N Unused Total %Cov %Cov(50) %Cov(95) Accessions Names Used Annotation Contrib Conf Sequence Modifications Cleavages dMass Prec MW Prec m/z Theor MW Theor m/z Theor z Sc Spectrum Specific Time PrecursorSignal PrecursorElution 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AEFVEVTK 0.00342938001267612 921.484252929688 461.7494 921.480773925781 461.747650146484 2 9 1.1.1.4535.9 1 31.4209 392.1407 31.4072 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 -0.000557072984520346 1691.93408203125 564.9853 1691.9345703125 564.985473632813 3 20 1.1.1.5638.3 1 57.7973 13904.64 57.7442 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AEFVEVTKLVTDLTKVH Amidated@C-term cleaved H-K@C-term; missed K-L@8; missed K-V@15 0.00707028014585376 1927.08483886719 643.3689 1927.07788085938 643.366577148438 3 9 1.1.1.5624.2 1 57.4457 136.5779 57.4411 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@14 missed K-L@5 -0.006328159943223 2497.17724609375 625.3016 2497.18359375 625.303161621094 4 21 1.1.1.5407.2 1 52.1804 3501.005 52.271 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 0.0167695004492998 2866.43798828125 956.4866 2866.42114257813 956.48095703125 3 25 1.1.1.5348.18 1 50.7569 1760.424 50.8138 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.0138068003579974 2994.50244140625 749.6329 2994.51611328125 749.636291503906 4 19 1.1.1.5267.9 1 48.8432 3468.608 48.9308 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 -0.0161658003926277 3990.1015625 799.0276 3990.11767578125 799.030822753906 5 24 1.1.1.5549.2 1 55.5932 1224.086 55.6378 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHK Carbamidomethyl(C)@14; acrolein addition +112(K)@25; acrolein addition +112(K)@36 cleaved K-P@C-term; missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25; missed K-H@34 0.00814620032906532 4479.384765625 640.9194 4479.37646484375 640.918212890625 7 11 1.1.1.5411.5 1 52.2787 393.2764 52.2467 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPK Carbamidomethyl(C)@14; Lys->Allysine(K)@25 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25; missed K-H@34 -0.00308719999156892 4479.384765625 640.9194 4479.3876953125 640.919799804688 7 13 1.1.1.5411.5 1 52.2787 393.2764 52.2467 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ALKAWSVAR Trp->Kynurenin(W)@5 missed K-A@3 0.0029033599421382 1004.57965087891 503.2971 1004.57672119141 503.295623779297 2 12 1.1.1.4401.5 1 28.2242 250.9205 28.212 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ATEEQLKTVMENFVAFVDK missed K-T@7 0.0143374996259809 2198.107421875 733.7097 2198.09301757813 733.704895019531 3 28 1.1.1.5960.2 1 65.527 248.6486 65.5437 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 -0.00936449971050024 4122.8583984375 825.579 4122.8681640625 825.580932617188 5 32 1.1.1.5571.5 1 56.1458 1880.822 56.1851 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1; Acetyl(K)@6 missed K-F@6 0.00616549979895353 1236.59826660156 619.3064 1236.59216308594 619.303344726563 2 13 1.1.1.4652.12 1 34.2211 180.8974 34.2279 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCAADDKEACFAVEGPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@10 missed K-E@7 0.00161998998373747 1926.79260253906 643.2715 1926.791015625 643.270935058594 3 23 1.1.1.4562.10 1 32.0708 1354.102 32.1716 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTESLVNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 -0.000736222020350397 1137.49011230469 569.7523 1137.49072265625 569.752624511719 2 14 1.1.1.4380.7 1 27.7263 8059.976 27.6358 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 -0.00517607014626265 2982.36206054688 995.128 2982.36743164063 