleaved I-V@N-term; missed K-S@42 0.0262831002473831 4800.25341796875 961.058 4800.22705078125 961.052734375 5 17 1.1.1.5048.3 1 54.1637 4955.505 54.23 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 -0.00222170003689826 3634.93359375 727.994 3634.93579101563 727.994445800781 5 31 1.1.1.5085.2 1 54.9879 7333.51 55.0541 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 -0.00222170003689826 3634.93359375 727.994 3634.93579101563 727.994445800781 5 17 1.1.1.5092.4 1 55.158 7333.51 55.0541 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2 cleaved A-A@N-term; missed K-I@2; missed K-L@22 -0.0726407021284103 3605.85131835938 902.4701 3605.92407226563 902.48828125 4 15 1.1.1.5142.10 1 56.4226 1146.736 56.6096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl@N-term; acrolein addition +38(K)@2; Deamidated(N)@12 cleaved A-A@N-term; missed K-I@2; missed K-L@22 -0.0241435002535582 3589.83203125 898.4653 3589.85620117188 898.471313476563 4 16 1.1.1.5203.11 1 57.9344 278.5967 57.9223 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@2; Deamidated(N)@12; Methyl(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 -0.0178119000047445 3634.88500976563 909.7285 3634.90283203125 909.732971191406 4 15 1.1.1.5148.16 1 56.5759 1208.39 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.7200019359589 CYKSRIQVRLGEHNIDVLEGNEQFINAAK Carbamidomethyl(C)@1; Deamidated(Q)@7; Deamidated(R)@9 cleaved H-C@N-term; missed K-S@3; missed R-I@5; missed R-L@9 -0.0381110012531281 3402.66235351563 1135.228 3402.69897460938 1135.240234375 3 15 1.1.1.4820.16 1 48.6152 719.9094 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 EGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@31 cleaved L-E@N-term; missed K-I@11; missed K-L@31 1.27692001115065E-05 4566.31787109375 914.2708 4566.31787109375 914.270812988281 5 11 1.1.1.5361.8 1 61.763 2809.452 61.8211 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.000789373996667564 2661.38037109375 888.1341 2661.37963867188 888.1337890625 3 15 1.1.1.5194.10 1 57.7018 4798.358 57.8448 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.000789373996667564 2661.38037109375 888.1341 2661.37963867188 888.1337890625 3 24 1.1.1.5201.7 1 57.8796 4798.358 57.8448 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Dethiomethyl(M)@11; acrolein addition +76(K)@14 cleaved N-F@N-term; missed K-L@14 -0.0020783799700439 2662.35815429688 888.46 2662.3603515625 888.460693359375 3 17 1.1.1.5270.7 1 59.5886 996.299 59.5316 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 FNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@4; Dethiomethyl(M)@11; acrolein addition +76(K)@14 cleaved N-F@N-term; missed K-L@14 -0.0020783799700439 2662.35815429688 888.46 2662.3603515625 888.460693359375 3 11 1.1.1.5263.10 1 59.4184 996.299 59.5316 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.5000028610229 FNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@4; Dethiomethyl(M)@11; acrolein addition +76(K)@14 cleaved N-F@N-term; missed K-L@14 0.0111050996929407 2662.37133789063 888.4644 2662.3603515625 888.460693359375 3 11 1.1.1.5246.7 1 58.9959 258.0194 58.9875 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.6600017547607 FNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Dethiomethyl(M)@11; acrolein addition +76(K)@14 cleaved N-F@N-term; missed K-L@14 -0.00189527997281402 2662.3583984375 888.4601 2662.3603515625 888.460693359375 3 11 1.1.1.5278.4 1 59.7817 994.5717 59.5316 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.8199980258942 GEHNIDVLEGNEQFINAAK Hex(N)@4 cleaved L-G@N-term 0.011167399585247 2259.07739257813 1130.546 2259.0654296875 1130.5400390625 2 12 1.1.1.4825.6 1 48.7358 485.8283 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@23; Delta:H(4)C(2)(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 -0.0548321008682251 5573.82763671875 929.9786 5573.8828125 929.987731933594 6 21 1.1.1.5492.5 1 64.9706 1998.844 64.9581 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7699995040894 GNTLDNDIMLIK cleaved N-G@N-term 0.00354710989631712 1345.69470214844 673.8546 1345.69116210938 673.852844238281 2 12 1.1.1.4915.6 1 50.8937 280.8402 50.8624 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 77.5099992752075 GNTLDNDIMLIK cleaved N-G@N-term 0.00330296996980906 1345.69445800781 673.8545 1345.69116210938 673.852844238281 2 9 1.1.1.4925.6 1 51.143 268.6856 50.9848 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Oxidation(M)@9; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.000510978978127241 2416.26293945313 806.4282 2416.26318359375 806.428344726563 3 28 1.1.1.5055.3 1 54.3117 1600.488 54.4257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Met->Hcy(M)@9; reduced acrolein addition +58(K)@12 cleaved N-G@N-term; missed K-L@12 -0.000327874993672594 2416.26293945313 806.4282 2416.26318359375 806.428344726563 3 22 1.1.1.5064.3 1 54.4876 1606.826 54.4257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00066505599534139 2401.25170898438 801.4245 2401.25219726563 801.424682617188 3 16 1.1.1.5086.6 1 55.0122 1840.11 55.0541 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00065059500047937 2400.267578125 801.0965 2400.26831054688 801.0966796875 3 28 1.1.1.5120.6 1 55.8621 28475.08 55.9311 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00389776006340981 2400.2646484375 601.0734 2400.26831054688 601.074340820313 4 17 1.1.1.5121.3 1 55.8853 1513.531 55.9311 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Oxidation(M)@9; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.0005876449868083 2416.263671875 806.4285 2416.26318359375 806.428344726563 3 19 1.1.1.5121.9 1 55.8903 1842.165 55.9311 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@9; acrolein addition +76(K)@12 cleaved N-G@N-term; missed K-L@12 -0.000526932009961456 2400.2646484375 601.0734 2400.26489257813 601.073486328125 4 19 1.1.1.5122.2 1 55.9102 1513.531 55.9311 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00389776006340981 2400.2646484375 601.0734 2400.26831054688 601.074340820313 4 18 1.1.1.5123.2 1 55.9355 1513.531 55.9311 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00389776006340981 2400.2646484375 601.0734 2400.26831054688 601.074340820313 4 17 1.1.1.5124.2 1 55.9612 1513.531 55.9311 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00065059500047937 2400.267578125 801.0965 2400.26831054688 801.0966796875 3 28 1.1.1.5127.2 1 56.0378 28475.08 55.9311 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12; Deamidated(N)@20 cleaved N-G@N-term; missed K-L@12 -0.00121437001507729 2401.25122070313 801.4243 2401.25219726563 801.424682617188 3 18 1.1.1.5133.3 1 56.1894 3086.161 56.286 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12; Deamidated(N)@20 cleaved N-G@N-term; missed K-L@12 -0.00121437001507729 2401.25122070313 801.4243 2401.25219726563 801.424682617188 3 16 1.1.1.5134.2 1 56.2139 3086.161 56.286 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00121437001507729 2401.25122070313 801.4243 2401.25219726563 801.424682617188 3 24 1.1.1.5141.3 1 56.3918 3086.161 56.286 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00121437001507729 2401.25122070313 801.4243 2401.25219726563 801.424682617188 3 16 1.1.1.5143.4 1 56.4423 3086.161 56.286 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Dethiomethyl(M)@9; acrolein addition +76(K)@12 cleaved N-G@N-term; missed K-L@12 0.000691628025379032 2401.24975585938 801.4238 2401.2490234375 801.423583984375 3 21 1.1.1.5159.4 1 56.8404 795.6154 56.8522 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.002679199911654 2401.24975585938 801.4238 2401.25219726563 801.424682617188 3 17 1.1.1.5166.4 1 57.0052 795.6154 56.8522 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00389776006340981 2400.2646484375 601.0734 2400.26831054688 601.074340820313 4 14 1.1.1.5125.5 1 55.9892 1513.531 55.9311 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 GNTLDNDIMLIKLSSPATLNSR cleaved N-G@N-term; missed K-L@12 0.00163466995581985 2372.23852539063 791.7535 2372.23706054688 791.7529296875 3 10 1.1.1.5115.8 1 55.7366 818.0925 55.7023 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3699994087219 GNTLDNDIMLIKLSSPATLNSR cleaved N-G@N-term; missed K-L@12 0.00163466995581985 2372.23852539063 791.7535 2372.23706054688 791.7529296875 3 10 1.1.1.5112.8 1 55.6613 818.0925 55.7023 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@29; acrolein addition +56(K)@35 cleaved N-I@N-term; missed K-I@15; missed K-L@35 0.0260969009250402 5007.59375 1002.526 5007.56494140625 1002.52032470703 5 13 1.1.1.5557.3 1 66.5931 692.9323 66.5541 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 IDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@35 cleaved N-I@N-term; missed K-I@15; missed K-L@35 0.0280613992363214 5006.6083984375 1002.329 5006.5810546875 1002.32348632813 5 10 1.1.1.5520.5 1 65.6713 1151.344 65.7269 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.00186350999865681 2298.166015625 767.0626 2298.16772460938 767.063232421875 3 21 1.1.1.4963.12 1 52.0801 3535.684 51.992 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.00271364999935031 2282.17553710938 761.7325 2282.1728515625 761.731567382813 3 26 1.1.1.5029.5 1 53.6888 27489.88 53.7818 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.000461229996290058 2298.16845703125 767.0634 2298.16772460938 767.063232421875 3 25 1.1.1.5031.6 1 53.7402 1959.928 53.7818 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.000461229996290058 2298.16845703125 767.0634 2298.16772460938 767.063232421875 3 16 1.1.1.5035.3 1 53.8367 1959.928 53.7818 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.00271364999935031 2282.17553710938 761.7325 2282.1728515625 761.731567382813 3 26 1.1.1.5036.5 1 53.863 27489.88 53.7818 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@14 0.0191778000444174 2283.17602539063 762.066 2283.15698242188 762.0595703125 3 17 1.1.1.5038.6 1 53.914 17855.91 53.7818 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.000461229996290058 2298.16845703125 767.0634 2298.16772460938 767.063232421875 3 15 1.1.1.5039.4 1 53.9409 1959.928 53.7818 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.00271364999935031 2282.17553710938 761.7325 2282.1728515625 761.731567382813 3 20 1.1.1.5043.4 1 54.035 28903.98 53.7818 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10 0.00159985001664609 2283.15844726563 762.0601 2283.15698242188 762.0595703125 3 29 1.1.1.5053.2 1 54.2725 3535.858 54.4018 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@6 0.00159985001664609 2283.15844726563 762.0601 2283.15698242188 762.0595703125 3 27 1.1.1.5061.2 1 54.4311 3543.513 54.4018 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.00123364001046866 2283.158203125 762.06 2283.15698242188 762.0595703125 3 30 1.1.1.5069.4 1 54.6079 11092.49 54.6222 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 -5.24066017533187E-05 2299.15161132813 767.3912 2299.15185546875 767.391235351563 3 19 1.1.1.5007.9 1 53.1509 811.228 53.2397 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.0013616899959743 2299.1533203125 767.3917 2299.15185546875 767.391235351563 3 16 1.1.1.5014.6 1 53.3248 808.2576 53.2397 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Methyl(K)@20 -0.000543132016900927 2296.18823242188 766.4033 2296.1884765625 766.403442382813 3 22 1.1.1.5042.4 1 54.0126 2169.488 54.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Ammonia-loss(N)@10 0.00206527998670936 2265.14868164063 756.0568 2265.14624023438 756.056091308594 3 22 1.1.1.5062.3 1 54.4566 1474.658 54.4734 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@10 0.0156836993992329 2284.15673828125 762.3928 2284.14086914063 762.387573242188 3 15 1.1.1.5082.3 1 54.9197 360.3109 54.8133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 IITHPNFNGNTLDNDIMLIK Oxidation(N)@14; Dethiomethyl(M)@17 0.00296248006634414 2250.16723632813 751.063 2250.16455078125 751.062072753906 3 11 1.1.1.5032.6 1 53.7642 299.3817 53.7818 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8099980354309 IITHPNFNGNTLDNDIMLIK Deamidated(N)@6 -0.0190909001976252 2283.13793945313 762.0532 2283.15698242188 762.0595703125 3 10 1.1.1.5091.3 1 55.1324 181.5438 55.1278 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.2699997425079 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@14 0.00115999998524785 2284.14208984375 762.388 2284.14086914063 762.387573242188 3 10 1.1.1.5010.9 1 53.2263 266.8346 53.2397 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATL Methyl(K)@20 cleaved L-N@C-term; missed K-L@20 0.0070958100259304 2965.5654296875 989.5291 2965.55834960938 989.526733398438 3 21 1.1.1.5373.6 1 62.0509 1829.114 62.1399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATL Delta:H(4)C(2)(K)@20 cleaved L-N@C-term; missed K-L@20 0.00590367987751961 2979.580078125 994.2006 2979.57397460938 994.198608398438 3 30 1.1.1.5379.15 1 62.2071 2667.482 62.1911 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.6600017547607 IITHPNFNGNTLDNDIMLIKLSSPATL Dethiomethyl(M)@17; MDA adduct +62(K)@20 cleaved L-N@C-term; missed K-L@20 -0.00303570996038616 2965.55224609375 742.3953 2965.55493164063 742.39599609375 4 11 1.1.1.5378.4 1 62.1719 682.4427 62.1399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17 missed K-L@20 -0.00081539701204747 3324.712890625 832.1855 3324.71362304688 832.185668945313 4 20 1.1.1.5093.5 1 55.1852 921.4598 55.3771 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.00505171017721295 3308.7138671875 828.1857 3308.71875 828.186950683594 4 17 1.1.1.5136.5 1 56.2676 29724.34 56.4615 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.00502600986510515 3308.72338867188 1103.915 3308.71875 1103.91357421875 3 14 1.1.1.5138.14 1 56.3258 6462.758 56.4615 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.012878299690783 3308.70556640625 662.7484 3308.71875 662.751037597656 5 24 1.1.1.5142.3 1 56.4167 2759.73 56.4615 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.00505171017721295 3308.7138671875 828.1857 3308.71875 828.186950683594 4 37 1.1.1.5143.6 1 56.4439 29656.01 56.4615 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.00505171017721295 3308.7138671875 828.1857 3308.71875 828.186950683594 4 38 1.1.1.5144.5 1 56.4679 29656.01 56.4615 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.00505171017721295 3308.7138671875 828.1857 3308.71875 828.186950683594 4 20 1.1.1.5145.8 1 56.4952 29656.01 56.4615 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.00505171017721295 3308.7138671875 828.1857 3308.71875 828.186950683594 4 39 1.1.1.5145.9 1 56.496 29656.01 56.4615 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.00505171017721295 3308.7138671875 828.1857 3308.71875 828.186950683594 4 18 1.1.1.5147.3 1 56.542 29656.01 56.4615 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@28 missed K-L@20 -0.00640847021713853 3309.69604492188 828.4313 3309.70263671875 828.432983398438 4 17 1.1.1.5155.7 1 56.7386 1693.34 56.7067 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.00178417004644871 3308.72045898438 828.1874 3308.71875 828.186950683594 4 22 1.1.1.5159.5 1 56.8438 1210.192 56.7796 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.0113992998376489 3308.70727539063 828.1841 3308.71875 828.186950683594 4 19 1.1.1.5166.5 1 57.0069 611.4611 56.9732 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10 missed K-L@20 -0.00469949981197715 3309.6982421875 828.4318 3309.70263671875 828.432983398438 4 16 1.1.1.5173.6 1 57.1753 1528.432 57.2418 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.0206765998154879 3308.6982421875 828.1818 3308.71875 828.186950683594 4 19 1.1.1.5181.3 1 57.3688 1541.527 57.2907 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8 missed K-L@20 -0.00518778013065457 3309.697265625 828.4316 3309.70263671875 828.432983398438 4 14 1.1.1.5189.8 1 57.5727 501.8374 57.5125 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8 missed K-L@20 0.00098744104616344 3309.7041015625 1104.242 3309.70263671875 1104.24157714844 3 24 1.1.1.5203.18 1 57.9403 2343.26 57.9223 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8 missed K-L@20 -0.0103147001937032 3309.69262695313 828.4304 3309.70263671875 828.432983398438 4 37 1.1.1.5204.4 1 57.9544 9444.163 57.9223 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8 missed K-L@20 -0.0103147001937032 3309.69262695313 828.4304 3309.70263671875 828.432983398438 4 24 1.1.1.5205.4 1 57.9799 9444.163 57.9223 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; reduced acrolein addition +58(K)@20 missed K-L@20 -0.0176851004362106 3367.72705078125 842.939 3367.74462890625 842.943420410156 4 14 1.1.1.5154.4 1 56.7117 1136.502 56.7309 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Arg-add@N-term; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0179970990866423 3492.86889648438 874.2245 3492.85107421875 874.220031738281 4 25 1.1.1.5080.2 1 54.8659 559.7822 54.8611 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0106765003874898 3336.7392578125 835.1921 3336.75 835.194763183594 4 19 1.1.1.5088.6 1 55.061 427.8028 55.0785 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 -0.00655691977590322 3338.72265625 835.6879 3338.72924804688 835.689575195313 4 24 1.1.1.5096.8 1 55.2609 2758.597 55.4274 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Methyl(K)@20 missed K-L@20 -0.00238532992079854 3323.71606445313 831.9363 3323.71826171875 831.936889648438 4 17 1.1.1.5098.12 1 55.3144 1288.38 55.4021 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 -0.00655691977590322 3338.72265625 835.6879 3338.72924804688 835.689575195313 4 24 1.1.1.5103.6 1 55.4349 2758.597 55.4274 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00765899010002613 3352.7373046875 839.1916 3352.74487304688 839.193481445313 4 30 1.1.1.5104.7 1 55.4608 2689.397 55.4776 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0084909601137042 3352.73681640625 671.5546 3352.74487304688 671.556274414063 5 20 1.1.1.5105.3 1 55.4825 418.6971 55.4776 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Methyl(K)@20 missed K-L@20 -0.00238532992079854 3323.71606445313 831.9363 3323.71826171875 831.936889648438 4 20 1.1.1.5105.6 1 55.485 1288.38 55.4021 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 -0.00582450022920966 3338.72338867188 835.6881 3338.72924804688 835.689575195313 4 32 1.1.1.5110.5 1 55.6089 3316.117 55.6027 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00692657986655831 3352.73803710938 839.1918 3352.74487304688 839.193481445313 4 34 1.1.1.5111.11 1 55.6389 4023.704 55.6523 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0084909601137042 3352.73681640625 671.5546 3352.74487304688 671.556274414063 5 21 1.1.1.5112.4 1 55.658 652.0487 55.6523 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 -0.00582450022920966 3338.72338867188 835.6881 3338.72924804688 835.689575195313 4 15 1.1.1.5116.11 1 55.7643 3316.117 55.6027 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20; Deamidated(N)@28 missed K-L@20 -0.00169139995705336 3353.72729492188 839.4391 3353.72900390625 839.439514160156 4 19 1.1.1.5119.9 1 55.8388 638.216 55.8797 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00345578999258578 3338.72143554688 835.6876 3338.71801757813 835.686767578125 4 17 1.1.1.5128.5 1 56.0654 728.9752 56.0076 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.000666819978505373 3336.74926757813 835.1946 3336.75 835.194763183594 4 14 1.1.1.5141.4 1 56.3926 272.9414 56.387 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@20; GlyGly(S)@22 missed K-L@20 0.00951354019343853 3518.82861328125 880.7144 3518.81909179688 880.712036132813 4 19 1.1.1.5142.9 1 56.4217 447.5502 56.4615 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Deamidated(N)@14; Carboxy(D)@15 missed K-L@20 0.03602309897542 3354.71264648438 839.6854 3354.67651367188 839.676391601563 4 21 1.1.1.5144.6 1 56.4687 1922.084 56.5851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.0171415992081165 3322.71728515625 665.5507 3322.734375 665.554138183594 5 31 1.1.1.5147.2 1 56.5403 10286.37 56.5851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; HexNAc(S)@23 missed K-L@20 -0.0286292005330324 3573.78540039063 894.4536 3573.81372070313 894.460693359375 4 15 1.1.1.5147.4 1 56.5436 1636.121 56.5111 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Hex(N)@14; MDA adduct +62(K)@20 missed K-L@20 0.0518115982413292 3532.8388671875 707.5751 3532.787109375 707.564697265625 5 18 1.1.1.5148.2 1 56.5642 1443.007 56.6096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0250663999468088 3324.72729492188 832.1891 3324.70239257813 832.182861328125 4 19 1.1.1.5148.6 1 56.5676 23676.3 56.6096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00139448000118136 3337.7353515625 835.4411 3337.73413085938 835.440795898438 4 24 1.1.1.5148.8 1 56.5692 62808.82 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Methyl(L)@21; Carbamidomethyl(S)@22 missed K-L@20 -0.011497600004077 3533.84375 884.4682 3533.85522460938 884.471069335938 4 20 1.1.1.5148.13 1 56.5734 590.4514 56.634 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Phosphopantetheine(S)@22 missed K-L@20 0.057777501642704 3648.86206054688 913.2228 3648.80444335938 913.208374023438 4 16 1.1.1.5148.17 1 56.5768 826.1379 56.6096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.00882382970303297 3338.73803710938 835.6918 3338.72924804688 835.689575195313 4 29 1.1.1.5149.6 1 56.5921 24186.71 56.8281 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Formyl(K)@20 missed K-L@20 0.0199375003576279 3352.728515625 839.1894 3352.70849609375 839.184387207031 4 18 1.1.1.5149.7 1 56.5929 4558.916 56.7796 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dicarbamidomethyl(D)@13; acrolein addition +112(K)@20 missed K-L@20 0.031097399070859 3534.84545898438 884.7186 3534.81396484375 884.710815429688 4 18 1.1.1.5149.9 1 56.5946 649.6589 56.6096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0214039999991655 3336.72875976563 668.353 3336.75 668.357299804688 5 22 1.1.1.5150.2 1 56.6139 12662.83 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR CHDH(D)@15 missed K-L@20 -0.0536637008190155 3602.84814453125 901.7193 3602.90185546875 901.732727050781 4 16 1.1.1.5150.6 1 56.6239 2882.668 56.5851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00201216991990805 3337.7314453125 668.5536 3337.73413085938 668.554077148438 5 25 1.1.1.5151.2 1 56.6389 7015.177 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00315623008646071 3353.72583007813 839.4387 3353.72900390625 839.439514160156 4 22 1.1.1.5151.3 1 56.6414 3586.205 56.7067 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@14; Methyl(K)@20 missed K-L@20 0.00782245956361294 3305.7158203125 827.4362 3305.70776367188 827.434204101563 4 18 1.1.1.5152.3 1 56.6641 639.0656 56.6825 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.00835280027240515 3322.72607421875 831.6888 3322.734375 831.690856933594 4 32 1.1.1.5152.4 1 56.6657 110816.9 56.5851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dioxidation(M)@17; MDA adduct +54(K)@20 missed K-L@20 0.00419392017647624 3394.72338867188 849.6881 3394.71899414063 849.687072753906 4 16 1.1.1.5152.5 1 56.6674 310.3817 56.6581 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Glycerophospho(S)@22 missed K-L@20 0.0456692017614841 3616.86694335938 905.224 3616.8212890625 905.212585449219 4 17 1.1.1.5152.6 1 56.6691 3105.921 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0250663999468088 3324.72729492188 832.1891 3324.70239257813 832.182861328125 4 25 1.1.1.5153.3 1 56.69 23676.3 56.6096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 0.00275453994981945 3322.736328125 1108.586 3322.734375 1108.58544921875 3 35 1.1.1.5154.10 1 56.7209 25818.1 56.5851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0064742099493742 3336.7431640625 1113.255 3336.75 1113.25732421875 3 39 1.1.1.5154.11 1 56.7226 30249.3 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.0171415992081165 3322.71728515625 665.5507 3322.734375 665.554138183594 5 29 1.1.1.5155.3 1 56.7353 10286.37 56.5851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Hex(N)@14; acrolein addition +76(K)@20 missed K-L@20 0.0442055985331535 3546.84716796875 710.3767 3546.802734375 710.367858886719 5 18 1.1.1.5155.5 1 56.7369 1510.646 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.010920699685812 3336.7392578125 835.1921 3336.75 835.194763183594 4 19 1.1.1.5155.8 1 56.7394 111423.8 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.010920699685812 3336.7392578125 835.1921 3336.75 835.194763183594 4 36 1.1.1.5155.9 1 56.7403 111423.8 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Cation:Na(D)@13; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.018657399341464 3358.71337890625 840.6856 3358.73193359375 840.690246582031 4 20 1.1.1.5155.10 1 56.7411 687.3271 56.7309 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.016448000445962 3352.728515625 839.1894 3352.74487304688 839.193481445313 4 20 1.1.1.5156.5 1 56.7612 4622.402 56.7553 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR HexNAc(N)@14; Oxidation(M)@17; acrolein addition +56(K)@20 missed K-L@20 0.0317467004060745 3583.85083007813 896.97 3583.81909179688 896.962097167969 4 18 1.1.1.5156.8 1 56.7645 438.5311 56.7796 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +94(K)@20; HexNAc(S)@22; Carbamidomethyl(S)@23 missed K-L@20 0.0186088997870684 3662.88012695313 916.7273 3662.861328125 916.72265625 4 18 1.1.1.5156.9 1 56.7662 907.0611 56.7553 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@17; GlnThrGlyGly(K)@20 missed K-L@20 -0.00880481023341417 3603.85571289063 901.9712 3603.86450195313 901.973388671875 4 17 1.1.1.5157.4 1 56.7871 2353.605 56.5851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR HPNE addition +172(K)@20; Glycerophospho(S)@22 missed K-L@20 0.0447609983384609 3634.87646484375 909.7264 3634.83178710938 909.715209960938 4 17 1.1.1.5157.5 1 56.7887 1203.831 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0214039999991655 3336.72875976563 668.353 3336.75 668.357299804688 5 30 1.1.1.5158.3 1 56.8097 12738.3 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0214039999991655 3336.72875976563 668.353 3336.75 668.357299804688 5 33 1.1.1.5159.3 1 56.8371 12738.3 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Glycerophospho(S)@22 missed K-L@20 0.0456692017614841 3616.86694335938 905.224 3616.8212890625 905.212585449219 4 19 1.1.1.5159.6 1 56.8471 3105.921 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.0095734903588891 3322.72485351563 831.6885 3322.734375 831.690856933594 4 30 1.1.1.5160.4 1 56.8646 105628.9 56.6096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0214039999991655 3336.72875976563 668.353 3336.75 668.357299804688 5 33 1.1.1.5161.2 1 56.8829 12738.3 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.010920699685812 3336.7392578125 835.1921 3336.75 835.194763183594 4 35 1.1.1.5162.4 1 56.9079 111423.8 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dioxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0214859992265701 3368.71850585938 843.1869 3368.73974609375 843.192260742188 4 21 1.1.1.5162.5 1 56.9096 1339.514 56.7796 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0214039999991655 3336.72875976563 668.353 3336.75 668.357299804688 5 29 1.1.1.5163.2 1 56.9279 12738.3 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.016448000445962 3352.728515625 839.1894 3352.74487304688 839.193481445313 4 25 1.1.1.5163.4 1 56.9296 4622.402 56.7553 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.00420917011797428 3323.72338867188 1108.915 3323.71826171875 1108.91345214844 3 17 1.1.1.5163.9 1 56.9355 1379.132 57.0219 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0214039999991655 3336.72875976563 668.353 3336.75 668.357299804688 5 26 1.1.1.5164.2 1 56.9523 12738.3 56.8038 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.016448000445962 3352.728515625 839.1894 3352.74487304688 839.193481445313 4 26 1.1.1.5164.5 1 56.9548 4622.402 56.7553 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20; Deamidated(N)@28 missed K-L@20 -0.00848880037665367 3323.71020507813 831.9348 3323.71826171875 831.936889648438 4 25 1.1.1.5167.4 1 57.0272 6298.89 57.0219 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Methyl(K)@20 missed K-L@20 -0.00751534989103675 3323.71118164063 665.7495 3323.71826171875 665.7509765625 5 20 1.1.1.5168.2 1 57.0506 603.9094 57.0464 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.010920699685812 3336.7392578125 835.1921 3336.75 835.194763183594 4 29 1.1.1.5169.4 1 57.0769 100227.1 56.8281 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Deamidated(N)@28 missed K-L@20 -0.000258813000982627 3337.73315429688 1113.585 3337.73413085938 1113.58532714844 3 15 1.1.1.5170.6 1 57.1096 1485.987 57.2173 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.00762037979438901 3322.72705078125 831.689 3322.734375 831.690856933594 4 24 1.1.1.5174.4 1 57.2005 2147.019 57.1929 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Methyl(K)@20 missed K-L@20 -0.0153706995770335 3305.69262695313 827.4304 3305.70776367188 827.434204101563 4 21 1.1.1.5175.3 1 57.2217 1718.182 57.2662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Deamidated(N)@28 missed K-L@20 -0.00690623978152871 3337.72729492188 835.4391 3337.73413085938 835.440795898438 4 21 1.1.1.5176.5 1 57.2511 6039.297 57.2662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00988302007317543 3319.7138671875 830.9357 3319.72338867188 830.938171386719 4 21 1.1.1.5179.4 1 57.323 1967.464 57.5125 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 -0.0119999004527926 3305.69262695313 827.4304 3305.70434570313 827.433410644531 4 16 1.1.1.5182.3 1 57.395 1718.182 57.2662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00839141011238098 3352.73657226563 839.1914 3352.74487304688 839.193481445313 4 18 1.1.1.5182.4 1 57.3967 374.7087 57.3644 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -3.02626991271973 3305.69262695313 827.4304 3308.71875 828.186950683594 4 14 1.1.1.5183.6 1 57.4205 1718.182 57.2662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00506132002919912 3336.74487304688 835.1935 3336.75 835.194763183594 4 32 1.1.1.5183.7 1 57.4213 3996.896 57.4873 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0113332998007536 3336.73852539063 668.355 3336.75 668.357299804688 5 22 1.1.1.5185.3 1 57.4672 600.9617 57.4381 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00988302007317543 3319.7138671875 830.9357 3319.72338867188 830.938171386719 4 30 1.1.1.5186.6 1 57.4949 1979.949 57.5125 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.01066629961133 3319.71264648438 664.9498 3319.72338867188 664.951965332031 5 18 1.1.1.5188.3 1 57.5432 230.1075 57.5378 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0113332998007536 3336.73852539063 668.355 3336.75 668.357299804688 5 17 1.1.1.5189.2 1 57.5677 600.9617 57.4381 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00506132002919912 3336.74487304688 835.1935 3336.75 835.194763183594 4 32 1.1.1.5190.6 1 57.5964 3996.896 57.4873 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Methyl(K)@20 missed K-L@20 -0.0172809008508921 3323.701171875 665.7475 3323.71826171875 665.7509765625 5 22 1.1.1.5191.3 1 57.6194 892.4663 57.6901 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00353802996687591 3337.72998046875 668.5533 3337.73413085938 668.554077148438 5 16 1.1.1.5191.4 1 57.6202 647.4782 57.3644 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.00238532992079854 3323.71606445313 831.9363 3323.71826171875 831.936889648438 4 32 1.1.1.5193.5 1 57.6717 9166.537 57.716 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Methyl(K)@20 missed K-L@20 -0.00238532992079854 3323.71606445313 831.9363 3323.71826171875 831.936889648438 4 16 1.1.1.5197.7 1 57.7767 9166.537 57.716 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00617381976917386 3337.72802734375 835.4393 3337.73413085938 835.440795898438 4 35 1.1.1.5198.5 1 57.8004 13051.95 57.8448 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00608590012416244 3353.72290039063 839.438 3353.72900390625 839.439514160156 4 25 1.1.1.5198.6 1 57.8013 711.2961 57.8448 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0160501003265381 3337.71752929688 668.5508 3337.73413085938 668.554077148438 5 30 1.1.1.5200.3 1 57.8504 1464.81 57.8448 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0160501003265381 3337.71752929688 668.5508 3337.73413085938 668.554077148438 5 29 1.1.1.5201.2 1 57.8754 1464.81 57.8448 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0143480999395251 3323.7041015625 831.9333 3323.71826171875 831.936889648438 4 26 1.1.1.5201.4 1 57.8771 25573.2 58.0491 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Dicarbamidomethyl(D)@15; reduced acrolein addition +96(K)@20 missed K-L@20 0.0232941992580891 3519.82666015625 880.9639 3519.80322265625 880.958068847656 4 17 1.1.1.5203.10 1 57.9336 273.5513 57.9223 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0143480999395251 3323.7041015625 831.9333 3323.71826171875 831.936889648438 4 29 1.1.1.5204.5 1 57.9552 25573.2 58.0491 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0143480999395251 3323.7041015625 831.9333 3323.71826171875 831.936889648438 4 29 1.1.1.5204.6 1 57.9561 25573.2 58.0491 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20; Deamidated(N)@28 missed K-L@20 0.00418820977210999 3338.72216796875 835.6878 3338.71801757813 835.686767578125 4 26 1.1.1.5204.8 1 57.9577 7259.665 57.8448 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00617381976917386 3337.72802734375 835.4393 3337.73413085938 835.440795898438 4 27 1.1.1.5205.6 1 57.9816 13051.95 57.8448 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.00201639998704195 3323.71704101563 1108.913 3323.71826171875 1108.91345214844 3 25 1.1.1.5205.19 1 57.9924 6532.415 58.0491 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0172809008508921 3323.701171875 665.7475 3323.71826171875 665.7509765625 5 27 1.1.1.5207.2 1 58.0282 2626.605 58.074 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0172809008508921 3323.701171875 665.7475 3323.71826171875 665.7509765625 5 25 1.1.1.5208.2 1 58.053 2626.605 58.074 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.00822077970951796 3324.71044921875 832.1849 3324.70239257813 832.182861328125 4 20 1.1.1.5208.4 1 58.0547 14164.91 58.0491 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Dethiomethyl(M)@17; GlnThrGlyGly(K)@20 missed K-L@20 -0.0172403994947672 3604.83129882813 902.2151 3604.8486328125 902.219421386719 4 16 1.1.1.5208.8 1 58.058 434.6134 58.074 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0172809008508921 3323.701171875 665.7475 3323.71826171875 665.7509765625 5 26 1.1.1.5209.2 1 58.0779 2626.605 58.074 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0172809008508921 3323.701171875 665.7475 3323.71826171875 665.7509765625 5 29 1.1.1.5210.2 1 58.1025 2626.605 58.074 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0172809008508921 3323.701171875 665.7475 3323.71826171875 665.7509765625 5 29 1.1.1.5211.3 1 58.1296 2626.605 58.074 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0143480999395251 3323.7041015625 831.9333 3323.71826171875 831.936889648438 4 29 1.1.1.5211.4 1 58.1313 25573.2 58.0491 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0086152097210288 3337.72583007813 835.4387 3337.73413085938 835.440795898438 4 34 1.1.1.5212.5 1 58.1574 20981.59 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.00201639998704195 3323.71704101563 1108.913 3323.71826171875 1108.91345214844 3 20 1.1.1.5212.11 1 58.1674 6532.415 58.0491 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0172809008508921 3323.701171875 665.7475 3323.71826171875 665.7509765625 5 29 1.1.1.5213.2 1 58.1795 2626.605 58.074 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00730659998953342 3353.7216796875 839.4377 3353.72900390625 839.439514160156 4 30 1.1.1.5213.3 1 58.1837 913.0498 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0194070003926754 3337.71435546875 668.5502 3337.73413085938 668.554077148438 5 26 1.1.1.5215.4 1 58.2272 2509.969 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.00822077970951796 3324.71044921875 832.1849 3324.70239257813 832.182861328125 4 19 1.1.1.5215.7 1 58.2297 14164.91 58.0491 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0194070003926754 3337.71435546875 668.5502 3337.73413085938 668.554077148438 5 23 1.1.1.5216.4 1 58.2518 2509.969 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0194070003926754 3337.71435546875 668.5502 3337.73413085938 668.554077148438 5 30 1.1.1.5217.2 1 58.2748 2509.969 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Deamidated(N)@8; Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.0349190011620522 3340.73217773438 836.1903 3340.697265625 836.181579589844 4 16 1.1.1.5217.8 1 58.2798 2078.365 58.2464 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0194070003926754 3337.71435546875 668.5502 3337.73413085938 668.554077148438 5 27 1.1.1.5218.4 1 58.3011 2509.969 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0148363998159766 3323.70385742188 831.9332 3323.71826171875 831.936889648438 4 18 1.1.1.5218.5 1 58.302 27086.5 58.0491 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0153246996924281 3323.70288085938 831.933 3323.71826171875 831.936889648438 4 27 1.1.1.5219.6 1 58.3274 24012.65 58.074 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0086152097210288 3337.72583007813 835.4387 3337.73413085938 835.440795898438 4 21 1.1.1.5219.7 1 58.3283 20981.59 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0086152097210288 3337.72583007813 835.4387 3337.73413085938 835.440795898438 4 36 1.1.1.5219.8 1 58.3291 20981.59 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0086152097210288 3337.72583007813 835.4387 3337.73413085938 835.440795898438 4 22 1.1.1.5219.9 1 58.3299 20981.59 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0194070003926754 3337.71435546875 668.5502 3337.73413085938 668.554077148438 5 20 1.1.1.5220.2 1 58.3489 2509.969 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0194070003926754 3337.71435546875 668.5502 3337.73413085938 668.554077148438 5 29 1.1.1.5221.2 1 58.3737 2509.969 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00730659998953342 3353.7216796875 839.4377 3353.72900390625 839.439514160156 4 23 1.1.1.5222.3 1 58.3992 913.0498 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0194070003926754 3337.71435546875 668.5502 3337.73413085938 668.554077148438 5 23 1.1.1.5223.2 1 58.4234 2509.969 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0194070003926754 3337.71435546875 668.5502 3337.73413085938 668.554077148438 5 27 1.1.1.5225.3 1 58.4737 2509.969 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.00897707976400852 3323.70922851563 831.9346 3323.71826171875 831.936889648438 4 19 1.1.1.5226.8 1 58.5026 1260.982 58.5185 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0086152097210288 3337.72583007813 835.4387 3337.73413085938 835.440795898438 4 34 1.1.1.5226.9 1 58.5034 20981.59 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 -0.00642755022272468 3324.69604492188 832.1813 3324.70239257813 832.182861328125 4 23 1.1.1.5227.5 1 58.5264 1445.575 58.4443 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.00848880037665367 3323.71020507813 831.9348 3323.71826171875 831.936889648438 4 25 1.1.1.5233.5 1 58.6722 1116.205 58.6417 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Methyl(K)@20 missed K-L@20 -0.00848880037665367 3323.71020507813 831.9348 3323.71826171875 831.936889648438 4 18 1.1.1.5234.3 1 58.695 1116.205 58.6417 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00910349003970623 3337.72485351563 835.4385 3337.73413085938 835.440795898438 4 29 1.1.1.5234.4 1 58.6958 7307.778 58.4443 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0086152097210288 3337.72583007813 835.4387 3337.73413085938 835.440795898438 4 31 1.1.1.5235.3 1 58.721 5703.54 58.4691 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.00970949977636337 3323.70849609375 831.9344 3323.71826171875 831.936889648438 4 27 1.1.1.5240.6 1 58.8447 1409.31 58.8623 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Methyl(K)@20 missed K-L@20 -0.00970949977636337 3323.70849609375 831.9344 3323.71826171875 831.936889648438 4 17 1.1.1.5241.5 1 58.8685 1409.31 58.8623 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00739452010020614 3337.72705078125 835.439 3337.73413085938 835.440795898438 4 34 1.1.1.5242.6 1 58.8941 3729.883 58.8869 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00803900975733995 3353.72094726563 839.4375 3353.72900390625 839.439514160156 4 18 1.1.1.5242.7 1 58.8949 245.0806 58.8869 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@10; Methyl(K)@20 missed K-L@20 0.00114075001329184 3324.70385742188 832.1832 3324.70239257813 832.182861328125 4 20 1.1.1.5247.7 1 59.021 1302.447 58.9117 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00788278970867395 3337.72607421875 835.4388 3337.73413085938 835.440795898438 4 29 1.1.1.5249.4 1 59.0708 943.0264 59.0875 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0213104002177715 3337.712890625 835.4355 3337.73413085938 835.440795898438 4 26 1.1.1.5256.5 1 59.2412 772.7901 59.2842 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0213104002177715 3337.712890625 835.4355 3337.73413085938 835.440795898438 4 20 1.1.1.5263.8 1 59.4167 772.7901 59.2842 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.000662065984215587 3337.73461914063 835.4409 3337.73413085938 835.440795898438 4 15 1.1.1.5290.7 1 60.0793 210.7703 59.996 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)@N-term; Methyl(K)@20 missed K-L@20 0.00364151992835104 3348.75366210938 838.1957 3348.75 838.194763183594 4 25 1.1.1.5376.5 1 62.1215 547.4465 62.1144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@4; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0121082998812199 3362.75366210938 841.6957 3362.765625 841.698669433594 4 26 1.1.1.5378.11 1 62.1777 596.3749 62.1652 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@14; Methyl(K)@20 missed K-L@20 -0.0153706995770335 3305.69262695313 827.4304 3305.70776367188 827.434204101563 4 16 1.1.1.5130.8 1 56.118 322.4912 56.0838 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; acrolein addition +112(K)@20; Octanoyl(S)@22 missed K-L@20 0.0140255000442266 3547.87377929688 887.9757 3547.85961914063 887.97216796875 4 15 1.1.1.5155.12 1 56.7428 621.7939 56.7796 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; ONE addition +154(K)@20; Glycerophospho(S)@22 missed K-L@20 0.0328354015946388 3632.84887695313 909.2195 3632.81616210938 909.211303710938 4 15 1.1.1.5155.13 1 56.7436 457.5925 56.7309 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Formyl(K)@20 missed K-L@20 0.0295711997896433 3352.7392578125 1118.587 3352.70849609375 1118.57678222656 3 14 1.1.1.5157.10 1 56.7971 1451.357 56.7796 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Dehydrated(T)@11; MDA adduct +62(K)@20 missed K-L@20 0.0231001004576683 3353.73095703125 839.44 3353.70776367188 839.434204101563 4 14 1.1.1.5187.6 1 57.5202 328.1114 57.5125 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; ONE addition +154(K)@20; Glycerophospho(S)@22 missed K-L@20 0.0482199005782604 3617.85327148438 905.4706 3617.80517578125 905.458557128906 4 15 1.1.1.5213.4 1 58.1879 404.7623 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0107274996116757 3337.7451171875 1113.589 3337.73413085938 1113.58532714844 3 13 1.1.1.5149.16 1 56.6004 16083.21 56.7796 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Dethiomethyl(M)@17; acrolein addition +76(K)@20 missed K-L@20 0.00128097005654126 3337.73315429688 1113.585 3337.73071289063 1113.58410644531 3 13 1.1.1.5233.10 1 58.6805 2618.784 58.4193 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00765899010002613 3352.7373046875 839.1916 3352.74487304688 839.193481445313 4 13 1.1.1.5097.7 1 55.285 2636.042 55.4776 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.002458960050717 3353.7314453125 839.4401 3353.72900390625 839.439514160156 4 13 1.1.1.5133.7 1 56.1928 302.3309 56.1339 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Met->Hcy(M)@17; Delta:H(2)C(2)(K)@20 missed K-L@20 0.0196269005537033 3321.72265625 831.4379 3321.70263671875 831.432983398438 4 15 1.1.1.5143.7 1 56.4448 3126.055 56.634 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dehydrated(D)@15; Oxidation(M)@17; GlnThrGlyGly(K)@20 missed K-L@20 0.0154028004035354 3649.86767578125 913.4742 3649.85229492188 913.470336914063 4 15 1.1.1.5155.14 1 56.7445 710.3867 56.6096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Hex(N)@14; acrolein addition +94(K)@20 missed K-L@20 0.0413413010537624 3564.8544921875 892.2209 3564.8134765625 892.210632324219 4 13 1.1.1.5148.14 1 56.5743 311.3402 56.6096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR HexNAc(N)@14; acrolein addition +94(K)@20 missed K-L@20 0.0164905991405249 3605.8564453125 902.4714 3605.83984375 902.46728515625 4 13 1.1.1.5143.9 1 56.4464 1168.155 56.6096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR HexNAc(N)@14; reduced acrolein addition +58(K)@20 missed K-L@20 0.011098699644208 3569.85083007813 893.47 3569.83984375 893.46728515625 4 13 1.1.1.5149.10 1 56.5954 423.0712 56.6096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Oxidation(M)@17; reduced acrolein addition +58(K)@20 missed K-L@20 -0.0300462003797293 3383.70922851563 846.9346 3383.73950195313 846.942138671875 4 12 1.1.1.5157.3 1 56.7854 436.4348 56.7553 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; CHDH(D)@15 missed K-L@20 -0.0420798994600773 3603.84375 901.9682 3603.8857421875 901.978759765625 4 14 1.1.1.5209.11 1 58.0854 509.2276 58.074 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Carbamyl(K)@20 missed K-L@20 0.0223788991570473 3352.73095703125 839.19 3352.70849609375 839.184387207031 4 13 1.1.1.5218.7 1 58.3036 535.9924 58.271 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Met->Hcy(M)@17; hexanoyl addition +98(K)@20 missed K-L@20 -0.0352266989648342 3393.72485351563 849.4385 3393.76025390625 849.447326660156 4 13 1.1.1.5150.5 1 56.6214 383.29 56.634 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 IITHPNFNGNTLDNDIMLIKLSSPATLNSR CHDH(D)@15; Oxidation(M)@17 missed K-L@20 -0.0154732000082731 3618.88134765625 905.7276 3618.89672851563 905.7314453125 4 13 1.1.1.5145.11 1 56.4977 1196.748 56.7309 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00207969988696277 3336.7490234375 1113.257 3336.75 1113.25732421875 3 11 1.1.1.5184.12 1 57.4501 1084.893 57.4873 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Deamidated(N)@14; reduced acrolein addition +58(K)@20 missed K-L@20 -0.0107409004122019 3368.71826171875 843.1868 3368.728515625 843.189453125 4 11 1.1.1.5219.10 1 58.3308 244.6799 58.3204 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0441275984048843 3337.74169921875 835.4427 3337.69775390625 835.431701660156 4 11 1.1.1.5137.6 1 56.2938 368.2143 56.387 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Met->Hcy(M)@17; reduced acrolein addition +58(K)@20 missed K-L@20 1.75710993062239E-05 3353.72900390625 839.4395 3353.72900390625 839.439514160156 4 10 1.1.1.5175.4 1 57.2226 432.1124 57.2418 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3699994087219 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 -0.0159681998193264 3322.71484375 831.686 3322.73095703125 831.690002441406 4 11 1.1.1.5120.8 1 55.8638 339.555 55.8797 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3699994087219 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 0.00275453994981945 3322.736328125 1108.586 3322.734375 1108.58544921875 3 11 1.1.1.5144.12 1 56.4745 25818.1 56.5851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.7499997615814 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Ammonia-loss(N)@14; Dethiomethyl(M)@17; reduced acrolein addition +96(K)@20 missed K-L@20 0.00214842008426785 3340.73266601563 836.1904 3340.73022460938 836.189880371094 4 13 1.1.1.5156.4 1 56.7603 4297.602 56.7553 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Deamidated(N)@10; Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0133006004616618 3324.71264648438 832.1854 3324.69897460938 832.182006835938 4 11 1.1.1.5187.5 1 57.5194 5044.619 57.716 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.6699987649918 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14 missed K-L@20 -0.0115353995934129 3309.69140625 828.4301 3309.70263671875 828.432983398438 4 13 1.1.1.5095.7 1 55.2349 304.3795 55.327 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.6699987649918 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; acrolein addition +76(K)@20 missed K-L@20 -0.00212018005549908 3385.73168945313 847.4402 3385.73413085938 847.440795898438 4 13 1.1.1.5156.6 1 56.762 461.1799 56.7796 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 36.4399999380112 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8 missed K-L@20 -0.0039670797996223 3309.69848632813 828.4319 3309.70263671875 828.432983398438 4 12 1.1.1.5197.5 1 57.7751 475.7895 57.716 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.3200013637543 IMLIKLSSPATLNSR Delta:H(4)C(2)(K)@5 cleaved D-I@N-term; missed K-L@5 0.000502255978062749 1670.97583007813 557.9992 1670.97534179688 557.9990234375 3 18 1.1.1.4841.3 1 49.1114 3484.459 49.156 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.4400001764297 IMLIKLSSPATLNSR MDA adduct +62(K)@5; Dehydrated(S)@7 cleaved D-I@N-term; missed K-L@5 0.025458600372076 1686.97485351563 563.3322 1686.94909667969 563.323669433594 3 9 1.1.1.4843.6 1 49.163 198.8936 49.156 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 -0.00209842994809151 2706.40673828125 903.1429 2706.40893554688 903.143615722656 3 34 1.1.1.4943.11 1 51.5881 13579.76 51.6457 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 -0.00779230007901788 2706.40087890625 677.6075 2706.40893554688 677.609497070313 4 31 1.1.1.4948.9 1 51.7044 21408.99 51.6457 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 -0.00779230007901788 2706.40087890625 677.6075 2706.40893554688 677.609497070313 4 26 1.1.1.4950.7 1 51.7521 21408.99 51.6457 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 -0.00730402022600174 2706.40185546875 677.6077 2706.40893554688 677.609497070313 4 20 1.1.1.4957.8 1 51.926 20268.97 51.6702 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK Deamidated(N)@21 missed R-L@4 0.00988612044602633 2707.40283203125 677.858 2707.39282226563 677.855529785156 4 12 1.1.1.4941.8 1 51.5316 9539.517 51.6457 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.3200013637543 IQVRLGEHNIDVLEGNEQFINAAK Methyl(N)@21 missed R-L@4 -0.020965900272131 2720.40380859375 681.1082 2720.42456054688 681.113403320313 4 15 1.1.1.4951.8 1 51.7776 433.6483 51.8181 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3299987316132 IQVRLGEHNIDVLEGNEQFINAAK Deamidated(Q)@18; HexNAc(N)@21; acrolein addition +94(K)@24 missed R-L@4 0.0279644001275301 3004.54223632813 752.1428 3004.51416015625 752.135803222656 4 14 1.1.1.4944.13 1 51.6094 1542.431 51.6457 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.3099982738495 IQVRLGEHNIDVLEGNEQFINAAK Methyl+Deamidated(Q)@18 missed R-L@4 -0.0174982007592916 2721.39086914063 908.1376 2721.40869140625 908.143493652344 3 16 1.1.1.4946.5 1 51.6618 295.3557 51.6457 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@24; Delta:H(2)C(2)(H)@28 cleaved F-N@C-term; missed R-L@4; missed K-I@24 -0.0379314012825489 3652.8984375 914.2319 3652.9365234375 914.241394042969 4 13 1.1.1.5204.11 1 57.9603 466.3674 57.9737 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00829965993762016 6054.1357421875 865.8838 6054.12744140625 865.882629394531 7 17 1.1.1.5374.5 1 62.0741 1833.552 62.1144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00912441033869982 6053.15234375 1009.866 6053.14306640625 1009.86450195313 6 15 1.1.1.5383.16 1 62.3103 48884.48 62.4934 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0121505996212363 6069.14892578125 1214.837 6069.13818359375 1214.8349609375 5 15 1.1.1.5388.14 1 62.4376 1173.884 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@24; Deamidated(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 -0.00184458994772285 6036.1123046875 1007.026 6036.11669921875 1007.02673339844 6 16 1.1.1.5403.17 1 62.8022 4115.046 62.7366 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0117808002978563 6054.11572265625 865.8809 6054.12744140625 865.882629394531 7 17 1.1.1.5468.6 1 64.3756 1335.604 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR HPNE addition +172(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0441249012947083 6169.18017578125 1029.204 6169.22705078125 1029.21179199219 6 17 1.1.1.5483.7 1 64.7521 557.6805 64.6876 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@24; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.011276800185442 6169.19287109375 1029.206 6169.2060546875 1029.20825195313 6 19 1.1.1.5511.3 1 65.4393 362.8776 65.3246 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; Formyl(K)@24; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0241369996219873 6054.10009765625 1010.024 6054.1240234375 1010.02795410156 6 25 1.1.1.5364.6 1 61.8351 478.387 61.797 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00253264000639319 6053.146484375 1009.865 6053.14306640625 1009.86450195313 6 21 1.1.1.5371.8 1 62.0052 1219.82 62.1144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Met->Hcy(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00766594987362623 6069.1484375 1012.532 6069.13818359375 1012.53033447266 6 25 1.1.1.5374.8 1 62.0791 4350.237 62.1399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@24; Oxidation(P)@29; Dethiomethyl(M)@41; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0175870005041361 6069.1533203125 868.0292 6069.17138671875 868.03173828125 7 26 1.1.1.5375.5 1 62.096 3197.838 62.1399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@28; Oxidation(M)@41 missed R-L@4; missed K-I@24; missed K-L@44 -0.0314034000039101 6027.09619140625 862.021 6027.12744140625 862.025512695313 7 14 1.1.1.5376.6 1 62.1223 197.0875 62.1144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@24; Dethiomethyl(M)@41; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00917044002562761 6041.13037109375 864.0259 6041.14013671875 864.027282714844 7 16 1.1.1.5376.7 1 62.1231 305.3091 62.1144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(I)@40 missed R-L@4; missed K-I@24; missed K-L@44 -0.0452914014458656 6011.08740234375 859.7341 6011.1328125 859.740539550781 7 29 1.1.1.5382.7 1 62.2775 3214.765 62.3196 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28 missed R-L@4; missed K-I@24; missed K-L@44 -0.0380659997463226 6025.1083984375 1005.192 6025.1484375 1005.19866943359 6 26 1.1.1.5382.14 1 62.2834 9465.007 62.3447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24 missed R-L@4; missed K-I@24; missed K-L@44 -0.0178149994462729 6025.09375 861.735 6025.11181640625 861.737548828125 7 32 1.1.1.5383.6 1 62.302 7620.008 62.3447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@34; Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0196883007884026 6038.11279296875 863.5948 6038.13232421875 863.597595214844 7 27 1.1.1.5383.7 1 62.3028 3841.414 62.3946 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0168332997709513 6053.12646484375 865.7396 6053.14306640625 865.742004394531 7 27 1.1.1.5383.8 1 62.3037 44053.39 62.4934 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@28 missed R-L@4; missed K-I@24; missed K-L@44 -0.0258898008614779 6011.10400390625 1002.858 6011.1328125 1002.86273193359 6 29 1.1.1.5383.14 1 62.3087 4197.346 62.3196 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@32; Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0154288001358509 6038.1162109375 1007.36 6038.13232421875 1007.36267089844 6 20 1.1.1.5383.15 1 62.3095 4929.609 62.3946 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@28 missed R-L@4; missed K-I@24; missed K-L@44 -0.0144547997042537 6011.1181640625 1203.231 6011.1328125 1203.23376464844 5 17 1.1.1.5383.20 1 62.3137 1636.381 62.3196 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@34; Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0196883007884026 6038.11279296875 863.5948 6038.13232421875 863.597595214844 7 23 1.1.1.5384.9 1 62.3296 3841.414 62.3946 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(P)@29; Deamidated(N)@34; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00045470500481315 6070.12158203125 868.1675 6070.1220703125 868.167602539063 7 20 1.1.1.5384.10 1 62.3304 2147.418 62.4934 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@24; reduced HNE(H)@28; Oxidation(M)@41 missed R-L@4; missed K-I@24; missed K-L@44 0.0015634800074622 6283.29443359375 1048.223 6283.294921875 1048.22314453125 6 14 1.1.1.5384.19 1 62.3379 312.0148 62.3946 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dimethyl(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 -0.017688600346446 6025.12841796875 1206.033 6025.1484375 1206.03698730469 5 21 1.1.1.5384.20 1 62.3388 3428.267 62.3447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0542005002498627 6025.09375 861.735 6025.1484375 861.742736816406 7 19 1.1.1.5385.5 1 62.3527 7620.008 62.3447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0181150007992983 6053.12451171875 865.7394 6053.14306640625 865.742004394531 7 25 1.1.1.5385.6 1 62.3543 45922.05 62.5421 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0131820999085903 6068.12255859375 1012.361 6068.1064453125 1012.3583984375 6 15 1.1.1.5385.8 1 62.3577 2025.735 62.4444 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Trimethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0245840009301901 6039.13818359375 1208.835 6039.1640625 1208.84008789063 5 18 1.1.1.5385.11 1 62.3627 3047.78 62.3694 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0452914014458656 6011.08740234375 859.7341 6011.1328125 859.740539550781 7 21 1.1.1.5386.4 1 62.3754 3214.765 62.3196 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; Deamidated(N)@38; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0476192012429237 6061.1484375 866.8856 6061.1005859375 866.878784179688 7 15 1.1.1.5386.5 1 62.3762 451.2817 62.3946 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@16; Deamidated(N)@38; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0172572005540133 6075.09912109375 868.8786 6075.1162109375 868.881042480469 7 16 1.1.1.5386.6 1 62.377 802.4321 62.4934 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0542136989533901 6087.10986328125 870.5944 6087.1640625 870.602111816406 7 19 1.1.1.5386.7 1 62.3779 515.967 62.3946 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Cation:K(E)@17; reduced acrolein addition +96(K)@24; reduced HNE(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0219359006732702 6317.2705078125 903.4745 6317.29248046875 903.477600097656 7 23 1.1.1.5386.8 1 62.3787 537.9182 62.469 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@24; reduced HNE(H)@28; Deamidated(N)@38; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0114927999675274 6282.32275390625 1048.061 6282.33642578125 1048.06335449219 6 15 1.1.1.5386.17 1 62.3862 405.539 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0535307005047798 6079.10546875 869.4509 6079.1591796875 869.458557128906 7 23 1.1.1.5387.3 1 62.3996 483.6684 62.4444 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0790484994649887 6105.0595703125 873.1586 6105.13818359375 873.169860839844 7 14 1.1.1.5387.4 1 62.4005 492.8882 62.469 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@24; Deamidated(N)@38; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0448595993220806 6108.0927734375 873.592 6108.1376953125 873.598388671875 7 14 1.1.1.5387.5 1 62.4013 471.5587 62.4934 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR HPNE addition +172(K)@24; Delta:H(2)C(2)(H)@28; Deamidated(N)@38; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0168878007680178 6258.25927734375 895.0443 6258.2421875 895.041870117188 7 19 1.1.1.5387.7 1 62.403 444.1746 62.4444 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; reduced HNE(H)@28; Deamidated(N)@38; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0798567980527878 6276.208984375 897.6086 6276.2890625 897.620056152344 7 18 1.1.1.5387.8 1 62.4038 200.9914 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Deamidated(N)@34; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0414750017225742 6084.1328125 870.1691 6084.17431640625 870.175048828125 7 22 1.1.1.5388.5 1 62.426 895.1143 62.4934 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Deamidated(N)@38; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0566523000597954 6084.1181640625 1015.027 6084.17431640625 1015.03631591797 6 16 1.1.1.5388.7 1 62.4276 930.05 62.5177 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Deamidated(N)@38; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0219110008329153 6088.12646484375 1015.695 6088.14794921875 1015.69860839844 6 15 1.1.1.5388.9 1 62.4293 635.7669 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +94(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0579034984111786 6119.13427734375 1020.863 6119.1904296875 1020.87231445313 6 16 1.1.1.5388.11 1 62.4326 258.4165 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; HexNAc(N)@34; Formyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0417696014046669 6290.248046875 1049.382 6290.20703125 1049.37512207031 6 17 1.1.1.5388.13 1 62.436 851.8507 62.5905 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0380659997463226 6025.1083984375 1005.192 6025.1484375 1005.19866943359 6 22 1.1.1.5389.4 1 62.4522 9465.007 62.3447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; reduced HNE(H)@28; Carboxy(M)@41; hexanoyl addition +98(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0202920995652676 6351.29833984375 1059.557 6351.3212890625 1059.56079101563 6 20 1.1.1.5389.7 1 62.4573 269.0515 62.4444 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@24; reduced HNE(H)@28; Carbamidomethyl(D)@39; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0891473963856697 6428.29638671875 1072.39 6428.38427734375 1072.40466308594 6 18 1.1.1.5389.9 1 62.4614 1858.814 62.6879 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0542005002498627 6025.09375 861.735 6025.1484375 861.742736816406 7 27 1.1.1.5390.3 1 62.475 7620.008 62.3447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Dethiomethyl(M)@41; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0105355996638536 6039.11376953125 863.7378 6039.1240234375 863.739318847656 7 25 1.1.1.5390.4 1 62.4767 6561.479 62.3946 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.000701598008163273 6053.146484375 1009.865 6053.14306640625 1009.86450195313 6 41 1.1.1.5390.8 1 62.4833 52441.33 62.5662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Dehydrated(D)@39; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00942123960703611 6069.142578125 1012.531 6069.1533203125 1012.53283691406 6 27 1.1.1.5390.9 1 62.485 2717.463 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dimethyl(N)@21; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0180514007806778 6053.16357421875 1211.64 6053.1796875 1211.64318847656 5 46 1.1.1.5390.11 1 62.4883 21389.11 62.5662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0304204002022743 6034.12451171875 863.0251 6034.1552734375 863.029479980469 7 17 1.1.1.5391.3 1 62.5026 1294.629 62.5662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0181150007992983 6053.12451171875 865.7394 6053.14306640625 865.742004394531 7 34 1.1.1.5391.4 1 62.5059 46592.16 62.5662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; MDA adduct +54(K)@24; Delta:H(2)C(2)(H)@28; Formyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0430469997227192 6106.07861328125 1018.687 6106.1220703125 1018.6943359375 6 17 1.1.1.5391.6 1 62.5126 584.7725 62.5421 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0181150007992983 6053.12451171875 865.7394 6053.14306640625 865.742004394531 7 24 1.1.1.5392.3 1 62.5237 46592.16 62.5662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; MDA adduct +62(K)@44; Dehydrated(S)@46 missed R-L@4; missed K-I@24; missed K-L@44 0.00835898984223604 6069.12548828125 868.0252 6069.1171875 868.023986816406 7 24 1.1.1.5392.4 1 62.5253 2711.438 62.6149 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Deamidated(N)@34; Deamidated(N)@38; Dethiomethyl(M)@41 missed R-L@4; missed K-I@24; missed K-L@44 0.00387435010634363 6009.13037109375 1002.529 6009.12353515625 1002.52789306641 6 16 1.1.1.5392.5 1 62.527 783.4511 62.3447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; Delta:H(2)C(2)(H)@28; Met->Hcy(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00745639018714428 6068.13427734375 1012.363 6068.14306640625 1012.36444091797 6 19 1.1.1.5392.6 1 62.5295 2426.836 62.5905 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; hexanoyl addition +98(K)@24; reduced HNE(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0246763993054628 6282.31005859375 1048.059 6282.33642578125 1048.06335449219 6 20 1.1.1.5392.7 1 62.532 360.0745 62.5177 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0143176997080445 6025.12841796875 1206.033 6025.14501953125 1206.03625488281 5 16 1.1.1.5392.8 1 62.5345 3428.267 62.3447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Ammonia-loss(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 0.00119355996139348 6038.1337890625 1208.634 6038.13232421875 1208.6337890625 5 19 1.1.1.5393.2 1 62.5611 1156.171 62.5905 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0820391997694969 6105.0556640625 873.1581 6105.13818359375 873.169860839844 7 17 1.1.1.5394.4 1 62.5737 497.1964 62.5662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@38; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00144386000465602 6034.10205078125 1006.691 6034.10107421875 1006.69079589844 6 16 1.1.1.5394.6 1 62.5771 1321.207 62.5662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0455937013030052 6068.1083984375 867.8799 6068.154296875 867.886474609375 7 24 1.1.1.5395.5 1 62.5965 2145.358 62.5905 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@24; reduced HNE(H)@28; Hex(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 -0.0314675010740757 6429.32177734375 919.4818 6429.35302734375 919.486267089844 7 17 1.1.1.5395.7 1 62.5982 4090.892 62.6879 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0224463008344173 6075.1064453125 1013.525 6075.12744140625 1013.52856445313 6 14 1.1.1.5395.10 1 62.6007 799.8325 62.5177 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0588495992124081 6084.1123046875 1015.026 6084.17431640625 1015.03631591797 6 21 1.1.1.5395.11 1 62.6015 1042.598 62.6149 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@24; reduced HNE(H)@28; Deamidated(N)@30; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0151549000293016 6282.32275390625 1048.061 6282.33642578125 1048.06335449219 6 19 1.1.1.5395.14 1 62.604 366.75 62.5662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 -0.00361923989839852 6024.1123046875 1005.026 6024.11669921875 1005.02673339844 6 18 1.1.1.5396.5 1 62.6265 3756.852 62.3694 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0125099001452327 6071.140625 1012.864 6071.15380859375 1012.86627197266 6 14 1.1.1.5396.7 1 62.6315 2000.5 62.5905 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@24; Deamidated(N)@38; Dehydrated(D)@39 missed R-L@4; missed K-I@24; missed K-L@44 -0.0336780995130539 6078.13037109375 869.3116 6078.16357421875 869.316345214844 7 17 1.1.1.5397.3 1 62.6466 590.8719 62.639 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0330455005168915 6053.146484375 1009.865 6053.17626953125 1009.86999511719 6 36 1.1.1.5397.5 1 62.6516 53212.62 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@16; reduced acrolein addition +58(K)@24; Oxidation(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0357710011303425 6100.13232421875 1017.696 6100.1689453125 1017.7021484375 6 25 1.1.1.5397.6 1 62.6549 469.1805 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0180514007806778 6053.16357421875 1211.64 6053.1796875 1211.64318847656 5 49 1.1.1.5397.7 1 62.6582 21540.52 62.5905 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Deamidated(N)@34; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0423295013606548 6084.13232421875 870.169 6084.17431640625 870.175048828125 7 23 1.1.1.5398.6 1 62.6745 987.4979 62.6149 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -3.08208982460201E-05 6053.146484375 1009.865 6053.14306640625 1009.86450195313 6 27 1.1.1.5398.8 1 62.6778 53212.62 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Dehydrated(T)@27; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0182102993130684 6069.13671875 1012.53 6069.1533203125 1012.53283691406 6 27 1.1.1.5398.9 1 62.6795 3216.645 62.5905 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00828840956091881 6053.134765625 865.7408 6053.14306640625 865.742004394531 7 39 1.1.1.5399.2 1 62.6947 48071.4 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Oxidation(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.037338599562645 6151.1240234375 1231.232 6151.1591796875 1231.23901367188 5 15 1.1.1.5399.5 1 62.7072 477.2749 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Dehydrated(T)@35; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0280265007168055 6069.12548828125 868.0252 6069.1533203125 868.029174804688 7 26 1.1.1.5401.3 1 62.741 2711.438 62.6149 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@16; Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -2.74612993962364E-05 6070.1220703125 868.1676 6070.1220703125 868.167602539063 7 17 1.1.1.5401.4 1 62.7418 2108.41 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@24; reduced HNE(H)@28; Hex(N)@34 missed R-L@4; missed K-I@24; missed K-L@44 -0.0573324002325535 6413.30078125 917.1931 6413.35791015625 917.201293945313 7 21 1.1.1.5401.6 1 62.7435 619.7368 62.761 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@24; Formyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0176957007497549 6068.13427734375 1012.363 6068.11767578125 1012.36022949219 6 18 1.1.1.5401.11 1 62.7476 2426.836 62.5905 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@24; Dethiomethyl(M)@41 missed R-L@4; missed K-I@24; missed K-L@44 -0.024083299562335 6025.11865234375 1206.031 6025.14501953125 1206.03625488281 5 16 1.1.1.5401.18 1 62.7543 648.6281 62.7366 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@34; Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0231062993407249 6038.109375 863.5943 6038.13232421875 863.597595214844 7 22 1.1.1.5402.8 1 62.7698 3864.441 62.7366 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@28; Deamidated(N)@30 missed R-L@4; missed K-I@24; missed K-L@44 -0.0390847995877266 6012.07666015625 1003.02 6012.11669921875 1003.02673339844 6 23 1.1.1.5402.16 1 62.7765 692.829 62.761 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@16; Delta:H(4)C(2)(H)@28; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0209720004349947 6054.142578125 1010.031 6054.16015625 1010.03399658203 6 27 1.1.1.5404.17 1 62.8272 35576.17 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0238604992628098 6054.13623046875 865.8839 6054.16015625 865.887329101563 7 26 1.1.1.5406.4 1 62.8668 30972.8 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -3.08208982460201E-05 6053.146484375 1009.865 6053.14306640625 1009.86450195313 6 29 1.1.1.5406.8 1 62.8735 53212.62 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0189445000141859 6053.16357421875 1211.64 6053.14306640625 1211.63598632813 5 24 1.1.1.5406.12 1 62.8801 21668.78 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; Formyl(K)@24; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00149759999476373 6054.12451171875 1010.028 6054.1240234375 1010.02795410156 6 29 1.1.1.5413.8 1 63.0498 3383.437 63.1754 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0129806995391846 6054.14892578125 1211.837 6054.16015625 1211.83935546875 5 24 1.1.1.5417.7 1 63.1464 1576.923 63.1754 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.024634100496769 6054.13671875 1010.03 6054.16015625 1010.03399658203 6 31 1.1.1.5420.3 1 63.2101 3966.49 63.32 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; Formyl(K)@24; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0234047994017601 6054.14892578125 1211.837 6054.1240234375 1211.83203125 5 21 1.1.1.5424.4 1 63.315 1785.233 63.32 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.024634100496769 6054.13671875 1010.03 6054.16015625 1010.03399658203 6 34 1.1.1.5427.3 1 63.3817 3966.49 63.32 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00969166960567236 6054.11376953125 865.8807 6054.1240234375 865.882141113281 7 28 1.1.1.5428.3 1 63.3999 4405.535 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0142013998702168 6054.14892578125 1211.837 6054.16015625 1211.83935546875 5 27 1.1.1.5431.6 1 63.4842 2350.501 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0330568999052048 6054.13037109375 1010.029 6054.16015625 1010.03399658203 6 36 1.1.1.5434.4 1 63.5523 5626.705 63.5375 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00969166960567236 6054.11376953125 865.8807 6054.1240234375 865.882141113281 7 28 1.1.1.5438.2 1 63.6384 4526.779 63.6335 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0209634006023407 6054.14404296875 1211.836 6054.1240234375 1211.83203125 5 26 1.1.1.5438.7 1 63.6525 2286.59 63.6335 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0352540984749794 6054.12451171875 1010.028 6054.16015625 1010.03399658203 6 33 1.1.1.5441.4 1 63.7246 5828.451 63.778 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0148186003789306 6054.10888671875 865.88 6054.1240234375 865.882141113281 7 25 1.1.1.5445.2 1 63.8077 4426.9 63.8021 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0154221002012491 6054.14404296875 1211.836 6054.16015625 1211.83935546875 5 30 1.1.1.5445.6 1 63.821 2407.266 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00113138998858631 6054.12451171875 1010.028 6054.1240234375 1010.02795410156 6 27 1.1.1.5448.9 1 63.8998 5828.451 63.778 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.018189400434494 6054.10888671875 865.88 6054.12744140625 865.882629394531 7 18 1.1.1.5452.2 1 63.9811 4426.9 63.8021 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0221841000020504 6054.14892578125 1211.837 6054.1240234375 1211.83203125 5 19 1.1.1.5452.10 1 63.9961 2469.902 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0352540984749794 6054.12451171875 1010.028 6054.16015625 1010.03399658203 6 30 1.1.1.5455.11 1 64.0734 5566.438 63.8808 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0135369002819061 6054.1103515625 865.8802 6054.1240234375 865.882141113281 7 32 1.1.1.5459.2 1 64.156 4037.26 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Deamidated(N)@38; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0129806995391846 6054.14892578125 1211.837 6054.16015625 1211.83935546875 5 22 1.1.1.5459.7 1 64.1702 1134.478 64.1753 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0341554991900921 6054.12451171875 1010.028 6054.16015625 1010.03399658203 6 25 1.1.1.5462.11 1 64.2429 4188.591 63.9771 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00149759999476373 6054.12451171875 1010.028 6054.1240234375 1010.02795410156 6 26 1.1.1.5469.11 1 64.4109 3195.14 64.151 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00969166960567236 6054.11376953125 865.8807 6054.1240234375 865.882141113281 7 25 1.1.1.5475.6 1 64.5517 1379.604 64.3446 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0338529013097286 6053.146484375 1009.865 6053.1796875 1009.87054443359 6 23 1.1.1.5484.10 1 64.7818 628.7233 64.6136 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)@N-term; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00457068020477891 6079.15625 1014.2 6079.1591796875 1014.20043945313 6 16 1.1.1.5509.11 1 65.3945 821.535 65.4249 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)@N-term; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00751422019675374 6079.16845703125 1014.202 6079.1591796875 1014.20043945313 6 15 1.1.1.5523.9 1 65.7447 614.7689 65.7523 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)@N-term; Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0122635997831821 6080.15234375 1014.366 6080.14306640625 1014.36444091797 6 17 1.1.1.5540.7 1 66.1736 336.4734 66.1787 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0329025015234947 6069.173828125 1214.842 6069.13818359375 1214.8349609375 5 12 1.1.1.5376.19 1 62.1331 1598.15 62.1399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR missed R-L@4; missed K-I@24; missed K-L@44 -1.03873002529144 5996.08056640625 1000.354 5997.1171875 1000.52679443359 6 14 1.1.1.5380.16 1 62.2342 853.5617 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@16; Deamidated(N)@38; Oxidation(M)@41; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0534537993371487 6069.142578125 1012.531 6069.0908203125 1012.52239990234 6 14 1.1.1.5382.18 1 62.2867 2717.463 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@24; Deamidated(N)@32; Deamidated(N)@34; Deamidated(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 0.0321900993585587 6038.1162109375 1007.36 6038.0849609375 1007.35473632813 6 14 1.1.1.5389.5 1 62.4539 4929.609 62.3946 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Cation:K(E)@17; ONE addition +154(K)@24; reduced HNE(H)@28; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0752488002181053 6409.240234375 1069.214 6409.31884765625 1069.22705078125 6 15 1.1.1.5389.8 1 62.4589 138.4189 62.5662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; reduced acrolein addition +58(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0166119001805782 6084.15869140625 1217.839 6084.17431640625 1217.84216308594 5 15 1.1.1.5389.10 1 62.4639 361.8347 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@24; reduced HNE(H)@28; Deamidated(N)@38; reduced acrolein addition +96(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0561534985899925 6290.248046875 1049.382 6290.30517578125 1049.39147949219 6 14 1.1.1.5395.15 1 62.6048 851.8507 62.5905 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@24; reduced HNE(H)@28; Hex(N)@34; Oxidation(M)@41 missed R-L@4; missed K-I@24; missed K-L@44 -0.0186042003333569 6429.33447265625 1072.563 6429.35302734375 1072.56616210938 6 15 1.1.1.5396.8 1 62.634 4891.646 62.6879 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; reduced HNE(H)@28; Hex(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0263126008212566 6413.33251953125 1069.896 6413.35791015625 1069.90026855469 6 15 1.1.1.5398.10 1 62.6812 471.4833 62.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Deamidated(N)@34; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.065420001745224 6108.0703125 1019.019 6108.1376953125 1019.0302734375 6 14 1.1.1.5400.3 1 62.7315 450.5226 62.5905 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Delta:H(2)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0335840992629528 6085.1142578125 1015.193 6085.1484375 1015.19866943359 6 14 1.1.1.5402.17 1 62.7773 1094.065 62.6149 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@24; Deamidated(N)@34; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0555400997400284 6092.08642578125 1016.355 6092.14306640625 1016.36444091797 6 13 1.1.1.5386.13 1 62.3829 384.8952 62.3946 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@34; Deamidated(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 0.00772181991487741 6025.1083984375 1005.192 6025.1005859375 1005.19073486328 6 14 1.1.1.5403.16 1 62.8014 1860.729 62.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00438620988279581 6026.12841796875 1005.362 6026.13232421875 1005.36267089844 6 14 1.1.1.5374.7 1 62.0775 337.6136 62.1144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(P)@29 missed R-L@4; missed K-I@24; missed K-L@44 -0.0412930995225906 6013.07080078125 860.0174 6013.11181640625 860.023254394531 7 13 1.1.1.5398.4 1 62.6711 351.3323 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; HexNAc(N)@38; HPNE addition +172(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00457978015765548 6430.34228515625 1072.731 6430.34814453125 1072.73193359375 6 14 1.1.1.5403.19 1 62.8039 3616.789 62.6879 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Dehydrated(T)@35 missed R-L@4; missed K-I@24; missed K-L@44 0.00858809985220432 6041.13037109375 864.0259 6041.1220703125 864.024719238281 7 13 1.1.1.5376.8 1 62.124 305.3091 62.1144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@8; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00457068020477891 6079.15625 1014.2 6079.1591796875 1014.20043945313 6 13 1.1.1.5516.9 1 65.5711 821.535 65.4249 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.000198877998627722 6040.1201171875 1007.694 6040.123046875 1007.69439697266 6 13 1.1.1.5376.13 1 62.1281 487.9602 62.1144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; MDA adduct +54(K)@24; Dehydrated(T)@35 missed R-L@4; missed K-I@24; missed K-L@44 -0.00497200014069676 6034.0986328125 1207.827 6034.10107421875 1207.82751464844 5 13 1.1.1.5390.10 1 62.4867 434.3445 62.4934 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0260029993951321 6035.10400390625 1006.858 6035.1328125 1006.86273193359 6 14 1.1.1.5396.6 1 62.629 2716.983 62.7366 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@24; Deamidated(N)@38; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0322741009294987 6112.1142578125 1019.693 6112.14794921875 1019.69860839844 6 12 1.1.1.5388.10 1 62.431 313.4281 62.3946 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Ammonia-loss(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 0.0189459007233381 6042.12451171875 1008.028 6042.10595703125 1008.02496337891 6 13 1.1.1.5382.16 1 62.285 1901.314 62.3694 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@24; Deamidated(N)@38; Dethiomethyl(M)@41; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0474564991891384 6086.140625 1015.364 6086.1865234375 1015.37170410156 6 12 1.1.1.5395.12 1 62.6023 1005.616 62.6149 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0343460999429226 6052.1484375 1211.437 6052.11181640625 1211.42956542969 5 11 1.1.1.5383.21 1 62.3145 6652.846 62.4934 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@24; reduced HNE(H)@28; hexanoyl addition +98(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.130367994308472 6351.263671875 908.3307 6351.39404296875 908.349304199219 7 12 1.1.1.5387.10 1 62.4055 439.1342 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(P)@29; Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0164969991892576 6085.1142578125 1015.193 6085.13330078125 1015.19610595703 6 12 1.1.1.5388.8 1 62.4285 1039.343 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; acrolein addition +112(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0405437014997005 6126.1064453125 1022.025 6126.1484375 1022.03204345703 6 11 1.1.1.5395.13 1 62.6032 290.3303 62.5421 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0464730001986027 6068.1533203125 1214.638 6068.1064453125 1214.62854003906 5 12 1.1.1.5395.18 1 62.6098 1002.011 62.5905 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Formyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00114400999154896 6079.1201171875 1014.194 6079.12255859375 1014.19439697266 6 12 1.1.1.5403.18 1 62.8031 505.963 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.4399993419647 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Hex(1)HexNAc(1)NeuAc(2)(T)@35; hexanoyl addition +98(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.136032000184059 7042.64892578125 1007.1 7042.51318359375 1007.08062744141 7 14 1.1.1.5382.15 1 62.2842 976.1362 62.2943 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.2899992465973 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.000408394989790395 6054.12451171875 1010.028 6054.12744140625 1010.02850341797 6 14 1.1.1.5476.15 1 64.579 1816.048 64.3446 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0942713022232056 6151.1201171875 1026.194 6151.21630859375 1026.2099609375 6 11 1.1.1.5387.14 1 62.4088 198.5507 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.4600005149841 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@32; Dethiomethyl(M)@41; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0007055249880068 6038.12841796875 1007.362 6038.12890625 1007.36212158203 6 13 1.1.1.5404.16 1 62.8263 4310.019 62.