995.129760742188 3 18 1.1.1.5296.7 1 49.5493 12173.16 49.4628 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12; Carbamidomethyl(C)@39 missed R-R@9; missed K-A@25; missed K-L@30 0.00903575960546732 5478.576171875 914.1033 5478.56689453125 914.101745605469 6 17 1.1.1.5536.6 1 55.2716 432.4982 55.2645 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-M@9 -1.01373994350433 2870.28833007813 957.7701 2871.30224609375 958.108032226563 3 12 1.1.1.5533.15 1 55.2037 1236.448 55.2137 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Lys->Allysine(K)@4; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.00148234004154801 3749.73315429688 750.9539 3749.734375 750.954162597656 5 19 1.1.1.5791.5 1 61.4069 615.8836 61.5172 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Lys->Allysine(K)@4; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30 -0.0123416995629668 4391.060546875 732.8507 4391.07275390625 732.852722167969 6 16 1.1.1.5674.2 1 58.6815 906.8701 58.7517 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 -0.0147823998704553 4736.2958984375 790.3899 4736.310546875 790.392333984375 6 22 1.1.1.5534.8 1 55.2232 2318.607 55.2645 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DAFLGSFLYEYSR 0.0112161003053188 1566.74670410156 784.3806 1566.73547363281 784.375 2 16 1.1.1.5723.2 1 59.8848 1962.427 59.7076 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@21 missed K-D@18 0.0158238001167774 2457.18920898438 820.0703 2457.17333984375 820.065063476563 3 20 1.1.1.5384.5 1 51.624 1272.728 51.5903 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 EYEATLEECCAK Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.00696968007832766 1501.61352539063 751.814 1501.6064453125 751.810546875 2 20 1.1.1.4493.3 1 30.43 296.8324 30.435 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 EYGFQNALIVR Glu->pyro-Glu@N-term cleaved G-E@N-term 0.00699777016416192 1290.67907714844 646.3468 1290.67211914063 646.343322753906 2 12 1.1.1.5490.6 1 54.1079 99.5914 54.1755 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 FVEVTKLVTDLTK cleaved E-F@N-term; missed K-L@6 0.00915586017072201 1491.86401367188 746.9393 1491.85485839844 746.934692382813 2 8 1.1.1.5634.3 1 57.6998 183.1047 57.7198 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HLVDEPQNLIK 0.00313931005075574 1304.71203613281 653.3633 1304.70886230469 653.361694335938 2 14 1.1.1.4733.9 1 36.1915 5713.866 36.3715 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HLVDEPQNLIKQNCDQFEK Carbamidomethyl(C)@14 missed K-Q@11 -0.0106368996202946 2354.12158203125 785.7145 2354.13256835938 785.718078613281 3 26 1.1.1.4900.4 1 40.0925 331.6034 40.1213 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@14 missed K-Q@11; missed K-L@19 0.0127092003822327 3814.9228515625 954.738 3814.91015625 954.734802246094 4 19 1.1.1.5574.11 1 56.2201 3238.795 56.1366 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HPEYAVSVLLR 0.00332392007112503 1282.70666503906 642.3606 1282.70336914063 642.358947753906 2 13 1.1.1.5070.11 1 44.0848 630.0847 44.0915 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HPYFYAPELLYYANK 0.00279262010008097 1887.92260742188 630.3148 1887.91955566406 630.313781738281 3 13 1.1.1.5482.6 1 53.9052 116.1136 53.8725 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@23; Carbamidomethyl(C)@24; Carbamidomethyl(C)@32 missed K-Y@15; missed K-G@29 -0.0108449002727866 4356.0009765625 872.2075 4356.01171875 872.209655761719 5 32 1.1.1.5661.3 1 58.3626 1001.474 58.3802 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 IETMREKVLTSSAR missed R-E@5; missed K-V@7 -0.00281803007237613 1619.86389160156 540.9619 1619.86645507813 540.962768554688 3 12 1.1.1.4417.11 1 28.6244 474.6384 28.6378 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KQTALVELLK missed K-Q@1 0.00530205015093088 1141.71252441406 571.8635 1141.70703125 571.860778808594 2 17 1.1.1.4939.4 1 40.9791 10371.96 40.9368 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.00183210999239236 1638.92846679688 547.3168 1638.93041992188 547.317443847656 3 23 1.1.1.4887.4 1 39.7804 35422.06 39.671 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LAKEYEATLEECCAKDD Carbamidomethyl(C)@12; Carbamidomethyl(C)@13 cleaved D-P@C-term; missed K-E@3; missed K-D@15 -0.00885859970003366 2043.86767578125 682.2965 2043.87646484375 682.299438476563 3 21 1.1.1.4648.9 1 34.1243 454.0281 34.1319 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LCVLHEKTPVSEK Carbamidomethyl(C)@2 missed K-T@7 -0.000750293023884296 1538.81188964844 513.9446 1538.81262207031 513.94482421875 3 19 1.1.1.4437.15 1 29.1101 1419.222 29.1441 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LCVLHEKTPVSEKVTK Carbamidomethyl(C)@2 missed K-T@7; missed K-V@13 -0.00724114011973143 1867.0166015625 467.7614 1867.02368164063 467.763214111328 4 20 1.1.1.4446.3 1 29.323 3004.025 29.3339 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LFTFHADICTLPDTEK Carbamidomethyl(C)@9 0.003186060115695 1906.91674804688 636.6462 1906.91345214844 636.645080566406 3 23 1.1.1.5299.3 1 49.6184 696.8286 49.6318 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LGEYGFQNALIVR 0.00763237988576293 1478.7958984375 740.4052 1478.78820800781 740.4013671875 2 18 1.1.1.5357.5 1 50.9685 14195.07 50.8626 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKECCDKPLLEK No Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-E@2 0.00328485993668437 1474.75561523438 492.5925 1474.75231933594 492.591400146484 3 17 1.1.1.4368.4 1 27.4252 189.8601 27.4089 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 0.00111650000326335 2665.322265625 534.0717 2665.32104492188 534.071472167969 5 17 1.1.1.5335.3 1 50.4323 389.8031 50.4215 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0188356004655361 3577.7724609375 597.3027 3577.79150390625 597.305847167969 6 13 1.1.1.5529.5 1 55.0936 1114.781 55.0119 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 0.000200413996935822 1749.96691894531 438.499 1749.96655273438 438.498901367188 4 17 1.1.1.4768.2 1 37.0059 2604.645 36.8952 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00424626003950834 2520.41625976563 631.1113 2520.42041015625 631.112365722656 4 20 1.1.1.5670.2 1 58.5826 1002.609 58.6027 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LVNELTEFAK 0.00430377991870046 1162.62768554688 582.3211 1162.62341308594 582.318969726563 2 12 1.1.1.5122.4 1 45.3311 1718.654 45.1547 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LVVSTQTALA 0.004174729809165 1001.57989501953 501.7972 1001.57568359375 501.795135498047 2 14 1.1.1.4949.3 1 41.1918 9249.193 41.2264 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNR Oxidation(M)@1; Carbamidomethyl(C)@3 0.0137085998430848 1739.83581542969 870.9252 1739.822265625 870.918395996094 2 20 1.1.1.5647.5 1 58.0222 956.7099 57.9638 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNRLCVLHEK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14 -0.00265771988779306 2619.28344726563 655.8281 2619.28588867188 655.828735351563 4 20 1.1.1.5841.2 1 62.6472 1228.22 62.6648 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 -0.00337816006503999 3244.6259765625 649.9325 3244.62939453125 649.933166503906 5 24 1.1.1.5819.3 1 62.1089 688.3119 62.103 