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3699994087219 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@24; reduced HNE(H)@28; hexanoyl addition +98(K)@44; Deamidated(N)@52 missed R-L@4; missed K-I@24; missed K-L@44 -0.0795240998268127 6352.30029296875 1059.724 6352.3779296875 1059.73693847656 6 11 1.1.1.5386.19 1 62.3879 321.2883 62.469 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8099980354309 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.069147102534771 6095.12255859375 1016.861 6095.1904296875 1016.87231445313 6 13 1.1.1.5394.7 1 62.5787 377.5696 62.5662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Deamidated(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0113115003332496 6098.12255859375 1017.361 6098.13232421875 1017.36267089844 6 10 1.1.1.5386.14 1 62.3837 400.9193 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 40.090000629425 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Deamidated(N)@38; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0203521996736526 6128.123046875 876.4534 6128.14306640625 876.456298828125 7 10 1.1.1.5387.6 1 62.4021 312.2088 62.469 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.8500012159348 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00912441033869982 6053.15234375 1009.866 6053.14306640625 1009.86450195313 6 12 1.1.1.5382.17 1 62.2859 47266.8 62.469 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.5600007772446 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Ammonia-loss(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 0.0102867996320128 6034.11328125 1207.83 6034.10107421875 1207.82751464844 5 10 1.1.1.5398.11 1 62.6828 609.555 62.6635 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.4699994325638 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00904763955622911 6054.13818359375 1211.835 6054.12744140625 1211.83276367188 5 12 1.1.1.5467.12 1 64.3638 678.339 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR HPNE addition +172(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0441249012947083 6169.18017578125 1029.204 6169.22705078125 1029.21179199219 6 11 1.1.1.5476.16 1 64.5798 557.6805 64.6876 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSG Carbamidomethyl(C)@7 cleaved G-S@C-term -3.98611998558044 2166.04931640625 1084.032 2170.03637695313 1086.02551269531 2 12 1.1.1.5030.20 1 53.7263 1246.001 53.7818 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.0157986991107464 4814.2705078125 1204.575 4814.2568359375 1204.57141113281 4 15 1.1.1.5065.8 1 54.5215 2501.187 54.5743 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Deamidated(N)@10; Ser->LacticAcid(S)@11; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.0159683991223574 4800.24609375 961.0565 4800.22998046875 961.05322265625 5 17 1.1.1.5038.8 1 53.9173 7251.452 53.8319 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Dehydrated(S)@11; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; Carbamidomethyl(Y)@42; hexanoyl addition +98(K)@43 -0.00661876983940601 4796.25048828125 960.2574 4796.25732421875 960.258728027344 5 19 1.1.1.5061.5 1 54.4411 8469.232 54.4734 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Deamidated(N)@10; Ser->Oxoalanine(S)@11; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.0400599017739296 4813.26513671875 963.6603 4813.22509765625 963.652282714844 5 16 1.1.1.5064.4 1 54.4909 4327.81 54.5743 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Dehydrated(Y)@5; Methyl(T)@6; Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.00195201998576522 4810.26416015625 963.0601 4810.26171875 963.059631347656 5 16 1.1.1.5103.10 1 55.4382 6222.22 55.4274 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; Delta:H(4)C(2)(H)@40; Carbamidomethyl(C)@41; acrolein addition +112(K)@43 0.0168354008346796 4800.2587890625 1201.072 4800.2412109375 1201.06750488281 4 14 1.1.1.5033.18 1 53.8018 1765.332 53.8319 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 75.7700026035309 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Dehydrated(S)@11; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; Carbamidomethyl(Y)@42; hexanoyl addition +98(K)@43 -0.0276913996785879 4796.22998046875 800.3789 4796.25732421875 800.383483886719 6 13 1.1.1.5062.5 1 54.4616 1118.874 54.479 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Dehydrated(S)@11; Carbamidomethyl(C)@25; reduced HNE(H)@40; Carbamidomethyl(C)@41 -0.00623519020155072 4799.28662109375 1200.829 4799.29345703125 1200.83068847656 4 11 1.1.1.5051.3 1 54.2249 770.8003 54.23 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 73.0599999427795 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKS Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; MDA adduct +54(K)@43 cleaved S-R@C-term; missed K-S@43 0.0298871006816626 4800.24609375 961.0565 4800.2158203125 961.050476074219 5 11 1.1.1.5039.6 1 53.9467 7251.452 53.8319 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 48.4499990940094 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; MDA adduct +54(K)@43; Arg-loss@C-term missed K-S@43 0.0298871006816626 4800.24609375 961.0565 4800.2158203125 961.050476074219 5 11 1.1.1.5039.6 1 53.9467 7251.452 53.8319 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.17999792099 LGEHNIDVLEGN cleaved N-E@C-term -0.000794588995631784 1308.63024902344 655.3224 1308.63098144531 655.32275390625 2 14 1.1.1.4526.5 1 41.6724 622.8011 41.6775 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.17999792099 LGEHNIDVLEGN cleaved N-E@C-term 0.000426095997681841 1308.63146972656 655.323 1308.63098144531 655.32275390625 2 14 1.1.1.4536.2 1 41.8728 611.6764 41.7357 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 77.5099992752075 LGEHNIDVLEGN Dehydrated(E)@10 cleaved N-E@C-term 0.00370170990936458 1290.6240234375 646.3193 1290.62048339844 646.317504882813 2 12 1.1.1.4547.4 1 42.1333 2749.316 42.02 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00900781992822886 1565.74133300781 783.8779 1565.73217773438 783.873352050781 2 19 1.1.1.4522.6 1 41.5776 909.0561 41.6064 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00900781992822886 1565.74133300781 783.8779 1565.73217773438 783.873352050781 2 18 1.1.1.4531.8 1 41.7543 930.3422 41.6064 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.5300028324127 LGEHNIDVLEGNEQF cleaved F-I@C-term -7.98632001876831 1704.81433105469 853.4144 1712.80053710938 857.407592773438 2 12 1.1.1.4826.7 1 48.7531 544.5035 48.7409 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00427005020901561 1939.93188476563 970.9732 1939.92761230469 970.971069335938 2 23 1.1.1.4913.10 1 50.854 5787.755 50.8137 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Deamidated(N)@17 cleaved N-A@C-term 0.00596182979643345 1940.91772460938 971.4661 1940.91162109375 971.463073730469 2 22 1.1.1.4947.9 1 51.6897 1315.872 51.6702 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00427005020901561 1939.93188476563 970.9732 1939.92761230469 970.971069335938 2 19 1.1.1.4906.12 1 50.6852 5787.755 50.8137 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7699995040894 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00439212005585432 1939.93212890625 970.9733 1939.92761230469 970.971069335938 2 14 1.1.1.4940.12 1 51.5161 389.2397 51.4738 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7699995040894 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.00037760499981232 1921.91723632813 961.9659 1921.9169921875 961.965759277344 2 16 1.1.1.4960.20 1 52.0122 3648.278 51.992 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.17999792099 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -1.02160000801086 1938.90612792969 970.4603 1939.92761230469 970.971069335938 2 14 1.1.1.4924.11 1 51.1252 249.4537 51.1319 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.0500011444092 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -1.00732004642487 1938.92028808594 970.4674 1939.92761230469 970.971069335938 2 14 1.1.1.4932.9 1 51.3188 329.7635 51.2541 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.6300029754639 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -0.00413089990615845 1939.92333984375 647.6484 1939.92761230469 647.649780273438 3 13 1.1.1.4915.5 1 50.8929 1291.86 50.8137 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.129997253418 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.00037760499981232 1921.91723632813 961.9659 1921.9169921875 961.965759277344 2 13 1.1.1.4953.11 1 51.8359 3648.278 51.992 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 77.5099992752075 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -0.999843001365662 1938.927734375 647.3165 1939.92761230469 647.649780273438 3 12 1.1.1.4907.2 1 50.6961 434.3394 50.7649 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.2699997425079 LGEHNIDVLEGNEQFIN Ammonia-loss(N)@17 cleaved N-A@C-term 0.0195252001285553 1922.92053222656 962.4675 1922.90100097656 962.457763671875 2 12 1.1.1.4957.15 1 51.9319 1922.653 51.992 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.2699997425079 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.00037760499981232 1921.91723632813 961.9659 1921.9169921875 961.965759277344 2 11 1.1.1.4967.20 1 52.1865 3648.278 51.992 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.4400019645691 LGEHNIDVLEGNEQFIN Delta:H(4)C(2)(H)@4 cleaved N-A@C-term 0.00502455979585648 1967.9638671875 984.9892 1967.95886230469 984.986694335938 2 10 1.1.1.4937.10 1 51.4445 129.4242 51.4006 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.2300026416779 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -3.99136996269226 1935.93603515625 646.3193 1939.92761230469 647.649780273438 3 12 1.1.1.4547.4 1 42.1333 2749.316 42.02 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.5300009250641 LGEHNIDVLEGNEQFINA cleaved A-A@C-term 0.00694712018594146 2010.97143554688 1006.493 2010.96472167969 1006.48962402344 2 10 1.1.1.4958.17 1 51.9602 1096.835 51.8674 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 77.5099992752075 LGEHNIDVLEGNEQFINAA cleaved A-K@C-term 0.00623372988775373 2082.00732421875 1042.011 2082.00170898438 1042.00817871094 2 10 1.1.1.4958.18 1 51.9618 1207.306 52.0675 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 LGEHNIDVLEGNEQFINAA cleaved A-K@C-term 0.00494610983878374 2082.0068359375 695.0095 2082.00170898438 695.007873535156 3 9 1.1.1.4959.10 1 51.9778 656.4034 52.0675 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 -0.00390907004475594 2211.07690429688 738.0329 2211.08081054688 738.0341796875 3 23 1.1.1.4800.8 1 48.1162 4271.492 48.2293 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 -0.00390907004475594 2211.07690429688 738.0329 2211.08081054688 738.0341796875 3 25 1.1.1.4807.4 1 48.291 4271.492 48.2293 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00405150977894664 2210.10131835938 1106.058 2210.0966796875 1106.0556640625 2 26 1.1.1.4817.14 1 48.5421 51808.27 48.6447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -4.3491498217918E-05 2210.0966796875 737.7062 2210.0966796875 737.706176757813 3 23 1.1.1.4820.3 1 48.6001 83771.96 48.6692 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -4.3491498217918E-05 2210.0966796875 737.7062 2210.0966796875 737.706176757813 3 22 1.1.1.4822.6 1 48.6516 83771.96 48.6692 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -4.3491498217918E-05 2210.0966796875 737.7062 2210.0966796875 737.706176757813 3 25 1.1.1.4824.2 1 48.6992 83771.96 48.6692 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -4.3491498217918E-05 2210.0966796875 737.7062 2210.0966796875 737.706176757813 3 22 1.1.1.4829.4 1 48.8209 83771.96 48.6692 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -4.3491498217918E-05 2210.0966796875 737.7062 2210.0966796875 737.706176757813 3 27 1.1.1.4831.3 1 48.8695 83771.96 48.6692 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00405150977894664 2210.10131835938 1106.058 2210.0966796875 1106.0556640625 2 21 1.1.1.4831.7 1 48.8812 53786.49 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 0.00121300003957003 2224.11328125 1113.064 2224.1123046875 1113.0634765625 2 24 1.1.1.4832.9 1 48.9055 5091.551 49.0082 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.000811467005405575 2224.11157226563 742.3778 2224.1123046875 742.378051757813 3 26 1.1.1.4833.4 1 48.9207 14509.68 49.0082 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.000322714011417702 2210.09716796875 737.7063 2210.0966796875 737.706176757813 3 27 1.1.1.4838.12 1 49.045 59446.15 48.7891 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.000811467005405575 2224.11157226563 742.3778 2224.1123046875 742.378051757813 3 26 1.1.1.4840.10 1 49.0927 14509.68 49.0082 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(K)@20 -0.00231073005124927 2238.12573242188 747.0492 2238.12817382813 747.049987792969 3 24 1.1.1.4841.8 1 49.1155 3384.684 49.3488 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.000226593998377211 2210.09643554688 737.7061 2210.0966796875 737.706176757813 3 26 1.1.1.4845.2 1 49.2088 22217.16 48.9594 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.000811467005405575 2224.11157226563 742.3778 2224.1123046875 742.378051757813 3 26 1.1.1.4847.3 1 49.2569 14661.76 49.0082 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term -0.00743761006742716 2238.12060546875 747.0475 2238.12817382813 747.049987792969 3 29 1.1.1.4848.3 1 49.2825 4541.209 49.4204 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term -0.00743761006742716 2238.12060546875 747.0475 2238.12817382813 747.049987792969 3 30 1.1.1.4855.3 1 49.45 4541.209 49.4204 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.00337490998208523 2224.10913085938 742.377 2224.1123046875 742.378051757813 3 26 1.1.1.4856.3 1 49.4739 2574.965 49.2289 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00864932965487242 2210.08813476563 737.7033 2210.0966796875 737.706176757813 3 27 1.1.1.4859.4 1 49.5473 4375.91 49.4683 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term -0.00780382007360458 2238.12036132813 747.0474 2238.12817382813 747.049987792969 3 26 1.1.1.4864.5 1 49.6652 4460.928 49.4204 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.000959006021730602 2210.095703125 737.7059 2210.0966796875 737.706176757813 3 26 1.1.1.4866.2 1 49.7114 2449.002 49.6358 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.000872022996190935 2210.09765625 737.7065 2210.0966796875 737.706176757813 3 27 1.1.1.4873.2 1 49.8797 2179.805 49.7555 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00123823003377765 2210.09790039063 737.7066 2210.0966796875 737.706176757813 3 25 1.1.1.4880.3 1 50.048 1311.146 49.9228 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -4.3491498217918E-05 2210.0966796875 737.7062 2210.0966796875 737.706176757813 3 19 1.1.1.4895.6 1 50.4112 568.3391 50.4263 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.000226593998377211 2210.09643554688 737.7061 2210.0966796875 737.706176757813 3 23 1.1.1.4902.6 1 50.5824 514.6798 50.5467 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.983951985836029 2211.08081054688 738.0342 2210.0966796875 737.706176757813 3 21 1.1.1.4909.5 1 50.7498 1250.742 50.6434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 -0.000613218988291919 2211.080078125 738.034 2211.08081054688 738.0341796875 3 26 1.1.1.4917.8 1 50.9444 5448.495 50.9848 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 -0.000613218988291919 2211.080078125 738.034 2211.08081054688 738.0341796875 3 23 1.1.1.4924.8 1 51.1202 5448.495 50.9848 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 -0.00335667002946138 2236.10913085938 746.377 2236.1123046875 746.378051757813 3 26 1.1.1.4934.2 1 51.3627 5718.685 51.5965 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.00652780011296272 2211.08740234375 738.0364 2211.08081054688 738.0341796875 3 21 1.1.1.4938.5 1 51.4587 331.1171 51.4006 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 -0.00390597991645336 2236.1083984375 746.3768 2236.1123046875 746.378051757813 3 23 1.1.1.4941.9 1 51.5324 5926.999 51.5965 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -4.3491498217918E-05 2210.0966796875 737.7062 2210.0966796875 737.706176757813 3 18 1.1.1.4945.12 1 51.6332 265.9394 51.5965 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 -0.00390597991645336 2236.1083984375 746.3768 2236.1123046875 746.378051757813 3 25 1.1.1.4948.13 1 51.7077 5926.999 51.5965 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4; Methyl(K)@20 -0.00137602002359927 2250.12670898438 751.0495 2250.12817382813 751.049987792969 3 23 1.1.1.4951.11 1 51.7801 736.3627 51.8181 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00734404008835554 2210.10400390625 737.7086 2210.0966796875 737.706176757813 3 21 1.1.1.6033.5 1 74.5482 114.5938 74.5324 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00221714004874229 2210.09887695313 737.7069 2210.0966796875 737.706176757813 3 20 1.1.1.6072.4 1 75.433 124.1248 75.4205 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.000935408985242248 2210.09765625 737.7065 2210.0966796875 737.706176757813 3 22 1.1.1.6083.4 1 75.6755 167.2911 75.6923 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00148472003638744 2210.09838867188 737.7067 2210.0966796875 737.706176757813 3 21 1.1.1.6112.4 1 76.384 223.2666 76.2962 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17; Methyl(K)@20 0.000449913990451023 2225.0966796875 742.7062 2225.09643554688 742.706115722656 3 21 1.1.1.4812.9 1 48.417 600.6051 48.4254 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00784100964665413 2210.0888671875 553.5295 2210.0966796875 553.531494140625 4 17 1.1.1.4834.5 1 48.941 3437.149 48.693 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 0.0131908999755979 2211.09326171875 1106.554 2211.08081054688 1106.54760742188 2 17 1.1.1.4903.9 1 50.6141 406.6978 50.6676 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00425485987216234 2210.09252929688 737.7048 2210.0966796875 737.706176757813 3 17 1.1.1.4931.6 1 51.2894 401.6562 51.2296 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 -0.00335975992493331 2211.07739257813 738.0331 2211.08081054688 738.0341796875 3 17 1.1.1.4954.6 1 51.8498 974.1901 51.7935 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00571967987343669 2210.09106445313 737.7043 2210.0966796875 737.706176757813 3 15 1.1.1.4963.11 1 52.0792 190.1694 52.1175 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00370554998517036 2210.09326171875 737.705 2210.0966796875 737.706176757813 3 14 1.1.1.5007.5 1 53.1476 168.9426 53.1904 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00405150977894664 2210.10131835938 1106.058 2210.0966796875 1106.0556640625 2 13 1.1.1.4882.10 1 50.1093 415.6487 50.0424 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.00366949988529086 2211.08325195313 1106.549 2211.08081054688 1106.54760742188 2 12 1.1.1.4924.12 1 51.1269 1527.433 50.9848 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term; Delta:H(2)C(2)(H)@4 0.0113692004233599 2264.15502929688 755.7256 2264.14379882813 755.721862792969 3 17 1.1.1.5046.5 1 54.114 241.1264 54.0791 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Formyl@N-term 0.00754114985466003 2238.09912109375 747.0403 2238.091796875 747.037841796875 3 26 1.1.1.5055.2 1 54.3075 1262.418 54.3544 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Formyl@N-term 0.00284636998549104 2238.09545898438 1120.055 2238.091796875 1120.05310058594 2 26 1.1.1.5055.5 1 54.32 1531.635 54.3544 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)@N-term; Delta:H(2)C(2)(H)@4 0.00115794001612812 2262.12939453125 755.0504 2262.12817382813 755.049987792969 3 24 1.1.1.5075.3 1 54.7503 870.3871 54.8611 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)@N-term; Delta:H(2)C(2)(H)@4 0.0115476995706558 2262.13940429688 1132.077 2262.12817382813 1132.0712890625 2 22 1.1.1.5082.5 1 54.928 766.7714 54.8611 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@3 -0.00250692991539836 2232.07641601563 745.0327 2232.07861328125 745.033508300781 3 16 1.1.1.5117.6 1 55.7855 172.6778 55.7777 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Oxidation(H)@4; Ammonia-loss(N)@5 0.00776669010519981 2209.0732421875 1105.544 2209.06518554688 1105.53979492188 2 17 1.1.1.5157.8 1 56.7938 770.7927 56.8281 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.995332002639771 2209.10131835938 737.3744 2210.0966796875 737.706176757813 3 15 1.1.1.6182.9 1 77.9835 88.0984 77.9145 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 0.0108446003869176 2296.14331054688 1149.079 2296.13354492188 1149.07409667969 2 13 1.1.1.5206.19 1 58.0175 1657.895 57.9223 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5; Deamidated(N)@17 0.0341559015214443 2212.09887695313 738.3736 2212.06469726563 738.362182617188 3 19 1.1.1.4828.3 1 48.7933 15713.5 48.7649 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(H)@4; Deamidated(N)@17 -0.0124017000198364 2239.099609375 747.3738 2239.11206054688 747.377990722656 3 18 1.1.1.4818.7 1 48.5548 429.8974 48.5715 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5; Deamidated(N)@17 0.0350713990628719 2212.09985351563 738.3739 2212.06469726563 738.362182617188 3 18 1.1.1.4821.7 1 48.6279 19439.38 48.6447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8200008869171 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12; Methyl(N)@17 0.000999222975224257 2225.09741210938 742.7064 2225.09643554688 742.706115722656 3 15 1.1.1.4935.11 1 51.3872 484.8846 51.3028 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.3200013637543 LGEHNIDVLEGNEQFINAAK Oxidation(N)@12 -0.00394841004163027 2226.08740234375 1114.051 2226.091796875 1114.05310058594 2 17 1.1.1.4819.13 1 48.5857 1075.835 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.0499982833862 LGEHNIDVLEGNEQFINAAK Dehydrated(E)@10 0.000334638985805213 2192.08666992188 731.7028 2192.08618164063 731.702697753906 3 15 1.1.1.4819.4 1 48.5766 262.9079 48.5472 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.0499982833862 LGEHNIDVLEGNEQFINAAK Ammonia-loss(N)@12 -0.00151691003702581 2193.06884765625 732.0302 2193.0703125 732.030700683594 3 14 1.1.1.4915.8 1 50.8954 284.6348 50.9603 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7699995040894 LGEHNIDVLEGNEQFINAAK Dioxidation(F)@15 -0.00398480007424951 2242.08276367188 748.3682 2242.08666992188 748.369445800781 3 17 1.1.1.4829.5 1 48.8226 1899.602 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.17999792099 LGEHNIDVLEGNEQFINAAK Methyl(N)@12; Carbamidomethyl(E)@13 -0.0272624008357525 2281.10693359375 761.3762 2281.1337890625 761.38525390625 3 15 1.1.1.4820.6 1 48.6026 328.3258 48.5958 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.17999792099 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 0.00213871989399195 2224.11450195313 557.0359 2224.1123046875 557.035400390625 4 15 1.1.1.4834.6 1 48.9418 842.1396 48.9837 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1900014877319 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@13 -0.00359253003261983 2232.07495117188 745.0323 2232.07861328125 745.033508300781 3 13 1.1.1.4827.5 1 48.774 492.7556 48.7649 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 -0.000461832998553291 2296.1328125 766.3849 2296.13354492188 766.385131835938 3 12 1.1.1.5199.5 1 57.8264 884.4794 57.8964 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.7200009822845 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17; Methyl(K)@20 0.0152351995930076 2225.111328125 1113.563 2225.09643554688 1113.55554199219 2 13 1.1.1.4931.10 1 51.2977 0 -1 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.2399988174438 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12; Methyl(E)@13 -0.00551653979346156 2225.09130859375 1113.553 2225.09643554688 1113.55554199219 2 14 1.1.1.4825.5 1 48.7324 721.481 48.7169 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.2399988174438 LGEHNIDVLEGNEQFINAAK Methyl(N)@17 0.00194541004020721 2224.11328125 1113.064 2224.1123046875 1113.0634765625 2 14 1.1.1.4849.7 1 49.3172 3894.458 49.0575 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.7200019359589 LGEHNIDVLEGNEQFINAAK Dioxidation(F)@15 -0.00144917995203286 2242.08544921875 1122.05 2242.08666992188 1122.05053710938 2 14 1.1.1.4823.4 1 48.688 1115.641 48.6447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.6399974822998 LGEHNIDVLEGNEQFINAAK Formyl(K)@20 -0.0216351002454758 2238.0693359375 1120.042 2238.091796875 1120.05310058594 2 12 1.1.1.4909.11 1 50.7598 298.3118 50.7893 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.129997253418 LGEHNIDVLEGNEQFINAAK -1.01169002056122 2209.08520507813 737.369 2210.0966796875 737.706176757813 3 12 1.1.1.5000.5 1 52.9821 132.9952 52.9209 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.3099982738495 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12; Methyl(E)@13 -0.00551653979346156 2225.09130859375 1113.553 2225.09643554688 1113.55554199219 2 12 1.1.1.4818.14 1 48.5665 733.5437 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.3099982738495 LGEHNIDVLEGNEQFINAAK Methyl(I)@6 -0.0308404006063938 2224.08154296875 742.3678 2224.1123046875 742.378051757813 3 21 1.1.1.4826.6 1 48.7515 1115.302 48.7409 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.5300009250641 LGEHNIDVLEGNEQFINAAK Dimethyl(N)@12; Deamidated(Q)@14 -0.0255851000547409 2239.08642578125 747.3694 2239.11206054688 747.377990722656 3 13 1.1.1.4827.6 1 48.7757 330.4471 48.7649 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.5400013923645 LGEHNIDVLEGNEQFINAAK Oxidation(H)@4; Ammonia-loss(N)@5 0.00776669010519981 2209.0732421875 1105.544 2209.06518554688 1105.53979492188 2 12 1.1.1.5164.12 1 56.9614 770.7927 56.8281 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 75.4999995231628 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 0.0105053996667266 2211.09130859375 1106.553 2211.08081054688 1106.54760742188 2 10 1.1.1.4910.11 1 50.7842 406.6978 50.6676 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 74.6399998664856 LGEHNIDVLEGNEQFINAAK HexNAc(N)@17; reduced acrolein addition +96(K)@20 -0.00747059006243944 2509.22631835938 837.416 2509.23364257813 837.418518066406 3 12 1.1.1.4801.14 1 48.149 1105.057 48.2537 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 71.4999973773956 LGEHNIDVLEGNEQFINAAK HexNAc(N)@17; reduced acrolein addition +96(K)@20 -0.00747059006243944 2509.22631835938 837.416 2509.23364257813 837.418518066406 3 12 1.1.1.4808.12 1 48.3155 1105.057 48.2537 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 71.4999973773956 LGEHNIDVLEGNEQFINAAK Methyl(E)@10 -0.036150299012661 2224.076171875 742.366 2224.1123046875 742.378051757813 3 17 1.1.1.4819.5 1 48.5774 1097.612 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.2699997425079 LGEHNIDVLEGNEQFINAAK Methylthio(N)@12; Deamidated(Q)@14 -0.0109983002766967 2257.0576171875 753.3598 2257.06860351563 753.363464355469 3 13 1.1.1.4819.7 1 48.5791 459.5945 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.2699997425079 LGEHNIDVLEGNEQFINAAK Oxidation(N)@12; Cation:K(E)@13 -0.013285499997437 2264.03442382813 755.6854 2264.04760742188 755.689819335938 3 13 1.1.1.4820.4 1 48.601 333.1327 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.2300026416779 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4; Methyl(E)@10 -0.000460509996628389 2250.12768554688 751.0498 2250.12817382813 751.049987792969 3 12 1.1.1.4944.12 1 51.6085 768.4777 51.8426 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.2300026416779 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4; Methyl(N)@17 0.00290602003224194 2250.13134765625 1126.073 2250.12817382813 1126.0712890625 2 11 1.1.1.4950.20 1 51.7638 346.6944 51.8181 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5; Methyl(N)@17 -0.00083180598448962 2225.095703125 742.7058 2225.09643554688 742.706115722656 3 10 1.1.1.4918.5 1 50.9664 195.0564 50.9848 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.4400001764297 LGEHNIDVLEGNEQFINAAK Formyl(K)@20 -0.0216351002454758 2238.0693359375 1120.042 2238.091796875 1120.05310058594 2 11 1.1.1.4916.8 1 50.9306 298.3118 50.7893 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.9999983310699 LGEHNIDVLEGNEQFINAAKI Hex(N)@17; MDA adduct +54(K)@20 cleaved I-I@C-term; missed K-I@20 -0.00741537986323237 2539.23706054688 847.4196 2539.244140625 847.421997070313 3 13 1.1.1.4835.5 1 48.9687 324.5701 48.9349 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 72.3100006580353 LGEHNIDVLEGNEQFINAAKII Hex(N)@17; MDA adduct +54(K)@20 cleaved I-T@C-term; missed K-I@20 0.0489613004028797 2652.37719726563 885.133 2652.32836914063 885.11669921875 3 13 1.1.1.4828.6 1 48.7958 420.6856 48.7649 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; acrolein addition +94(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.0266076996922493 2927.50146484375 976.8411 2927.52807617188 976.849975585938 3 11 1.1.1.5442.6 1 63.7489 503.0861 63.778 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.5000028610229 LGEHNIDVLEGNEQFINAAKIITHP acrolein addition +112(K)@20 cleaved P-N@C-term; missed K-I@20 -0.00491996016353369 2883.47192382813 962.1646 2883.4765625 962.166137695313 3 10 1.1.1.5405.13 1 62.8489 235.0557 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.6600017547607 LGEHNIDVLEGNEQFINAAKIITHP Deamidated(N)@17; acrolein addition +112(K)@20; Delta:H(2)C(2)(H)@24 cleaved P-N@C-term; missed K-I@20 0.00186526996549219 2910.47827148438 971.1667 2910.47631835938 971.166076660156 3 11 1.1.1.5485.9 1 64.8031 136.1452 64.8115 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN Delta:H(4)C(2)(K)@20 cleaved N-F@C-term; missed K-I@20 0.00168991996906698 2913.50024414063 972.174 2913.49853515625 972.173461914063 3 19 1.1.1.5096.12 1 55.2642 2089.33 55.2019 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN Delta:H(4)C(2)(K)@20 cleaved N-F@C-term; missed K-I@20 -0.00885654985904694 2913.48974609375 729.3797 2913.49853515625 729.381896972656 4 24 1.1.1.5097.4 1 55.2825 4138.181 55.2019 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 LGEHNIDVLEGNEQFINAAKIITHPN acrolein addition +112(K)@20; reduced HNE(H)@24; Deamidated(N)@26 cleaved N-F@C-term; missed K-I@20 -0.0408096015453339 3156.59326171875 790.1556 3156.63427734375 790.165832519531 4 13 1.1.1.5242.4 1 58.8924 697.498 58.9117 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.7499997615814 LGEHNIDVLEGNEQFINAAKIITHPN Delta:H(4)C(2)(H)@24 cleaved N-F@C-term; missed K-I@20 -0.00958895962685347 2913.48901367188 729.3795 2913.49853515625 729.381896972656 4 12 1.1.1.5115.4 1 55.7332 577.5084 55.7524 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 -0.034331601113081 3156.59008789063 790.1548 3156.62451171875 790.163391113281 4 18 1.1.1.5217.3 1 58.2756 3942.158 58.3204 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 -0.034331601113081 3156.59008789063 790.1548 3156.62451171875 790.163391113281 4 17 1.1.1.5224.2 1 58.4482 3942.158 58.3204 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 -0.0309136006981134 3156.59326171875 790.1556 3156.62451171875 790.163391113281 4 15 1.1.1.5242.4 1 58.8924 697.498 58.9117 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 -0.0303303003311157 3156.59301757813 1053.205 3156.62451171875 1053.21545410156 3 14 1.1.1.5220.11 1 58.3581 2026.281 58.2957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 LGEHNIDVLEGNEQFINAAKIITHPNF acrolein addition +38(K)@20; Hex(N)@26 cleaved F-N@C-term; missed K-I@20 0.0288718994706869 3232.63305664063 809.1655 3232.60400390625 809.158264160156 4 13 1.1.1.5203.6 1 57.9303 261.0277 57.9478 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.4800028800964 LGEHNIDVLEGNEQFINAAKIITHPNF acrolein addition +56(K)@20; Oxidation(P)@25 cleaved F-N@C-term; missed K-I@20 -0.0439965017139912 3104.51318359375 1035.845 3104.556640625 1035.85949707031 3 15 1.1.1.4825.4 1 48.7291 2353.124 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3699994087219 LGEHNIDVLEGNEQFINAAKIITHPNF reduced acrolein addition +96(K)@20; Methyl(H)@24 cleaved F-N@C-term; missed K-I@20 -0.0278463996946812 3142.5810546875 786.6525 3142.60864257813 786.659484863281 4 11 1.1.1.5215.6 1 58.2288 161.1835 58.2217 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3299987316132 LGEHNIDVLEGNEQFINAAKIITHPNF acrolein addition +56(K)@20; Oxidation(P)@25 cleaved F-N@C-term; missed K-I@20 -0.0439965017139912 3104.51318359375 1035.845 3104.556640625 1035.85949707031 3 14 1.1.1.4818.13 1 48.5648 2353.124 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.7499997615814 LGEHNIDVLEGNEQFINAAKIITHPNF acrolein addition +112(K)@20; Oxidation(P)@25; Deamidated(N)@26 cleaved F-N@C-term; missed K-I@20 0.00648235995322466 3161.5732421875 791.4006 3161.56689453125 791.398986816406 4 10 1.1.1.5207.4 1 58.0299 540.1673 58.0988 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.1100015640259 LGEHNIDVLEGNEQFINAAKIITHPNF acrolein addition +56(K)@20; Oxidation(P)@25 cleaved F-N@C-term; missed K-I@20 -0.0454613007605076 3104.51025390625 1035.844 3104.556640625 1035.85949707031 3 13 1.1.1.4832.7 1 48.9005 2233.383 48.6447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20; Deamidated(N)@28 cleaved N-G@C-term; missed K-I@20 -0.0139205995947123 3175.580078125 794.9023 3175.59375 794.90576171875 4 28 1.1.1.5210.4 1 58.1042 7317.409 58.1234 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20; Deamidated(N)@28 cleaved N-G@C-term; missed K-I@20 -0.0139205995947123 3175.580078125 794.9023 3175.59375 794.90576171875 4 23 1.1.1.5217.4 1 58.2765 7317.409 58.1234 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Methyl(H)@24; Oxidation(P)@25 cleaved N-G@C-term; missed K-I@20 -0.0145485000684857 3176.57446289063 795.1509 3176.58911132813 795.154541015625 4 16 1.1.1.5249.3 1 59.0691 583.6001 59.1122 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(H)@24; Deamidated(N)@26 cleaved N-G@C-term; missed K-I@20 -0.0148970996960998 3175.57885742188 794.902 3175.59375 794.90576171875 4 14 1.1.1.5224.3 1 58.449 598.091 58.4193 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Formyl(K)@20; Deamidated(N)@26 cleaved N-G@C-term; missed K-I@20 0.0227090995758772 3175.580078125 794.9023 3175.55737304688 794.896606445313 4 15 1.1.1.5241.4 1 58.8677 535.1588 58.8623 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20 cleaved N-G@C-term; missed K-I@20 -0.00426251022145152 3174.60571289063 794.6587 3174.60986328125 794.659729003906 4 14 1.1.1.5203.4 1 57.9286 2454.997 57.8448 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9799976348877 LGEHNIDVLEGNEQFINAAKIITHPNFN Deamidated(N)@17; reduced acrolein addition +58(K)@20; Delta:H(2)C(2)(H)@24 cleaved N-G@C-term; missed K-I@20 -0.00712426006793976 3231.61303710938 808.9105 3231.6201171875 808.912292480469 4 13 1.1.1.5194.7 1 57.6993 353.2524 57.7417 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20; Deamidated(N)@28 cleaved N-T@C-term; missed K-I@20 0.00267497007735074 3346.66088867188 837.6725 3346.658203125 837.671813964844 4 20 1.1.1.5200.6 1 57.8529 1604.633 57.7674 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20 cleaved N-T@C-term; missed K-I@20 -0.00650287000462413 3345.66821289063 1116.23 3345.67431640625 1116.23205566406 3 14 1.1.1.5168.9 1 57.0657 650.343 57.0464 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20; Deamidated(N)@28 cleaved N-T@C-term; missed K-I@20 0.0124404998496175 3346.67065429688 837.6749 3346.658203125 837.671813964844 4 15 1.1.1.5170.2 1 57.0995 1000.027 57.0707 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Deamidated(N)@12; Delta:H(4)C(2)(K)@20 cleaved N-T@C-term; missed K-I@20 0.00511635979637504 3346.66333007813 837.6731 3346.658203125 837.671813964844 4 13 1.1.1.5179.5 1 57.3247 1003.647 57.0707 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20 cleaved N-T@C-term; missed K-I@20 -0.00793122965842485 3345.66625976563 837.4238 3345.67431640625 837.425842285156 4 11 1.1.1.5186.8 1 57.4966 284.3808 57.5125 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Formyl(K)@20 missed K-I@20 0.0290290992707014 4502.283203125 901.4639 4502.25390625 901.458068847656 5 15 1.1.1.5375.8 1 62.0985 3551.34 62.1652 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Formyl(K)@20; Methyl(K)@40 missed K-I@20 0.0178098008036613 4516.28759765625 904.2648 4516.26953125 904.26123046875 5 16 1.1.1.5379.12 1 62.2046 574.1351 62.1911 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24; Deamidated(N)@28 missed K-I@20 -0.020685400813818 4489.23828125 898.8549 4489.2587890625 898.859008789063 5 26 1.1.1.5384.11 1 62.3312 1226.59 62.3447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Formyl(K)@20; Deamidated(N)@28 missed K-I@20 0.0108888996765018 4503.24853515625 901.657 4503.23779296875 901.654907226563 5 17 1.1.1.5384.12 1 62.3321 1582.397 62.3447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24 missed K-I@20 -0.0262509007006884 4488.24853515625 749.0487 4488.27490234375 749.053039550781 6 14 1.1.1.5378.5 1 62.1727 247.7665 62.1652 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24 missed K-I@20 -0.0120056001469493 4488.26318359375 898.6599 4488.27490234375 898.662231445313 5 13 1.1.1.5375.7 1 62.0977 2873.004 62.1652 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.4600005149841 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Deamidated(N)@12; Deamidated(N)@17; Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20 0.0476072989404202 4503.27490234375 1126.826 4503.2265625 1126.81396484375 4 12 1.1.1.5383.18 1 62.312 662.0619 62.3694 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 20.9199994802475 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK missed K-I@20 -0.0404576994478703 4474.21875 895.851 4474.25927734375 895.859069824219 5 11 1.1.1.5377.6 1 62.1476 207.4148 62.1399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATL Delta:H(4)C(2)@N-term; acrolein addition +56(K)@40 cleaved L-N@C-term; missed K-I@20; missed K-L@40 0.0226489007472992 5227.70849609375 1046.549 5227.6865234375 1046.54455566406 5 17 1.1.1.5584.14 1 67.1783 2177.788 67.2582 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATL Delta:H(4)C(2)@N-term; acrolein addition +56(K)@40 cleaved L-N@C-term; missed K-I@20; missed K-L@40 0.0226489007472992 5227.70849609375 1046.549 5227.6865234375 1046.54455566406 5 20 1.1.1.5592.10 1 67.3598 2180.09 67.2582 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATL Delta:H(4)C(2)@N-term; acrolein addition +56(K)@40 cleaved L-N@C-term; missed K-I@20; missed K-L@40 0.0121755003929138 5227.6982421875 872.2903 5227.6865234375 872.288330078125 6 13 1.1.1.5584.8 1 67.1683 1101.492 67.2582 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN acrolein addition +56(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0397220999002457 5313.73876953125 1063.755 5313.69775390625 1063.74682617188 5 17 1.1.1.5538.4 1 66.1233 1082.025 66.1283 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN Deamidated(N)@34; acrolein addition +56(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0273822993040085 5314.70849609375 1063.949 5314.68212890625 1063.94372558594 5 16 1.1.1.5564.4 1 66.7544 429.3775 66.7841 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9799976348877 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN acrolein addition +56(K)@40; Dehydrated(T)@46 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0193533003330231 5295.708984375 1060.149 5295.6875 1060.14477539063 5 13 1.1.1.5565.4 1 66.7724 1012.737 66.7594 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.6600017547607 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN acrolein addition +38(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.00798460002988577 5295.69580078125 883.6232 5295.6875 883.621826171875 6 10 1.1.1.5564.2 1 66.7427 274.739 66.7347 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0189507007598877 5557.83349609375 1112.574 5557.81494140625 1112.5703125 5 15 1.1.1.5369.9 1 61.9562 1207.008 61.9907 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0397026017308235 5557.853515625 1112.578 5557.81494140625 1112.5703125 5 15 1.1.1.5394.10 1 62.5854 601.788 62.5662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0114457001909614 5597.85791015625 933.9836 5597.8466796875 933.981689453125 6 16 1.1.1.5436.3 1 63.5943 726.5024 63.6095 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.00108001998160034 5556.830078125 927.1456 5556.8310546875 927.145812988281 6 15 1.1.1.5439.4 1 63.6699 70621.7 63.6335 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00923783984035254 5578.80615234375 930.8083 5578.8154296875 930.809875488281 6 16 1.1.1.5443.2 1 63.7604 1298.535 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00374469999223948 5578.8115234375 930.8092 5578.8154296875 930.809875488281 6 16 1.1.1.5458.4 1 64.1393 870.3456 64.1026 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0299359001219273 5597.81640625 933.9767 5597.8466796875 933.981689453125 6 16 1.1.1.5459.3 1 64.1585 674.4522 64.151 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.00119185994844884 5597.84765625 933.9819 5597.8466796875 933.981689453125 6 15 1.1.1.5461.4 1 64.2086 674.4522 64.151 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0189867001026869 5572.84375 1115.576 5572.826171875 1115.57250976563 5 16 1.1.1.5461.8 1 64.2187 1186.939 64.1753 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20 missed K-I@20; missed K-L@40 -0.00327727990224957 5556.828125 927.1453 5556.8310546875 927.145812988281 6 17 1.1.1.5464.5 1 64.2845 45473.85 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0452678017318249 5594.80126953125 933.4742 5594.8466796875 933.481750488281 6 17 1.1.1.5466.3 1 64.3336 465.9026 64.151 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0174927990883589 5539.82373046875 1108.972 5539.8046875 1108.96813964844 5 17 1.1.1.5473.4 1 64.506 830.8817 64.4909 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0306682996451855 5597.81591796875 933.9766 5597.8466796875 933.981689453125 6 16 1.1.1.5478.9 1 64.6248 388.8611 64.5642 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0140928002074361 5576.82177734375 930.4776 5576.83642578125 930.47998046875 6 16 1.1.1.5482.6 1 64.7239 947.5432 64.836 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0350263006985188 5595.7958984375 933.6399 5595.83056640625 933.645751953125 6 17 1.1.1.5489.5 1 64.8977 440.6048 64.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; reduced HNE(H)@24; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0401648990809917 5883.00048828125 981.5073 5883.04052734375 981.514038085938 6 15 1.1.1.5489.6 1 64.9011 201.7889 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0194386001676321 5574.822265625 930.1443 5574.841796875 930.147583007813 6 19 1.1.1.5491.2 1 64.9389 1637.026 64.9581 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.00156350003089756 5770.98681640625 962.8384 5770.98779296875 962.838623046875 6 15 1.1.1.5493.5 1 64.9902 162.4311 64.9095 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0305473990738392 5557.84375 1112.576 5557.81494140625 1112.5703125 5 17 1.1.1.5506.10 1 65.3178 11984.92 65.0553 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0286542996764183 5672.88330078125 1135.584 5672.9150390625 1135.59020996094 5 16 1.1.1.5528.6 1 65.8726 1288.418 65.8025 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0127852000296116 5672.90380859375 1135.588 5672.9150390625 1135.59020996094 5 16 1.1.1.5539.4 1 66.1485 1777.565 66.1787 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0398212000727654 5673.859375 946.6505 5673.89892578125 946.657104492188 6 18 1.1.1.5574.6 1 66.9471 530.1871 66.9522 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.00144622998777777 5556.830078125 927.1456 5556.8310546875 927.145812988281 6 14 1.1.1.5412.2 1 63.0141 111213.2 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0350138992071152 5594.8115234375 933.4759 5594.8466796875 933.481750488281 6 14 1.1.1.5499.6 1 65.1424 296.4811 64.9826 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Formyl(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00174990994855762 5557.810546875 927.309 5557.8115234375 927.309265136719 6 30 1.1.1.5369.5 1 61.9495 2530.317 61.9907 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0307563003152609 5573.8408203125 929.9808 5573.81005859375 929.975646972656 6 15 1.1.1.5374.6 1 62.0758 24116.61 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00107998005114496 5556.830078125 927.1456 5556.8310546875 927.145812988281 6 28 1.1.1.5376.9 1 62.1248 4434.703 62.1911 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.01988760009408 5543.8193359375 924.9772 5543.79931640625 924.973876953125 6 23 1.1.1.5377.7 1 62.1484 2259.872 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0102695003151894 5556.85400390625 1112.378 5556.8642578125 1112.38012695313 5 20 1.1.1.5377.14 1 62.1543 2291.72 62.1911 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0346590988337994 5556.82958984375 794.8401 5556.8642578125 794.845031738281 7 27 1.1.1.5378.10 1 62.1769 1224.541 62.1911 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.0152334999293089 5544.81005859375 925.1423 5544.794921875 925.139709472656 6 20 1.1.1.5378.12 1 62.1785 3001.963 62.2172 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Oxidation(M)@37; Formyl(K)@40 missed K-I@20; missed K-L@40 0.00538477022200823 5602.841796875 934.8143 5602.83642578125 934.813354492188 6 16 1.1.1.5378.15 1 62.181 1089.796 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.00400948990136385 5572.82177734375 797.1247 5572.826171875 797.125305175781 7 25 1.1.1.5379.7 1 62.2004 9620.986 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0203421004116535 5587.841796875 799.2704 5587.8623046875 799.273315429688 7 19 1.1.1.5379.8 1 62.2013 457.3046 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0324675999581814 5587.82958984375 932.3122 5587.8623046875 932.317626953125 6 16 1.1.1.5379.13 1 62.2054 1367.653 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0287523008882999 5572.853515625 1115.578 5572.826171875 1115.57250976563 5 24 1.1.1.5379.19 1 62.2104 18802.08 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0242541991174221 5544.8076171875 793.1226 5544.8310546875 793.126037597656 7 16 1.1.1.5380.4 1 62.2241 630.5758 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamidomethyl(E)@13; ONE addition +154(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0382567010819912 5739.9951171875 821.0066 5739.95703125 821.001159667969 7 19 1.1.1.5380.7 1 62.2266 249.8295 62.2172 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0177970007061958 5529.8017578125 922.6409 5529.78369140625 922.637939453125 6 23 1.1.1.5380.9 1 62.2283 823.4139 62.2172 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; MDA adduct +62(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.000294230994768441 5591.8359375 932.9799 5591.8359375 932.979919433594 6 19 1.1.1.5380.10 1 62.2291 860.6476 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; Formyl(K)@40 missed K-I@20; missed K-L@40 -0.0710162967443466 5624.78662109375 938.4717 5624.857421875 938.483520507813 6 17 1.1.1.5380.11 1 62.23 462.4073 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0105582997202873 5783.99755859375 965.0069 5784.00830078125 965.008666992188 6 20 1.1.1.5380.14 1 62.2325 247.726 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Oxidation(M)@37; Formyl(K)@40 missed K-I@20; missed K-L@40 -0.0433043017983437 5856.98095703125 977.1708 5857.02490234375 977.178100585938 6 19 1.1.1.5380.15 1 62.2333 304.3136 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Phosphoguanosine(H)@24; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0338964015245438 6019.990234375 1004.339 6019.95703125 1004.33343505859 6 16 1.1.1.5380.17 1 62.235 359.9929 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00677768979221582 5557.81884765625 794.9814 5557.8115234375 794.980407714844 7 24 1.1.1.5381.3 1 62.2488 2046.951 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.00865419954061508 5543.8193359375 924.9772 5543.810546875 924.975708007813 6 16 1.1.1.5381.6 1 62.2513 2259.872 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Oxidation(D)@35; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0139646995812654 5572.84521484375 929.8148 5572.85888671875 929.817138671875 6 36 1.1.1.5381.7 1 62.2522 33112.88 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0371632017195225 5614.79931640625 936.8072 5614.83642578125 936.813354492188 6 24 1.1.1.5381.8 1 62.253 379.5802 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; Dethiomethyl(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0746717005968094 5836.97802734375 973.837 5837.052734375 973.849426269531 6 19 1.1.1.5381.12 1 62.2563 447.794 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Phosphoadenosine(T)@31; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0216832999140024 5941.888671875 991.322 5941.90966796875 991.325561523438 6 18 1.1.1.5381.13 1 62.2572 314.2092 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0111761996522546 5600.84619140625 801.1282 5600.857421875 801.129760742188 7 16 1.1.1.5382.4 1 62.275 426.3374 62.2943 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)@N-term; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.00236073997803032 5600.85986328125 934.4839 5600.857421875 934.483520507813 6 18 1.1.1.5382.8 1 62.2784 1245.146 62.2943 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; HPNE addition +172(K)@20; Oxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.06547000259161 5802.01171875 968.0092 5801.9462890625 967.998291015625 6 18 1.1.1.5382.10 1 62.28 571.3101 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Oxidation(M)@37; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.00724704004824162 5822.9755859375 971.5032 5822.98291015625 971.504455566406 6 15 1.1.1.5382.11 1 62.2809 206.6983 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0176276993006468 5557.83056640625 927.3124 5557.84814453125 927.315307617188 6 28 1.1.1.5383.9 1 62.3045 8869.074 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0374655015766621 5556.830078125 927.1456 5556.86767578125 927.15185546875 6 22 1.1.1.5384.13 1 62.3329 4434.703 62.1911 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.00400948990136385 5572.82177734375 797.1247 5572.826171875 797.125305175781 7 23 1.1.1.5386.3 1 62.3745 9620.986 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.00865419954061508 5543.8193359375 924.9772 5543.810546875 924.975708007813 6 16 1.1.1.5386.10 1 62.3804 2259.872 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Formyl(K)@40 missed K-I@20; missed K-L@40 -0.01181669998914 5586.830078125 932.1456 5586.841796875 932.147583007813 6 15 1.1.1.5386.11 1 62.3812 1074.272 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0190500002354383 5572.84521484375 929.8148 5572.826171875 929.811645507813 6 23 1.1.1.5388.6 1 62.4268 33112.88 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0427239984273911 5538.83154296875 924.1459 5538.87451171875 924.153076171875 6 21 1.1.1.5389.3 1 62.4506 416.2469 62.469 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0187577996402979 5557.83056640625 927.3124 5557.8115234375 927.309265136719 6 27 1.1.1.5390.5 1 62.4783 9522.773 62.2172 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0161060001701117 5572.810546875 929.809 5572.826171875 929.811645507813 6 27 1.1.1.5395.8 1 62.599 4484.854 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0360006988048553 5556.83154296875 927.1459 5556.86767578125 927.15185546875 6 32 1.1.1.5397.4 1 62.6491 72908.39 62.8852 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24 missed K-I@20; missed K-L@40 -0.0365202017128468 