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEKVTK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21; missed K-V@27 -0.0115026002749801 3588.82348632813 718.772 3588.83544921875 718.774353027344 5 19 1.1.1.5677.5 1 58.7579 1046.853 58.8011 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 NYQEAKDAFLGSFLYEYSR missed K-D@6 0.00625137006863952 2300.0810546875 767.701 2300.07495117188 767.698913574219 3 18 1.1.1.5564.3 1 55.9688 1575.313 56.0393 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QEPERNECFLSHKDDSPDLPK Gln->pyro-Glu@N-term; Carbamidomethyl(C)@8 missed R-N@5; missed K-D@13 -0.00990540999919176 2523.12377929688 631.7882 2523.13354492188 631.790710449219 4 18 1.1.1.4734.13 1 36.2157 1159.285 36.2995 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 missed K-L@8 0.0121387001127005 2511.19750976563 838.0731 2511.18530273438 838.069030761719 3 26 1.1.1.5628.5 1 57.5507 1717.66 57.5433 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QTALVELLK 0.00663253990933299 1013.61889648438 507.8167 1013.61212158203 507.813323974609 2 14 1.1.1.5269.2 1 48.8882 37874.03 48.7135 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QTALVELLKHKPK Gln->pyro-Glu@N-term missed K-H@9 0.00704581011086702 1486.89428710938 496.6387 1486.88720703125 496.636322021484 3 15 1.1.1.5213.2 1 47.5409 824.4211 47.5593 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPEYAVSVLLR missed R-H@1 0.00466813007369637 1438.80908203125 480.6103 1438.80444335938 480.608764648438 3 19 1.1.1.4817.6 1 38.1754 10096.1 38.2551 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPYFYAPELLYYANK missed R-H@1 -0.00324263004586101 2044.01733398438 682.3464 2044.02062988281 682.347534179688 3 17 1.1.1.5330.9 1 50.3128 1170.386 50.4215 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLL acrolein addition +56(K)@16; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Methyl(Q)@26; reduced acrolein addition +96(K)@30; Carbamidomethyl(C)@33 cleaved L-P@C-term; missed R-H@1; missed K-Y@16; missed K-G@30 0.0104294000193477 4453.0751953125 891.6223 4453.064453125 891.620178222656 5 16 1.1.1.5466.4 1 53.5214 563.4345 53.4824 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -1.00442004203796 4511.1083984375 903.229 4512.11279296875 903.429870605469 5 14 1.1.1.5531.10 1 55.1486 292.0283 55.112 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 -0.00157554005272686 1879.91235351563 627.6447 1879.91381835938 627.645202636719 3 17 1.1.1.5033.3 1 43.1913 4100.812 42.9393 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SHCIAEVEK Acetyl@N-term; Carbamidomethyl(C)@3 0.00633074017241597 1113.51892089844 557.7667 1113.51245117188 557.763488769531 2 14 1.1.1.4428.4 1 28.8893 161.6794 28.8531 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SHCIAEVEKDAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@3; Carbamidomethyl(C)@30 missed K-D@9; missed K-D@27 -0.00972963031381369 3510.65502929688 878.671 3510.66479492188 878.673461914063 4 28 1.1.1.5325.4 1 50.1941 587.7287 50.2033 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00441156979650259 1418.69091796875 710.3527 1418.68640136719 710.350463867188 2 19 1.1.1.5088.2 1 44.5211 4084.495 44.7195 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SLHTLFGDELCKVASLR Carbamidomethyl(C)@11 missed K-V@12 -0.00192647997755557 1945.00720214844 649.343 1945.00915527344 649.343627929688 3 15 1.1.1.5477.3 1 53.7777 998.2962 53.8226 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -0.00300944992341101 1462.57873535156 488.5335 1462.58166503906 488.534515380859 3 15 1.1.1.3705.3 1 20.5856 1026.753 20.5379 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TPVSEKVTK missed K-V@6 0.00282918009907007 