5528.7998046875 922.4739 5528.83642578125 922.47998046875 6 36 1.1.1.5400.2 1 62.7232 28843.09 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(I)@21 missed K-I@20; missed K-L@40 -0.036413099616766 5514.78369140625 920.1379 5514.8203125 920.14404296875 6 31 1.1.1.5401.7 1 62.7443 9180.629 62.7857 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00404655002057552 5541.82470703125 924.6447 5541.8203125 924.643981933594 6 22 1.1.1.5401.8 1 62.7451 14187.59 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; PhosphoUridine(H)@24 missed K-I@20; missed K-L@40 0.085200697183609 5904.9892578125 985.1721 5904.9033203125 985.157836914063 6 26 1.1.1.5401.9 1 62.746 3017.557 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] GlycerylPE(E)@13; acrolein addition +94(K)@20; reduced HNE(H)@24 missed K-I@20; missed K-L@40 -0.00804055016487837 5950.0146484375 992.6764 5950.02294921875 992.677734375 6 16 1.1.1.5401.10 1 62.7468 559.2587 62.7857 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20 missed K-I@20; missed K-L@40 -0.0248454008251429 5528.8134765625 1106.77 5528.83642578125 1106.77453613281 5 31 1.1.1.5401.15 1 62.751 14782.94 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.052760798484087 5540.84375 1109.176 5540.78857421875 1109.1650390625 5 15 1.1.1.5401.16 1 62.7518 2334.215 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Formyl(K)@40 missed K-I@20; missed K-L@40 0.049975398927927 5556.84326171875 1112.376 5556.794921875 1112.3662109375 5 19 1.1.1.5401.17 1 62.7526 55251.92 62.9345 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20 missed K-I@20; missed K-L@40 -0.00814635027199984 5528.7919921875 790.8347 5528.7998046875 790.835815429688 7 26 1.1.1.5402.5 1 62.7673 4824.576 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0136072002351284 5556.81787109375 794.8384 5556.8310546875 794.840270996094 7 24 1.1.1.5402.6 1 62.7681 21279.28 62.9099 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24 missed K-I@20; missed K-L@40 -0.036413099616766 5514.78369140625 920.1379 5514.8203125 920.14404296875 6 24 1.1.1.5402.11 1 62.7723 9180.629 62.7857 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dehydrated(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0211082994937897 5572.82080078125 929.8107 5572.84130859375 929.814147949219 6 29 1.1.1.5402.12 1 62.7731 5596.995 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0482022017240524 5586.830078125 932.1456 5586.8779296875 932.153625488281 6 23 1.1.1.5402.13 1 62.774 1668.338 62.9099 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(Q)@14; NeuAc(N)@17; hexanoyl addition +98(K)@20 missed K-I@20; missed K-L@40 0.0122194001451135 5890.9697265625 982.8356 5890.95751953125 982.833557128906 6 23 1.1.1.5402.15 1 62.7756 903.9787 62.7857 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24 missed K-I@20; missed K-L@40 -0.0118316002190113 5514.80859375 1103.969 5514.8203125 1103.97143554688 5 31 1.1.1.5402.18 1 62.7781 4492.261 62.7857 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20 missed K-I@20; missed K-L@40 -0.000134729998535477 5528.7998046875 922.4739 5528.7998046875 922.473937988281 6 18 1.1.1.5403.5 1 62.7922 28843.09 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0358944982290268 5542.8154296875 924.8099 5542.85205078125 924.81591796875 6 42 1.1.1.5403.6 1 62.793 26589.08 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 -0.00489227985963225 5581.810546875 931.309 5581.81494140625 931.309814453125 6 17 1.1.1.5403.7 1 62.7939 1018.869 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Deamidated(N)@28; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00115821999497712 5592.82080078125 933.1441 5592.81982421875 933.143920898438 6 20 1.1.1.5403.8 1 62.7947 961.4112 62.9099 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; hexanoyl addition +98(K)@20; reduced HNE(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0218477007001638 5771.9873046875 963.0051 5772.00830078125 963.008666992188 6 20 1.1.1.5403.11 1 62.7972 689.8051 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.100100003182888 5826.95068359375 972.1657 5827.05078125 972.182373046875 6 21 1.1.1.5403.12 1 62.7981 505.9294 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.00767272990196943 5542.80810546875 792.837 5542.8154296875 792.838073730469 7 24 1.1.1.5404.2 1 62.8147 4541.575 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00291102007031441 5556.828125 927.1453 5556.8310546875 927.145812988281 6 41 1.1.1.5404.4 1 62.8163 106520.3 62.9345 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0165291000157595 5557.83203125 927.3126 5557.84814453125 927.315307617188 6 24 1.1.1.5404.5 1 62.8172 73743.27 62.9345 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; MDA adduct +62(K)@20; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.0179038997739553 5601.80224609375 934.641 5601.8203125 934.643981933594 6 15 1.1.1.5404.6 1 62.818 803.1727 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +62(K)@20; Oxidation(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0405873991549015 5607.7900390625 935.639 5607.83056640625 935.645751953125 6 23 1.1.1.5404.7 1 62.8188 675.5629 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0309159997850657 5770.990234375 962.839 5771.02099609375 962.844116210938 6 18 1.1.1.5404.8 1 62.8197 493.3308 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0442732013761997 5784.99560546875 965.1732 5785.0400390625 965.180603027344 6 23 1.1.1.5404.9 1 62.8205 522.4464 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; reduced HNE(H)@24; Dioxidation(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.00354949990287423 5820.9638671875 971.1679 5820.96728515625 971.168518066406 6 16 1.1.1.5404.11 1 62.8222 457.0752 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0958020985126495 5840.970703125 974.5024 5841.06640625 974.518310546875 6 21 1.1.1.5404.12 1 62.823 511.8311 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Hex(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.011969399638474 5933.02880859375 1187.613 5933.041015625 1187.61547851563 5 16 1.1.1.5404.21 1 62.8305 4434.052 62.8852 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00291102007031441 5556.828125 927.1453 5556.8310546875 927.145812988281 6 23 1.1.1.5405.3 1 62.8405 106520.3 62.9345 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.048700500279665 5573.859375 929.9838 5573.81005859375 929.975646972656 6 17 1.1.1.5405.4 1 62.8414 5341.188 62.9345 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.032480001449585 5588.8134765625 932.4762 5588.84619140625 932.481628417969 6 23 1.1.1.5405.5 1 62.8422 1776.423 62.9585 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0310079995542765 5611.794921875 936.3064 5611.82568359375 936.311584472656 6 16 1.1.1.5405.6 1 62.843 717.3301 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@34; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.008327960036695 5625.82861328125 938.6454 5625.8203125 938.643981933594 6 15 1.1.1.5405.8 1 62.8447 480.1335 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HexNAc(N)@17; acrolein addition +56(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0309723000973463 5787.96923828125 965.6688 5787.9384765625 965.663696289063 6 18 1.1.1.5405.14 1 62.8497 390.346 62.9099 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0179839003831148 5572.8232421875 797.1249 5572.84130859375 797.12744140625 7 25 1.1.1.5406.2 1 62.8643 1379.252 62.9585 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Phospho(T)@23; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00929383002221584 5822.96875 971.5021 5822.95947265625 971.50048828125 6 26 1.1.1.5406.6 1 62.8701 476.2516 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; Hex(N)@34; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0618396997451782 5918.99951171875 987.5072 5919.0615234375 987.517517089844 6 16 1.1.1.5406.7 1 62.8718 2703.643 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Formyl(K)@40 missed K-I@20; missed K-L@40 0.00658506015315652 5586.84814453125 1118.377 5586.841796875 1118.37561035156 5 17 1.1.1.5406.9 1 62.8751 852.9111 62.8852 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0365202017128468 5528.7998046875 922.4739 5528.83642578125 922.47998046875 6 43 1.1.1.5407.4 1 62.9005 28843.09 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0358944982290268 5542.8154296875 924.8099 5542.85205078125 924.81591796875 6 29 1.1.1.5408.2 1 62.917 26589.08 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(T)@23; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0248454008251429 5528.8134765625 1106.77 5528.83642578125 1106.77453613281 5 42 1.1.1.5408.3 1 62.9228 14782.94 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0234060008078814 5556.84326171875 1112.376 5556.86767578125 1112.38073730469 5 47 1.1.1.5408.4 1 62.9287 55832.3 62.9345 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0466219000518322 5556.81787109375 794.8384 5556.8642578125 794.845031738281 7 33 1.1.1.5409.3 1 62.9417 21279.28 62.9099 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.018657099455595 5571.8232421875 929.6445 5571.841796875 929.647583007813 6 29 1.1.1.5409.4 1 62.9442 4141.567 62.9585 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dehydrated(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0192773006856442 5572.822265625 929.811 5572.84130859375 929.814147949219 6 30 1.1.1.5409.5 1 62.9467 5754.059 62.9099 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0226000007241964 5542.82861328125 1109.573 5542.85205078125 1109.57763671875 5 39 1.1.1.5409.7 1 62.9534 13983.53 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0358944982290268 5542.8154296875 924.8099 5542.85205078125 924.81591796875 6 35 1.1.1.5410.2 1 62.9657 26589.08 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0474697984755039 5586.83056640625 932.1457 5586.8779296875 932.153625488281 6 25 1.1.1.5410.3 1 62.9715 1623.505 62.9345 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.03446089848876 5556.830078125 927.1456 5556.8642578125 927.151306152344 6 41 1.1.1.5411.2 1 62.9885 111213.2 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0215006992220879 5596.8408203125 933.8141 5596.8623046875 933.817687988281 6 26 1.1.1.5411.3 1 62.9918 648.9491 62.9829 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0107882004231215 5571.83349609375 1115.374 5571.841796875 1115.37573242188 5 19 1.1.1.5411.5 1 62.9985 2263.856 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0184110999107361 5572.82275390625 797.1248 5572.84130859375 797.12744140625 7 26 1.1.1.5413.4 1 63.0397 1524.394 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +62(K)@20; Oxidation(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0296011008322239 5607.80126953125 935.6408 5607.83056640625 935.645751953125 6 27 1.1.1.5413.5 1 63.0422 909.8954 63.0789 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0874862000346184 5608.77490234375 935.8031 5608.8623046875 935.817687988281 6 28 1.1.1.5413.6 1 63.0447 943.5746 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; Hex(N)@30; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.00468626990914345 5854.96826171875 976.8353 5854.97265625 976.836059570313 6 20 1.1.1.5413.7 1 63.0473 1044.047 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.037252701818943 5528.79931640625 922.4738 5528.83642578125 922.47998046875 6 30 1.1.1.5414.3 1 63.0638 5074.907 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Dioxidation(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0553612001240253 5561.86572265625 927.9849 5561.81005859375 927.975646972656 6 21 1.1.1.5414.4 1 63.0672 4711.45 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(P)@25; Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0380695983767509 5589.84326171875 932.6478 5589.80517578125 932.641418457031 6 17 1.1.1.5414.5 1 63.0705 1474.923 63.0789 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Methyl(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0154371997341514 5543.84765625 924.9819 5543.83251953125 924.979370117188 6 21 1.1.1.5415.2 1 63.0836 7910.644 63.0789 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0530139990150929 5594.82666015625 933.4784 5594.8798828125 933.487243652344 6 24 1.1.1.5415.3 1 63.0861 882.5603 63.0789 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] GlnThrGlyGly(K)@20; Hex(N)@34 missed K-I@20; missed K-L@40 0.00411880994215608 6006.01025390625 1002.009 6006.0068359375 1002.00842285156 6 17 1.1.1.5415.4 1 63.0886 360.7512 63.1034 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0260661002248526 5528.80859375 1106.769 5528.83642578125 1106.77453613281 5 29 1.1.1.5415.5 1 63.0911 2725.964 63.0789 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0213792994618416 5542.82861328125 1109.573 5542.85205078125 1109.57763671875 5 23 1.1.1.5415.6 1 63.0945 6225.25 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0227956008166075 5556.84326171875 1112.376 5556.86767578125 1112.38073730469 5 50 1.1.1.5415.7 1 63.0978 60116.48 63.0789 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0453401990234852 5556.8193359375 794.8386 5556.8642578125 794.845031738281 7 31 1.1.1.5416.3 1 63.109 21625.4 63.0789 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0461483001708984 5542.8056640625 924.8082 5542.85205078125 924.81591796875 6 25 1.1.1.5416.4 1 63.1107 11265.48 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Oxidation(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0293454006314278 5572.830078125 929.8123 5572.85888671875 929.817138671875 6 30 1.1.1.5416.5 1 63.1124 6764.025 63.0789 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Cation:K(E)@13; acrolein addition +112(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00285505992360413 5836.97802734375 973.837 5836.97509765625 973.836486816406 6 27 1.1.1.5416.6 1 63.1149 386.9277 63.1034 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0213792994618416 5542.82861328125 1109.573 5542.85205078125 1109.57763671875 5 29 1.1.1.5416.8 1 63.1199 6225.25 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; Hex(N)@30; Deamidated(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0424947999417782 5932.05322265625 1187.418 5932.00927734375 1187.40905761719 5 16 1.1.1.5416.9 1 63.1224 2680.19 63.1034 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0140775004401803 5585.8603515625 931.984 5585.8466796875 931.981689453125 6 24 1.1.1.5417.4 1 63.1372 2195.94 63.1754 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0859498009085655 5780.9228515625 964.4944 5781.0087890625 964.508728027344 6 25 1.1.1.5417.5 1 63.1397 369.4375 63.0789 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Phospho(T)@31; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.011812400072813 5933.02099609375 989.8441 5933.03271484375 989.846069335938 6 17 1.1.1.5417.6 1 63.143 7071.022 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0274717006832361 5542.82421875 924.8113 5542.85205078125 924.81591796875 6 36 1.1.1.5418.2 1 63.157 9694.963 63.1754 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.03446089848876 5556.830078125 927.1456 5556.8642578125 927.151306152344 6 41 1.1.1.5418.3 1 63.1603 99883.27 63.1754 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0101779000833631 5571.83349609375 1115.374 5571.841796875 1115.37573242188 5 18 1.1.1.5418.5 1 63.167 1993.293 63.1515 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00144619005732238 5556.830078125 927.1456 5556.8310546875 927.145812988281 6 22 1.1.1.5419.2 1 63.1811 99883.27 63.1754 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0361539982259274 5528.7998046875 922.4739 5528.83642578125 922.47998046875 6 38 1.1.1.5421.3 1 63.2366 4554.135 63.1754 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dioxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0553612001240253 5561.86572265625 927.9849 5561.81005859375 927.975646972656 6 24 1.1.1.5422.3 1 63.2541 4711.45 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0349841006100178 5573.857421875 929.9835 5573.82177734375 929.977600097656 6 22 1.1.1.5422.4 1 63.2566 5572.349 63.0789 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0133392000570893 5582.83349609375 931.4795 5582.8466796875 931.481750488281 6 22 1.1.1.5422.5 1 63.2591 1584.074 63.2476 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0324608981609344 5528.79833984375 1106.767 5528.8330078125 1106.77380371094 5 25 1.1.1.5422.7 1 63.2641 2391.364 63.1754 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0240163002163172 5556.84326171875 1112.376 5556.86767578125 1112.38073730469 5 48 1.1.1.5422.8 1 63.2666 52826.34 63.1754 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0466219000518322 5556.81787109375 794.8384 5556.8642578125 794.845031738281 7 34 1.1.1.5423.2 1 63.276 19342.7 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0014465800486505 5541.818359375 924.6437 5541.8203125 924.643981933594 6 26 1.1.1.5423.3 1 63.2776 7022.296 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00938965007662773 5572.83203125 929.8126 5572.84130859375 929.814147949219 6 26 1.1.1.5423.4 1 63.2793 4427.379 63.32 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@28; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0119722997769713 5588.833984375 932.4796 5588.84619140625 932.481628417969 6 23 1.1.1.5423.5 1 63.281 1643.93 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; GlnThrGlyGly(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00354565004818141 5872.962890625 979.8344 5872.9658203125 979.8349609375 6 26 1.1.1.5423.7 1 63.2843 1014.02 63.32 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0111130997538567 5541.83349609375 1109.374 5541.8203125 1109.37133789063 5 22 1.1.1.5423.9 1 63.2885 3300.026 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Hex(N)@26; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.00723777990788221 5933.03369140625 989.8462 5933.041015625 989.847412109375 6 18 1.1.1.5424.3 1 63.3091 3730.708 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0359257012605667 5556.828125 927.1453 5556.8642578125 927.151306152344 6 40 1.1.1.5425.2 1 63.3265 92545.45 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Oxidation(H)@24; Dethiomethyl(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0244038999080658 5572.83349609375 1115.574 5572.85888671875 1115.5791015625 5 24 1.1.1.5425.4 1 63.3348 2270.14 63.32 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.021865900605917 5586.85888671875 1118.379 5586.8779296875 1118.38293457031 5 19 1.1.1.5425.5 1 63.339 955.205 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Lys->Allysine(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00565944984555244 5527.79541015625 922.3065 5527.80126953125 922.307495117188 6 22 1.1.1.5426.2 1 63.3513 3048.836 63.32 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0246267002075911 5556.84326171875 1112.376 5556.86767578125 1112.38073730469 5 30 1.1.1.5426.4 1 63.363 49826.91 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0188382007181644 5585.865234375 931.9848 5585.8466796875 931.981689453125 6 23 1.1.1.5427.2 1 63.3759 2184.031 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0219896994531155 5542.82861328125 1109.573 5542.85205078125 1109.57763671875 5 27 1.1.1.5427.4 1 63.3876 4720.706 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0401822999119759 5528.79638671875 922.4733 5528.83642578125 922.47998046875 6 35 1.1.1.5428.4 1 63.4024 3613.847 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0163912996649742 5544.81494140625 925.1431 5544.8310546875 925.145812988281 6 21 1.1.1.5428.5 1 63.4049 3884.62 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.017781799659133 5573.83984375 797.2701 5573.82177734375 797.267578125 7 23 1.1.1.5429.2 1 63.4215 1387.214 63.1754 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00144619005732238 5556.830078125 927.1456 5556.8310546875 927.145812988281 6 21 1.1.1.5429.4 1 63.4265 79994.49 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0254558008164167 5528.80859375 1106.769 5528.83642578125 1106.77453613281 5 22 1.1.1.5429.6 1 63.4323 1803.495 63.4412 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0227956008166075 5556.84326171875 1112.376 5556.86767578125 1112.38073730469 5 49 1.1.1.5429.7 1 63.4357 41854.86 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0102356001734734 5541.81005859375 924.6423 5541.8203125 924.643981933594 6 24 1.1.1.5430.2 1 63.446 6956.337 63.4653 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Oxidation(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0293454006314278 5572.830078125 929.8123 5572.85888671875 929.817138671875 6 32 1.1.1.5430.3 1 63.4485 5853.463 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00931094959378242 5582.837890625 931.4802 5582.8466796875 931.481750488281 6 22 1.1.1.5430.4 1 63.451 1331.822 63.4412 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0168306995183229 5540.81884765625 1109.171 5540.83642578125 1109.17456054688 5 20 1.1.1.5430.6 1 63.4569 2391.971 63.4893 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0466219000518322 5556.81787109375 794.8384 5556.8642578125 794.845031738281 7 30 1.1.1.5431.3 1 63.4742 16396.33 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00364250992424786 5571.83837890625 929.647 5571.841796875 929.647583007813 6 26 1.1.1.5431.4 1 63.4776 3689.419 63.4166 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0376138016581535 5540.794921875 924.4731 5540.8330078125 924.479431152344 6 21 1.1.1.5432.2 1 63.4941 4857.947 63.4893 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.03446089848876 5556.830078125 927.1456 5556.8642578125 927.151306152344 6 41 1.1.1.5432.3 1 63.4966 79994.49 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; GlnThrGlyGly(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00794016011059284 5872.9580078125 979.8336 5872.9658203125 979.8349609375 6 24 1.1.1.5432.6 1 63.5049 1065.75 63.4412 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0298931002616882 5541.80322265625 792.6934 5541.7724609375 792.689086914063 7 18 1.1.1.5433.2 1 63.5174 1500.586 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.011586899869144 5572.830078125 929.8123 5572.84130859375 929.814147949219 6 24 1.1.1.5433.4 1 63.5207 5853.463 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0368307009339333 5571.83349609375 1115.374 5571.79443359375 1115.3662109375 5 15 1.1.1.5433.10 1 63.5324 2069.538 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0261988993734121 5583.85693359375 931.6501 5583.83056640625 931.645751953125 6 27 1.1.1.5434.3 1 63.5481 1724.639 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0401822999119759 5528.79638671875 922.4733 5528.83642578125 922.47998046875 6 33 1.1.1.5435.3 1 63.5703 3613.847 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@26; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0372283011674881 5587.82470703125 932.3114 5587.8623046875 932.317626953125 6 23 1.1.1.5435.4 1 63.5737 2117.392 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00219089002348483 5585.84375 1118.176 5585.8466796875 1118.17651367188 5 18 1.1.1.5435.6 1 63.5803 954.7899 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0214018002152443 5572.81982421875 797.1244 5572.84130859375 797.12744140625 7 28 1.1.1.5436.2 1 63.591 1179.613 63.6095 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0227956008166075 5556.84326171875 1112.376 5556.86767578125 1112.38073730469 5 44 1.1.1.5436.5 1 63.601 41854.86 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Lys->Allysine(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00605922983959317 5527.80712890625 922.3085 5527.80126953125 922.307495117188 6 22 1.1.1.5437.3 1 63.6159 2362.578 63.6335 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0358944982290268 5542.8154296875 924.8099 5542.85205078125 924.81591796875 6 32 1.1.1.5437.4 1 63.6185 7289.394 63.6095 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Oxidation(D)@35; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0293454006314278 5572.830078125 929.8123 5572.85888671875 929.817138671875 6 33 1.1.1.5437.5 1 63.621 5000.44 63.5854 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0138590997084975 5528.8232421875 1106.772 5528.83642578125 1106.77453613281 5 25 1.1.1.5437.7 1 63.626 1581.278 63.6095 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Phospho(T)@31; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.00741787999868393 5933.02490234375 989.8448 5933.03271484375 989.846069335938 6 19 1.1.1.5438.4 1 63.6434 1981.961 63.6335 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.000714163994416595 5541.81982421875 924.6439 5541.8203125 924.643981933594 6 24 1.1.1.5439.3 1 63.6665 6962.067 63.6095 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0340946987271309 5556.830078125 927.1456 5556.8642578125 927.151306152344 6 39 1.1.1.5439.5 1 63.6732 70621.7 63.6335 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; GlnThrGlyGly(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0192926004528999 5872.94677734375 979.8317 5872.9658203125 979.8349609375 6 25 1.1.1.5439.6 1 63.6765 1000.258 63.6335 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0461946986615658 5556.81787109375 794.8384 5556.8642578125 794.845031738281 7 34 1.1.1.5440.3 1 63.6922 14314.39 63.6335 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.020906500518322 5605.83056640625 935.3124 5605.8515625 935.315856933594 6 25 1.1.1.5440.4 1 63.6963 756.07 63.4893 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00481433002278209 5572.83837890625 1115.575 5572.84130859375 1115.57556152344 5 19 1.1.1.5440.5 1 63.7005 2970.612 63.4893 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0168260000646114 5571.8251953125 929.6448 5571.841796875 929.647583007813 6 25 1.1.1.5441.3 1 63.7187 2327.946 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0409146994352341 5528.794921875 922.4731 5528.83642578125 922.47998046875 6 32 1.1.1.5442.2 1 63.7355 2659.956 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Ammonia-loss(N)@17; MDA adduct +62(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0342517010867596 5573.85595703125 929.9833 5573.82177734375 929.977600097656 6 24 1.1.1.5442.3 1 63.7389 2795.149 63.7299 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00898130983114243 5584.853515625 931.8162 5584.8623046875 931.817687988281 6 25 1.1.1.5442.4 1 63.7422 1547.668 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0188143998384476 5556.84326171875 1112.376 5556.8642578125 1112.38012695313 5 43 1.1.1.5443.4 1 63.7687 32606.27 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0108545003458858 5572.83056640625 929.8124 5572.84130859375 929.814147949219 6 28 1.1.1.5444.2 1 63.782 3308.902 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +56(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0115016000345349 5586.841796875 932.1476 5586.83056640625 932.145690917969 6 25 1.1.1.5444.3 1 63.7837 1467.974 63.778 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0129297003149986 5528.818359375 1106.771 5528.8330078125 1106.77380371094 5 19 1.1.1.5444.9 1 63.7945 1470.749 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00369427003897727 5540.82861328125 1109.173 5540.8330078125 1109.173828125 5 19 1.1.1.5444.10 1 63.797 1974.574 63.778 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00572079978883266 5584.8583984375 1117.979 5584.8623046875 1117.97973632813 5 16 1.1.1.5445.4 1 63.8144 659.6966 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Carbamidomethyl(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0386907011270523 5932.033203125 1187.414 5932.072265625 1187.42175292969 5 16 1.1.1.5445.5 1 63.8177 712.1129 63.778 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.00448771007359028 5541.82177734375 924.6442 5541.81689453125 924.643432617188 6 22 1.1.1.5446.2 1 63.8368 5912.635 63.8808 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0340946987271309 5556.830078125 927.1456 5556.8642578125 927.151306152344 6 41 1.1.1.5446.3 1 63.8451 70621.7 63.6335 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0359086990356445 5604.83154296875 935.1459 5604.86767578125 935.15185546875 6 25 1.1.1.5447.4 1 63.8657 647.0071 63.8808 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Dehydrated(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00847642030566931 5572.83349609375 1115.574 5572.84130859375 1115.57556152344 5 22 1.1.1.5447.8 1 63.8757 2090.636 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0153162004426122 5556.8154296875 794.8381 5556.8310546875 794.840270996094 7 33 1.1.1.5448.3 1 63.8865 11940.73 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0477457009255886 5561.85400390625 927.983 5561.806640625 927.975036621094 6 16 1.1.1.5448.4 1 63.8881 2840.283 63.8021 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0169184003025293 5541.7998046875 792.693 5541.81689453125 792.695373535156 7 21 1.1.1.5449.2 1 63.9091 1072.057 63.8808 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24 missed K-I@20; missed K-L@40 -0.00865153037011623 5526.81201171875 922.1426 5526.8203125 922.14404296875 6 19 1.1.1.5449.4 1 63.9124 1179.611 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00165712996385992 5584.86083984375 931.8174 5584.8623046875 931.817687988281 6 25 1.1.1.5449.5 1 63.9141 1574.975 63.8808 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0415915995836258 5609.7685546875 935.9687 5609.81005859375 935.975646972656 6 15 1.1.1.5449.6 1 63.9157 696.3292 63.9292 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.112744003534317 5854.96875 976.8354 5855.08203125 976.854248046875 6 16 1.1.1.5449.10 1 63.9224 778.6862 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0160936005413532 5571.82666015625 929.645 5571.841796875 929.647583007813 6 29 1.1.1.5450.4 1 63.9381 2537.207 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Ammonia-loss(N)@34 missed K-I@20; missed K-L@40 -0.00048353400779888 5541.818359375 1109.371 5541.8203125 1109.37133789063 5 18 1.1.1.5450.6 1 63.9431 3066.262 63.8567 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0240163002163172 5556.84326171875 1112.376 5556.86767578125 1112.38073730469 5 44 1.1.1.5450.7 1 63.9456 30383.97 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Methyl(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0477822013199329 5580.81640625 931.1433 5580.8642578125 931.151306152344 6 20 1.1.1.5451.3 1 63.9621 912.9473 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0184767004102468 5598.8232421875 934.1445 5598.841796875 934.147583007813 6 23 1.1.1.5451.4 1 63.9654 813.2832 63.8808 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Pro->pyro-Glu(P)@25; Methyl(D)@35 missed K-I@20; missed K-L@40 0.0200849995017052 5528.818359375 1106.771 5528.7998046875 1106.76721191406 5 24 1.1.1.5451.5 1 63.9687 1470.749 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Methyl(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0132400002330542 5543.84619140625 924.9816 5543.83251953125 924.979370117188 6 20 1.1.1.5452.3 1 63.9828 4478.479 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Ammonia-loss(N)@17; MDA adduct +62(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0360828004777431 5573.85791015625 929.9836 5573.82177734375 929.977600097656 6 24 1.1.1.5452.4 1 63.9844 2525.428 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Dioxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.00209164991974831 5595.79638671875 933.64 5595.79443359375 933.6396484375 6 18 1.1.1.5452.5 1 63.9861 560.2747 63.8808 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0218090005218983 5600.8359375 934.4799 5600.857421875 934.483520507813 6 20 1.1.1.5452.6 1 63.9878 629.2426 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.00448771007359028 5541.82177734375 924.6442 5541.81689453125 924.643432617188 6 22 1.1.1.5453.2 1 64.0118 5912.635 63.8808 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.03446089848876 5556.830078125 927.1456 5556.8642578125 927.151306152344 6 40 1.1.1.5453.3 1 64.0202 60747.38 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dioxidation(F)@15; acrolein addition +56(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0370263010263443 5774.94580078125 963.4982 5774.98291015625 963.504455566406 6 28 1.1.1.5454.3 1 64.0374 557.3434 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; HexNAc(N)@28; Oxidation(M)@37 missed K-I@20; missed K-L@40 -0.0225588995963335 5873.95556640625 979.9999 5873.978515625 980.003723144531 6 17 1.1.1.5454.4 1 64.0399 681.9373 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0950030013918877 5988.97216796875 999.1693 5989.06689453125 999.185119628906 6 19 1.1.1.5454.6 1 64.0457 914.4465 64.1995 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.01183329988271 5603.86865234375 934.9854 5603.85693359375 934.983459472656 6 21 1.1.1.5455.3 1 64.06 397.2719 64.0301 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0536178015172482 5627.83984375 938.9806 5627.8935546875 938.989501953125 6 20 1.1.1.5455.4 1 64.0617 462.1473 63.9532 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Oxidation(M)@37; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.106518998742104 5870.97021484375 979.5023 5871.07666015625 979.520080566406 6 17 1.1.1.5455.8 1 64.0683 444.9034 63.8808 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0409146994352341 5528.794921875 922.4731 5528.83642578125 922.47998046875 6 23 1.1.1.5456.3 1 64.0842 2582.895 63.8261 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0302636008709669 5572.81103515625 929.8091 5572.84130859375 929.814147949219 6 27 1.1.1.5456.4 1 64.0859 2891.798 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.113476999104023 5854.96826171875 976.8353 5855.08203125 976.854248046875 6 19 1.1.1.5456.5 1 64.0876 738.7244 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0461946986615658 5556.81787109375 794.8384 5556.8642578125 794.845031738281 7 28 1.1.1.5457.3 1 64.1083 8930.016 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00291102007031441 5556.828125 927.1453 5556.8310546875 927.145812988281 6 21 1.1.1.5457.4 1 64.11 45459.32 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00016813499678392 5583.83056640625 931.6457 5583.83056640625 931.645751953125 6 23 1.1.1.5457.5 1 64.1116 1126.445 64.0784 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0415915995836258 5609.7685546875 935.9687 5609.81005859375 935.975646972656 6 16 1.1.1.5457.6 1 64.1142 550.2146 64.1269 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0221852995455265 5556.84326171875 1112.376 5556.86767578125 1112.38073730469 5 44 1.1.1.5457.9 1 64.1217 23515.82 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Hex(N)@17; acrolein addition +56(K)@20; reduced HNE(H)@24; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.0174915995448828 5933.0234375 989.8445 5933.041015625 989.847412109375 6 21 1.1.1.5459.5 1 64.1635 787.1157 64.1753 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +76(K)@20; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.00431377999484539 5578.80859375 797.9799 5578.80419921875 797.979309082031 7 19 1.1.1.5460.3 1 64.182 625.217 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00148308998905122 5541.82177734375 924.6442 5541.8203125 924.643981933594 6 25 1.1.1.5460.4 1 64.1845 5481.188 63.9292 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0359257012605667 5556.828125 927.1453 5556.8642578125 927.151306152344 6 41 1.1.1.5460.5 1 64.187 45459.32 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@28; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0343111008405685 5588.8115234375 932.4759 5588.84619140625 932.481628417969 6 24 1.1.1.5460.6 1 64.1895 858.509 64.1753 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0728038996458054 5853.9775390625 976.6702 5854.05029296875 976.682312011719 6 18 1.1.1.5460.7 1 64.192 620.0949 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.0272457003593445 5773.96044921875 963.334 5773.98779296875 963.338562011719 6 18 1.1.1.5461.5 1 64.2112 407.5366 64.1753 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20 missed K-I@20; missed K-L@40 0.0121504003182054 5528.8134765625 1106.77 5528.7998046875 1106.76721191406 5 17 1.1.1.5461.6 1 64.2137 845.7901 64.2237 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0135898999869823 5556.84326171875 1112.376 5556.8310546875 1112.37353515625 5 28 1.1.1.5461.7 1 64.2162 25731.94 63.9532 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0349841006100178 5573.857421875 929.9835 5573.82177734375 929.977600097656 6 21 1.1.1.5462.3 1 64.2295 1992.071 64.1995 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0296954996883869 5605.82177734375 935.3109 5605.8515625 935.315856933594 6 21 1.1.1.5462.5 1 64.2329 438.1077 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; reduced acrolein addition +96(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0202686991542578 5626.841796875 938.8142 5626.86181640625 938.817565917969 6 20 1.1.1.5462.6 1 64.2345 398.4249 64.0784 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Oxidation(M)@37; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0980669036507607 5822.884765625 971.4881 5822.98291015625 971.504455566406 6 17 1.1.1.5462.7 1 64.2362 249.9069 64.0784 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] GlnThrGlyGly(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.018257200717926 5871.96728515625 979.6685 5871.9853515625 979.671508789063 6 24 1.1.1.5462.9 1 64.2395 386.0807 64.1995 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0950030013918877 5988.97216796875 999.1693 5989.06689453125 999.185119628906 6 17 1.1.1.5462.10 1 64.2412 914.4465 64.1995 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0390837006270885 5528.796875 922.4734 5528.83642578125 922.47998046875 6 31 1.1.1.5463.2 1 64.2529 2139.291 64.0012 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00975586008280516 5572.83203125 929.8126 5572.84130859375 929.814147949219 6 27 1.1.1.5463.3 1 64.2554 2630.908 64.151 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0793716013431549 5612.77783203125 936.4703 5612.857421875 936.483520507813 6 16 1.1.1.5463.4 1 64.2579 375.3506 64.151 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Oxidation(M)@37; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0681101009249687 5842.94140625 974.8308 5843.00927734375 974.842163085938 6 17 1.1.1.5463.6 1 64.2637 346.1569 64.1753 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0453401990234852 5556.8193359375 794.8386 5556.8642578125 794.845031738281 7 30 1.1.1.5464.3 1 64.2795 9037.693 64.0301 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0351620987057686 5542.81689453125 924.8101 5542.85205078125 924.81591796875 6 30 1.1.1.5464.4 1 64.282 4306.53 64.1995 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0221852995455265 5556.84326171875 1112.376 5556.86767578125 1112.38073730469 5 39 1.1.1.5464.7 1 64.2912 23461.19 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0130153996869922 5583.84375 931.6479 5583.83056640625 931.645751953125 6 21 1.1.1.5465.3 1 64.3037 1028.752 64.1753 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Phospho(T)@23; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0147219002246857 5609.7685546875 935.9687 5609.783203125 935.971130371094 6 21 1.1.1.5465.4 1 64.3062 550.2146 64.1269 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] GlnThrGlyGly(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00281323003582656 5872.96337890625 979.8345 5872.9658203125 979.8349609375 6 25 1.1.1.5465.5 1 64.3088 441.8148 64.1753 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0448262989521027 5540.83349609375 1109.174 5540.78857421875 1109.1650390625 5 15 1.1.1.5465.7 1 64.3154 1527.389 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dioxidation(P)@25; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0425438992679119 5561.8525390625 927.9827 5561.81005859375 927.975646972656 6 21 1.1.1.5466.2 1 64.3278 1660.674 64.442 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0137334996834397 5540.80224609375 792.5505 5540.78857421875 792.548522949219 7 16 1.1.1.5467.4 1 64.3505 536.5721 64.3446 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.00913697015494108 5541.8115234375 924.6425 5541.8203125 924.643981933594 6 23 1.1.1.5467.6 1 64.3538 3106.897 64.3932 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0333621986210346 5556.8310546875 927.1458 5556.8642578125 927.151306152344 6 37 1.1.1.5467.7 1 64.3555 29652.38 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0201586000621319 5542.83349609375 1109.574 5542.85205078125 1109.57763671875 5 19 1.1.1.5467.11 1 64.3622 1704.631 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24 missed K-I@20; missed K-L@40 -0.0495966002345085 5514.7705078125 920.1357 5514.8203125 920.14404296875 6 18 1.1.1.5468.7 1 64.3765 410.5752 64.3932 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; Deamidated(N)@34; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0152701996266842 5771.9873046875 963.0052 5771.97216796875 963.002624511719 6 16 1.1.1.5468.9 1 64.3781 242.6716 64.3932 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; Hex(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0370157994329929 5786.9833984375 965.5045 5786.94677734375 965.498352050781 6 21 1.1.1.5468.10 1 64.379 264.0591 64.151 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.110546998679638 5854.97119140625 976.8358 5855.08203125 976.854248046875 6 18 1.1.1.5468.12 1 64.3806 464.839 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Dethiomethyl(M)@37 missed K-I@20; missed K-L@40 -0.0196435991674662 5528.8134765625 1106.77 5528.8330078125 1106.77380371094 5 15 1.1.1.5468.16 1 64.384 825.1797 64.3932 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0279923006892204 5583.85888671875 1117.779 5583.83056640625 1117.7734375 5 14 1.1.1.5468.18 1 64.3856 317.4305 64.3446 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Hex(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0488968007266521 5844.9365234375 975.1633 5844.98486328125 975.171447753906 6 20 1.1.1.5469.4 1 64.3993 305.6567 64.4177 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0416471995413303 5528.79443359375 922.473 5528.83642578125 922.47998046875 6 28 1.1.1.5470.2 1 64.4219 1407.744 64.442 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00938965007662773 5572.83203125 929.8126 5572.84130859375 929.814147949219 6 21 1.1.1.5470.3 1 64.4236 1761.881 64.3932 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Oxidation(D)@35; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.027148200199008 5572.83203125 929.8126 5572.85888671875 929.817138671875 6 28 1.1.1.5470.4 1 64.4253 1761.881 64.3932 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0196605995297432 5603.837890625 934.9802 5603.85693359375 934.983459472656 6 21 1.1.1.5470.6 1 64.4294 289.411 64.3932 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Dethiomethyl(M)@37; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0338004007935524 5644.88232421875 941.821 5644.91650390625 941.826721191406 6 18 1.1.1.5470.7 1 64.4319 292.6388 64.442 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.113476999104023 5854.96826171875 976.8353 5855.08203125 976.854248046875 6 19 1.1.1.5470.9 1 64.4369 443.801 64.4664 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0474763996899128 5556.8173828125 794.8383 5556.8642578125 794.845031738281 7 30 1.1.1.5471.8 1 64.4563 5489.786 64.3446 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0221852995455265 5556.84326171875 1112.376 5556.86767578125 1112.38073730469 5 40 1.1.1.5471.11 1 64.4613 14957.01 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0440840981900692 5626.865234375 938.8182 5626.9091796875 938.825500488281 6 24 1.1.1.5472.5 1 64.4791 549.376 64.6382 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0918707028031349 5870.9853515625 979.5048 5871.07666015625 979.520080566406 6 17 1.1.1.5472.6 1 64.4825 265.4245 64.4664 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; MolybdopterinGD(D)@35; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0374093987047672 7247.8193359375 1036.41 7247.85888671875 1036.41564941406 7 19 1.1.1.5472.7 1 64.4858 705.0869 64.5399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0221647992730141 5584.84033203125 931.814 5584.8623046875 931.817687988281 6 25 1.1.1.5473.3 1 64.5018 880.9957 64.5399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@30; Formyl(K)@40 missed K-I@20; missed K-L@40 0.0335843004286289 5585.84375 1118.176 5585.81005859375 1118.16931152344 5 17 1.1.1.5473.5 1 64.5102 400.5182 64.5152 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.00744967022910714 5539.8154296875 924.3098 5539.822265625 924.310974121094 6 22 1.1.1.5474.9 1 64.5281 1635.125 64.5642 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0333621986210346 5556.8310546875 927.1458 5556.8642578125 927.151306152344 6 33 1.1.1.5474.10 1 64.5298 29652.38 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0331531018018723 5573.85546875 929.9832 5573.82177734375 929.977600097656 6 22 1.1.1.5474.11 1 64.5315 1514.944 64.5642 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0341655015945435 5541.806640625 792.694 5541.7724609375 792.689086914063 7 17 1.1.1.5475.5 1 64.5492 504.4368 64.5399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@26; Methyl(D)@35 missed K-I@20; missed K-L@40 -0.0206787008792162 5515.7841796875 920.3046 5515.8046875 920.308044433594 6 28 1.1.1.5475.7 1 64.5542 785.5763 64.6382 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0479352995753288 5784.9921875 965.1726 5785.0400390625 965.180603027344 6 21 1.1.1.5475.8 1 64.5567 213.6172 64.3446 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0267392992973328 5542.82568359375 924.8115 5542.85205078125 924.81591796875 6 27 1.1.1.5476.5 1 64.5706 3099.743 64.5642 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Dethiomethyl(M)@37 missed K-I@20; missed K-L@40 -0.030629800632596 5528.80322265625 1106.768 5528.8330078125 1106.77380371094 5 14 1.1.1.5476.17 1 64.5806 1332.945 64.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@30 missed K-I@20; missed K-L@40 0.00681070005521178 5529.7900390625 922.639 5529.78369140625 922.637939453125 6 25 1.1.1.5477.3 1 64.5952 4972.415 64.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0333621986210346 5556.8310546875 927.1458 5556.8642578125 927.151306152344 6 30 1.1.1.5477.4 1 64.5969 30063.89 64.3446 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0104882996529341 5572.83056640625 929.8124 5572.84130859375 929.814147949219 6 28 1.1.1.5477.5 1 64.5985 1530.855 64.6136 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0298290997743607 5598.81201171875 934.1426 5598.841796875 934.147583007813 6 22 1.1.1.5477.6 1 64.6002 420.2775 64.6136 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0326329991221428 5601.85302734375 934.6494 5601.8203125 934.643981933594 6 16 1.1.1.5477.7 1 64.6019 328.9154 64.5399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.113476999104023 5854.96826171875 976.8353 5855.08203125 976.854248046875 6 15 1.1.1.5477.10 1 64.6085 418.4716 64.589 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0453401990234852 5556.8193359375 794.8386 5556.8642578125 794.845031738281 7 29 1.1.1.5478.8 1 64.6231 5379.232 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Cation:Na(E)@13; acrolein addition +94(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0227489992976189 5644.88232421875 941.821 5644.85986328125 941.817260742188 6 23 1.1.1.5478.10 1 64.6264 460.4686 64.6631 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0142507003620267 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 36 1.1.1.5478.14 1 64.6331 14833.98 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0815209001302719 5856.97900390625 977.1705 5857.06103515625 977.184143066406 6 22 1.1.1.5479.6 1 64.653 417.681 64.6136 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0250944998115301 5584.83740234375 931.8135 5584.8623046875 931.817687988281 6 24 1.1.1.5480.2 1 64.6708 793.131 64.6631 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0290695000439882 5626.88037109375 938.8207 5626.9091796875 938.825500488281 6 26 1.1.1.5480.3 1 64.6767 572.1633 64.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Deamidated(N)@17; reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0373889990150929 5588.80859375 1118.769 5588.84619140625 1118.77648925781 5 18 1.1.1.5480.4 1 64.6825 337.0692 64.6382 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Formyl(K)@40 missed K-I@20; missed K-L@40 0.00416800985112786 5529.7880859375 790.977 5529.78369140625 790.976379394531 7 22 1.1.1.5481.4 1 64.6956 844.2281 64.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0362607017159462 5542.8154296875 924.8099 5542.85205078125 924.81591796875 6 29 1.1.1.5481.7 1 64.7006 4791.098 64.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0161629002541304 5557.83203125 927.3126 5557.84814453125 927.315307617188 6 38 1.1.1.5481.8 1 64.7022 36216.98 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@34; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0470646992325783 5645.8935546875 941.9895 5645.8466796875 941.981689453125 6 15 1.1.1.5482.7 1 64.7256 353.2538 64.6876 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0241132993251085 5543.80810546875 924.9753 5543.83251953125 924.979370117188 6 30 1.1.1.5483.3 1 64.7437 7198.127 64.7373 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; GlnThrGlyGly(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0192926004528999 5872.94677734375 979.8317 5872.9658203125 979.8349609375 6 25 1.1.1.5483.4 1 64.7454 341.7208 64.7869 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(Q)@14; HPNE addition +172(K)@20; HexNAc(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0490961000323296 5988.98193359375 999.1709 5989.03076171875 999.179077148438 6 17 1.1.1.5483.6 1 64.7496 459.5844 64.5399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Deamidated(N)@28; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0103292996063828 5529.80859375 1106.969 5529.8203125 1106.97131347656 5 30 1.1.1.5483.8 1 64.7546 2440.83 64.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0262039992958307 5529.7900390625 922.639 5529.81689453125 922.643432617188 6 36 1.1.1.5484.2 1 64.7668 4972.415 64.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0432762987911701 5561.85302734375 927.9828 5561.81005859375 927.975646972656 6 20 1.1.1.5484.3 1 64.7685 3305.583 64.836 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0200097002089024 5572.82177734375 929.8109 5572.84130859375 929.814147949219 6 23 1.1.1.5484.4 1 64.7702 1845.181 64.836 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0056874300353229 5573.82763671875 929.9786 5573.82177734375 929.977600097656 6 21 1.1.1.5484.5 1 64.7718 2411.154 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00506890006363392 5543.8046875 792.9794 5543.79931640625 792.978637695313 7 25 1.1.1.5485.2 1 64.7914 1287.24 64.7373 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0317439995706081 5557.81640625 794.9811 5557.84814453125 794.985595703125 7 33 1.1.1.5485.3 1 64.793 8438.042 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00913138035684824 5579.79052734375 798.1202 5579.79931640625 798.121459960938 7 18 1.1.1.5485.4 1 64.7947 614.277 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Methyl(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0712196007370949 5580.79296875 931.1394 5580.8642578125 931.151306152344 6 20 1.1.1.5485.5 1 64.7964 753.486 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(Q)@14; Delta:H(2)C(2)(H)@24; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.00926372967660427 5589.82958984375 932.6455 5589.8203125 932.643981933594 6 19 1.1.1.5485.6 1 64.798 774.072 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Oxidation(P)@25; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0129319997504354 5603.8701171875 934.9856 5603.85693359375 934.983459472656 6 19 1.1.1.5485.7 1 64.7997 362.6969 64.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0723771974444389 5610.76953125 936.1355 5610.841796875 936.147583007813 6 16 1.1.1.5485.8 1 64.8014 544.4308 64.836 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; HexNAc(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.056097399443388 5927.93310546875 988.9961 5927.9892578125 989.005493164063 6 16 1.1.1.5485.10 1 64.8047 215.2447 64.8115 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0018569000530988 5557.8486328125 1112.577 5557.84814453125 1112.57690429688 5 36 1.1.1.5485.11 1 64.8064 18959.04 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Cation:K(E)@13; acrolein addition +112(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00300428993068635 5836.97216796875 973.836 5836.97509765625 973.836486816406 6 25 1.1.1.5486.4 1 64.8176 290.252 64.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Deamidated(N)@28; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0922482013702393 5855.97412109375 977.0029 5856.06591796875 977.018249511719 6 20 1.1.1.5486.5 1 64.8193 699.0856 64.836 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; reduced HNE(H)@24; Hex(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.023496700450778 5935.01171875 990.1759 5935.03515625 990.179809570313 6 16 1.1.1.5486.6 1 64.821 351.4324 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00118211994413286 5514.8154296875 920.1432 5514.8173828125 920.143493652344 6 16 1.1.1.5487.3 1 64.8422 227.519 64.8115 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0290695000439882 5626.88037109375 938.8207 5626.9091796875 938.825500488281 6 22 1.1.1.5487.4 1 64.8439 572.1633 64.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; Deamidated(N)@34; Oxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.0251544006168842 5787.9921875 965.6726 5787.966796875 965.66845703125 6 17 1.1.1.5487.6 1 64.8472 203.0707 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.105715997517109 5850.9443359375 976.1647 5851.05078125 976.182373046875 6 16 1.1.1.5487.7 1 64.8489 241.0186 64.8115 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; Iodo(H)@24; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.03306769952178 5894.90234375 983.491 5894.869140625 983.485473632813 6 16 1.1.1.5487.8 1 64.8506 270.4326 64.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; HexNAc(N)@26; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.0626379027962685 5971.9892578125 996.3388 5972.0517578125 996.349243164063 6 16 1.1.1.5487.9 1 64.8522 314.3281 64.9338 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.00189634005073458 5573.81201171875 797.2661 5573.81005859375 797.265869140625 7 19 1.1.1.5488.6 1 64.8675 656.2366 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0401822999119759 5528.79638671875 922.4733 5528.83642578125 922.47998046875 6 20 1.1.1.5488.8 1 64.8692 2306.493 64.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00890133995562792 5543.80810546875 924.9753 5543.79931640625 924.973876953125 6 25 1.1.1.5488.9 1 64.87 7198.127 64.7373 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0161629002541304 5557.83203125 927.3126 5557.84814453125 927.315307617188 6 21 1.1.1.5488.10 1 64.8708 36216.98 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0161629002541304 5557.83203125 927.3126 5557.84814453125 927.315307617188 6 39 1.1.1.5488.11 1 64.8717 36216.98 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00126013997942209 5585.84765625 931.9819 5585.8466796875 931.981689453125 6 20 1.1.1.5488.12 1 64.8725 890.3624 65.007 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.078471302986145 5624.8154296875 938.4765 5624.8935546875 938.489562988281 6 15 1.1.1.5488.13 1 64.8733 265.1813 64.836 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; reduced HNE(H)@24; Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0298960991203785 5779.947265625 964.3318 5779.97705078125 964.336791992188 6 15 1.1.1.5488.15 1 64.875 185.6965 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0248048007488251 5781.9677734375 964.6686 5781.99267578125 964.672729492188 6 17 1.1.1.5488.16 1 64.8758 179.9446 64.9095 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0192291997373104 5542.82861328125 1109.573 5542.8486328125 1109.57702636719 5 17 1.1.1.5488.20 1 64.8792 2258.086 64.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; Hex(N)@28; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0799921005964279 5972.9921875 996.506 5973.072265625 996.519287109375 6 18 1.1.1.5489.7 1 64.9044 402.3883 64.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0241132993251085 5543.80810546875 924.9753 5543.83251953125 924.979370117188 6 31 1.1.1.5490.2 1 64.9162 7198.127 64.7373 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; MDA adduct +54(K)@20; Dethiomethyl(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0466471016407013 5561.85302734375 927.9828 5561.806640625 927.975036621094 6 16 1.1.1.5490.3 1 64.9204 3305.583 64.836 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] GlnThrGlyGly(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0200883001089096 5871.9658203125 979.6682 5871.9853515625 979.671508789063 6 26 1.1.1.5490.4 1 64.9245 319.4785 64.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@40 missed K-I@20; missed K-L@40 0.00238484004512429 5528.80322265625 1106.768 5528.7998046875 1106.76721191406 5 19 1.1.1.5490.5 1 64.9287 1332.945 64.7123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +58(K)@20; reduced HNE(H)@24; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.0109826996922493 5812.01416015625 969.6763 5812.00341796875 969.674499511719 6 18 1.1.1.5491.3 1 64.9414 205.0712 64.9581 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0961683019995689 5840.97021484375 974.5023 5841.06640625 974.518310546875 6 26 1.1.1.5491.4 1 64.9439 277.97 64.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.122571997344494 5874.94970703125 980.1655 5875.07177734375 980.185913085938 6 26 1.1.1.5491.5 1 64.9464 376.6317 64.9581 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; HexNAc(N)@34; Oxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0795146971940994 5989.9833984375 999.3378 5990.0625 999.351013183594 6 16 1.1.1.5491.7 1 64.9531 384.6436 64.7869 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0317439995706081 5557.81640625 794.9811 5557.84814453125 794.985595703125 7 32 1.1.1.5492.3 1 64.9656 8438.042 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0192773006856442 5572.822265625 929.811 5572.84130859375 929.814147949219 6 23 1.1.1.5492.4 1 64.9681 1594.735 64.9338 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Deamidated(N)@28; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00517182983458042 5606.83056640625 935.479 5606.83544921875 935.479858398438 6 25 1.1.1.5492.6 1 64.974 299.9177 64.9338 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0018569000530988 5557.8486328125 1112.577 5557.84814453125 1112.57690429688 5 42 1.1.1.5492.7 1 64.9773 18959.04 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@28; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0218844003975391 5529.79833984375 922.6403 5529.8203125 922.643981933594 6 23 1.1.1.5493.3 1 64.9868 3976.052 64.7373 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; HexNAc(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0163666997104883 5835.95849609375 973.667 5835.94189453125 973.664245605469 6 16 1.1.1.5493.7 1 64.9935 244.0241 64.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.112744003534317 5854.96875 976.8354 5855.08203125 976.854248046875 6 18 1.1.1.5493.8 1 64.9952 498.1056 64.9826 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0196605995297432 5603.837890625 934.9802 5603.85693359375 934.983459472656 6 22 1.1.1.5494.3 1 65.026 328.9273 64.9338 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.00189634005073458 5573.81201171875 797.2661 5573.81005859375 797.265869140625 7 20 1.1.1.5495.6 1 65.0378 656.2366 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0126924999058247 5542.80224609375 924.8077 5542.8154296875 924.809875488281 6 21 1.1.1.5495.8 1 65.0394 3067.814 64.7869 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0161629002541304 5557.83203125 927.3126 5557.84814453125 927.315307617188 6 36 1.1.1.5495.9 1 65.0403 36216.98 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; reduced HNE(H)@24; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0364791005849838 5794.95166015625 966.8325 5794.98779296875 966.838623046875 6 25 1.1.1.5495.10 1 65.0419 226.0618 65.007 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; HPNE addition +172(K)@20; reduced HNE(H)@24; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0354509986937046 5886.0048828125 982.0081 5886.0400390625 982.013977050781 6 16 1.1.1.5495.11 1 65.0436 168.6371 65.007 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; Iodo(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0235111005604267 5896.908203125 983.8253 5896.884765625 983.821411132813 6 17 1.1.1.5495.12 1 65.0453 244.2472 64.9826 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.000541880028322339 5572.83837890625 1115.575 5572.84130859375 1115.57556152344 5 18 1.1.1.5495.14 1 65.0486 937.7746 64.836 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0635882019996643 5610.7783203125 936.137 5610.841796875 936.147583007813 6 17 1.1.1.5496.3 1 65.0613 547.9466 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0397018007934093 5627.85400390625 938.9829 5627.8935546875 938.989501953125 6 16 1.1.1.5496.4 1 65.0629 335.6841 64.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0464112013578415 5781.9462890625 964.665 5781.99267578125 964.672729492188 6 21 1.1.1.5496.5 1 65.0646 155.8479 65.0553 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; Dicarbamidomethyl(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0830956026911736 5928.95263671875 989.1661 5929.0361328125 989.179931640625 6 18 1.1.1.5496.8 1 65.0696 170.6817 64.9581 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; HexNAc(N)@30; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0714616999030113 5973.99609375 996.6733 5974.0673828125 996.685180664063 6 18 1.1.1.5496.9 1 65.0721 411.4948 65.0553 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00126013997942209 5585.84765625 931.9819 5585.8466796875 931.981689453125 6 23 1.1.1.5497.2 1 65.0905 890.3624 65.007 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Deamidated(N)@30; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.042408999055624 5870.0029296875 979.3411 5870.04541015625 979.34814453125 6 18 1.1.1.5497.3 1 65.0988 216.5559 64.9826 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0148146003484726 5598.82666015625 934.1451 5598.841796875 934.147583007813 6 23 1.1.1.5498.5 1 65.1197 303.0652 65.0553 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Oxidation(M)@37; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0190380997955799 5842.990234375 974.839 5843.00927734375 974.842163085938 6 18 1.1.1.5498.6 1 65.123 167.2444 65.1039 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.018911100924015 5572.822265625 929.811 5572.84130859375 929.814147949219 6 26 1.1.1.5499.5 1 65.1399 1562.005 64.9581 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0018569000530988 5557.8486328125 1112.577 5557.84814453125 1112.57690429688 5 36 1.1.1.5499.8 1 65.1474 18287.89 64.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0037869899533689 5557.81640625 794.981 5557.8115234375 794.980407714844 7 25 1.1.1.5500.2 1 65.1592 7249.051 64.9095 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0241132993251085 5543.80810546875 924.9753 5543.83251953125 924.979370117188 6 24 1.1.1.5500.3 1 65.1634 3384.049 64.9095 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0488614998757839 5582.7978515625 931.4736 5582.8466796875 931.481750488281 6 25 1.1.1.5500.4 1 65.1676 714.3604 64.9095 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.112744003534317 5854.96875 976.8354 5855.08203125 976.854248046875 6 19 1.1.1.5500.5 1 65.1717 498.1056 64.9826 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0101289004087448 5587.85205078125 932.3159 5587.8623046875 932.317626953125 6 18 1.1.1.5501.5 1 65.1927 747.4615 64.9338 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0383513011038303 5528.7978515625 922.4736 5528.83642578125 922.47998046875 6 18 1.1.1.5502.10 1 65.2116 377.3299 65.2012 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0347957983613014 5542.81689453125 924.8101 5542.85205078125 924.81591796875 6 28 1.1.1.5502.11 1 65.2124 1971.068 64.9581 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0161629002541304 5557.83203125 927.3126 5557.84814453125 927.315307617188 6 35 1.1.1.5502.12 1 65.2132 31610.24 64.9581 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@34; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 -0.0367481000721455 5835.966796875 973.6684 5836.00341796875 973.674499511719 6 16 1.1.1.5503.5 1 65.2386 203.1691 65.2258 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.0720110014081001 5610.77001953125 936.1356 5610.841796875 936.147583007813 6 16 1.1.1.5504.4 1 65.2608 307.0954 65.1039 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@34; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.00266294996254146 5571.828125 929.6453 5571.83056640625 929.645751953125 6 21 1.1.1.5506.9 1 65.3162 803.5691 65.3744 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Delta:H(2)C(2)(H)@24; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.0277088992297649 5568.85888671875 1114.779 5568.8310546875 1114.77355957031 5 16 1.1.1.5506.11 1 65.3195 1259.474 65.4249 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0313167981803417 5557.81640625 794.9811 5557.84814453125 794.985595703125 7 30 1.1.1.5507.3 1 65.3343 4535.75 65.0797 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00419380003586411 5582.8427734375 798.5562 5582.8466796875 798.556823730469 7 23 1.1.1.5507.4 1 65.3377 2992.04 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0211520008742809 5544.81005859375 925.1423 5544.8310546875 925.145812988281 6 18 1.1.1.5507.5 1 65.341 1247.265 65.0797 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 0.010203399695456 5568.84130859375 929.1475 5568.8310546875 929.145812988281 6 21 1.1.1.5507.6 1 65.3443 1587.681 65.4249 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0137601997703314 5582.8603515625 931.484 5582.8466796875 931.481750488281 6 22 1.1.1.5508.5 1 65.3659 13065.96 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0238520000129938 5582.86865234375 1117.581 5582.8466796875 1117.57666015625 5 20 1.1.1.5508.6 1 65.3693 10369.12 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0161629002541304 5557.83203125 927.3126 5557.84814453125 927.315307617188 6 30 1.1.1.5509.8 1 65.3895 18172.14 65.1281 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.01045379973948 5598.85205078125 934.1493 5598.841796875 934.147583007813 6 19 1.1.1.5509.9 1 65.3912 881.6777 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0362586006522179 5603.87255859375 934.986 5603.8359375 934.979919433594 6 17 1.1.1.5509.10 1 65.3928 419.9269 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0175473000854254 5540.81884765625 924.4771 5540.83642578125 924.47998046875 6 21 1.1.1.5510.5 1 65.4165 536.3999 65.2258 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0217576008290052 5627.87158203125 938.9859 5627.8935546875 938.989501953125 6 19 1.1.1.5511.2 1 65.4335 214.4563 65.4249 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0204210001975298 5558.8193359375 795.1243 5558.79931640625 795.121459960938 7 15 1.1.1.5512.7 1 65.4678 1974.754 65.2012 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Deamidated(N)@17; acrolein addition +38(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0121186999604106 5568.83203125 796.5547 5568.81982421875 796.552978515625 7 19 1.1.1.5512.8 1 65.4703 303.2356 65.4502 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0725445002317429 5612.8212890625 936.4775 5612.8935546875 936.489562988281 6 23 1.1.1.5513.3 1 65.4872 238.7483 65.4754 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Delta:H(2)C(2)(H)@24; Deamidated(N)@34; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0350922010838985 5615.87109375 936.9858 5615.8359375 936.979919433594 6 17 1.1.1.5513.4 1 65.4914 212.1458 65.5006 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0291805993765593 5557.81884765625 794.9814 5557.84814453125 794.985595703125 7 23 1.1.1.5514.5 1 65.514 2394.073 65.2504 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.00376654998399317 5582.8427734375 798.5563 5582.8466796875 798.556823730469 7 19 1.1.1.5514.6 1 65.5174 3019.689 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0261821001768112 5568.84130859375 929.1475 5568.86767578125 929.15185546875 6 19 1.1.1.5514.7 1 65.5207 1587.681 65.4249 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0138595001772046 5543.81884765625 924.9771 5543.83251953125 924.979370117188 6 23 1.1.1.5515.4 1 65.5368 380.7744 65.5006 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0137601997703314 5582.8603515625 931.484 5582.8466796875 931.481750488281 6 23 1.1.1.5515.5 1 65.5393 13065.96 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.000604878005106002 5672.87890625 946.4871 5672.87841796875 946.486999511719 6 27 1.1.1.5515.6 1 65.5426 2990.392 65.7523 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)@N-term; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0238520000129938 5582.86865234375 1117.581 5582.8466796875 1117.57666015625 5 20 1.1.1.5515.7 1 65.5459 10369.12 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0165291000157595 5557.83203125 927.3126 5557.84814453125 927.315307617188 6 29 1.1.1.5516.7 1 65.5661 9293.628 65.2996 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.01045379973948 5598.85205078125 934.1493 5598.841796875 934.147583007813 6 17 1.1.1.5516.8 1 65.5686 881.6777 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Trimethyl(K)@40 missed K-I@20; missed K-L@40 -0.00867663975805044 5568.85888671875 1114.779 5568.86767578125 1114.78076171875 5 17 1.1.1.5517.4 1 65.5923 1259.474 65.4249 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0138964001089334 5571.828125 929.6453 5571.841796875 929.647583007813 6 22 1.1.1.5518.4 1 65.6147 804.1306 65.3744 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0261883996427059 5599.85205078125 934.3159 5599.82568359375 934.311584472656 6 20 1.1.1.5518.5 1 65.6181 696.6096 65.5762 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.013141299597919 5621.85986328125 937.9839 5621.8466796875 937.981689453125 6 18 1.1.1.5519.9 1 65.6439 175.91 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0232190992683172 5557.82373046875 1112.572 5557.84814453125 1112.57690429688 5 21 1.1.1.5519.10 1 65.6464 3030.252 65.3744 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.00376654998399317 5582.8427734375 798.5563 5582.8466796875 798.556823730469 7 19 1.1.1.5521.2 1 65.6839 3019.689 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0158316995948553 5672.8623046875 811.4162 5672.87841796875 811.41845703125 7 26 1.1.1.5521.3 1 65.6881 511.5441 65.7775 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Delta:H(2)C(2)(H)@24; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.010203399695456 5568.84130859375 929.1475 5568.8310546875 929.145812988281 6 19 1.1.1.5521.4 1 65.6923 1585.401 65.4249 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00773123977705836 5672.88330078125 1135.584 5672.87841796875 1135.5830078125 5 25 1.1.1.5521.5 1 65.6965 1288.418 65.8025 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0137601997703314 5582.8603515625 931.484 5582.8466796875 931.481750488281 6 18 1.1.1.5522.3 1 65.7118 13065.96 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dioxidation(F)@15; acrolein addition +112(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00170350994449109 5672.88037109375 946.4873 5672.87841796875 946.486999511719 6 30 1.1.1.5522.4 1 65.7151 3137.264 65.7775 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)@N-term; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0238520000129938 5582.86865234375 1117.581 5582.8466796875 1117.57666015625 5 23 1.1.1.5522.5 1 65.7185 10369.12 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0278815999627113 5557.82080078125 927.3107 5557.84814453125 927.315307617188 6 28 1.1.1.5523.7 1 65.7405 3431.862 65.4754 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0239482000470161 5566.82861328125 928.812 5566.85205078125 928.81591796875 6 20 1.1.1.5523.8 1 65.7422 458.1494 65.7015 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; Deamidated(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.0259786993265152 5689.89892578125 949.3237 5689.87255859375 949.319396972656 6 16 1.1.1.5525.3 1 65.7916 138.162 65.8025 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0247360002249479 5598.8662109375 934.1517 5598.841796875 934.147583007813 6 18 1.1.1.5527.3 1 65.8416 724.008 65.5762 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.00163034000433981 5582.84521484375 798.5566 5582.8466796875 798.556823730469 7 18 1.1.1.5528.4 1 65.8659 2471.335 65.6015 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0130278002470732 5582.85986328125 931.4839 5582.8466796875 931.481750488281 6 15 1.1.1.5529.4 1 65.8912 9903.931 65.6265 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00170350994449109 5672.88037109375 946.4873 5672.87841796875 946.486999511719 6 30 1.1.1.5529.5 1 65.8945 3137.264 65.7775 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Formyl(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0209550000727177 5557.83251953125 927.3127 5557.8115234375 927.309265136719 6 25 1.1.1.5530.4 1 65.9184 2060.416 65.6515 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0322646982967854 5583.86376953125 1117.78 5583.83056640625 1117.7734375 5 17 1.1.1.5535.4 1 66.0483 980.6981 66.028 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0243679005652666 5583.85498046875 931.6498 5583.83056640625 931.645751953125 6 18 1.1.1.5536.2 1 66.0617 1021.295 66.028 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dioxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.00316834007389843 5672.88134765625 946.4875 5672.87841796875 946.486999511719 6 24 1.1.1.5536.3 1 66.0675 3934.4 66.2036 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0351933017373085 5556.82861328125 927.1454 5556.8642578125 927.151306152344 6 33 1.1.1.5537.3 1 66.0985 873.4921 66.1536 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0222759004682302 5569.83740234375 929.3135 5569.81494140625 929.309814453125 6 18 1.1.1.5543.3 1 66.2384 363.0234 66.2287 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0141139999032021 5583.8447265625 931.6481 5583.83056640625 931.645751953125 6 18 1.1.1.5543.4 1 66.2417 3134.938 66.3289 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dioxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.00316834007389843 5672.88134765625 946.4875 5672.87841796875 946.486999511719 6 25 1.1.1.5543.5 1 66.245 3934.4 66.2036 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00321394996717572 5556.83349609375 1112.374 5556.8310546875 1112.37353515625 5 20 1.1.1.5543.6 1 66.2484 544.4299 66.2036 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00217861006967723 5556.82861328125 927.1454 5556.8310546875 927.145812988281 6 33 1.1.1.5544.3 1 66.2635 873.4921 66.1536 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0206681005656719 5583.853515625 1117.778 5583.83056640625 1117.7734375 5 18 1.1.1.5544.6 1 66.2736 2677.298 66.3289 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(E)@3; Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.00596498977392912 5596.86865234375 933.8187 5596.8623046875 933.817687988281 6 21 1.1.1.5546.5 1 66.3238 416.3692 66.354 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0141139999032021 5583.8447265625 931.6481 5583.83056640625 931.645751953125 6 17 1.1.1.5550.3 1 66.424 3134.938 66.3289 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@20; Deamidated(N)@30 missed K-I@20; missed K-L@40 0.0206681005656719 5583.853515625 1117.778 5583.83056640625 1117.7734375 5 17 1.1.1.5551.2 1 66.4406 2677.298 66.3289 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00444420985877514 5557.84375 927.3146 5557.84814453125 927.315307617188 6 28 1.1.1.5552.5 1 66.4708 585.9902 66.4041 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; Dioxidation(P)@25; Deamidated(N)@28; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00828307028859854 5673.87060546875 946.6524 5673.8623046875 946.651000976563 6 27 1.1.1.5554.5 1 66.524 624.7115 66.5291 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0124888001009822 5608.87548828125 935.8198 5608.8623046875 935.817687988281 6 22 1.1.1.5556.3 1 66.5741 250.0117 66.5792 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0272116009145975 5556.83984375 927.1473 5556.86767578125 927.15185546875 6 24 1.1.1.5561.5 1 66.6766 354.3334 66.6603 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00512820016592741 5610.88330078125 936.1545 5610.8779296875 936.153625488281 6 24 1.1.1.5565.3 1 66.7691 508.8256 66.7594 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Formyl(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0209550000727177 5557.83251953125 927.3127 5557.8115234375 927.309265136719 6 27 1.1.1.5574.5 1 66.9438 341.5341 66.9522 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0304883997887373 5608.86865234375 935.8187 5608.89892578125 935.82373046875 6 29 1.1.1.5580.2 1 67.0783 2188.602 67.1833 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(D)@7; hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0126459002494812 5608.888671875 1122.785 5608.89892578125 1122.78698730469 5 25 1.1.1.5581.3 1 67.1034 3245.198 67.1833 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0110048996284604 5556.841796875 927.1476 5556.8310546875 927.145812988281 6 24 1.1.1.5584.10 1 67.1716 321.0023 67.1582 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(D)@7; hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0304883997887373 5608.86865234375 935.8187 5608.89892578125 935.82373046875 6 31 1.1.1.5587.3 1 67.2529 2188.602 67.1833 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(D)@7; hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0126459002494812 5608.888671875 1122.785 5608.89892578125 1122.78698730469 5 24 1.1.1.5588.6 1 67.2782 3245.198 67.1833 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00807524006813765 5556.83984375 927.1472 5556.8310546875 927.145812988281 6 28 1.1.1.5593.7 1 67.3847 368.1883 67.3398 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0304883997887373 5608.86865234375 935.8187 5608.89892578125 935.82373046875 6 27 1.1.1.5595.4 1 67.4345 2183.78 67.1833 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(D)@7; hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0126459002494812 5608.888671875 1122.785 5608.89892578125 1122.78698730469 5 27 1.1.1.5598.2 1 67.5089 2966.062 67.2582 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00107998005114496 5556.830078125 927.1456 5556.8310546875 927.145812988281 6 29 1.1.1.5602.3 1 67.6086 323.9792 67.5639 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(D)@7; hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0242628995329142 5608.87451171875 935.8197 5608.89892578125 935.82373046875 6 28 1.1.1.5603.2 1 67.6333 1368.313 67.3649 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0294089000672102 5556.83837890625 927.147 5556.86767578125 927.15185546875 6 31 1.1.1.5629.2 1 68.1212 264.3233 68.1346 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00617229007184505 5555.82861328125 1112.173 5555.8359375 1112.17443847656 5 20 1.1.1.5629.3 1 68.1295 1096.849 68.0792 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0326726995408535 5741.00634765625 957.8417 5740.97412109375 957.836303710938 6 14 1.1.1.5375.12 1 62.1019 199.1637 62.1144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0470600984990597 6007.0302734375 1002.179 6007.07763671875 1002.18688964844 6 15 1.1.1.5381.14 1 62.258 397.9034 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0439875982701778 5540.83251953125 924.4794 5540.78857421875 924.472045898438 6 14 1.1.1.5394.5 1 62.5754 4091.175 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0471111983060837 5595.78369140625 933.6379 5595.83056640625 933.645751953125 6 13 1.1.1.5403.9 1 62.7955 632.5745 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; Dioxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0785619989037514 5975.009765625 996.8422 5975.087890625 996.855224609375 6 15 1.1.1.5404.15 1 62.8255 391.0333 62.8852 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0217585004866123 5579.81005859375 930.9756 5579.7880859375 930.971984863281 6 14 1.1.1.5417.3 1 63.1347 1502.427 63.0548 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0174410007894039 5540.81884765625 1109.171 5540.83642578125 1109.17456054688 5 14 1.1.1.5437.8 1 63.6285 2309.184 63.6335 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Carbamidomethyl(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.020380200818181 5932.05322265625 1187.418 5932.072265625 1187.42175292969 5 15 1.1.1.5438.6 1 63.6492 1189.99 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0307881999760866 5540.81884765625 1109.171 5540.78857421875 1109.1650390625 5 14 1.1.1.5451.6 1 63.9721 2094.544 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0465962998569012 5571.83837890625 1115.375 5571.79443359375 1115.3662109375 5 14 1.1.1.5454.7 1 64.0491 1121.837 64.0542 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Hex(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0290194004774094 5969.01171875 995.8426 5969.041015625 995.847412109375 6 15 1.1.1.5455.10 1 64.0717 508.7568 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0684809982776642 5988.99853515625 1198.807 5989.06689453125 1198.82067871094 5 15 1.1.1.5456.9 1 64.0976 383.4217 64.0784 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.00392118981108069 5540.8388671875 1109.175 5540.83642578125 1109.17456054688 5 14 1.1.1.5458.5 1 64.1426 1522.458 64.151 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; MolybdopterinGD(D)@35; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0472575984895229 7203.7890625 1030.12 7203.83251953125 1030.12622070313 7 16 1.1.1.5460.8 1 64.1945 981.072 64.151 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.0676774978637695 5869.97802734375 979.3369 5870.04541015625 979.34814453125 6 14 1.1.1.5469.5 1 64.4009 267.0673 64.3932 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Deamidated(N)@34; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00408001989126205 5580.779296875 798.2615 5580.78369140625 798.262084960938 7 14 1.1.1.5481.5 1 64.6972 563.6221 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0136812999844551 5581.80126953125 931.3075 5581.81494140625 931.309814453125 6 14 1.1.1.5493.4 1 64.9885 711.1956 64.9338 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Phospho(T)@31; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0363834016025066 5935.01171875 990.1759 5935.04833984375 990.182006835938 6 15 1.1.1.5493.10 1 64.9985 351.4324 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0948508009314537 5874.9560546875 980.1666 5875.05078125 980.182373046875 6 14 1.1.1.5502.13 1 65.2141 187.0546 65.2012 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; HexNAc(N)@34; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0707293003797531 5973.99658203125 996.6734 5974.0673828125 996.685180664063 6 15 1.1.1.5505.7 1 65.2896 274.7748 65.1768 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0214745998382568 5528.8134765625 1106.77 5528.8330078125 1106.77380371094 5 15 1.1.1.5405.19 1 62.8539 14782.94 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0329413004219532 5589.84326171875 1118.976 5589.87451171875 1118.98217773438 5 14 1.1.1.5412.4 1 63.0258 886.7092 62.9829 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; HexNAc(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0744104012846947 5895.9248046875 983.6614 5895.99951171875 983.673828125 6 13 1.1.1.5502.14 1 65.2149 130.4256 65.2012 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Oxidation(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0176928993314505 5804.990234375 968.5056 5804.97216796875 968.502685546875 6 13 1.1.1.5484.6 1 64.7735 255.8919 64.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0706065967679024 5853.97900390625 976.6705 5854.05029296875 976.682312011719 6 13 1.1.1.5403.14 1 62.7997 551.1875 62.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24 missed K-I@20; missed K-L@40 0.00533796008676291 5526.8232421875 1106.372 5526.8203125 1106.37133789063 5 13 1.1.1.5456.7 1 64.0926 535.6024 64.0784 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; Hex(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0211245995014906 5933.0185546875 1187.611 5933.041015625 1187.61547851563 5 13 1.1.1.5456.8 1 64.0951 614.4207 63.9292 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; MolybdopterinGD(D)@35; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0172096006572247 7203.81396484375 1201.643 7203.83251953125 1201.64599609375 6 15 1.1.1.5459.6 1 64.1669 1523.569 64.151 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0538964010775089 5561.8642578125 927.9846 5561.81005859375 927.975646972656 6 16 1.1.1.5506.8 1 65.3145 1961.807 65.0797 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Cation:Na(E)@3; acrolein addition +56(K)@20; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0413254983723164 5579.83837890625 1116.975 5579.796875 1116.96667480469 5 14 1.1.1.5597.3 1 67.4842 549.0037 67.5389 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Oxidation(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0546967014670372 5905.0087890625 1182.009 5905.06103515625 1182.01953125 5 13 1.1.1.5403.21 1 62.8056 1577.526 62.8106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0316542983055115 5583.86376953125 1117.78 5583.83056640625 1117.7734375 5 14 1.1.1.5458.6 1 64.146 453.9004 64.1026 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; HPNE addition +172(K)@20; Oxidation(M)@37; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0535097010433674 5861.95068359375 977.999 5862.00390625 978.007873535156 6 13 1.1.1.5384.15 1 62.3346 203.5039 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Carbamidomethyl(T)@23; reduced HNE(H)@24; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 -0.0429631993174553 5932.0283203125 1187.413 5932.072265625 1187.42175292969 5 14 1.1.1.5430.7 1 63.4602 2404.592 63.1995 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0832843035459518 5988.984375 999.1713 5989.06689453125 999.185119628906 6 18 1.1.1.5469.10 1 64.4093 591.6677 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Dethiomethyl(M)@37; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0480079017579556 5544.8740234375 1109.982 5544.82763671875 1109.97277832031 5 13 1.1.1.5378.20 1 62.1852 1075.183 62.2172 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; Hex(N)@30; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0200551003217697 5933.02099609375 989.8441 5933.041015625 989.847412109375 6 19 1.1.1.5403.15 1 62.8006 8701.148 62.9099 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; Hex(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0163930002599955 5933.02490234375 989.8447 5933.041015625 989.847412109375 6 18 1.1.1.5445.3 1 63.811 1435.451 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; Hex(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0174915995448828 5933.0234375 989.8445 5933.041015625 989.847412109375 6 16 1.1.1.5452.8 1 63.9911 1218.442 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; Hex(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.00797019992023706 5933.033203125 989.8461 5933.041015625 989.847412109375 6 15 1.1.1.5468.14 1 64.3823 522.4512 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0854815989732742 5988.98193359375 999.1709 5989.06689453125 999.185119628906 6 14 1.1.1.5476.14 1 64.5781 459.5844 64.5399 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.0926399007439613 5794.931640625 966.8292 5795.0244140625 966.844665527344 6 12 1.1.1.5488.17 1 64.8767 362.3003 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] GlnThrGlyGly(K)@20; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0199551992118359 5920.00537109375 987.6748 5919.9853515625 987.671508789063 6 13 1.1.1.5409.6 1 62.95 2175.56 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0394935011863709 5599.86328125 1120.98 5599.82568359375 1120.97241210938 5 13 1.1.1.5522.6 1 65.7218 293.7096 65.7015 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.0441792011260986 5610.79736328125 936.1402 5610.841796875 936.147583007813 6 14 1.1.1.5379.14 1 62.2063 443.7029 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.00943491980433464 5592.82177734375 799.9818 5592.8310546875 799.983154296875 7 14 1.1.1.5380.5 1 62.225 436.2562 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0177660007029772 5572.84375 1115.576 5572.826171875 1115.57250976563 5 14 1.1.1.5395.17 1 62.6082 859.203 62.5662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0310344994068146 5597.8154296875 933.9765 5597.8466796875 933.981689453125 6 14 1.1.1.5444.4 1 63.7853 858.6727 63.8808 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0324993990361691 5597.814453125 933.9763 5597.8466796875 933.981689453125 6 14 1.1.1.5470.5 1 64.4269 474.1674 64.4177 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0147142000496387 5572.83837890625 1115.575 5572.826171875 1115.57250976563 5 14 1.1.1.5488.21 1 64.88 937.7746 64.836 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.00541384005919099 5806.982421875 968.8377 5806.98779296875 968.838623046875 6 14 1.1.1.5493.6 1 64.9918 212.6949 64.9826 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0415936000645161 5651.89892578125 942.9904 5651.85693359375 942.983459472656 6 12 1.1.1.5375.11 1 62.101 343.2686 62.1144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0655037015676498 5871.01171875 979.5092 5871.07666015625 979.520080566406 6 12 1.1.1.5383.11 1 62.3062 563.3143 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Phospho(T)@31; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.011812400072813 5933.02099609375 989.8441 5933.03271484375 989.846069335938 6 17 1.1.1.5410.4 1 62.9774 8701.148 62.9099 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Dicarbamidomethyl(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0439811982214451 5933.0234375 989.8445 5933.0673828125 989.851806640625 6 16 1.1.1.5433.9 1 63.5299 2565.788 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Hex(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.00741309998556972 5969.03369140625 995.8462 5969.041015625 995.847412109375 6 13 1.1.1.5469.8 1 64.4059 224.2014 64.2237 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Phospho(T)@31; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.00100493000354618 5933.03369140625 989.8462 5933.03271484375 989.846069335938 6 18 1.1.1.5431.5 1 63.4809 3730.708 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; Dioxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.0274184998124838 5919.033203125 1184.814 5919.0615234375 1184.81958007813 5 12 1.1.1.5406.11 1 62.8785 1325.38 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.6999988555908 [trypsin fragment, 50 aa] Deamidated(N)@17; Delta:H(2)C(2)(H)@24; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.0276912003755569 5543.828125 1109.773 5543.79931640625 1109.76721191406 5 13 1.1.1.5379.18 1 62.2096 1231.658 62.2172 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.6999988555908 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.0731486976146698 5794.95361328125 1159.998 5795.0244140625 1160.01220703125 5 12 1.1.1.5486.10 1 64.8276 794.9967 64.836 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 [trypsin fragment, 50 aa] Oxidation(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0476888008415699 5544.87890625 1109.983 5544.8310546875 1109.97351074219 5 14 1.1.1.5404.18 1 62.828 5749.537 62.8356 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; MolybdopterinGD(D)@35; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0179420001804829 7203.81396484375 1201.643 7203.83251953125 1201.64599609375 6 14 1.1.1.5452.9 1 63.9936 1593.068 64.0784 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 [trypsin fragment, 50 aa] reduced HNE(H)@24; Hex(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.00797019992023706 5933.033203125 989.8461 5933.041015625 989.847412109375 6 12 1.1.1.5476.12 1 64.5765 522.4512 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; Carbamyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0279144998639822 5936.0390625 990.3471 5936.06689453125 990.351745605469 6 13 1.1.1.5493.11 1 65.0002 204.3684 64.9826 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.00412657018750906 5605.8193359375 935.3105 5605.81494140625 935.309814453125 6 13 1.1.1.5518.6 1 65.6214 365.785 65.6015 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00464919023215771 5640.89306640625 941.1561 5640.888671875 941.155395507813 6 12 1.1.1.5378.16 1 62.1819 233.6597 62.1911 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0832843035459518 5988.984375 999.1713 5989.06689453125 999.185119628906 6 17 1.1.1.5469.9 1 64.4076 591.6677 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 [trypsin fragment, 50 aa] Deamidated(N)@17; Deamidated(N)@26; Deamidated(N)@28; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0243219006806612 5579.8125 930.976 5579.7880859375 930.971984863281 6 12 1.1.1.5472.4 1 64.4766 577.5994 64.4177 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 [trypsin fragment, 50 aa] Deamidated(N)@12; Oxidation(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.000267953000729904 5575.82373046875 1116.172 5575.82568359375 1116.17236328125 5 11 1.1.1.5479.8 1 64.658 431.9657 64.6631 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; Dioxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.10419700294733 5974.98388671875 996.8379 5975.087890625 996.855224609375 6 13 1.1.1.5481.10 1 64.7056 401.3171 64.