987.562866210938 494.7887 987.56005859375 494.787292480469 2 13 1.1.1.3693.2 1 20.4984 129.6323 20.5095 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.00455527985468507 1414.68481445313 708.3497 1414.68029785156 708.347412109375 2 15 1.1.1.5272.5 1 48.9674 385.4339 49.0275 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 -0.000481524999486282 3323.46020507813 831.8723 3323.46069335938 831.872436523438 4 28 1.1.1.5366.5 1 51.1886 2326.76 51.2729 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VASLRETYGDMADCCEK Oxidation(M)@11; Carbamidomethyl(C)@14; Carbamidomethyl(C)@15 missed R-E@5 -0.0118506997823715 2019.82177734375 674.2812 2019.83361816406 674.28515625 3 24 1.1.1.4427.8 1 28.872 734.3917 28.901 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 98.9799976348877 VHKECCHGDLLECADDRADLAK Carbamidomethyl(C)@5; Carbamidomethyl(C)@6; Carbamidomethyl(C)@13 missed K-E@3; missed R-A@17 -0.0159159004688263 2611.14208984375 523.2357 2611.15771484375 523.238830566406 5 14 1.1.1.4501.5 1 30.6131 1335.268 30.6724 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VPQVSTPTLVEVSR 0.000512582017108798 1510.83605957031 756.4253 1510.83544921875 756.425048828125 2 18 1.1.1.5061.7 1 43.8695 2390.735 43.6581 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3; Amidated@C-term -0.00383261009119451 1441.64685058594 721.8307 1441.65075683594 721.832641601563 2 14 1.1.1.4380.8 1 27.7288 91.3177 27.7339 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.92081785202026 98.7600028514862 RHPYFYAPELLYYANKYNGVFQECCQAEDK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25 missed R-H@1; missed K-Y@16 0.00243217009119689 3772.71044921875 944.1849 3772.7080078125 944.184265136719 4 16 1.1.1.5502.14 1 54.4207 182.4289 54.4821 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.61978900432587 97.5799977779388 QNCDQFEKLGEYGFQNALIVRYTR Carbamidomethyl(C)@3 missed K-L@8; missed R-Y@21 0.000452920998213813 2948.42407226563 738.1133 2948.423828125 738.11328125 4 14 1.1.1.5470.3 1 53.6122 556.8423 53.6514 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.07572078704834 98.7200021743774 EKVLTSSAR Glu->pyro-Glu@N-term missed K-V@2 0.00113847001921386 971.541076660156 486.7778 971.539978027344 486.777282714844 2 13 1.1.1.4321.2 1 26.4311 180.201 26.4608 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.03621208667755 99.0000009536743 DPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@6; MDA adduct +54(K)@10; HPNE addition +172(K)@14; reduced acrolein addition +58(K)@15; reduced acrolein addition +58(K)@19 cleaved P-D@N-term; missed K-A@10; missed K-K@14; missed K-F@15; missed K-Y@19 0.0036311699077487 3577.7724609375 597.3027 3577.76904296875 597.302124023438 6 10 1.1.1.5521.4 1 54.8924 1114.781 55.0119 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.03621208667755 90.7800018787384 QNCDQFEK Carbamidomethyl(C)@3 0.00125186995137483 1067.43542480469 534.725 1067.43420410156 534.724365234375 2 11 1.1.1.4009.3 1 22.8173 157.8409 22.8464 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.910094797611237 87.720000743866 DAIPENLPPLTADFAEDK 0.0176622997969389 1954.97009277344 978.4923 1954.95239257813 978.483459472656 2 12 1.1.1.5486.18 1 54.0156 512.4501 53.9979 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.821022987365723 96.6099977493286 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26; missed K-L@36 0.0032164400909096 5106.4384765625 1022.295 5106.43359375 1022.2939453125 5 15 1.1.1.5790.5 1 61.389 495.8321 61.3941 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.659555912017822 78.1199991703033 CCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12; Carbamidomethyl(C)@39 