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0150757003575563 5573.82763671875 929.9786 5573.84326171875 929.981140136719 6 19 1.1.1.5492.5 1 64.9706 1998.844 64.9581 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Phosphoadenosine(T)@31; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0167718008160591 5989.96337890625 999.3345 5989.9462890625 999.331665039063 6 13 1.1.1.5502.16 1 65.2166 344.0687 65.2258 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Delta:H(2)C(2)(H)@24; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0102366004139185 5614.86328125 1123.98 5614.85205078125 1123.97766113281 5 13 1.1.1.5517.5 1 65.5964 235.8955 65.5257 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 [trypsin fragment, 50 aa] Methyl(E)@3; Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0330521017313004 5597.87939453125 933.9872 5597.8466796875 933.981689453125 6 14 1.1.1.5539.3 1 66.1427 269.4251 66.1536 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.2899992465973 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@40; Deamidated(N)@48 missed K-I@20; missed K-L@40 -0.00676594022661448 5559.82373046875 795.2678 5559.83056640625 795.268798828125 7 14 1.1.1.5379.6 1 62.1996 1089.142 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.2899992465973 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0170383006334305 5597.82958984375 800.6972 5597.8466796875 800.699645996094 7 14 1.1.1.5380.6 1 62.2258 350.5739 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.2899992465973 [trypsin fragment, 50 aa] Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0218732003122568 5578.79345703125 797.9778 5578.8154296875 797.980895996094 7 14 1.1.1.5476.4 1 64.5698 398.3238 64.4664 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.000938544981181622 5643.8896484375 941.6555 5643.88818359375 941.655334472656 6 11 1.1.1.5476.7 1 64.5723 301.1597 64.5642 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 [trypsin fragment, 50 aa] GlnThrGlyGly(K)@20; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.00985911022871733 5897.955078125 983.9998 5897.96484375 984.001403808594 6 12 1.1.1.5496.7 1 65.0679 197.0749 65.0311 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3699994087219 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Phospho(T)@31; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.00372669007629156 5933.02880859375 1187.613 5933.03271484375 1187.61376953125 5 15 1.1.1.5411.6 1 63.0019 4434.052 62.8852 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 75.7700026035309 [trypsin fragment, 50 aa] Dioxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.00740174017846584 5644.85400390625 941.8163 5644.84716796875 941.815124511719 6 11 1.1.1.5383.10 1 62.3053 298.8828 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 75.7700026035309 [trypsin fragment, 50 aa] GlnThrGlyGly(K)@20; Oxidation(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0411970987915993 5936.021484375 990.3442 5935.98046875 990.337341308594 6 12 1.1.1.5484.9 1 64.7793 245.2167 64.8606 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 75.7700026035309 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0749304965138435 5849.94384765625 975.9979 5850.01904296875 976.010437011719 6 11 1.1.1.5496.6 1 65.0663 201.0711 65.0797 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8099980354309 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0177660007029772 5572.84375 1115.576 5572.826171875 1115.57250976563 5 13 1.1.1.5468.17 1 64.3848 840.5823 64.3932 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.6600017547607 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.0174476001411676 5542.83349609375 1109.574 5542.8154296875 1109.5703125 5 9 1.1.1.5502.17 1 65.2174 1123.646 64.9581 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0163956005126238 5583.8486328125 1117.777 5583.83056640625 1117.7734375 5 11 1.1.1.5605.2 1 67.6828 317.42 67.5389 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.6699987649918 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0555315986275673 5610.7861328125 936.1383 5610.841796875 936.147583007813 6 13 1.1.1.5476.6 1 64.5715 348.9636 64.589 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9199993610382 [trypsin fragment, 50 aa] ONE addition +154(K)@40 missed K-I@20; missed K-L@40 0.00944884959608316 5654.9140625 808.8521 5654.904296875 808.850769042969 7 13 1.1.1.5379.9 1 62.2021 360.4733 62.1144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9199993610382 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.000679716991726309 5600.8359375 934.4799 5600.83642578125 934.47998046875 6 13 1.1.1.5462.4 1 64.2312 406.782 64.2237 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9199993610382 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0165452994406223 5572.84375 1115.576 5572.826171875 1115.57250976563 5 12 1.1.1.5476.18 1 64.5815 779.0283 64.5642 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.4699990749359 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.00555896991863847 5572.83349609375 1115.574 5572.826171875 1115.57250976563 5 13 1.1.1.5402.19 1 62.779 3227.371 62.9345 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.4699990749359 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0277485996484756 5613.8134765625 936.6429 5613.84130859375 936.647521972656 6 13 1.1.1.5477.8 1 64.6035 393.8665 64.7622 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.4699990749359 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0181031003594399 5539.82373046875 1108.972 5539.8046875 1108.96813964844 5 13 1.1.1.5481.11 1 64.7073 714.6017 64.6136 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.4699990749359 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0443092994391918 5559.8740234375 1112.982 5559.83056640625 1112.97338867188 5 13 1.1.1.5513.5 1 65.4956 2710.977 65.2258 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.7700006961823 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.00211097998544574 5628.85009765625 939.149 5628.85205078125 939.149291992188 6 12 1.1.1.5468.8 1 64.3773 380.0256 64.3932 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.5499988794327 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0287523008882999 5572.853515625 1115.578 5572.826171875 1115.57250976563 5 12 1.1.1.5386.21 1 62.3896 18802.08 62.2689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.4699994325638 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.0124842999503016 5670.890625 946.1557 5670.8779296875 946.153625488281 6 11 1.1.1.5381.10 1 62.2547 275.6033 62.2172 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.023132000118494 5630.82373046875 939.4779 5630.8466796875 939.481750488281 6 10 1.1.1.5381.9 1 62.2538 335.8889 62.2434 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 [trypsin fragment, 50 aa] acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00926405005156994 5576.82861328125 1116.373 5576.83642578125 1116.37451171875 5 11 1.1.1.5434.5 1 63.5565 1076.227 63.4653 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.8900001049042 LIKLSSPATLNSR Delta:H(4)C(2)@N-term cleaved M-L@N-term; missed K-L@3 0.000715616974048316 1426.85168457031 476.6245 1426.85070800781 476.624206542969 3 13 1.1.1.4373.6 1 38.1414 865.1346 38.1738 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.0099995136261 LISGWGNTK Oxidation(W)@5 cleaved C-L@N-term 0.00348357995972037 990.516845703125 496.2657 990.513427734375 496.264007568359 2 8 1.1.1.4101.14 1 31.7498 152.1772 31.8055 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR 0.00115244998596609 1044.55749511719 523.286 1044.55639648438 523.285461425781 2 15 1.1.1.4046.6 1 30.465 122672.4 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR 0.00115244998596609 1044.55749511719 523.286 1044.55639648438 523.285461425781 2 15 1.1.1.4053.6 1 30.6368 122672.4 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR 0.00115244998596609 1044.55749511719 523.286 1044.55639648438 523.285461425781 2 14 1.1.1.4052.3 1 30.6089 122672.4 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR 0.00151865999214351 1044.55786132813 523.2862 1044.55639648438 523.285461425781 2 13 1.1.1.4085.3 1 31.3594 610.2765 31.3507 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR -0.00360820000059903 1044.552734375 523.2836 1044.55639648438 523.285461425781 2 10 1.1.1.4129.4 1 32.3242 145.1132 32.2569 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1900014877319 LSSPATLNSR Oxidation(P)@4 -0.00248142005875707 1060.548828125 531.2817 1060.55126953125 531.282897949219 2 13 1.1.1.4048.3 1 30.5132 2363.491 30.5547 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1900014877319 LSSPATLNSR Dehydrated(S)@3 -0.00271501997485757 1026.54309082031 514.2788 1026.54577636719 514.280151367188 2 10 1.1.1.4049.5 1 30.5429 254.8947 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9499974250793 LSSPATLNSR -0.00446267984807491 1044.55187988281 523.2832 1044.55639648438 523.285461425781 2 11 1.1.1.4076.7 1 31.1859 1108.678 30.9369 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3299987316132 LSSPATLNSR 2.00367999076843 1046.56005859375 524.2873 1044.55639648438 523.285461425781 2 12 1.1.1.4049.6 1 30.5463 9649.955 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.6399974822998 LSSPATLNSR Delta:H(2)C(2)@N-term -0.000573628989513963 1070.57153320313 536.293 1070.57202148438 536.293273925781 2 12 1.1.1.4156.6 1 32.9322 651.6928 32.8899 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.0900015830994 LSSPATLNSR Deamidated(N)@8 0.00576590001583099 1045.54602050781 523.7803 1045.54040527344 523.777465820313 2 12 1.1.1.4093.5 1 31.5494 1390.745 31.5644 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.5300009250641 LSSPATLNSR Oxidation(P)@4 -0.00223727989941835 1060.54907226563 531.2818 1060.55126953125 531.282897949219 2 10 1.1.1.4041.7 1 30.3485 2433.205 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.1099994182587 LSSPATLNSR Dioxidation(P)@4; Deamidated(N)@8 0.00289669004268944 1077.53308105469 539.7738 1077.5302734375 539.772399902344 2 11 1.1.1.4069.4 1 31.0225 139.3885 31.0317 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 71.4999973773956 LSSPATLNSR Pro->pyro-Glu(P)@4 0.0018531900132075 1058.53747558594 530.276 1058.53564453125 530.275085449219 2 11 1.1.1.4048.2 1 30.5107 3151.442 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.4400019645691 LSSPATLNSR Dioxidation(P)@4 -0.0020834100432694 1076.54431152344 539.2794 1076.54614257813 539.280395507813 2 10 1.1.1.4055.9 1 30.6904 4915.809 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 53.1499981880188 LSSPATLNSR 0.00115244998596609 1044.55749511719 523.286 1044.55639648438 523.285461425781 2 11 1.1.1.4060.7 1 30.8129 131204.1 30.5547 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 LSSPATLNSR Dioxidation(P)@4 -0.0020834100432694 1076.54431152344 539.2794 1076.54614257813 539.280395507813 2 11 1.1.1.4048.4 1 30.5157 4915.809 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.4400001764297 LSSPATLNSR Pro->pyro-Glu(P)@4 0.0018531900132075 1058.53747558594 530.276 1058.53564453125 530.275085449219 2 8 1.1.1.4055.8 1 30.6879 3151.442 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 40.1100009679794 LSSPATLNSR 0.00176279002334923 1044.55810546875 523.2863 1044.55639648438 523.285461425781 2 9 1.1.1.4100.12 1 31.7222 509.634 31.5407 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 40.0200009346008 LSSPATLNSR Pro->pyro-Glu(P)@4 -0.00034403899917379 1058.53527832031 530.2749 1058.53564453125 530.275085449219 2 9 1.1.1.4041.6 1 30.346 3080.595 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 40.0200009346008 LSSPATLNSR Delta:H(2)C(2)@N-term 0.00198980001732707 1070.57409667969 536.2943 1070.57202148438 536.293273925781 2 10 1.1.1.4168.7 1 33.2163 499.1143 33.1741 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.2000008821487 LSSPATLNSR -0.000800636014901102 1044.55541992188 523.285 1044.55639648438 523.285461425781 2 10 1.1.1.4039.5 1 30.295 73996.95 30.5308 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.2000008821487 LSSPATLNSR Deamidated(N)@8 0.000150774998473935 1045.54052734375 523.7775 1045.54040527344 523.777465820313 2 11 1.1.1.4078.3 1 31.24 3377.323 30.9844 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.7100007534027 LSSPATLNSR -0.002021319931373 1044.55432128906 523.2844 1044.55639648438 523.285461425781 2 7 1.1.1.4023.6 1 29.9474 113.7948 29.9608 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.4200011491776 LSSPATLNSR Dioxidation(P)@4 -0.00232754996977746 1076.54382324219 539.2792 1076.54614257813 539.280395507813 2 10 1.1.1.4041.8 1 30.351 4876.907 30.5786 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.3100007772446 LSSPATLNSR 0.00139659002888948 1044.5576171875 523.2861 1044.55639648438 523.285461425781 2 10 1.1.1.4109.2 1 31.9272 245.8731 31.8792 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.00769462017342448 1773.8974609375 887.956 1773.88977050781 887.9521484375 2 25 1.1.1.4902.7 1 50.5849 451.6639 50.6676 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@36 cleaved H-N@N-term; missed K-I@16; missed K-L@36 0.025441600009799 5120.6484375 1025.137 5120.6240234375 1025.13208007813 5 13 1.1.1.5523.10 1 65.7472 2064.531 65.8526 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 NIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@36 cleaved H-N@N-term; missed K-I@16; missed K-L@36 0.025441600009799 5120.6484375 1025.137 5120.6240234375 1025.13208007813 5 12 1.1.1.5530.5 1 65.9226 2064.531 65.8526 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +56(K)@2; acrolein addition +76(K)@8; Carbamidomethyl(C)@10 missed K-V@8 -0.0029455900657922 2813.3818359375 938.8012 2813.384765625 938.802185058594 3 19 1.1.1.5425.3 1 63.3307 804.5353 63.3927 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN acrolein addition +94(K)@2; acrolein addition +38(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11; Deamidated(N)@14 missed K-V@8 0.012605999596417 2814.38134765625 939.1344 2814.36865234375 939.130187988281 3 15 1.1.1.5436.4 1 63.5977 937.6512 63.4412 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN MDA adduct +54(K)@2; Oxidation(P)@3; acrolein addition +76(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 0.00458938023075461 2827.36840820313 943.4634 2827.36401367188 943.4619140625 3 15 1.1.1.5561.6 1 66.68 270.2151 66.7904 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 -0.0122766997665167 2855.3828125 952.8016 2855.39526367188 952.8056640625 3 22 1.1.1.5568.5 1 66.8352 2215.285 67.0087 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN MDA adduct +62(K)@2; acrolein addition +112(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 -0.019352400675416 2855.37622070313 714.8513 2855.39526367188 714.856079101563 4 22 1.1.1.5573.2 1 66.9134 260.5045 66.9834 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN MDA adduct +54(K)@2; Oxidation(P)@3; acrolein addition +76(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 -0.00621378002688289 2827.357421875 943.4598 2827.36401367188 943.4619140625 3 15 1.1.1.5577.6 1 67.0003 243.3634 66.9522 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 -0.0120935998857021 2855.3828125 952.8016 2855.39526367188 952.8056640625 3 24 1.1.1.5577.7 1 67.0036 2466.078 67.0335 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN acrolein addition +76(K)@2; acrolein addition +38(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@14; Dioxidation(W)@15 missed K-V@8 1.17681001938763E-05 2827.36401367188 943.4619 2827.36401367188 943.4619140625 3 14 1.1.1.5584.11 1 67.1733 330.3018 67.1833 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 -0.0120935998857021 2855.3828125 952.8016 2855.39526367188 952.8056640625 3 23 1.1.1.5584.12 1 67.1749 2466.078 67.0335 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 -0.0147137995809317 2855.38061523438 714.8524 2855.39526367188 714.856079101563 4 14 1.1.1.5592.6 1 67.3515 447.9374 67.4643 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 -0.0122766997665167 2855.3828125 952.8016 2855.39526367188 952.8056640625 3 22 1.1.1.5592.9 1 67.3573 3076.209 67.514 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 -0.0122766997665167 2855.3828125 952.8016 2855.39526367188 952.8056640625 3 23 1.1.1.5599.5 1 67.5339 3076.209 67.514 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 -0.0147137995809317 2855.38061523438 714.8524 2855.39526367188 714.856079101563 4 22 1.1.1.5601.3 1 67.5779 447.9374 67.4643 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 -0.0147137995809317 2855.38061523438 714.8524 2855.39526367188 714.856079101563 4 22 1.1.1.5604.2 1 67.658 447.9374 67.4643 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN MDA adduct +62(K)@2; acrolein addition +112(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 -0.0122766997665167 2855.3828125 952.8016 2855.39526367188 952.8056640625 3 22 1.1.1.5606.5 1 67.7074 3076.209 67.514 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN MDA adduct +62(K)@2; acrolein addition +112(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 -0.00202281004749238 2855.39306640625 952.805 2855.39526367188 952.8056640625 3 22 1.1.1.5616.4 1 67.8814 1661.579 67.6879 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN hexanoyl addition +98(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10; Ammonia-loss(N)@11 missed K-V@8 0.0106258001178503 2823.41577148438 942.1459 2823.40551757813 942.142395019531 3 13 1.1.1.5590.4 1 67.3094 192.7254 67.2833 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3699994087219 NKPGVYTKVCNYVNWIQQTIAAN acrolein addition +94(K)@2; MDA adduct +54(K)@8; Carbamidomethyl(C)@10 missed K-V@8 -0.0437741987407207 2828.35180664063 943.7912 2828.3955078125 943.805786132813 3 10 1.1.1.5592.8 1 67.3548 268.6337 67.3398 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 NKPGVYTKVCNYVNWIQQTIAAN MDA adduct +62(K)@8; Carbamidomethyl(C)@10; Amidated@C-term missed K-V@8 -0.0272404998540878 2741.34765625 914.7898 2741.37475585938 914.798889160156 3 11 1.1.1.5573.3 1 66.9218 329.2928 67.0835 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 26.6299992799759 PYQVSLNSGSHFCGGSLINSQWVVSAAHCYK reduced HNE(H)@11; Carbamidomethyl(C)@13; Deamidated(Q)@21; Carbamidomethyl(C)@29; ONE addition +154(K)@31 cleaved I-P@N-term -0.0541110001504421 3765.76318359375 754.1599 3765.81713867188 754.170715332031 5 11 1.1.1.4952.9 1 51.8105 1279.832 51.8426 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.4100022315979 QVRLGEHNIDVLEGNEQFINAAK Carbamyl@N-term; Oxidation(R)@3 cleaved I-Q@N-term; missed R-L@3 0.0459703989326954 2652.37158203125 885.1311 2652.32568359375 885.115783691406 3 16 1.1.1.4821.13 1 48.638 524.71 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.1700000762939 QVRLGEHNIDVLEGNEQFINAAK Oxidation(R)@3; GlycerylPE(E)@6; Deamidated(N)@20 cleaved I-Q@N-term; missed R-L@3 0.0193051993846893 2807.36865234375 936.7968 2807.34912109375 936.790283203125 3 16 1.1.1.4804.10 1 48.2225 439.0539 48.2293 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.4499986171722 QVRLGEHNIDVLEGNEQFINAAK Deamidated(Q)@1; Carbamidomethyl(E)@6; Deamidated(N)@8 cleaved I-Q@N-term; missed R-L@3 0.0628800019621849 2652.37719726563 885.133 2652.314453125 885.112060546875 3 14 1.1.1.4828.6 1 48.7958 420.6856 48.7649 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.5300028324127 QVRLGEHNIDVLEGNEQFINAAK GlycerylPE(E)@6; Oxidation(H)@7 cleaved I-Q@N-term; missed R-L@3 0.0123648997396231 2806.37719726563 936.4664 2806.36499023438 936.462280273438 3 14 1.1.1.4817.12 1 48.5388 7395.968 48.6447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 35.1500004529953 QVRLGEHNIDVLEGNEQFINAAK Gln->pyro-Glu@N-term; Dehydrated(D)@10 cleaved I-Q@N-term; missed R-L@3 -0.0541725009679794 2558.2333984375 853.7518 2558.28784179688 853.769836425781 3 12 1.1.1.4819.10 1 48.5816 1209.399 48.6202 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0326258987188339 5933.02099609375 989.8441 5933.05322265625 989.849487304688 6 18 1.1.1.5410.4 1 62.9774 8701.148 62.9099 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0245402008295059 5933.02880859375 1187.613 5933.05322265625 1187.61791992188 5 17 1.1.1.5411.6 1 63.0019 4434.052 62.8852 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0198085997253656 5933.03369140625 989.8462 5933.05322265625 989.849487304688 6 19 1.1.1.5431.5 1 63.4809 3730.708 63.2961 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0300625003874302 5933.0234375 989.8445 5933.05322265625 989.849487304688 6 17 1.1.1.5433.9 1 63.5299 2565.788 63.5133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@23; Deamidated(N)@33; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0958551988005638 5988.984375 999.1713 5989.07958984375 999.187194824219 6 19 1.1.1.5469.9 1 64.4076 591.6677 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0289638005197048 5933.02490234375 989.8447 5933.05322265625 989.849487304688 6 19 1.1.1.5445.3 1 63.811 1435.451 63.7539 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0300625003874302 5933.0234375 989.8445 5933.05322265625 989.849487304688 6 17 1.1.1.5452.8 1 63.9911 1218.442 63.9049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0205409992486238 5933.033203125 989.8461 5933.05322265625 989.849487304688 6 16 1.1.1.5468.14 1 64.3823 522.4512 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@20; acrolein addition +76(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0958551988005638 5988.984375 999.1713 5989.07958984375 999.187194824219 6 19 1.1.1.5469.10 1 64.4093 591.6677 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; Deamidated(N)@20; acrolein addition +94(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.10062699764967 5989.96337890625 999.3345 5990.0634765625 999.351196289063 6 15 1.1.1.5502.16 1 65.2166 344.0687 65.2258 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0205409992486238 5933.033203125 989.8461 5933.05322265625 989.849487304688 6 13 1.1.1.5476.12 1 64.5765 522.4512 64.3689 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR HPNE addition +172(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0166119001805782 6084.15869140625 1217.839 6084.17431640625 1217.84216308594 5 14 1.1.1.5389.10 1 62.4639 361.8347 62.4198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.7200019359589 RIQVRLGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)@N-term cleaved S-R@N-term; missed R-I@1; missed R-L@5 -0.0200961995869875 2888.505859375 963.8425 2888.52563476563 963.849182128906 3 14 1.1.1.4829.10 1 48.8309 466.4844 48.7891 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.7200014591217 RLGEHNIDVLEGNEQFINAAK cleaved V-R@N-term; missed R-L@1 -7.04417991638184 2359.1533203125 1180.584 2366.19775390625 1184.10620117188 2 11 1.1.1.4822.19 1 48.6625 468.0735 48.6447 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 SGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGN Carbamidomethyl(C)@11; Carbamidomethyl(C)@22; acrolein addition +56(K)@23 cleaved S-S@N-term; cleaved N-M@C-term; missed K-A@13; missed K-S@23 0.0179807990789413 3542.72021484375 886.6873 3542.7021484375 886.682800292969 4 12 1.1.1.5146.5 1 56.5174 1542.652 56.4119 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 SGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGN Carbamidomethyl(C)@11; Carbamidomethyl(C)@22; acrolein addition +56(K)@23 cleaved S-S@N-term; cleaved N-M@C-term; missed K-A@13; missed K-S@23 0.026366900652647 3542.72924804688 1181.917 3542.7021484375 1181.90795898438 3 10 1.1.1.5140.17 1 56.3786 5788.891 56.387 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.0499982833862 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Deamidated(N)@21; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term -0.00517908995971084 3807.79736328125 762.5668 3807.80249023438 762.567810058594 5 17 1.1.1.4987.6 1 52.6669 12742.18 52.7495 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.0499982833862 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Deamidated(N)@21; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term -0.00517908995971084 3807.79736328125 762.5668 3807.80249023438 762.567810058594 5 17 1.1.1.4992.4 1 52.7814 12742.18 52.7495 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.17999792099 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Carbamidomethyl(S)@27; Carbamidomethyl(C)@31; hexanoyl addition +98(K)@33 cleaved N-S@N-term -0.0164125002920628 3807.79736328125 762.5668 3807.81372070313 762.570007324219 5 16 1.1.1.4986.2 1 52.6345 12742.18 52.7495 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.17999792099 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Deamidated(N)@21; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term -0.00517908995971084 3807.79736328125 762.5668 3807.80249023438 762.567810058594 5 15 1.1.1.4991.4 1 52.7571 12742.18 52.7495 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1900014877319 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Deamidated(N)@21; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term -0.00517908995971084 3807.79736328125 762.5668 3807.80249023438 762.567810058594 5 14 1.1.1.4990.9 1 52.7361 12742.18 52.7495 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.7200009822845 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Carbamidomethyl(C)@31; Carbamidomethyl(Y)@32; hexanoyl addition +98(K)@33 cleaved N-S@N-term -0.00862674042582512 3807.80541992188 952.9586 3807.81372070313 952.960693359375 4 15 1.1.1.4985.7 1 52.6188 13426.97 52.7495 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.3099982738495 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Delta:H(4)C(2)(H)@13; Carbamidomethyl(C)@15; Deamidated(N)@21; Carbamidomethyl(C)@31; hexanoyl addition +98(K)@33 cleaved N-S@N-term -0.0236598998308182 3779.78369140625 945.9532 3779.8076171875 945.959167480469 4 14 1.1.1.4984.4 1 52.5956 1200.618 52.6049 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 81.3099980354309 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Oxidation(W)@24; Carbamidomethyl(S)@27; Carbamidomethyl(C)@31; hexanoyl addition +98(K)@33 cleaved N-S@N-term -0.00127203995361924 3823.80737304688 956.9591 3823.80859375 956.95947265625 4 14 1.1.1.4989.6 1 52.7203 904.4745 52.7739 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.3099982738495 SPATLNSR cleaved S-S@N-term 0.00270818988792598 844.443054199219 423.2288 844.440307617188 423.227416992188 2 9 1.1.1.3600.2 1 22.6259 179.8486 22.7351 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 78.8399994373322 SRIQVRLGEHNIDVLEGNEQFINAAK Dehydrated(S)@1; Arg->GluSA(R)@6 missed R-I@2; missed R-L@6 0.0282550994306803 2888.50634765625 963.8427 2888.47802734375 963.833312988281 3 15 1.1.1.4822.12 1 48.6566 535.0829 48.6692 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 71.4999973773956 SRIQVRLGEHNIDVLEGNEQFINAAK Dehydrated(S)@1; Arg->GluSA(R)@6 missed R-I@2; missed R-L@6 0.0275226999074221 2888.505859375 963.8425 2888.47802734375 963.833312988281 3 14 1.1.1.4829.10 1 48.8309 466.4844 48.7891 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3699994087219 SSGSSYPSLLQCLK Phospho(S)@8; Deamidated(Q)@11; Carbamidomethyl(C)@12; acrolein addition +38(K)@14 0.0141805000603199 1644.72485351563 823.3697 1644.71069335938 823.362609863281 2 11 1.1.1.5396.3 1 62.6215 1326.62 62.3694 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.129997253418 SSPATLNSR cleaved L-S@N-term 0.000631760980468243 931.472900390625 466.7437 931.472290039063 466.743438720703 2 9 1.1.1.3698.2 1 24.0697 613.9149 24.0126 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -0.00056918797781691 2229.20336914063 744.0751 2229.20385742188 744.075256347656 3 20 1.1.1.5087.4 1 55.0349 17630.98 55.1278 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -0.00981641001999378 2229.19409179688 558.3058 2229.20385742188 558.308227539063 4 14 1.1.1.5089.2 1 55.0822 688.2173 55.1278 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.00138423999305815 2245.19995117188 749.4073 2245.19873046875 749.406860351563 3 18 1.1.1.5089.5 1 55.0847 1181.04 55.1031 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -0.00056918797781691 2229.20336914063 744.0751 2229.20385742188 744.075256347656 3 27 1.1.1.5094.5 1 55.2084 17630.98 55.1278 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10; Deamidated(N)@18 cleaved N-T@N-term; missed K-L@10 0.0105846002697945 2230.1982421875 744.4067 2230.18798828125 744.403259277344 3 15 1.1.1.5114.8 1 55.7115 277.6124 55.7274 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.1800019741058 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -0.0034273499622941 2245.1953125 749.4057 2245.19873046875 749.406860351563 3 18 1.1.1.4995.8 1 52.8567 467.3125 52.9455 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7699995040894 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -0.00910354964435101 2245.18969726563 749.4038 2245.19873046875 749.406860351563 3 16 1.1.1.5002.15 1 53.0336 459.9066 53.019 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.4600005149841 TLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@7; acrolein addition +76(K)@10; Deamidated(N)@18 cleaved N-T@N-term; missed K-L@10 0.00278610992245376 2230.18725585938 744.403 2230.1845703125 744.402099609375 3 11 1.1.1.5106.5 1 55.5093 1005.668 55.4525 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00423253001645207 869.537658691406 435.7761 869.533447265625 435.774017333984 2 10 1.1.1.6078.3 1 75.5599 525.4532 75.5165 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.6299991607666 VATVSLPR 0.00528567982837558 841.507446289063 421.761 841.502136230469 421.758361816406 2 9 1.1.1.5460.2 1 64.1795 410.0234 64.1995 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 VATVSLPR Delta:H(4)C(2)@N-term -0.00095536099979654 869.532470703125 435.7735 869.533447265625 435.774017333984 2 9 1.1.1.5938.2 1 72.5143 172.343 72.5194 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 VATVSLPR Delta:H(4)C(2)@N-term 0.00124185997992754 869.53466796875 435.7746 869.533447265625 435.774017333984 2 9 1.1.1.6003.3 1 73.8388 329.1199 73.8933 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 VATVSLPR Delta:H(4)C(2)@N-term 0.00386633002199233 869.537292480469 435.7759 869.533447265625 435.774017333984 2 10 1.1.1.6127.2 1 76.7443 643.4705 76.9284 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 VATVSLPR Delta:H(4)C(2)@N-term 0.00386633002199233 869.537292480469 435.7759 869.533447265625 435.774017333984 2 8 1.1.1.6184.3 1 78.0211 563.7027 77.9145 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.2299993038177 VATVSLPR Delta:H(4)C(2)@N-term 0.00362219009548426 869.537048339844 435.7758 869.533447265625 435.774017333984 2 9 1.1.1.6113.2 1 76.4011 698.949 76.369 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4200029373169 VATVSLPR Delta:H(4)C(2)@N-term 0.00404943013563752 869.537475585938 435.776 869.533447265625 435.774017333984 2 6 1.1.1.5593.3 1 67.373 143.5049 67.3897 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.2899992465973 VATVSLPR 0.00528567982837558 841.507446289063 421.761 841.502136230469 421.758361816406 2 8 1.1.1.5188.2 1 57.5424 516.4517 57.3398 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 VATVSLPR Delta:H(4)C(2)@N-term 0.00124185997992754 869.53466796875 435.7746 869.533447265625 435.774017333984 2 7 1.1.1.5348.2 1 61.4471 323.0224 61.4173 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 VATVSLPR Delta:H(4)C(2)@N-term 0.00362219009548426 869.537048339844 435.7758 869.533447265625 435.774017333984 2 9 1.1.1.5663.2 1 68.673 160.3623 68.5419 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 VATVSLPR Delta:H(4)C(2)@N-term 0.00325599010102451 869.536682128906 435.7756 869.533447265625 435.774017333984 2 8 1.1.1.5691.2 1 69.0582 144.6434 69.096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.1200017929077 VATVSLPR Delta:H(4)C(2)@N-term 0.00404943013563752 869.537475585938 435.776 869.533447265625 435.774017333984 2 10 1.1.1.5813.2 1 70.3827 144.9949 70.3637 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.7500009536743 VATVSLPR 0.00749034993350506 841.509643554688 421.7621 841.502136230469 421.758361816406 2 9 1.1.1.4815.2 1 48.4775 1695.833 48.4497 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.7200019359589 VATVSLPR Oxidation(P)@7 0.00123840000014752 857.498291015625 429.7564 857.4970703125 429.755798339844 2 12 1.1.1.4203.4 1 34.037 10766.74 34.0538 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.7200019359589 VATVSLPR Oxidation(P)@7 0.00099426694214344 857.498046875 429.7563 857.4970703125 429.755798339844 2 12 1.1.1.4210.4 1 34.2049 10845.21 34.1737 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.7200019359589 VATVSLPR Oxidation(P)@7 0.0014214999973774 857.498474121094 429.7565 857.4970703125 429.755798339844 2 12 1.1.1.4224.3 1 34.5392 8340.233 34.5568 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 91.5899991989136 VATVSLPR Dehydrated(T)@3 0.00222134008072317 823.493896484375 412.7542 823.491577148438 412.753082275391 2 12 1.1.1.4199.3 1 33.9395 27682.54 33.9819 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 91.5899991989136 VATVSLPR Delta:H(4)C(2)@N-term 0.0033492399379611 869.536865234375 435.7757 869.533447265625 435.774017333984 2 12 1.1.1.4335.7 1 37.1997 32043.87 36.95 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 91.5899991989136 VATVSLPR Deamidated(R)@8 0.0218658000230789 842.508056640625 422.2613 842.486145019531 422.250366210938 2 10 1.1.1.4344.2 1 37.4173 2023.34 37.3144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.9799993038177 VATVSLPR Dehydrated(T)@3 0.00283168000169098 823.494445800781 412.7545 823.491577148438 412.753082275391 2 12 1.1.1.4234.3 1 34.7789 19147.07 34.7479 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.9799993038177 VATVSLPR Delta:H(4)C(2)@N-term 0.0033492399379611 869.536865234375 435.7757 869.533447265625 435.774017333984 2 12 1.1.1.4328.4 1 37.0289 50163.83 36.8045 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3699994087219 VATVSLPR Delta:H(4)C(2)@N-term 0.00386633002199233 869.537292480469 435.7759 869.533447265625 435.774017333984 2 9 1.1.1.5778.2 1 70.0399 137.1341 70.0704 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3699994087219 VATVSLPR Delta:H(4)C(2)@N-term 0.00307288998737931 869.536499023438 435.7755 869.533447265625 435.774017333984 2 9 1.1.1.6099.2 1 76.0619 673.054 76.103 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3699994087219 VATVSLPR Delta:H(4)C(2)@N-term 0.00343908998183906 869.536865234375 435.7757 869.533447265625 435.774017333984 2 9 1.1.1.6134.2 1 76.9116 657.3382 76.9767 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3299987316132 VATVSLPR Dioxidation(P)@7 -0.000858257000800222 873.491088867188 437.7528 873.492004394531 437.753265380859 2 13 1.1.1.4208.3 1 34.1586 21145.56 34.0778 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3299987316132 VATVSLPR Dioxidation(P)@7 -0.000675155024509877 873.491271972656 437.7529 873.492004394531 437.753265380859 2 13 1.1.1.4215.2 1 34.3213 17765.56 34.3893 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3299987316132 VATVSLPR Delta:H(4)C(2)@N-term 0.00499715004116297 869.538452148438 435.7765 869.533447265625 435.774017333984 2 12 1.1.1.4279.3 1 35.8531 639311.2 36.0393 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3299987316132 VATVSLPR Delta:H(4)C(2)@N-term 0.00499715004116297 869.538452148438 435.7765 869.533447265625 435.774017333984 2 12 1.1.1.4300.4 1 36.3564 553161.8 36.111 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3299987316132 VATVSLPR Delta:H(4)C(2)@N-term 0.00359337008558214 869.537048339844 435.7758 869.533447265625 435.774017333984 2 12 1.1.1.4307.5 1 36.5251 92447.41 36.5883 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3299987316132 VATVSLPR Delta:H(4)C(2)@N-term 0.00359337008558214 869.537048339844 435.7758 869.533447265625 435.774017333984 2 12 1.1.1.4314.5 1 36.6899 86966.67 36.6363 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.3299987316132 VATVSLPR Delta:H(4)C(2)@N-term 0.00359337008558214 869.537048339844 435.7758 869.533447265625 435.774017333984 2 12 1.1.1.4321.3 1 36.8586 89087.41 36.6123 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.6399974822998 VATVSLPR Dioxidation(P)@7 0.00115586002357304 873.493103027344 437.7538 873.492004394531 437.753265380859 2 13 1.1.1.4201.4 1 33.9967 21732.63 33.9819 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.6399974822998 VATVSLPR Delta:H(4)C(2)@N-term 0.00499715004116297 869.538452148438 435.7765 869.533447265625 435.774017333984 2 12 1.1.1.4298.4 1 36.3106 639831.6 36.0633 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.9100015163422 VATVSLPR Delta:H(4)C(2)@N-term 0.00499715004116297 869.538452148438 435.7765 869.533447265625 435.774017333984 2 12 1.1.1.4293.4 1 36.1898 642824.3 36.0393 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.9100015163422 VATVSLPR Delta:H(2)C(2)@N-term 0.00408917013555765 867.521850585938 434.7682 867.517822265625 434.766174316406 2 12 1.1.1.4517.3 1 41.4506 8900.768 41.369 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.129997253418 VATVSLPR Dehydrated(T)@3 0.00325892004184425 823.494873046875 412.7547 823.491577148438 412.753082275391 2 8 1.1.1.4283.2 1 35.9476 2173.688 35.8957 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.129997253418 VATVSLPR Delta:H(4)C(2)@N-term 0.00499715004116297 869.538452148438 435.7765 869.533447265625 435.774017333984 2 12 1.1.1.4286.3 1 36.0226 642824.3 36.0393 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.129997253418 VATVSLPR Delta:H(4)C(2)@N-term 0.00499715004116297 869.538452148438 435.7765 869.533447265625 435.774017333984 2 12 1.1.1.4291.3 1 36.1421 642824.3 36.0393 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.129997253418 VATVSLPR Delta:H(4)C(2)@N-term 0.00359337008558214 869.537048339844 435.7758 869.533447265625 435.774017333984 2 10 1.1.1.4349.8 1 37.5477 6166.846 37.4631 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.129997253418 VATVSLPR Delta:H(4)C(2)@N-term 0.00518024992197752 869.538696289063 435.7766 869.533447265625 435.774017333984 2 10 1.1.1.4467.5 1 40.3421 1195.693 40.3505 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.129997253418 VATVSLPR Delta:H(2)C(2)@N-term 0.00366194010712206 867.521484375 434.768 867.517822265625 434.766174316406 2 12 1.1.1.4493.3 1 40.8989 8188.171 40.6698 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.129997253418 VATVSLPR Delta:H(2)C(2)@N-term 0.00408917013555765 867.521850585938 434.7682 867.517822265625 434.766174316406 2 12 1.1.1.4509.3 1 41.2629 8900.768 41.369 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.7499997615814 VATVSLPR Delta:H(4)C(2)@N-term 0.00386633002199233 869.537292480469 435.7759 869.533447265625 435.774017333984 2 9 1.1.1.5744.2 1 69.6864 165.1437 69.642 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.7499997615814 VATVSLPR Delta:H(4)C(2)@N-term 0.00307288998737931 869.536499023438 435.7755 869.533447265625 435.774017333984 2 10 1.1.1.6070.2 1 75.3911 665.8404 75.3962 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.3099982738495 VATVSLPR Oxidation(P)@7 -0.000775713997427374 857.496276855469 429.7554 857.4970703125 429.755798339844 2 11 1.1.1.4217.3 1 34.3693 9553.827 34.4133 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.3099982738495 VATVSLPR Oxidation(P)@7 0.00099426694214344 857.498046875 429.7563 857.4970703125 429.755798339844 2 11 1.1.1.4231.6 1 34.709 8635.461 34.6763 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.3099982738495 VATVSLPR Oxidation(P)@7 0.00099426694214344 857.498046875 429.7563 857.4970703125 429.755798339844 2 11 1.1.1.4238.5 1 34.8761 8635.461 34.6763 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.3099982738495 VATVSLPR Dioxidation(P)@7 0.00133896002080292 873.493286132813 437.7539 873.492004394531 437.753265380859 2 13 1.1.1.4243.4 1 34.9955 14355.25 34.9151 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.4499986171722 VATVSLPR Dehydrated(T)@3 0.00246548000723124 823.494079589844 412.7543 823.491577148438 412.753082275391 2 10 1.1.1.4206.2 1 34.1048 28322.29 34.1497 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.5300009250641 VATVSLPR Dehydrated(T)@3 0.00246548000723124 823.494079589844 412.7543 823.491577148438 412.753082275391 2 11 1.1.1.4213.2 1 34.2734 23410.93 34.2935 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.5300009250641 VATVSLPR Deamidated(R)@8 0.0220488999038935 842.50830078125 422.2614 842.486145019531 422.250366210938 2 11 1.1.1.4223.3 1 34.5161 162097 34.5329 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.5300009250641 VATVSLPR Pro->pyro-Glu(P)@7 0.00448120012879372 855.485900878906 428.7502 855.4814453125 428.747985839844 2 12 1.1.1.4238.4 1 34.8744 13688.44 34.8435 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.5300009250641 VATVSLPR Delta:H(4)C(2)@N-term 0.00499715004116297 869.538452148438 435.7765 869.533447265625 435.774017333984 2 12 1.1.1.4276.7 1 35.7875 594098.6 36.0154 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.5300009250641 VATVSLPR Delta:H(4)C(2)@N-term 0.00499715004116297 869.538452148438 435.7765 869.533447265625 435.774017333984 2 10 1.1.1.4285.6 1 35.9978 642824.3 36.0393 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.5600008964539 VATVSLPR Deamidated(R)@8 0.0220488999038935 842.50830078125 422.2614 842.486145019531 422.250366210938 2 11 1.1.1.4219.4 1 34.4256 153236 34.3893 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.5600008964539 VATVSLPR Deamidated(R)@8 0.0218658000230789 842.508056640625 422.2613 842.486145019531 422.250366210938 2 11 1.1.1.4232.3 1 34.7295 140377.1 34.7718 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.5600008964539 VATVSLPR Dehydrated(T)@3 0.00246548000723124 823.494079589844 412.7543 823.491577148438 412.753082275391 2 10 1.1.1.4241.3 1 34.9444 17612.88 34.8912 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.5600008964539 VATVSLPR Delta:H(4)C(2)@N-term 0.00359337008558214 869.537048339844 435.7758 869.533447265625 435.774017333984 2 12 1.1.1.4272.2 1 35.6848 170148.6 35.9198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.5600008964539 VATVSLPR Dehydrated(T)@3 0.00307581992819905 823.494689941406 412.7546 823.491577148438 412.753082275391 2 9 1.1.1.4276.3 1 35.7808 1480.942 35.7272 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.5600008964539 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 0.00290415994822979 885.53125 443.7729 885.528381347656 443.771453857422 2 12 1.1.1.4305.5 1 36.4798 2194.967 36.5883 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.5000028610229 VATVSLPR Delta:H(4)C(2)@N-term 0.00325599010102451 869.536682128906 435.7756 869.533447265625 435.774017333984 2 9 1.1.1.5715.2 1 69.3255 145.5479 69.3367 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.5000028610229 VATVSLPR Delta:H(4)C(2)@N-term 0.00325599010102451 869.536682128906 435.7756 869.533447265625 435.774017333984 2 8 1.1.1.6032.2 1 74.5156 516.0591 74.4596 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.5300028324127 VATVSLPR Oxidation(P)@7 -0.000775713997427374 857.496276855469 429.7554 857.4970703125 429.755798339844 2 8 1.1.1.4196.5 1 33.8673 10916.47 33.9819 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.5300028324127 VATVSLPR Deamidated(R)@8 0.0242461003363132 842.510498046875 422.2625 842.486145019531 422.250366210938 2 11 1.1.1.4206.6 1 34.1107 197590.8 34.1018 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.5300028324127 VATVSLPR Dioxidation(P)@7 0.00158309994731098 873.49365234375 437.7541 873.492004394531 437.753265380859 2 12 1.1.1.4250.3 1 35.16 14519.75 34.9151 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.5300028324127 VATVSLPR Delta:H(4)C(2)@N-term 0.00359337008558214 869.537048339844 435.7758 869.533447265625 435.774017333984 2 11 1.1.1.4356.6 1 37.726 5920.826 37.7896 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.4500024318695 VATVSLPR Delta:H(4)C(2)@N-term 0.00359337008558214 869.537048339844 435.7758 869.533447265625 435.774017333984 2 11 1.1.1.4311.6 1 36.6229 92447.41 36.5883 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 81.3099980354309 VATVSLPR Dioxidation(P)@7 0.00133896002080292 873.493286132813 437.7539 873.492004394531 437.753265380859 2 12 1.1.1.4229.3 1 34.6579 15887.05 34.6524 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 81.3099980354309 VATVSLPR Dioxidation(P)@7 0.00316997990012169 873.495300292969 437.7549 873.492004394531 437.753265380859 2 12 1.1.1.4236.3 1 34.8283 15045.08 34.8195 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 81.3099980354309 VATVSLPR Delta:H(4)C(2)@N-term 0.00499715004116297 869.538452148438 435.7765 869.533447265625 435.774017333984 2 11 1.1.1.4299.3 1 36.3343 604353.8 36.0871 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 81.3099980354309 VATVSLPR Delta:H(4)C(2)@N-term 0.00914745032787323 869.542663574219 435.7786 869.533447265625 435.774017333984 2 11 1.1.1.4419.3 1 39.2394 1684.33 39.2207 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 81.3099980354309 VATVSLPR Delta:H(2)C(2)@N-term 0.00366194010712206 867.521484375 434.768 867.517822265625 434.766174316406 2 11 1.1.1.4525.3 1 41.6404 7855.924 41.3928 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.5400013923645 VATVSLPR Delta:H(4)C(2)@N-term 0.00081462599337101 869.534301757813 435.7744 869.533447265625 435.774017333984 2 8 1.1.1.5760.2 1 69.8571 154.0242 69.8076 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.5400013923645 VATVSLPR Delta:H(4)C(2)@N-term 0.0062466599047184 869.539672851563 435.7771 869.533447265625 435.774017333984 2 9 1.1.1.5797.2 1 70.2121 124.4496 70.2172 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.1100015640259 VATVSLPR Dehydrated(T)@3 0.00283168000169098 823.494445800781 412.7545 823.491577148438 412.753082275391 2 10 1.1.1.4227.4 1 34.6117 21927.75 34.509 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.1100015640259 VATVSLPR Delta:H(4)C(2)@N-term 0.00499715004116297 869.538452148438 435.7765 869.533447265625 435.774017333984 2 11 1.1.1.4287.4 1 36.049 642824.3 36.0393 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.1100015640259 VATVSLPR Oxidation(P)@7 0.0144216995686293 857.511474609375 429.763 857.4970703125 429.755798339844 2 10 1.1.1.4294.5 1 36.2154 1658.328 36.0633 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.1100015640259 VATVSLPR Delta:H(4)C(2)@N-term 0.0033492399379611 869.536865234375 435.7757 869.533447265625 435.774017333984 2 10 1.1.1.4342.6 1 37.3708 8904.931 37.1195 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.1100015640259 VATVSLPR Delta:H(2)C(2)@N-term 0.0032347000669688 867.521057128906 434.7678 867.517822265625 434.766174316406 2 11 1.1.1.4475.3 1 40.5254 9238.202 40.6117 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 78.8399994373322 VATVSLPR Dehydrated(T)@3 0.00502890022471547 823.496704101563 412.7556 823.491577148438 412.753082275391 2 10 1.1.1.4262.2 1 35.4467 3782.096 35.2014 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 77.5099992752075 VATVSLPR Pro->pyro-Glu(P)@7 0.00149053998757154 855.482849121094 428.7487 855.4814453125 428.747985839844 2 12 1.1.1.4210.3 1 34.2032 20161.3 34.0778 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 77.5099992752075 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 0.00272106006741524 885.531066894531 443.7728 885.528381347656 443.771453857422 2 12 1.1.1.4283.6 1 35.9576 14038.5 36.0871 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 77.5099992752075 VATVSLPR Delta:H(2)C(2)@N-term 0.00366194010712206 867.521484375 434.768 867.517822265625 434.766174316406 2 11 1.1.1.4485.4 1 40.711 8133.481 40.6698 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.1099994182587 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 0.00272106006741524 885.531066894531 443.7728 885.528381347656 443.771453857422 2 12 1.1.1.4290.6 1 36.1299 14038.5 36.0871 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.1099994182587 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 0.00272106006741524 885.531066894531 443.7728 885.528381347656 443.771453857422 2 12 1.1.1.4297.5 1 36.2901 14038.5 36.0871 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 74.6399998664856 VATVSLPR Dehydrated(T)@3 0.00264857988804579 823.494262695313 412.7544 823.491577148438 412.753082275391 2 10 1.1.1.4248.4 1 35.1114 14811.53 35.0582 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 73.1100022792816 VATVSLPR Pro->pyro-Glu(P)@7 0.00210088002495468 855.483459472656 428.749 855.4814453125 428.747985839844 2 11 1.1.1.4217.2 1 34.3684 16807.32 34.3893 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 71.4999973773956 VATVSLPR Pro->pyro-Glu(P)@7 0.00149053998757154 855.482849121094 428.7487 855.4814453125 428.747985839844 2 12 1.1.1.4203.3 1 34.0354 20161.3 34.0778 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 71.4999973773956 VATVSLPR Formyl@N-term 0.00274824001826346 869.499877929688 435.7572 869.4970703125 435.755798339844 2 11 1.1.1.4258.4 1 35.353 9611.165 35.2014 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 71.4999973773956 VATVSLPR Dehydrated(T)@3 0.00502890022471547 823.496704101563 412.7556 823.491577148438 412.753082275391 2 8 1.1.1.4269.2 1 35.6119 1396.035 35.6553 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 69.8300004005432 VATVSLPR Pro->pyro-Glu(P)@7 0.00173467001877725 855.483093261719 428.7488 855.4814453125 428.747985839844 2 8 1.1.1.4196.4 1 33.8664 19750.28 34.0538 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 69.8300004005432 VATVSLPR Pro->pyro-Glu(P)@7 0.00191777001600713 855.483276367188 428.7489 855.4814453125 428.747985839844 2 11 1.1.1.4231.5 1 34.7073 15562.37 34.6763 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8099980354309 VATVSLPR 0.00284431991167367 841.505065917969 421.7598 841.502136230469 421.758361816406 2 8 1.1.1.5283.3 1 59.9021 510.8838 59.9222 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8099980354309 VATVSLPR 0.00223397999070585 841.504455566406 421.7595 841.502136230469 421.758361816406 2 9 1.1.1.5361.2 1 61.753 972.1651 61.654 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.8099980354309 VATVSLPR 0.00223397999070585 841.504455566406 421.7595 841.502136230469 421.758361816406 2 8 1.1.1.6199.2 1 78.3972 1233.702 78.3926 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.2699997425079 VATVSLPR Dehydrated(T)@3 0.00246548000723124 823.494079589844 412.7543 823.491577148438 412.753082275391 2 10 1.1.1.4220.2 1 34.4419 21407 34.3893 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.2699997425079 VATVSLPR Formyl@N-term -0.0318580009043217 869.465270996094 435.7399 869.4970703125 435.755798339844 2 11 1.1.1.4223.6 1 34.5245 1382.251 34.5568 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.2699997425079 VATVSLPR Pro->pyro-Glu(P)@7 0.00210088002495468 855.483459472656 428.749 855.4814453125 428.747985839844 2 11 1.1.1.4224.2 1 34.5367 15517.66 34.5568 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.2699997425079 VATVSLPR Carbamidomethyl@N-term -0.00403298996388912 898.519653320313 450.2671 898.523620605469 450.269073486328 2 9 1.1.1.4239.6 1 34.9024 305.9768 34.8435 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.2699997425079 VATVSLPR Deamidated(R)@8 0.0218658000230789 842.508056640625 422.2613 842.486145019531 422.250366210938 2 8 1.1.1.4351.2 1 37.593 1625.649 37.6139 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.2699997425079 VATVSLPR Delta:H(2)C(2)@N-term 0.00366194010712206 867.521484375 434.768 867.517822265625 434.766174316406 2 10 1.1.1.4467.4 1 40.3388 6910.549 40.5642 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.6600017547607 VATVSLPR Delta:H(4)C(2)@N-term 0.00343908998183906 869.536865234375 435.7757 869.533447265625 435.774017333984 2 9 1.1.1.6056.2 1 75.0529 491.8256 75.0096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.6600017547607 VATVSLPR Formyl@N-term 0.0398246012628078 869.536865234375 435.7757 869.4970703125 435.755798339844 2 8 1.1.1.6148.3 1 77.2537 636.9607 77.3197 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.6600017547607 VATVSLPR Delta:H(4)C(2)@N-term 0.00343908998183906 869.536865234375 435.7757 869.533447265625 435.774017333984 2 6 1.1.1.6155.2 1 77.4234 636.9607 77.3197 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.4400019645691 VATVSLPR Oxidation(P)@7 0.0014214999973774 857.498474121094 429.7565 857.4970703125 429.755798339844 2 7 1.1.1.3999.3 1 29.3784 144.9009 29.4648 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.4400019645691 VATVSLPR Deamidated(R)@8 0.022231999784708 842.508483886719 422.2615 842.486145019531 422.250366210938 2 10 1.1.1.4198.5 1 33.9154 199050.2 33.9819 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.4400019645691 VATVSLPR Deamidated(R)@8 0.0242461003363132 842.510498046875 422.2625 842.486145019531 422.250366210938 2 10 1.1.1.4212.4 1 34.2545 197590.8 34.1018 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.4400019645691 VATVSLPR Deamidated(R)@8 0.0220488999038935 842.50830078125 422.2614 842.486145019531 422.250366210938 2 10 1.1.1.4230.2 1 34.6801 162097 34.5329 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.4400019645691 VATVSLPR Deamidated(R)@8 0.0218658000230789 842.508056640625 422.2613 842.486145019531 422.250366210938 2 10 1.1.1.4246.6 1 35.0653 108033 35.0582 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.4400019645691 VATVSLPR Delta:H(4)C(2)@N-term 0.0033492399379611 869.536865234375 435.7757 869.533447265625 435.774017333984 2 6 1.1.1.5010.3 1 53.2196 620.5547 53.215 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 58.3599984645844 VATVSLPR Deamidated(R)@8 0.0218658000230789 842.508056640625 422.2613 842.486145019531 422.250366210938 2 10 1.1.1.4239.3 1 34.8966 140377.1 34.7718 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 VATVSLPR Delta:H(4)C(2)@N-term 0.00362219009548426 869.537048339844 435.7758 869.533447265625 435.774017333984 2 6 1.1.1.5046.2 1 54.109 473.2332 54.0791 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 VATVSLPR Delta:H(4)C(2)@N-term 0.00404943013563752 869.537475585938 435.776 869.533447265625 435.774017333984 2 6 1.1.1.5606.2 1 67.6949 171.4736 67.6879 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 VATVSLPR Delta:H(4)C(2)@N-term 0.00465977005660534 869.5380859375 435.7763 869.533447265625 435.774017333984 2 8 1.1.1.5900.2 1 71.7716 145.1752 71.7342 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 VATVSLPR Delta:H(4)C(2)@N-term 0.00282875006087124 869.536254882813 435.7754 869.533447265625 435.774017333984 2 8 1.1.1.5919.2 1 72.1254 160.8361 72.1063 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 VATVSLPR Delta:H(4)C(2)@N-term 0.00423253001645207 869.537658691406 435.7761 869.533447265625 435.774017333984 2 7 1.1.1.5928.2 1 72.2995 158.6497 72.3617 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 VATVSLPR Delta:H(4)C(2)@N-term 0.00386633002199233 869.537292480469 435.7759 869.533447265625 435.774017333984 2 6 1.1.1.5976.3 1 73.2663 186.3876 73.2773 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 VATVSLPR Delta:H(4)C(2)@N-term 0.00362219009548426 869.537048339844 435.7758 869.533447265625 435.774017333984 2 9 1.1.1.6017.2 1 74.1814 493.6351 74.3629 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 VATVSLPR Delta:H(4)C(2)@N-term 0.00362219009548426 869.537048339844 435.7758 869.533447265625 435.774017333984 2 9 1.1.1.6025.3 1 74.3519 490.6499 74.3629 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 VATVSLPR Delta:H(4)C(2)@N-term 0.00362219009548426 869.537048339844 435.7758 869.533447265625 435.774017333984 2 8 1.1.1.6040.2 1 74.6935 504.5502 74.5809 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 VATVSLPR Delta:H(4)C(2)@N-term 0.00325599010102451 869.536682128906 435.7756 869.533447265625 435.774017333984 2 7 1.1.1.6085.2 1 75.7232 643.2404 75.7408 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.3799977302551 VATVSLPR Formyl@N-term 0.0396414995193481 869.536682128906 435.7756 869.4970703125 435.755798339844 2 8 1.1.1.6092.2 1 75.8933 729.8909 75.8618 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.2300026416779 VATVSLPR Deamidated(R)@8 0.0216217003762722 842.507873535156 422.2612 842.486145019531 422.250366210938 2 10 1.1.1.4258.2 1 35.348 81041.23 35.106 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.2300026416779 VATVSLPR Delta:H(4)C(2)@N-term 0.00359337008558214 869.537048339844 435.7758 869.533447265625 435.774017333984 2 7 1.1.1.4913.3 1 50.8423 764.1767 50.8624 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 54.040002822876 VATVSLPR Deamidated(R)@8 0.0242461003363132 842.510498046875 422.2625 842.486145019531 422.250366210938 2 10 1.1.1.4205.4 1 34.0825 197590.8 34.1018 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 54.040002822876 VATVSLPR Acetyl@N-term 0.00278901006095111 883.515502929688 442.765 883.5126953125 442.763641357422 2 10 1.1.1.4290.5 1 36.1265 17392.01 36.0871 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 VATVSLPR Dioxidation(P)@7 -0.000675155024509877 873.491271972656 437.7529 873.492004394531 437.753265380859 2 11 1.1.1.4222.5 1 34.4939 17765.56 34.3893 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 VATVSLPR Pro->pyro-Glu(P)@7 0.0403080992400646 855.521667480469 428.7681 855.4814453125 428.747985839844 2 11 1.1.1.4245.4 1 35.0414 358930.5 35.2014 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 VATVSLPR Pro->pyro-Glu(P)@7 0.0398808009922504 855.521301269531 428.7679 855.4814453125 428.747985839844 2 11 1.1.1.4266.5 1 35.5441 219103.4 35.2968 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 VATVSLPR Pro->pyro-Glu(P)@7 0.0390873998403549 855.520446777344 428.7675 855.4814453125 428.747985839844 2 11 1.1.1.4287.2 1 36.044 19030.13 35.9198 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 VATVSLPR Pro->pyro-Glu(P)@7 0.0390873998403549 855.520446777344 428.7675 855.4814453125 428.747985839844 2 11 1.1.1.4302.3 1 36.4074 6051.391 36.3256 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 VATVSLPR Pro->pyro-Glu(P)@7 0.0389043018221855 855.520263671875 428.7674 855.4814453125 428.747985839844 2 11 1.1.1.4309.3 1 36.5732 5879.761 36.5643 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 VATVSLPR Pro->pyro-Glu(P)@7 0.0389043018221855 855.520263671875 428.7674 855.4814453125 428.747985839844 2 11 1.1.1.4316.5 1 36.7437 5447.821 36.8287 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 VATVSLPR Deamidated(R)@8 0.023818900808692 842.510070800781 422.2623 842.486145019531 422.250366210938 2 8 1.1.1.4359.3 1 37.7946 1527.58 37.8633 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 VATVSLPR Delta:H(4)C(2)@N-term 0.00817091017961502 869.541687011719 435.7781 869.533447265625 435.774017333984 2 9 1.1.1.4445.3 1 39.8134 1274.308 39.7317 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.800000667572 VATVSLPR Delta:H(2)C(2)@N-term 0.0170894004404545 867.534851074219 434.7747 867.517822265625 434.766174316406 2 10 1.1.1.4559.2 1 42.4176 801.4472 42.2332 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.5699982643127 VATVSLPR 0.00767344981431961 841.509887695313 421.7622 841.502136230469 421.758361816406 2 8 1.1.1.4895.2 1 50.4054 1847.04 50.3541 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.6699987649918 VATVSLPR 0.00467533990740776 841.506896972656 421.7607 841.502136230469 421.758361816406 2 8 1.1.1.5094.2 1 55.2059 1219.702 54.9572 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.6699987649918 VATVSLPR 0.00748291006311774 841.509643554688 421.7621 841.502136230469 421.758361816406 2 8 1.1.1.5173.2 1 57.172 625.5529 57.144 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.6699987649918 VATVSLPR 0.00247811991721392 841.504699707031 421.7596 841.502136230469 421.758361816406 2 8 1.1.1.5368.2 1 61.9209 619.7582 61.9175 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 44.8300004005432 VATVSLPR Formyl@N-term 0.00274824001826346 869.499877929688 435.7572 869.4970703125 435.755798339844 2 10 1.1.1.4251.4 1 35.1847 9611.165 35.2014 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 44.8300004005432 VATVSLPR Dehydrated(T)@3 0.00264857988804579 823.494262695313 412.7544 823.491577148438 412.753082275391 2 8 1.1.1.4255.3 1 35.2783 14999.46 35.0582 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 44.8300004005432 VATVSLPR Delta:H(2)C(2)@N-term 0.00646949000656605 867.524291992188 434.7694 867.517822265625 434.766174316406 2 10 1.1.1.4534.3 1 41.8171 1236.029 41.8068 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9199993610382 VATVSLPR 0.00504154991358519 841.507263183594 421.7609 841.502136230469 421.758361816406 2 8 1.1.1.5034.3 1 53.8118 1242.024 53.8568 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9199993610382 VATVSLPR 0.00504154991358519 841.507263183594 421.7609 841.502136230469 421.758361816406 2 8 1.1.1.5087.2 1 55.0332 1393.023 54.8851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9199993610382 VATVSLPR 0.00467533990740776 841.506896972656 421.7607 841.502136230469 421.758361816406 2 8 1.1.1.5110.3 1 55.6072 755.5173 55.6027 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9199993610382 VATVSLPR 0.00485845003277063 841.507080078125 421.7608 841.502136230469 421.758361816406 2 8 1.1.1.5142.2 1 56.4159 614.9758 56.4119 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9199993610382 VATVSLPR 0.00345466006547213 841.505676269531 421.7601 841.502136230469 421.758361816406 2 8 1.1.1.5305.2 1 60.4517 421.2654 60.4718 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9199993610382 VATVSLPR 0.00467533990740776 841.506896972656 421.7607 841.502136230469 421.758361816406 2 8 1.1.1.5471.2 1 64.4463 449.9702 64.3446 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9199993610382 VATVSLPR 0.00302743003703654 841.505249023438 421.7599 841.502136230469 421.758361816406 2 8 1.1.1.5499.2 1 65.1324 410.5605 65.1768 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9199993610382 VATVSLPR 0.00443120999261737 841.506652832031 421.7606 841.502136230469 421.758361816406 2 8 1.1.1.5506.2 1 65.3045 410.5605 65.1768 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9199993610382 VATVSLPR 0.00583499018102884 841.508056640625 421.7613 841.502136230469 421.758361816406 2 8 1.1.1.5514.2 1 65.5065 259.3572 65.6265 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.4400001764297 VATVSLPR Formyl@N-term -0.0294166002422571 869.467651367188 435.7411 869.4970703125 435.755798339844 2 11 1.1.1.4244.4 1 35.0293 1406.061 34.8912 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.4400001764297 VATVSLPR Delta:H(2)C(2)@N-term 0.00567605020478368 867.523498535156 434.769 867.517822265625 434.766174316406 2 10 1.1.1.4501.4 1 41.088 5641.524 41.2978 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 41.5499985218048 VATVSLPR 0.0102979000657797 841.512451171875 421.7635 841.502136230469 421.758361816406 2 9 1.1.1.4808.3 1 48.3072 1607.443 48.1803 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 41.5499985218048 VATVSLPR 0.00669691013172269 841.508850097656 421.7617 841.502136230469 421.758361816406 2 8 1.1.1.4997.3 1 52.9008 1792.438 52.8718 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 40.0200009346008 VATVSLPR Delta:H(4)C(2)@N-term 0.00817091017961502 869.541687011719 435.7781 869.533447265625 435.774017333984 2 10 1.1.1.4412.4 1 39.0727 1710.644 39.054 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.4699990749359 VATVSLPR 0.00467533990740776 841.506896972656 421.7607 841.502136230469 421.758361816406 2 7 1.1.1.5117.2 1 55.7821 755.5173 55.6027 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.4699990749359 VATVSLPR 0.00266122003085911 841.5048828125 421.7597 841.502136230469 421.758361816406 2 9 1.1.1.6213.2 1 78.7547 1322.903 78.6474 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.4699990749359 VATVSLPR 0.0020508801098913 841.504272460938 421.7594 841.502136230469 421.758361816406 2 8 1.1.1.6233.2 1 79.227 1058.623 79.1716 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.5900000333786 VATVSLPR Pro->pyro-Glu(P)@7 0.00149053998757154 855.482849121094 428.7487 855.4814453125 428.747985839844 2 9 1.1.1.4205.6 1 34.085 20161.3 34.0778 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.5900000333786 VATVSLPR Deamidated(R)@8 0.0208282005041838 842.507080078125 422.2608 842.486145019531 422.250366210938 2 6 1.1.1.4320.7 1 36.8361 5298.696 36.6363 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.4300003051758 VATVSLPR 0.00302743003703654 841.505249023438 421.7599 841.502136230469 421.758361816406 2 8 1.1.1.5593.2 1 67.3705 398.5718 67.3897 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 36.4399999380112 VATVSLPR 0.00467533990740776 841.506896972656 421.7607 841.502136230469 421.758361816406 2 8 1.1.1.5025.2 1 53.5877 1582.72 53.6086 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 36.4399999380112 VATVSLPR 0.00467533990740776 841.506896972656 421.7607 841.502136230469 421.758361816406 2 7 1.1.1.5103.2 1 55.4316 755.5173 55.6027 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 36.4399999380112 VATVSLPR 0.0018677799962461 841.504089355469 421.7593 841.502136230469 421.758361816406 2 7 1.1.1.5199.2 1 57.8239 220.5412 57.7935 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 36.4399999380112 VATVSLPR 0.00302743003703654 841.505249023438 421.7599 841.502136230469 421.758361816406 2 8 1.1.1.5569.2 1 66.8455 439.8596 66.8648 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 35.7600003480911 VATVSLPR 0.00688001001253724 841.509094238281 421.7618 841.502136230469 421.758361816406 2 8 1.1.1.4990.3 1 52.7295 1623.889 52.7254 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 35.479998588562 VATVSLPR 0.00504154991358519 841.507263183594 421.7609 841.502136230469 421.758361816406 2 7 1.1.1.5131.2 1 56.1382 573.2709 56.1591 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 35.1500004529953 VATVSLPR Arg->GluSA(R)@8 -0.000910968985408545 798.447875976563 400.2312 798.44873046875 400.231628417969 2 8 1.1.1.4227.2 1 34.6084 889.4323 34.6524 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 35.1500004529953 VATVSLPR Delta:H(4)C(2)@N-term 0.00518024992197752 869.538696289063 435.7766 869.533447265625 435.774017333984 2 9 1.1.1.4427.4 1 39.4235 1724.411 39.1731 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 35.1500004529953 VATVSLPR Delta:H(4)C(2)@N-term 0.00756056979298592 869.541076660156 435.7778 869.533447265625 435.774017333984 2 9 1.1.1.4582.4 1 42.9558 598.4739 42.9913 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 35.1500004529953 VATVSLPR Delta:H(4)C(2)@N-term 0.00255579990334809 869.536071777344 435.7753 869.533447265625 435.774017333984 2 6 1.1.1.4968.2 1 52.1967 592.8035 52.1674 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.6199998855591 VATVSLPR 0.00284431991167367 841.505065917969 421.7598 841.502136230469 421.758361816406 2 8 1.1.1.5011.2 1 53.2434 1741.765 53.215 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.2800000905991 VATVSLPR 0.00688001001253724 841.509094238281 421.7618 841.502136230469 421.758361816406 2 8 1.1.1.4794.3 1 47.9649 1688.515 48.0093 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.2800000905991 VATVSLPR 0.00688001001253724 841.509094238281 421.7618 841.502136230469 421.758361816406 2 8 1.1.1.4972.2 1 52.2965 1988.204 52.3896 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 32.7199995517731 VATVSLPR 0.00504154991358519 841.507263183594 421.7609 841.502136230469 421.758361816406 2 8 1.1.1.5561.2 1 66.6666 405.0236 66.6603 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 32.7199995517731 VATVSLPR 0.00504154991358519 841.507263183594 421.7609 841.502136230469 421.758361816406 2 8 1.1.1.5578.2 1 67.016 399.0095 67.0087 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 32.7199995517731 VATVSLPR 0.00266122003085911 841.5048828125 421.7597 841.502136230469 421.758361816406 2 8 1.1.1.5852.2 1 70.8486 367.3 70.9149 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.8500012159348 VATVSLPR 0.00247811991721392 841.504699707031 421.7596 841.502136230469 421.758361816406 2 7 1.1.1.5293.2 1 60.152 526.2145 59.9714 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.8500012159348 VATVSLPR 0.00266122003085911 841.5048828125 421.7597 841.502136230469 421.758361816406 2 8 1.1.1.5859.2 1 71.0177 322.0296 71.0113 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.8500012159348 VATVSLPR 0.00266122003085911 841.5048828125 421.7597 841.502136230469 421.758361816406 2 8 1.1.1.6185.2 1 78.0437 1367.132 78.089 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.8500012159348 VATVSLPR 0.00223397999070585 841.504455566406 421.7595 841.502136230469 421.758361816406 2 8 1.1.1.6192.2 1 78.2199 1233.702 78.3926 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.5600007772446 VATVSLPR Delta:H(4)C(2)@N-term 0.00343908998183906 869.536865234375 435.7757 869.533447265625 435.774017333984 2 5 1.1.1.5508.2 1 65.3559 175.0169 65.275 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.4399987459183 VATVSLPR 0.00730725005269051 841.509460449219 421.762 841.502136230469 421.758361816406 2 9 1.1.1.4573.3 1 42.7377 1738.375 42.6596 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 30.9899985790253 VATVSLPR 0.00528567982837558 841.507446289063 421.761 841.502136230469 421.758361816406 2 8 1.1.1.5585.2 1 67.1907 385.8495 67.1334 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 30.9899985790253 VATVSLPR 0.00266122003085911 841.5048828125 421.7597 841.502136230469 421.758361816406 2 9 1.1.1.6240.2 1 79.4088 934.2919 79.2983 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 30.2700012922287 VATVSLPR Formyl@N-term -0.0314306989312172 869.465698242188 435.7401 869.4970703125 435.755798339844 2 11 1.1.1.4230.5 1 34.6876 1451.148 34.6763 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 30.2700012922287 VATVSLPR Dehydrated(T)@3 0.00765335001051426 823.499267578125 412.7569 823.491577148438 412.753082275391 2 8 1.1.1.4305.3 1 36.4748 826.8664 36.5163 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 30.1600009202957 VATVSLPR 0.00247811991721392 841.504699707031 421.7596 841.502136230469 421.758361816406 2 8 1.1.1.5989.2 1 73.5041 479.3584 73.423 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.339998960495 VATVSLPR 0.00302743003703654 841.505249023438 421.7599 841.502136230469 421.758361816406 2 9 1.1.1.5997.2 1 73.6841 841.4493 73.8685 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.4000009298325 VATVSLPR 0.00688001001253724 841.509094238281 421.7618 841.502136230469 421.758361816406 2 10 1.1.1.4930.2 1 51.2592 2063.794 51.2052 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.0800014734268 VATVSLPR 0.00669691013172269 841.508850097656 421.7617 841.502136230469 421.758361816406 2 8 1.1.1.4951.2 1 51.7725 1909.944 51.8181 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.8400003910065 VATVSLPR Amidated@C-term 0.00330757000483572 840.521484375 421.268 840.518127441406 421.266357421875 2 8 1.1.1.4150.6 1 32.7817 830.5421 32.8662 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.7700006961823 VATVSLPR 0.00546878995373845 841.507690429688 421.7611 841.502136230469 421.758361816406 2 8 1.1.1.6226.2 1 79.0533 1079.003 79.0725 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.7599990367889 VATVSLPR 0.00688001001253724 841.509094238281 421.7618 841.502136230469 421.758361816406 2 8 1.1.1.4944.2 1 51.6002 1964.579 51.5228 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.1299988031387 VATVSLPR 0.00504900002852082 841.507263183594 421.7609 841.502136230469 421.758361816406 2 8 1.1.1.4843.4 1 49.1613 1308.802 49.2289 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 26.2100011110306 VATVSLPR 0.00407245988026261 841.506286621094 421.7604 841.502136230469 421.758361816406 2 10 1.1.1.4238.3 1 34.8728 470041.8 34.8912 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.6099998950958 VATVSLPR 0.00730725005269051 841.509460449219 421.762 841.502136230469 421.758361816406 2 9 1.1.1.4564.4 1 42.526 1738.375 42.6596 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.5499988794327 VATVSLPR 0.00467533990740776 841.506896972656 421.7607 841.502136230469 421.758361816406 2 8 1.1.1.5600.2 1 67.5471 418.9328 67.5888 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.5499988794327 VATVSLPR 0.00266122003085911 841.5048828125 421.7597 841.502136230469 421.758361816406 2 8 1.1.1.6206.2 1 78.5763 1322.903 78.6474 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.4200011491776 VATVSLPR Delta:H(4)C(2)@N-term 0.00475300988182426 869.538269042969 435.7764 869.533447265625 435.774017333984 2 9 1.1.1.4373.4 1 38.1356 1876.167 38.1021 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.4200011491776 VATVSLPR Delta:H(4)C(2)@N-term 0.00499715004116297 869.538452148438 435.7765 869.533447265625 435.774017333984 2 9 1.1.1.4533.3 1 41.7934 710.0325 41.7831 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.4200011491776 VATVSLPR Delta:H(2)C(2)@N-term 0.00506570981815457 867.522888183594 434.7687 867.517822265625 434.766174316406 2 9 1.1.1.4542.4 1 42.0049 1204.493 41.9253 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.4200011491776 VATVSLPR Delta:H(2)C(2)@N-term 0.00884980987757444 867.526672363281 434.7706 867.517822265625 434.766174316406 2 9 1.1.1.4550.3 1 42.1986 973.7543 42.1384 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.4200011491776 VATVSLPR Delta:H(4)C(2)@N-term 0.00554645014926791 869.5390625 435.7768 869.533447265625 435.774017333984 2 8 1.1.1.4939.4 1 51.4815 810.4785 51.5228 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.3100007772446 VATVSLPR 0.00407245988026261 841.506286621094 421.7604 841.502136230469 421.758361816406 2 10 1.1.1.4211.3 1 34.2347 720527.1 34.1737 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.3100007772446 VATVSLPR 0.00407245988026261 841.506286621094 421.7604 841.502136230469 421.758361816406 2 10 1.1.1.4225.2 1 34.5606 615917.9 34.5329 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.3100007772446 VATVSLPR 0.0064527802169323 841.508666992188 421.7616 841.502136230469 421.758361816406 2 8 1.1.1.4822.2 1 48.6483 1628.425 48.693 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 24.8400002717972 VATVSLPR 0.00528567982837558 841.507446289063 421.761 841.502136230469 421.758361816406 2 8 1.1.1.5867.2 1 71.1941 352.7878 71.1624 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 24.49000030756 VATVSLPR 0.00528567982837558 841.507446289063 421.761 841.502136230469 421.758361816406 2 8 1.1.1.5545.2 1 66.287 337.1204 66.1283 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.8499999046326 VATVSLPR 0.00407245988026261 841.506286621094 421.7604 841.502136230469 421.758361816406 2 10 1.1.1.4232.2 1 34.7279 617788.3 34.4851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.8499999046326 VATVSLPR 0.00407245988026261 841.506286621094 421.7604 841.502136230469 421.758361816406 2 10 1.1.1.4239.2 1 34.8949 470041.8 34.8912 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.8499999046326 VATVSLPR 0.00388935999944806 841.506103515625 421.7603 841.502136230469 421.758361816406 2 10 1.1.1.4246.4 1 35.0628 403307.8 35.0582 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.4699994325638 VATVSLPR 0.00302743003703654 841.505249023438 421.7599 841.502136230469 421.758361816406 2 8 1.1.1.5326.2 1 60.9431 924.2838 60.9852 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.4699994325638 VATVSLPR 0.00546878995373845 841.507690429688 421.7611 841.502136230469 421.758361816406 2 8 1.1.1.5811.2 1 70.3409 348.5855 70.3576 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.1600001454353 VATVSLPR Delta:H(4)C(2)@N-term 0.00343908998183906 869.536865234375 435.7757 869.533447265625 435.774017333984 2 8 1.1.1.5956.2 1 72.8775 167.5338 72.8827 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.8100001811981 VATVSLPR 0.00467533990740776 841.506896972656 421.7607 841.502136230469 421.758361816406 2 8 1.1.1.5530.2 1 65.9101 356.3692 65.9277 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.4600002169609 VATVSLPR 0.00407245988026261 841.506286621094 421.7604 841.502136230469 421.758361816406 2 10 1.1.1.4218.3 1 34.3949 575978.3 34.3893 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1799999475479 VATVSLPR 0.00407245988026261 841.506286621094 421.7604 841.502136230469 421.758361816406 2 10 1.1.1.4204.3 1 34.0644 720628.5 34.1018 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 VATVSLPR 0.00485845003277063 841.507080078125 421.7608 841.502136230469 421.758361816406 2 8 1.1.1.5042.2 1 54.0093 1293.445 53.9798 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 VATVSLPR 0.00528567982837558 841.507446289063 421.761 841.502136230469 421.758361816406 2 9 1.1.1.5066.2 1 54.5312 1547.893 54.4734 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 VATVSLPR 0.00546878995373845 841.507690429688 421.7611 841.502136230469 421.758361816406 2 8 1.1.1.5317.2 1 60.7478 889.0087 60.79 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 VATVSLPR 0.00467533990740776 841.506896972656 421.7607 841.502136230469 421.758361816406 2 6 1.1.1.5523.2 1 65.7322 352.7393 65.9277 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 VATVSLPR 0.00528567982837558 841.507446289063 421.761 841.502136230469 421.758361816406 2 8 1.1.1.5538.2 1 66.1116 337.1204 66.1283 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 VATVSLPR 0.00467533990740776 841.506896972656 421.7607 841.502136230469 421.758361816406 2 9 1.1.1.5626.2 1 68.0658 423.0823 68.1724 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 VATVSLPR 0.00284431991167367 841.505065917969 421.7598 841.502136230469 421.758361816406 2 9 1.1.1.5935.2 1 72.4416 450.98 72.3976 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 VATVSLPR 0.00504154991358519 841.507263183594 421.7609 841.502136230469 421.758361816406 2 8 1.1.1.5945.2 1 72.6206 472.097 72.5851 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 VATVSLPR 0.00266122003085911 841.5048828125 421.7597 841.502136230469 421.758361816406 2 9 1.1.1.5953.2 1 72.805 452.1225 72.8585 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 VATVSLPR 0.00266122003085911 841.5048828125 421.7597 841.502136230469 421.758361816406 2 9 1.1.1.6049.3 1 74.9022 1395.023 74.8586 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 VATVSLPR 0.00247811991721392 841.504699707031 421.7596 841.502136230469 421.758361816406 2 8 1.1.1.6064.3 1 75.2334 1710.141 75.3001 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.1699997782707 VATVSLPR 0.00284431991167367 841.505065917969 421.7598 841.502136230469 421.758361816406 2 9 1.1.1.6149.3 1 77.2783 1450.396 77.2459 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 21.6399997472763 VATVSLPR 0.00504900002852082 841.507263183594 421.7609 841.502136230469 421.758361816406 2 9 1.1.1.4459.2 1 40.1408 1737.073 40.1363 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 20.6699997186661 VATVSLPR Delta:H(4)C(2)@N-term 0.00615679007023573 869.539672851563 435.7771 869.533447265625 435.774017333984 2 9 1.1.1.4644.2 1 44.4021 694.8682 44.3715 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.310000538826 VATVSLPR 0.0046827900223434 841.506896972656 421.7607 841.502136230469 421.758361816406 2 8 1.1.1.4853.3 1 49.402 1698.038 49.5402 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.1599994897842 VATVSLPR 0.00284431991167367 841.505065917969 421.7598 841.502136230469 421.758361816406 2 9 1.1.1.6107.2 1 76.2549 1821.135 76.103 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.350000679493 VATVSLPR Pro->pyro-Glu(P)@7 0.0390873998403549 855.520446777344 428.7675 855.4814453125 428.747985839844 2 9 1.1.1.4344.3 1 37.4181 1568.815 37.2899 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.350000679493 VATVSLPR Delta:H(4)C(2)@N-term 0.00853710994124413 869.542053222656 435.7783 869.533447265625 435.774017333984 2 8 1.1.1.4453.6 1 40.0044 1332.979 39.9932 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.350000679493 VATVSLPR Delta:H(2)C(2)@N-term 0.00408917013555765 867.521850585938 434.7682 867.517822265625 434.766174316406 2 9 1.1.1.4523.2 1 41.593 9219.613 41.3453 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.350000679493 VATVSLPR Delta:H(4)C(2)@N-term 0.00554645014926791 869.5390625 435.7768 869.533447265625 435.774017333984 2 8 1.1.1.4996.2 1 52.8778 674.1866 52.9209 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.0800005793571 VATVSLPR 0.00730725005269051 841.509460449219 421.762 841.502136230469 421.758361816406 2 8 1.1.1.4752.3 1 46.9444 1644.234 46.8674 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.0399999022484 VATVSLPR 0.00302743003703654 841.505249023438 421.7599 841.502136230469 421.758361816406 2 8 1.1.1.5607.2 1 67.7204 426.8141 67.7618 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.0399999022484 VATVSLPR 0.00443120999261737 841.506652832031 421.7606 841.502136230469 421.758361816406 2 9 1.1.1.5635.2 1 68.2415 431.0363 68.2711 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.0399999022484 VATVSLPR 0.00302743003703654 841.505249023438 421.7599 841.502136230469 421.758361816406 2 8 1.1.1.5916.2 1 72.0625 365.738 72.0204 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.0399999022484 VATVSLPR 0.00284431991167367 841.505065917969 421.7598 841.502136230469 421.758361816406 2 8 1.1.1.5979.2 1 73.3184 444.5951 73.3318 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.0399999022484 VATVSLPR 0.00302743003703654 841.505249023438 421.7599 841.502136230469 421.758361816406 2 9 1.1.1.6018.3 1 74.2 1156.979 74.1865 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.4999997019768 VATVSLPR 0.00485845003277063 841.507080078125 421.7608 841.502136230469 421.758361816406 2 9 1.1.1.5645.2 1 68.4138 426.9346 68.4189 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.4999997019768 VATVSLPR 0.00467533990740776 841.506896972656 421.7607 841.502136230469 421.758361816406 2 9 1.1.1.5683.2 1 68.9615 362.346 68.9415 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.4999997019768 VATVSLPR 0.00485845003277063 841.507080078125 421.7608 841.502136230469 421.758361816406 2 9 1.1.1.5884.2 1 71.5466 372.3892 71.6247 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.4999997019768 VATVSLPR 0.00302743003703654 841.505249023438 421.7599 841.502136230469 421.758361816406 2 8 1.1.1.5926.2 1 72.2509 378.7613 72.191 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.4999997019768 VATVSLPR 0.00247811991721392 841.504699707031 421.7596 841.502136230469 421.758361816406 2 9 1.1.1.6093.2 1 75.9207 1811.795 75.8618 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.4999997019768 VATVSLPR 0.00266122003085911 841.5048828125 421.7597 841.502136230469 421.758361816406 2 9 1.1.1.6135.2 1 76.935 1854.997 76.9767 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.3700004816055 VATVSLPR 0.00504900002852082 841.507263183594 421.7609 841.502136230469 421.758361816406 2 9 1.1.1.4548.3 1 42.1453 1659.969 42.1621 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 16.4599999785423 VATVSLPR 0.00485845003277063 841.507080078125 421.7608 841.502136230469 421.758361816406 2 9 1.1.1.5696.2 1 69.134 329.5391 69.096 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 16.4599999785423 VATVSLPR 0.00302743003703654 841.505249023438 421.7599 841.502136230469 421.758361816406 2 9 1.1.1.5775.2 1 70.0039 280.0346 69.978 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 16.4599999785423 VATVSLPR 0.00284431991167367 841.505065917969 421.7598 841.502136230469 421.758361816406 2 9 1.1.1.5894.2 1 71.7169 307.8697 71.7342 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 16.2100002169609 VATVSLPR 0.00688001001253724 841.509094238281 421.7618 841.502136230469 421.758361816406 2 7 1.1.1.4958.4 1 51.9476 1555.393 52.0423 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 16.0600006580353 VATVSLPR Dioxidation(P)@7 0.00457376008853316 873.496704101563 437.7556 873.492004394531 437.753265380859 2 10 1.1.1.4257.3 1 35.3276 3123.466 35.2968 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.9600004553795 VATVSLPR 0.00485845003277063 841.507080078125 421.7608 841.502136230469 421.758361816406 2 9 1.1.1.5714.2 1 69.301 344.743 69.3306 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.9600004553795 VATVSLPR 0.00266122003085911 841.5048828125 421.7597 841.502136230469 421.758361816406 2 9 1.1.1.5906.2 1 71.9001 343.9854 71.881 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.4599994421005 VATVSLPR 0.00284431991167367 841.505065917969 421.7598 841.502136230469 421.758361816406 2 9 1.1.1.5051.2 1 54.2166 1555.918 54.1772 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.1700004935265 VATVSLPR Delta:H(4)C(2)@N-term 0.00362219009548426 869.537048339844 435.7758 869.533447265625 435.774017333984 2 8 1.1.1.5876.2 1 71.425 155.2543 71.4056 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.639999628067 VATVSLPRSCAAAGTECLISGWGNTK Carbamidomethyl(C)@10; No Carbamidomethyl(C)@17; Deamidated(N)@24 missed R-S@8 0.000678243988659233 2649.28979492188 884.1039 2649.2890625 884.103637695313 3 12 1.1.1.4978.4 1 52.4495 2654.047 52.509 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.7699998021126 VATVSLPRSCAAAGTECLISGWGNTK Carbamidomethyl(C)@10; Carbamidomethyl(C)@17; acrolein addition +56(K)@26 missed R-S@8 0.00867452006787062 2761.36157226563 921.4611 2761.35278320313 921.458190917969 3 10 1.1.1.5136.10 1 56.2718 1004.703 56.2348 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.01313710026443 1869.83349609375 935.924 1869.8203125 935.917419433594 2 18 1.1.1.5525.2 1 65.7857 679.6524 65.8526 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.01313710026443 1869.83349609375 935.924 1869.8203125 935.917419433594 2 18 1.1.1.5535.3 1 66.0425 679.6524 65.8526 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.01313710026443 1869.83349609375 935.924 1869.8203125 935.917419433594 2 16 1.1.1.5532.4 1 65.9726 679.6524 65.8526 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.0135033996775746 1869.83386230469 935.9242 1869.8203125 935.917419433594 2 15 1.1.1.5544.4 1 66.2669 185.8319 66.2287 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8500008583069 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@6; Ammonia-loss(N)@18; Carbamidomethyl(C)@24; reduced HNE(H)@39; Carbamidomethyl(C)@40; Carbamidomethyl(Y)@41; acrolein addition +56(K)@42 cleaved I-V@N-term 0.012364299967885 4800.25341796875 961.058 4800.2412109375 961.055480957031 5 16 1.1.1.5048.3 1 54.1637 4955.505 54.23 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.1300022602081 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Dehydrated(T)@5; Carbamidomethyl(C)@6; Carbamidomethyl(C)@24; Deamidated(N)@30; reduced HNE(H)@39; Carbamidomethyl(C)@40; acrolein addition +56(K)@42 cleaved I-V@N-term 0.00593621982261539 4743.2255859375 949.6524 4743.2197265625 949.651184082031 5 12 1.1.1.5230.3 1 58.5993 599.7999 58.6417 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Dehydrated(T)@5; Carbamidomethyl(C)@6; Carbamidomethyl(C)@24; Carbamidomethyl(C)@40; Delta:H(4)C(2)(K)@42 cleaved I-V@N-term; missed K-S@42 0.0440689995884895 4799.28662109375 1200.829 4799.2431640625 1200.81811523438 4 15 1.1.1.5051.3 1 54.2249 770.8003 54.23 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.7699995040894 VNWIQQTIAAN cleaved Y-V@N-term 0.00336106005124748 1256.65466308594 629.3346 1256.6513671875 629.332946777344 2 13 1.1.1.4994.3 1 52.8287 488.8481 52.9455 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.1700012683868 VNWIQQTIAAN cleaved Y-V@N-term -0.0034747701138258 1256.64782714844 629.3312 1256.6513671875 629.332946777344 2 13 1.1.1.5008.5 1 53.1754 201.6923 53.1413 2 49.03 49.03 87.4400019645691 75.7799983024597 75.7799983024597 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 YVNWIQQTIAAN cleaved N-Y@N-term 0.00314623001031578 1419.71789550781 710.8662 1419.71472167969 710.864624023438 2 18 1.1.1.5126.3 1 56.0131 2143.33 55.9311 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 ALVDTLKFVTQAEGAK missed K-F@7 -0.00499279983341694 1689.92517089844 564.3157 1689.93017578125 564.317321777344 3 13 1.1.1.5012.3 1 53.2722 316.6349 53.1904 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 GESKLEVLNFDFQANAQLSNPK missed K-L@4 0.000103227997897193 2448.22875976563 817.0835 2448.228515625 817.083435058594 3 12 1.1.1.5020.13 1 53.4741 122.8048 53.4612 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 GNVATEISTER 0.00101647002156824 1175.57922363281 588.7969 1175.57824707031 588.79638671875 2 11 1.1.1.4100.15 1 31.7272 292.5836 31.66 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 IAELSATAQEIIK 0.00283508002758026 1385.77941894531 693.897 1385.77661132813 693.895568847656 2 16 1.1.1.4808.8 1 48.3113 434.2322 48.3273 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 IGQDGISTSATTNLK 0.00725839985534549 1504.78063964844 753.3976 1504.77331542969 753.393920898438 2 20 1.1.1.4277.9 1 35.8182 197.3874 35.7993 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 LGNNPVSK 0.00161122996360064 827.451843261719 414.7332 827.450134277344 414.732330322266 2 12 1.1.1.3687.2 1 23.9395 261.7525 23.8718 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 NSLKIEIPLPFGGK missed K-I@4 0.00596390012651682 1511.87731933594 756.9459 1511.87121582031 756.94287109375 2 12 1.1.1.5111.7 1 55.6356 303.976 55.6523 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 SVSDGIAALDLNAVANK 0.00578062981367111 1656.8740234375 829.4443 1656.86828613281 829.44140625 2 19 1.1.1.4940.7 1 51.5077 191.9705 51.5228 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 TGISPLALIK 0.00210743001662195 1011.63488769531 506.8247 1011.6328125 506.823699951172 2 10 1.1.1.5025.8 1 53.5927 1157.401 53.3874 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 1.95860815048218 99.0000009536743 KGNVATEISTER missed K-G@1 -0.00152227003127337 1303.67175292969 435.5645 1303.67321777344 435.565002441406 3 11 1.1.1.3973.4 1 28.7849 163.7327 28.7788 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.950782001018524 98.8300025463104 SHDELPR 0.00343768997117877 852.412475585938 427.2135 852.408996582031 427.211761474609 2 9 1.1.1.3645.2 1 23.2993 91.2312 23.288 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.443697482347488 94.9599981307983 ALVEQGFTVPEIK 0.0123728001490235 1429.79406738281 715.9043 1429.78173828125 715.898132324219 2 10 1.1.1.4915.7 1 50.8945 156.5068 50.8868 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.429457098245621 99.0000009536743 AALGKLPQQANDYLNSFNWER Dioxidation(W)@19 missed K-L@5 0.00107900996226817 2466.19384765625 823.0719 2466.19287109375 823.071533203125 3 22 1.1.1.5014.7 1 53.3265 403.4775 53.3627 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.375717908143997 93.5800015926361 QVFLYPEKDEPTYILNIKR missed K-D@8; missed K-R@18 0.00310931005515158 2365.27124023438 592.3251 2365.26806640625 592.324340820313 4 10 1.1.1.4920.7 1 51.0173 466.8993 51.0586 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.142667502164841 80.4700016975403 TEVIPPLIENR 0.00469456007704139 1279.71826171875 640.8664 1279.71362304688 640.864074707031 2 11 1.1.1.4790.7 1 47.876 445.5309 47.9364 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.0347982980310917 46.8300014734268 GTYGLSCQR Carbamidomethyl(C)@7 0.0017119999974966 1040.47265625 521.2436 1040.47094726563 521.242736816406 2 11 1.1.1.3992.2 1 29.2116 116.8303 29.2418 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.0168249271810055 29.5500010251999 NIKIPSR missed K-I@3 0.000898295023944229 826.503479003906 414.259 826.502502441406 414.258514404297 2 8 1.1.1.4004.2 1 29.501 75.8395 29.4896 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.0118871601298451 22.5899994373322 SVGFHLPSR 0.00702871009707451 998.536865234375 500.2757 998.52978515625 500.272155761719 2 6 1.1.1.4326.13 1 36.9872 182.2363 37.0232 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.00568284746259451 38.5500013828278 TLQGIPQMIGEVIR Oxidation(M)@8 0.00246682995930314 1569.85729980469 785.9359 1569.85485839844 785.934692382813 2 11 1.1.1.4993.5 1 52.8101 369.4848 52.7982 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.00392634514719248 95.6300020217896 NLQNNAEWVYQGAIR Dioxidation(W)@8 -0.0135201998054981 1806.85144042969 904.433 1806.86486816406 904.439758300781 2 12 1.1.1.4748.9 1 46.8624 428.8766 46.8917 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.00217691925354302 65.3400003910065 SGLLTSLK acrolein addition +38(K)@8 cleaved A-S@N-term 0.0209541991353035 855.527465820313 428.771 855.506591796875 428.760559082031 2 8 1.1.1.4665.3 1 44.8828 367.8464 44.9287 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.000434511806815863 18.350000679493 EKLTALTK acrolein addition +38(K)@8 missed K-L@2 -0.0249924007803202 940.534301757813 471.2744 940.559326171875 471.286956787109 2 9 1.1.1.4299.5 1 36.341 4954.14 36.0871 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 99.0000009536743 ALVDTLKFVTQAEGAK missed K-F@7 -0.00486139021813869 1689.92529296875 845.9699 1689.93017578125 845.972351074219 2 13 1.1.1.5008.9 1 53.182 149.6252 53.1904 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 98.7500011920929 ALVDTLKFVTQAEGAK missed K-F@7 -0.0036055298987776 1689.92651367188 564.3161 1689.93017578125 564.317321777344 3 12 1.1.1.5009.4 1 53.1983 316.504 53.1904 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 99.0000009536743 IAELSATAQEIIK 0.00283508002758026 1385.77941894531 693.897 1385.77661132813 693.895568847656 2 14 1.1.1.4811.12 1 48.3893 434.2322 48.3273 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 27.4500012397766 LGNNPVSK 0.00161122996360064 827.451843261719 414.7332 827.450134277344 414.732330322266 2 8 1.1.1.3674.2 1 23.7626 261.8399 23.8718 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 23.1600001454353 MNFKQELNGNTK Dethiomethyl(M)@1; hexanoyl addition +98(K)@4; Deamidated(N)@10; acrolein addition +38(K)@12 missed K-Q@4 -0.00707089016214013 1511.75512695313 756.8848 1511.76196289063 756.888305664063 2 10 1.1.1.6148.6 1 77.2621 3120.766 77.0009 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 25.4200011491776 NLQNNAEWVYQGAIR Dioxidation(W)@8 -0.0254829991608858 1806.83947753906 904.427 1806.86486816406 904.439758300781 2 9 1.1.1.4756.12 1 47.0554 245.0022 47.0132 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 62.4400019645691 SGLLTSLK acrolein addition +38(K)@8 cleaved A-S@N-term 0.0151559002697468 855.521667480469 428.7681 855.506591796875 428.760559082031 2 8 1.1.1.4263.3 1 35.47 332877.4 35.2253 3 22.38 22.38 33.3799988031387 4.84299995005131 3.72599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 99.0000009536743 TGISPLALIK 0.00210743001662195 1011.63488769531 506.8247 1011.6328125 506.823699951172 2 15 1.1.1.5018.4 1 53.4223 1157.401 53.3874 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 2 99.0000009536743 GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR -0.0086726201698184 2382.93579101563 795.3192 2382.94458007813 795.322143554688 3 33 1.1.1.3977.4 1 28.8917 525.3566 28.9253 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 2 99.0000009536743 GSGGGSSGGSIGGRGSSSGGVK missed R-G@14 -0.00422772020101547 1750.8154296875 584.6124 1750.81945800781 584.61376953125 3 16 1.1.1.3555.3 1 21.8799 163.2541 21.861 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 2 99.0000009536743 LALDLEIATYR 0.010733200237155 1276.71350097656 639.364 1276.70275878906 639.358642578125 2 14 1.1.1.5045.5 1 54.0859 163.3948 54.0791 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 2 99.0000009536743 MSGECAPNVSVSVSTSHTTISGGGSR Carbamidomethyl(C)@5 -0.00401098979637027 2564.15576171875 855.7258 2564.15942382813 855.727111816406 3 21 1.1.1.4358.17 1 37.7846 202.5555 37.7896 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 2 99.0000009536743 SLDLDSIIAEVK 0.0075084799900651 1301.71533203125 651.8649 1301.70788574219 651.861206054688 2 13 1.1.1.5244.3 1 58.9422 474.954 59.0126 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 2 99.0000009536743 SLDLDSIIAEVKAQYEDIAQK missed K-A@12 -0.00364548992365599 2348.20751953125 783.7431 2348.21118164063 783.744323730469 3 28 1.1.1.5684.2 1 68.986 244.8661 69.0034 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 2 99.0000009536743 SLNNQFASFIDKVR missed K-V@12 0.00103031005710363 1637.85363769531 546.9585 1637.8525390625 546.958129882813 3 13 1.1.1.5027.2 1 53.6378 1285.652 53.6825 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 2 99.0000009536743 TNAENEFVTIKK missed K-K@11 0.0034675900824368 1392.72839355469 465.2501 1392.72485351563 465.248901367188 3 16 1.1.1.4168.5 0 33.2097 988.2701 33.1741 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 1.88605630397797 99.0000009536743 QISNLQQSISDAEQRGENALK missed R-G@15 0.00884355045855045 2328.17602539063 777.0659 2328.1669921875 777.062927246094 3 14 1.1.1.4919.5 1 50.9944 223.0072 50.9848 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 1.74472737312317 99.0000009536743 AQYEDIAQK 0.00230099004693329 1064.51611328125 533.2653 1064.51379394531 533.264221191406 2 13 1.1.1.3985.3 1 29.0738 293.4965 29.1161 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 1.08618605136871 99.0000009536743 LRSEIDNVKK missed R-S@2; missed K-K@9 -0.00320999999530613 1200.67956542969 401.2338 1200.6826171875 401.234832763672 3 13 1.1.1.3747.2 1 24.6763 530.8684 24.7069 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 0.14206475019455 82.3000013828278 TLLEGEESR -0.00202822010032833 1032.50671386719 517.2606 1032.5087890625 517.261657714844 2 11 1.1.1.4050.6 1 30.5619 1333.815 30.5786 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 0.0942041128873825 74.4400024414063 DVDGAYMTK 0.000692031986545771 998.438659667969 500.2266 998.437927246094 500.226226806641 2 9 1.1.1.4025.5 1 30.0051 200.6939 30.0598 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 0.0877779424190521 99.0000009536743 FLEQQNQVLQTKWELLQQVDTSTR missed K-W@12 -0.991138994693756 2930.51806640625 977.8466 2931.50903320313 978.176940917969 3 15 1.1.1.5077.5 1 54.8049 545.0383 54.7894 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 0.0273344088345766 43.6800003051758 AEAESLYQSK -0.00293804006651044 1124.53210449219 563.2733 1124.53491210938 563.274780273438 2 10 1.1.1.4002.4 1 29.4556 93.7825 29.4161 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 0.0154726868495345 30.57000041008 THNLEPYFESFINNLRR missed R-R@16 -0.000547876989003271 2149.0703125 717.364 2149.07055664063 717.364135742188 3 10 1.1.1.5164.3 1 56.9531 771.7347 56.9976 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 0 99.0000009536743 TNAENEFVTIKK missed K-K@11 -0.00550166983157396 1392.71923828125 697.3669 1392.72485351563 697.369750976563 2 15 1.1.1.4166.6 1 33.169 394.3574 33.1504 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 0 99.0000009536743 TNAENEFVTIKK missed K-K@11 0.0034675900824368 1392.72839355469 465.2501 1392.72485351563 465.248901367188 3 15 1.1.1.4167.3 1 33.1801 988.2701 33.1741 4 21.09 21.09 56.6799998283386 32.6099991798401 29.8099994659424 sp|P04264|K2C1_HUMAN; cont|000135 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)] 0 66.2699997425079 TNAENEFVTIKK missed K-K@11 -0.0186877008527517 1392.70629882813 465.2427 1392.72485351563 465.248901367188 3 9 1.1.1.4171.5 1 33.2806 253.0083 33.2687 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 DIENQYETQITQIEHEVSSSGQEVQSSAK 0.00381091004237533 3263.51025390625 1088.844 3263.50659179688 1088.8427734375 3 16 1.1.1.5132.17 1 56.1758 228.9564 56.2095 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 FSSSGGGGGGGRFSSSSGYGGGSSR missed R-F@12 -0.00777216022834182 2197.9296875 733.6505 2197.93725585938 733.653015136719 3 22 1.1.1.3993.6 1 29.2367 328.1765 29.2418 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 FSSSSGYGGGSSR 0.000308451009914279 1234.52172851563 618.2681 1234.521484375 618.268005371094 2 18 1.1.1.3818.3 1 25.7857 673.9169 25.6976 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR -0.00192409998271614 2704.15161132813 902.3912 2704.15380859375 902.391906738281 3 35 1.1.1.4912.6 1 50.828 570.4153 50.8624 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 GGSGGSYGGGGSGGGYGGGSGSR 0.00443441979587078 1790.72485351563 896.3697 1790.72045898438 896.367492675781 2 39 1.1.1.3775.2 1 25.0508 235.2424 25.0805 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 HGVQELEIELQSQLSK 0.0105841998010874 1836.96862792969 919.4916 1836.95812988281 919.486328125 2 25 1.1.1.4977.5 1 52.4323 481.394 52.4135 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 IGLGGRGGSGGSYGR missed R-G@6 -0.00525924982503057 1349.6748046875 450.8989 1349.68005371094 450.900604248047 3 15 1.1.1.3980.4 1 28.9623 402.2064 28.9986 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 SGGGGGGGLGSGGSIR 0.00109759997576475 1231.59167480469 616.8031 1231.59057617188 616.802551269531 2 28 1.1.1.3937.3 1 27.988 889.3332 28.0977 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 STMQELNSR 0.00186587998177856 1064.49389648438 533.2542 1064.49206542969 533.253295898438 2 11 1.1.1.3965.4 1 28.5964 545.7629 28.4837 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 1.36653172969818 99.0000009536743 QGVDADINGLR 0.00409879023209214 1156.58764648438 579.3011 1156.58361816406 579.299072265625 2 9 1.1.1.4335.18 1 37.2089 190.3743 37.192 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0.790484964847565 99.0000009536743 SRSGGGGGGGLGSGGSIR cleaved L-S@N-term; missed R-S@2 -0.00396504998207092 1474.7197265625 492.5805 1474.7236328125 492.581817626953 3 19 1.1.1.3787.2 1 25.2535 438.7548 25.2757 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 36.370000243187 DLKDQIVDLTVGNNK hexanoyl addition +98(K)@3; Oxidation(D)@4; reduced acrolein addition +96(K)@15 cleaved D-D@N-term; missed K-D@3 0.0178874991834164 1881.02746582031 628.0164 1881.00952148438 628.010437011719 3 12 1.1.1.4593.4 0 43.2232 5985.637 43.3232 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 FSSSSGYGGGSSR 0.000308451009914279 1234.52172851563 618.2681 1234.521484375 618.268005371094 2 12 1.1.1.3808.2 1 25.6017 673.909 25.6976 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 SGGGGGGGLGSGGSIR 0.00109759997576475 1231.59167480469 616.8031 1231.59057617188 616.802551269531 2 28 1.1.1.3945.2 1 28.1662 889.3332 28.0977 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 STMQELNSR 0.00186587998177856 1064.49389648438 533.2542 1064.49206542969 533.253295898438 2 13 1.1.1.3958.4 1 28.4289 545.7629 28.4837 5 20.16 20.16 40.9299999475479 28.5699993371964 28.5699993371964 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 29.7100007534027 STMQELNSR Oxidation(M)@3 0.00421785982325673 1080.49133300781 541.2529 1080.48693847656 541.250732421875 2 9 1.1.1.3960.5 1 28.4753 128.2386 28.5085 6 9.29 9.29 31.6799998283386 14.5500004291534 14.5500004291534 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 2 99.0000009536743 GSLGGGFSSGGFSGGSFSR 0.00676677981391549 1706.77172851563 854.3931 1706.76489257813 854.389709472656 2 27 1.1.1.4732.8 1 46.4737 856.9795 46.5293 6 9.29 9.29 31.6799998283386 14.5500004291534 14.5500004291534 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 2 99.0000009536743 SLLEGEGSSGGGGR 0.00091763399541378 1261.5908203125 631.8027 1261.58984375 631.802185058594 2 18 1.1.1.4034.4 1 30.2298 507.782 30.3068 6 9.29 9.29 31.6799998283386 14.5500004291534 14.5500004291534 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 2 99.0000009536743 SSSSGSVGESSSKGP cleaved P-R@C-term; missed K-G@13 0.00222742999903858 1338.59204101563 670.3033 1338.58996582031 670.30224609375 2 20 1.1.1.3549.4 1 21.7357 182.5129 21.789 6 9.29 9.29 31.6799998283386 14.5500004291534 14.5500004291534 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 2 99.0000009536743 VTMQNLNDRLASYLDKVR missed R-L@9; missed K-V@16 -0.00542847998440266 2135.11059570313 534.7849 2135.11572265625 534.786193847656 4 17 1.1.1.5010.5 0 53.2213 856.2719 53.215 6 9.29 9.29 31.6799998283386 14.5500004291534 14.5500004291534 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 0.872895181179047 98.9600002765656 SQYEQLAEQNRK missed R-K@11 -0.00519799022004008 1492.72180175781 498.5812 1492.72705078125 498.582946777344 3 10 1.1.1.3972.5 1 28.762 493.1535 28.8278 6 9.29 9.29 31.6799998283386 14.5500004291534 14.5500004291534 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 0.390405595302582 95.5399990081787 DYSKYYK missed K-Y@4 0.00321546010673046 965.452697753906 483.7336 965.449462890625 483.731994628906 2 9 1.1.1.3999.4 1 29.3825 111.8746 29.3918 6 9.29 9.29 31.6799998283386 14.5500004291534 14.5500004291534 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 0.0186344906687737 38.9499992132187 SKELTTEIDNNIEQISSYKSEITELRR missed K-E@2; missed K-S@19; missed R-R@26 -0.00100019003730267 3195.625 799.9135 3195.6259765625 799.913757324219 4 9 1.1.1.5016.13 1 53.3757 221.3754 53.4366 6 9.29 9.29 31.6799998283386 14.5500004291534 14.5500004291534 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 0.00744648277759552 20.2000007033348 LAADDFRLKYENEVALRQSVEADINGLRR missed R-L@7; missed K-Y@9; missed R-Q@17; missed R-R@28 -0.0250467006117105 3360.72875976563 673.153 3360.75390625 673.158020019531 5 11 1.1.1.5003.3 1 53.0573 495.5458 52.9947 6 9.29 9.29 31.6799998283386 14.5500004291534 14.5500004291534 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 0 99.0000009536743 VTMQNLNDRLASYLDKVR missed R-L@9; missed K-V@16 0.00164278002921492 2135.11743164063 712.7131 2135.11572265625 712.712524414063 3 15 1.1.1.5008.6 0 53.177 562.0158 53.215 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 AKLEEQAQQIR missed K-L@2 -0.00397071009501815 1312.70593261719 657.3602 1312.7099609375 657.362243652344 2 12 1.1.1.3969.8 1 28.7011 178.4531 28.7544 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 LSKELQAAQAR missed K-E@3 -0.00211320002563298 1213.67578125 405.5659 1213.67785644531 405.566558837891 3 15 1.1.1.3881.2 1 27.0123 477.1284 27.065 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 1.45593166351318 99.0000009536743 LAVYQAGAR -0.00126734003424644 947.517700195313 474.7661 947.518859863281 474.766723632813 2 10 1.1.1.4054.5 1 30.6574 661.5827 30.6741 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.958607256412506 99.0000009536743 LGADMEDVCGR Oxidation(M)@5; Carbamidomethyl(C)@9 0.00423990003764629 1237.51110839844 619.7628 1237.50671386719 619.760620117188 2 10 1.1.1.3972.11 1 28.7721 217.2652 28.8278 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.638272106647491 98.1100022792816 TRDRLDEVKEQVAEVR missed R-D@2; missed R-L@4; missed K-E@9 -0.00530252000316978 1942.01770019531 486.5117 1942.02319335938 486.513092041016 4 13 1.1.1.4303.4 1 36.4395 569.7277 36.3969 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.174573883414268 88.4500026702881 RLAVYQAGAR missed R-L@1 -0.00114982004743069 1103.61889648438 552.8167 1103.61999511719 552.817260742188 2 8 1.1.1.3973.9 1 28.7932 98.1364 28.8033 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.156767219305038 87.0899975299835 GLSAIRER missed R-E@6 0.00261949002742767 900.516845703125 451.2657 900.514099121094 451.264343261719 2 10 1.1.1.3858.2 1 26.6358 82.1908 26.5923 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.126679390668869 84.0099990367889 LGPLVEQGRVR missed R-V@9 0.0026522499974817 1222.71728515625 612.3659 1222.71459960938 612.364562988281 2 9 1.1.1.4147.6 1 32.7189 0 -1 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.010550182312727 50.8099973201752 LQAEAFQAR 0.034469299018383 1032.56970214844 517.2921 1032.53527832031 517.27490234375 2 10 1.1.1.4121.3 0 32.167 265.8476 32.1568 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.00436480529606342 15.3200000524521 EGAERGLSAIR missed R-G@5 0.0282323006540537 1157.64343261719 579.829 1157.615234375 579.81494140625 2 10 1.1.1.4606.5 1 43.5282 1465.407 43.6789 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.000869458774104714 31.4900010824203 SKELQAAQAR acrolein addition +112(K)@2 cleaved L-S@N-term; missed K-E@2 0.00680899992585182 1212.65319824219 405.225 1212.64624023438 405.222686767578 3 7 1.1.1.3893.2 1 27.1834 111.4523 27.1245 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0 44.1500008106232 AKLEEQAQQIR missed K-L@2 -0.000625289976596832 1312.70910644531 438.577 1312.7099609375 438.577239990234 3 10 1.1.1.3970.3 1 28.7135 299.679 28.7303 7 7.53 7.53 32.1799993515015 27.4399995803833 18.299999833107 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0 27.4500012397766 LQAEAFQAR 0.0250700991600752 1032.56030273438 517.2874 1032.53527832031 517.27490234375 2 10 1.1.1.4110.6 1 31.9478 402.3091 31.9562 8 6.33 6.33 51.3300001621246 14.8699998855591 13.459999859333 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 GFSSGSAVVSGGSR 0.0033255300950259 1253.603515625 627.809 1253.59997558594 627.807312011719 2 21 1.1.1.4051.5 1 30.5975 560.1896 30.6026 8 6.33 6.33 51.3300001621246 14.8699998855591 13.459999859333 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 GGSGGGGSISGGGYGSGGGSGGR -0.00814189016819 1740.73291015625 581.2516 1740.7412109375 581.254333496094 3 26 1.1.1.3846.2 1 26.3977 99.0436 26.378 8 6.33 6.33 51.3300001621246 14.8699998855591 13.459999859333 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 HGGGGGGFGGGGFGSR -0.000315248005790636 1319.5751953125 440.8657 1319.57556152344 440.865783691406 3 19 1.1.1.4019.3 1 29.8471 561.207 29.8639 8 6.33 6.33 51.3300001621246 14.8699998855591 13.459999859333 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0.299296289682388 94.3099975585938 AQYEEIAQR -0.000237009997363202 1106.53552246094 554.275 1106.53564453125 554.275085449219 2 7 1.1.1.4022.9 1 29.9215 110.8977 29.9366 8 6.33 6.33 51.3300001621246 14.8699998855591 13.459999859333 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0.0199966300278902 44.0499991178513 NLDLDSIIAEVK 0.0115775000303984 1328.73022460938 665.3724 1328.71875 665.366638183594 2 9 1.1.1.5243.4 1 58.9176 137.9708 58.9369 8 6.33 6.33 51.3300001621246 14.8699998855591 13.459999859333 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0.00877392385154963 25.7600009441376 YLDGLTAER 0.0084774000570178 1036.52746582031 519.271 1036.51892089844 519.266723632813 2 9 1.1.1.4339.10 1 37.301 433.6278 37.2165 8 6.33 6.33 51.3300001621246 14.8699998855591 13.459999859333 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 99.0000009536743 GGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGR Hex(S)@12 cleaved F-G@N-term; missed R-G@3 -0.0183649994432926 2830.18969726563 944.4038 2830.2080078125 944.409912109375 3 17 1.1.1.5022.9 1 53.5266 168.7843 53.5104 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 DALSSVQESQVAQQAR Cation:Na(E)@8 -0.0112287998199463 1737.81457519531 580.2788 1737.82580566406 580.282531738281 3 21 1.1.1.4372.7 1 38.1184 0 -1 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00909768976271153 2016.01440429688 673.0121 2016.02355957031 673.01513671875 3 27 1.1.1.4262.4 1 35.4584 14129.43 35.4158 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.0783135294914246 99.0000009536743 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Deamidated(Q)@13; Deamidated(Q)@14; MDA adduct +54(K)@34; MDA adduct +54(K)@36 missed R-G@16; missed K-D@27; missed K-D@34 -0.0287039000540972 4125.91552734375 826.1904 4125.9443359375 826.196166992188 5 21 1.1.1.5687.2 1 69.0225 555.3799 69.0347 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.00833099242299795 96.85999751091 QGYMKHATKTAKDALSSVQESQVAQQAR acrolein addition +76(K)@5; acrolein addition +94(K)@12 cleaved M-Q@N-term; missed K-H@5; missed K-T@9; missed K-D@12 0.00234234007075429 3230.61645507813 808.6614 3230.6142578125 808.660827636719 4 10 1.1.1.5384.8 1 62.3287 179.1146 62.3447 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.000434511806815863 99.0000009536743 ATKTAKDALSSVQESQVAQQAR Carbamidomethyl@N-term; acrolein addition +56(K)@6; Oxidation(D)@7 cleaved H-A@N-term; missed K-T@3; missed K-D@6 0.00141479005105793 2445.24731445313 816.0897 2445.24584960938 816.089233398438 3 22 1.1.1.4312.10 1 36.6553 452.6964 36.6363 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.000434511806815863 99.0000009536743 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK Trp->Kynurenin(W)@18; Phospho(S)@25; acrolein addition +38(K)@27; MDA adduct +62(K)@34 missed R-G@16; missed K-D@27 -0.00183885998558253 3956.82421875 990.2133 3956.82592773438 990.213745117188 4 20 1.1.1.5396.4 1 62.624 479.8119 62.639 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 ATKTAKDALSSVQESQVAQQAR Carbamidomethyl@N-term; acrolein addition +56(K)@6; Oxidation(D)@7 cleaved H-A@N-term; missed K-T@3; missed K-D@6 -0.0106459995731711 2445.2353515625 612.3161 2445.24584960938 612.318786621094 4 20 1.1.1.4313.12 1 36.6759 661.121 36.6603 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR 0.00140966998878866 1715.84521484375 858.9299 1715.84387207031 858.92919921875 2 26 1.1.1.4366.7 1 37.9775 14715.58 38.126 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR 0.00140966998878866 1715.84521484375 858.9299 1715.84387207031 858.92919921875 2 26 1.1.1.4373.7 1 38.1448 14715.58 38.126 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR 0.00140966998878866 1715.84521484375 858.9299 1715.84387207031 858.92919921875 2 26 1.1.1.4380.6 1 38.3117 14715.58 38.126 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR 0.000311051000608131 1715.84423828125 858.9294 1715.84387207031 858.92919921875 2 26 1.1.1.4388.7 1 38.502 7528.138 38.2453 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR 0.00848965998739004 1715.85241699219 858.9335 1715.84387207031 858.92919921875 2 26 1.1.1.4397.5 1 38.716 800.2724 38.626 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR -0.00266089010983706 1715.84106445313 572.9543 1715.84387207031 572.955200195313 3 18 1.1.1.4365.8 1 37.9511 11144.85 38.126 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK acrolein addition +94(K)@27; Dichloro(Y)@29; MDA adduct +54(K)@34 missed R-G@16; missed K-D@27 -0.00712708989158273 3988.80102539063 998.2075 3988.80786132813 998.209228515625 4 16 1.1.1.5364.5 1 61.8326 765.278 61.9175 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Dioxidation(W)@18; Oxidation(W)@30; Oxidation(D)@35; MDA adduct +62(K)@36 missed R-G@16; missed K-D@27; missed K-D@34 -0.0199395008385181 4141.9306640625 1036.49 4141.95068359375 1036.49487304688 4 25 1.1.1.5357.4 1 61.6728 522.1428 61.6778 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Cation:K(D)@28; Dioxidation(W)@30; acrolein addition +56(K)@36 missed R-G@16; missed K-D@27; missed K-D@34 -0.0154927996918559 4141.91162109375 829.3896 4141.92724609375 829.392700195313 5 25 1.1.1.5358.4 1 61.6898 926.3858 61.654 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 48.3599990606308 MQGYMKHATKTAKDALSSVQESQVAQQAR Iodo(Y)@4; acrolein addition +56(K)@6; MDA adduct +62(K)@10; reduced acrolein addition +58(K)@13 cleaved F-M@N-term; missed K-H@6; missed K-T@10; missed K-D@13 0.014058300293982 3493.57568359375 874.4012 3493.56201171875 874.397766113281 4 12 1.1.1.4372.8 1 38.1209 0 -1 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 0.00999554991722107 2016.03344726563 1009.024 2016.02355957031 1009.01910400391 2 22 1.1.1.4240.10 1 34.9339 394.6289 34.9151 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00909768976271153 2016.01440429688 673.0121 2016.02355957031 673.01513671875 3 28 1.1.1.4255.10 1 35.2917 14129.43 35.4158 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00909768976271153 2016.01440429688 673.0121 2016.02355957031 673.01513671875 3 27 1.1.1.4269.7 1 35.6261 14129.43 35.4158 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR Formyl@N-term; reduced acrolein addition +58(K)@3 missed K-D@3 0.00458972994238138 2102.0654296875 1052.04 2102.06030273438 1052.03747558594 2 20 1.1.1.4804.11 1 48.2242 287.7077 48.2293 9 4.09 4.09 55.5599987506866 48.4800010919571 48.4800010919571 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 98.3200013637543 TAKDALSSVQESQVAQQAR acrolein addition +56(K)@3; Ser->LacticAcid(S)@8 missed K-D@3 0.00671262992545962 2057.04541015625 686.6891 2057.03881835938 686.686889648438 3 18 1.1.1.4288.12 1 36.0821 514.3601 36.0633 10 4.04 4.04 6.83000013232231 2.81199999153614 2.36600004136562 sp|P02751-9|FINC_HUMAN Isoform Fibronectin not containing EIIIA and EIIIB and uses V64 variant of IIICS region of Fibronectin OS=Homo sapiens GN=FN1 2 99.0000009536743 ITYGETGGNSPVQEFTVPGSK 0.00539265014231205 2167.04931640625 1084.532 2167.04321289063 1084.52893066406 2 20 1.1.1.4773.10 1 47.4707 451.1842 47.5244 10 4.04 4.04 6.83000013232231 2.81199999153614 2.36600004136562 sp|P02751-9|FINC_HUMAN Isoform Fibronectin not containing EIIIA and EIIIB and uses V64 variant of IIICS region of Fibronectin OS=Homo sapiens GN=FN1 2 99.0000009536743 LGVRPSQGGEAPR -0.00197663996368647 1322.70336914063 441.9084 1322.70544433594 441.909118652344 3 18 1.1.1.3865.2 1 26.7575 637.7633 26.8229 10 4.04 4.04 6.83000013232231 2.81199999153614 2.36600004136562 sp|P02751-9|FINC_HUMAN Isoform Fibronectin not containing EIIIA and EIIIB and uses V64 variant of IIICS region of Fibronectin OS=Homo sapiens GN=FN1 0.0250280071049929 85.6100022792816 FTNIGPDTMR Oxidation(M)@9 0.00694470992311835 1166.54602050781 584.2803 1166.5390625 584.276794433594 2 9 1.1.1.4097.11 1 31.6516 129.4873 31.66 10 4.04 4.04 6.83000013232231 2.81199999153614 2.36600004136562 sp|P02751-9|FINC_HUMAN Isoform Fibronectin not containing EIIIA and EIIIB and uses V64 variant of IIICS region of Fibronectin OS=Homo sapiens GN=FN1 0.00966114550828934 32.3399990797043 ISCTIANR Carbamidomethyl(C)@3 0.00208904989995062 933.472290039063 467.7434 933.47021484375 467.742370605469 2 10 1.1.1.3909.3 1 27.5393 202.2368 27.5686 10 4.04 4.04 6.83000013232231 2.81199999153614 2.36600004136562 sp|P02751-9|FINC_HUMAN Isoform Fibronectin not containing EIIIA and EIIIB and uses V64 variant of IIICS region of Fibronectin OS=Homo sapiens GN=FN1 0.000434511806815863 98.4499990940094 SSPVVIDASTAIDAPSNLR Methyl(I)@6 0.00331585993990302 1926.00903320313 964.0118 1926.005859375 964.010192871094 2 17 1.1.1.4914.14 1 50.8767 305.0451 50.9113 11 4.03 4.03 68.3099985122681 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 2 99.0000009536743 VGAHAGEYGAEALER 0.0112245995551348 1528.73828125 765.3764 1528.72705078125 765.370788574219 2 18 1.1.1.4154.4 1 32.8848 0 -1 11 4.03 4.03 68.3099985122681 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 2 99.0000009536743 VGAHAGEYGAEALERMFLSFPTTK Oxidation(M)@16 missed R-M@15 -0.00318088009953499 2597.25537109375 650.3211 2597.25854492188 650.321899414063 4 16 1.1.1.5088.3 1 55.0585 678.7673 55.1031 11 4.03 4.03 68.3099985122681 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 0.0277971606701612 59.5200002193451 MFLSFPTTK 0.00498674996197224 1070.55212402344 536.2833 1070.54699707031 536.280822753906 2 11 1.1.1.4926.3 1 51.1673 244.857 51.1564 11 4.03 4.03 68.3099985122681 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 0 25.6099998950958 MFLSFPTTK 0.00755017995834351 1070.5546875 536.2846 1070.54699707031 536.280822753906 2 7 1.1.1.4919.3 1 50.991 325.3075 51.0586 12 3.7 3.7 38.7800008058548 22.4500000476837 22.4500000476837 cont|000069 gi|27806789|ref|NP_776392.1| transthyretin (prealbumin, amyloidosis type I) [Bos taurus (contaminant)] 2 99.0000009536743 SLGISPFHEFAEVVFTANDSGPR 0.00132969999685884 2476.20361328125 826.4085 2476.20239257813 826.408020019531 3 20 1.1.1.5371.4 1 61.9985 167.4527 62.0153 12 3.7 3.7 38.7800008058548 22.4500000476837 22.4500000476837 cont|000069 gi|27806789|ref|NP_776392.1| transthyretin (prealbumin, amyloidosis type I) [Bos taurus (contaminant)] 1.69897043704987 99.0000009536743 GSPAANVGVK 0.000981105957180262 898.48828125 450.2514 898.487243652344 450.250885009766 2 10 1.1.1.3861.4 1 26.6649 271.1688 26.7986 12 3.7 3.7 38.7800008058548 22.4500000476837 22.4500000476837 cont|000069 gi|27806789|ref|NP_776392.1| transthyretin (prealbumin, amyloidosis type I) [Bos taurus (contaminant)] 0 99.0000009536743 GSPAANVGVK 0.000981105957180262 898.48828125 450.2514 898.487243652344 450.250885009766 2 10 1.1.1.3868.4 1 26.838 271.1688 26.7986 13 3.41 3.41 17.1399995684624 2.22500003874302 1.503000035882 sp|P01024|CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 2 99.0000009536743 VFLDCCNYITELR Carbamidomethyl(C)@5; Carbamidomethyl(C)@6 0.00636762985959649 1701.79187011719 851.9032 1701.78552246094 851.900024414063 2 14 1.1.1.5007.12 1 53.1542 150.2858 53.1413 13 3.41 3.41 17.1399995684624 2.22500003874302 1.503000035882 sp|P01024|CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 1.25181198120117 99.0000009536743 TRFISLGEACKK Carbamidomethyl(C)@10 missed R-F@2; missed K-K@11 -8.87977003003471E-05 1408.74975585938 470.5905 1408.74963378906 470.590484619141 3 9 1.1.1.4103.7 1 31.7888 784.4587 31.8547 13 3.41 3.41 17.1399995684624 2.22500003874302 1.503000035882 sp|P01024|CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 0.135488927364349 89.6899998188019 CCEDGMRENPMR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 missed R-E@7 -0.00427090981975198 1553.580078125 518.8673 1553.58435058594 518.868713378906 3 12 1.1.1.3963.3 1 28.5474 185.2755 28.5832 13 3.41 3.41 17.1399995684624 2.22500003874302 1.503000035882 sp|P01024|CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 0.0127807697281241 41.0699993371964 FISLGEACKKVFLDCCNYITELRR Carbamidomethyl(C)@8; Carbamidomethyl(C)@15; Carbamidomethyl(C)@16 missed K-K@9; missed K-V@10; missed R-R@23 -0.00750670023262501 2991.46923828125 748.8746 2991.47680664063 748.876525878906 4 10 1.1.1.5020.9 1 53.4708 502.6411 53.5104 13 3.41 3.41 17.1399995684624 2.22500003874302 1.503000035882 sp|P01024|CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 0.00744648277759552 29.2199999094009 SVQLTEK 0.00160866999067366 803.440490722656 402.7275 803.438903808594 402.726715087891 2 9 1.1.1.3819.2 1 25.802 815.8532 25.7907 13 3.41 3.41 17.1399995684624 2.22500003874302 1.503000035882 sp|P01024|CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 0 99.0000009536743 TRFISLGEACKK Carbamidomethyl(C)@10 missed R-F@2; missed K-K@11 -0.000113727001007646 1408.74963378906 705.3821 1408.74963378906 705.382141113281 2 10 1.1.1.4105.12 1 31.8497 102.1595 31.8547 14 3.08 3.08 93.3600008487701 12.389999628067 12.389999628067 sp|P16401|H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 2 99.0000009536743 ALAAGGYDVEKNNSR missed K-N@11 -0.00634081987664104 1563.7578125 522.2599 1563.76416015625 522.261962890625 3 11 1.1.1.4015.7 1 29.7494 229.6178 29.7661 14 3.08 3.08 93.3600008487701 12.389999628067 12.389999628067 sp|P16401|H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 0.560667335987091 98.5099971294403 GTGASGSFKLNKK missed K-L@9; missed K-K@12 0.000257873005466536 1293.70446777344 432.2421 1293.7041015625 432.241973876953 3 13 1.1.1.3765.2 1 24.898 272.2058 24.9276 14 3.08 3.08 93.3600008487701 12.389999628067 12.389999628067 sp|P16401|H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 0.522878706455231 98.3200013637543 GTGASGSFKLNK missed K-L@9 0.00043081899639219 1165.60961914063 583.8121 1165.60913085938 583.811828613281 2 11 1.1.1.3971.5 1 28.746 157.1621 28.7788 15 2.71 2.71 14.9499997496605 9.8130002617836 9.8130002617836 cont|000081 gi|115646|sp|P02662|CAS1_BOVIN Alpha-S1-casein precursor [Bos taurus (contaminant)] 2 99.0000009536743 YLGYLEQLLR 0.00692615984007716 1266.70422363281 634.3594 1266.697265625 634.355895996094 2 10 1.1.1.5240.4 1 58.8431 443.3369 58.9369 15 2.71 2.71 14.9499997496605 9.8130002617836 9.8130002617836 cont|000081 gi|115646|sp|P02662|CAS1_BOVIN Alpha-S1-casein precursor [Bos taurus (contaminant)] 0.705533742904663 99.0000009536743 HIQKEDVPSER missed K-E@4 -0.00109678995795548 1336.67248535156 446.5648 1336.67358398438 446.565124511719 3 13 1.1.1.3649.3 1 23.4063 180.63 23.4177 15 2.71 2.71 14.9499997496605 9.8130002617836 9.8130002617836 cont|000081 gi|115646|sp|P02662|CAS1_BOVIN Alpha-S1-casein precursor [Bos taurus (contaminant)] 0 42.9199993610382 YLGYLEQLLR 0.00692615984007716 1266.70422363281 634.3594 1266.697265625 634.355895996094 2 8 1.1.1.5247.4 1 59.0185 443.3369 58.9369 16 2.54 2.54 23.2299998402596 9.07099992036819 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 -0.00185701996088028 2823.32885742188 942.1169 2823.33056640625 942.117492675781 3 21 1.1.1.4815.12 1 48.4934 4097.166 48.5472 16 2.54 2.54 23.2299998402596 9.07099992036819 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0.369572132825851 99.0000009536743 STGKPTLYNVSLVMSDTAGTCY Oxidation(M)@14; Carbamidomethyl(C)@21 0.00739024998620152 2380.09936523438 1191.057 2380.0927734375 1191.05358886719 2 12 1.1.1.4911.10 1 50.8069 810.0569 50.8868 16 2.54 2.54 23.2299998402596 9.07099992036819 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0.171340107917786 99.0000009536743 GGKYAATSQVLLPSK Carbamidomethyl@N-term; HPNE addition +172(K)@3 missed K-Y@3 0.00515071023255587 1747.97705078125 874.9958 1747.97204589844 874.993286132813 2 11 1.1.1.5108.11 1 55.5643 438.9578 55.6027 16 2.54 2.54 23.2299998402596 9.07099992036819 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 42.3500001430511 STGKPTLYNVSLVMSDTAGTCY Oxidation(M)@14; Carbamidomethyl(C)@21 0.000375893985619769 2380.09301757813 794.3716 2380.0927734375 794.371520996094 3 10 1.1.1.4915.9 1 50.8962 354.6468 50.9113 16 2.54 2.54 23.2299998402596 9.07099992036819 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 22.1799999475479 STGKPTLYNVSLVMSDTAGTCY Oxidation(M)@14; Carbamidomethyl(C)@21 0.000375893985619769 2380.09301757813 794.3716 2380.0927734375 794.371520996094 3 10 1.1.1.4914.9 1 50.8717 354.6468 50.9113 16 2.54 2.54 23.2299998402596 9.07099992036819 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Carbamidomethyl(C)@25 missed K-S@4 -0.000297785009024665 2807.33569335938 936.7858 2807.33569335938 936.785888671875 3 21 1.1.1.5018.7 1 53.4315 3118.841 53.535 16 2.54 2.54 23.2299998402596 9.07099992036819 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Carbamidomethyl(C)@25 missed K-S@4 -0.000297785009024665 2807.33569335938 936.7858 2807.33569335938 936.785888671875 3 24 1.1.1.5025.15 1 53.6036 3118.841 53.535 16 2.54 2.54 23.2299998402596 9.07099992036819 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 98.9400029182434 YAATSQVLLPSK Trimethyl(A)@2 0.00441474001854658 1318.75402832031 660.3843 1318.74963378906 660.382080078125 2 19 1.1.1.4664.2 1 44.8706 7356.514 44.8995 16 2.54 2.54 23.2299998402596 9.07099992036819 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 98.3200013637543 YAATSQVLLPSK Trimethyl(A)@2 0.00246164994314313 1318.75231933594 660.3834 1318.74963378906 660.382080078125 2 18 1.1.1.4656.3 1 44.6807 7008.14 44.8995 16 2.54 2.54 23.2299998402596 9.07099992036819 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 98.3200013637543 YAATSQVLLPSK Trimethyl(A)@2 0.00246164994314313 1318.75231933594 660.3834 1318.74963378906 660.382080078125 2 18 1.1.1.4672.3 1 45.0426 7334.371 44.8995 16 2.54 2.54 23.2299998402596 9.07099992036819 9.07099992036819 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 87.3099982738495 YAATSQVLLPSK Trimethyl(A)@2 0.000264414993580431 1318.75012207031 660.3823 1318.74963378906 660.382080078125 2 13 1.1.1.4695.4 1 45.5838 390.7308 45.5718 17 2.36 2.36 44.5800006389618 44.5800006389618 44.5800006389618 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 1.28399682044983 99.0000009536743 IKQSELSAK missed K-Q@2 0.00213162996806204 1002.57305908203 502.2938 1002.57098388672 502.292755126953 2 12 1.1.1.3636.3 1 23.123 613.6826 23.0051 17 2.36 2.36 44.5800006389618 44.5800006389618 44.5800006389618 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 0.552842020988464 99.0000009536743 TPDVSSALDKLKEFGNTLEDKARELISR cleaved G-T@N-term; missed K-L@10; missed K-E@12; missed K-A@21; missed R-E@23 -0.00755171990022063 3131.638671875 627.335 3131.64624023438 627.336547851563 5 33 1.1.1.5582.3 1 67.1283 549.6204 67.0335 17 2.36 2.36 44.5800006389618 44.5800006389618 44.5800006389618 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 0.51999306678772 99.0000009536743 TPDVSSALDKLKEFGNTLEDKAR cleaved G-T@N-term; missed K-L@10; missed K-E@12; missed K-A@21 -0.0100632002577186 2533.29248046875 634.3304 2533.30249023438 634.332885742188 4 19 1.1.1.5117.4 1 55.7838 1162.821 55.803 17 2.36 2.36 44.5800006389618 44.5800006389618 44.5800006389618 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 0 99.0000009536743 IKQSELSAK missed K-Q@2 0.00213162996806204 1002.57305908203 502.2938 1002.57098388672 502.292755126953 2 12 1.1.1.3623.4 1 22.9511 597.4639 23.0112 17 2.36 2.36 44.5800006389618 44.5800006389618 44.5800006389618 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 0 99.0000009536743 TPDVSSALDKLKEFGNTLEDKARELISR cleaved G-T@N-term; missed K-L@10; missed K-E@12; missed K-A@21; missed R-E@23 -0.00755171990022063 3131.638671875 627.335 3131.64624023438 627.336547851563 5 16 1.1.1.5574.3 1 66.9371 549.6204 67.0335 18 2.01 2.01 42.0199990272522 42.0199990272522 26.0500013828278 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 2 99.0000009536743 NDSKNTLYLLMNSLQAZBTALYYCAR Deamidated(B)@18; Carbamidomethyl(C)@24 missed K-N@4 0.013917800039053 3065.47119140625 1022.831 3065.45874023438 1022.82684326172 3 16 1.1.1.5349.2 1 61.4832 364.6218 61.441 18 2.01 2.01 42.0199990272522 42.0199990272522 26.0500013828278 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0.00436480529606342 99.0000009536743 FTISRNDSKNTLYLLMNSLQAZBTALYYCAR MDA adduct +62(K)@9; Dethiomethyl(M)@16; Deamidated(B)@23; Carbamidomethyl(C)@29 missed R-N@5; missed K-N@9 -0.00636486988514662 3683.7978515625 921.9567 3683.80419921875 921.958312988281 4 13 1.1.1.5235.5 1 58.7243 442.7932 58.715 18 2.01 2.01 42.0199990272522 42.0199990272522 26.0500013828278 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0.00261361571028829 99.0000009536743 AZBTALYYCAR Deamidated(Z)@2; Deamidated(B)@3; Carbamidomethyl(C)@9 cleaved Q-A@N-term 0.00393575010821223 1331.58544921875 666.8 1331.58154296875 666.798095703125 2 18 1.1.1.4250.8 1 35.1725 683.6187 35.2491 18 2.01 2.01 42.0199990272522 42.0199990272522 26.0500013828278 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 88.5299980640411 EVQLLESGGGLVQPGGSLR Deamidated(Q)@3; Ser->LacticAcid(S)@7 0.0430396012961864 1881.02746582031 628.0164 1880.984375 628.002075195313 3 14 1.1.1.4601.6 1 43.413 5985.637 43.3232 18 2.01 2.01 42.0199990272522 42.0199990272522 26.0500013828278 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 91.8799996376038 LLESGGGLVQPGGSLR Ser->LacticAcid(S)@4; Deamidated(Q)@10 cleaved Q-L@N-term 0.015565600246191 1524.83032226563 763.4224 1524.81481933594 763.414672851563 2 15 1.1.1.4433.6 1 39.5512 9675.47 39.6549 18 2.01 2.01 42.0199990272522 42.0199990272522 26.0500013828278 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 NDSKNTLYLLMNSLQAZBTALYYCAR Oxidation(M)@11; Deamidated(B)@18; Carbamidomethyl(C)@24 missed K-N@4 -0.0100595997646451 3081.443359375 1028.155 3081.45361328125 1028.15844726563 3 14 1.1.1.5217.17 1 58.2873 414.223 58.2464 18 2.01 2.01 42.0199990272522 42.0199990272522 26.0500013828278 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 NDSKNTLYLLMNSLQAZBTALYYCAR Oxidation(M)@11; Deamidated(B)@18; Carbamidomethyl(C)@24 missed K-N@4 0.00495494995266199 3081.45825195313 1028.16 3081.45361328125 1028.15844726563 3 11 1.1.1.5226.12 1 58.5084 420.2764 58.5432 18 2.01 2.01 42.0199990272522 42.0199990272522 26.0500013828278 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 38.8099998235703 VQLLESGGGLVQPGGSLR Deamidated(Q)@2; GlyGly(S)@6 cleaved E-V@N-term 0.0318062007427216 1881.02746582031 628.0164 1880.99560546875 628.005798339844 3 12 1.1.1.4593.4 0 43.2232 5985.637 43.3232 19 2 4 24.5800003409386 6.56799972057343 6.56799972057343 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 2 99.0000009536743 EVATNSELVQSGK 0.00360436993651092 1360.68713378906 681.3508 1360.68347167969 681.348999023438 2 11 1.1.1.4022.13 1 29.9248 95.6203 29.9123 19 2 4 24.5800003409386 6.56799972057343 6.56799972057343 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 99.0000009536743 VTMQNLNDRLASYLDKVR missed R-L@9; missed K-V@16 -0.00542847998440266 2135.11059570313 534.7849 2135.11572265625 534.786193847656 4 17 1.1.1.5010.5 0 53.2213 856.2719 53.215 19 2 4 24.5800003409386 6.56799972057343 6.56799972057343 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 99.0000009536743 VTMQNLNDRLASYLDKVR missed R-L@9; missed K-V@16 0.00164278002921492 2135.11743164063 712.7131 2135.11572265625 712.712524414063 3 15 1.1.1.5008.6 0 53.177 562.0158 53.215 20 2 2 37.0200008153915 0.930199958384037 0.930199958384037 sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 2 99.0000009536743 AGFAGDDAPR 0.0042549897916615 975.445251464844 488.7299 975.440979003906 488.727783203125 2 12 1.1.1.3971.3 1 28.7393 161.3763 28.7544