missed R-R@9; missed K-A@25; missed K-L@30; missed K-Q@46; missed K-K@49 -0.0211661998182535 5975.87841796875 854.7042 5975.8994140625 854.707214355469 7 13 1.1.1.5479.15 1 53.8375 1066.556 53.8226 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.480172038078308 66.8699979782104 LKHLVDEPQNLIK missed K-H@2 -5.2245599363232E-05 1545.88781738281 516.3032 1545.88781738281 516.30322265625 3 11 1.1.1.4708.6 1 35.5719 124.8925 35.5578 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.478861898183823 99.0000009536743 KECCDKPLLEK ONE addition +154(K)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved L-K@N-term; missed K-E@1 0.005269689951092 1572.79443359375 525.2721 1572.78918457031 525.270324707031 3 14 1.1.1.4377.5 1 27.6518 607.9214 27.7339 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.446116983890533 64.1600012779236 NYQEAKDAFLGSFLYEYSRR missed K-D@6; missed R-R@19 -0.00717634009197354 2456.1689453125 615.0495 2456.17602539063 615.05126953125 4 10 1.1.1.5491.4 1 54.1311 182.1904 54.0991 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.424812167882919 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQ Carbamidomethyl(C)@14; acrolein addition +76(K)@24; acrolein addition +94(K)@25 cleaved Q-T@C-term; missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 0.00781419966369867 3292.65551757813 659.5384 3292.64794921875 659.536865234375 5 15 1.1.1.5269.3 1 48.8915 632.4532 48.9066 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.309803903102875 51.010000705719 YLYEIARR missed R-R@7 0.00437925010919571 1082.59167480469 542.3031 1082.58728027344 542.300903320313 2 8 1.1.1.4535.11 1 31.4243 461.1214 31.4785 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.238072156906128 98.309999704361 FWGKYLYEIAR Dioxidation(W)@2 missed K-Y@4 0.00919266045093536 1476.74914550781 493.257 1476.74011230469 493.253997802734 3 10 1.1.1.5206.4 1 47.3706 320.1353 47.3412 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.23433144390583 95.959997177124 ICTLPDTEK Carbamidomethyl(C)@2 cleaved D-I@N-term 0.00641534011811018 1075.52844238281 538.7715 1075.52197265625 538.768249511719 2 9 1.1.1.4433.12 1 29.0171 187.2313 28.9979 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.198596298694611 86.2299978733063 LSQKFPK Deamidated(Q)@3 missed K-F@4 0.0218426007777452 847.502258300781 424.7584 847.480346679688 424.747467041016 2 10 1.1.1.4289.2 1 25.7642 136.4797 25.7451 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.136082619428635 26.8999993801117 LCVLHEK Carbamidomethyl(C)@2 0.00169171998277307 897.475891113281 449.7452 897.474243164063 449.744384765625 2 9 1.1.1.4357.5 1 27.1746 692.3325 27.2358 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00130484171677381 42.9199993610382 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIET ONE addition +154(K)@16; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; acrolein addition +112(K)@30; Carbamidomethyl(C)@33; MDA adduct +62(K)@37 cleaved T-M@C-term; missed R-H@1; missed K-Y@16; missed K-G@30; missed K-I@37 -0.0117440996691585 5183.44287109375 864.9144 5183.45458984375 864.916381835938 6 10 1.1.1.5620.11 1 57.351 237.1189 57.3391 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00130484171677381 97.0600008964539 VTKCCTESLVNR Carbamidomethyl(C)@4; Carbamidomethyl(C)@5; Didehydro(T)@6 missed K-C@3 -0.00258829002268612 1463.68359375 488.9018 1463.68603515625 488.902648925781 3 14 1.1.1.4339.2 1 26.7398 124.789 26.7037 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.000869458774104714 59.2499971389771 HAGCEKSLHTLFGDELCK reduced HNE(H)@1; Carbamidomethyl(C)@4; MDA adduct +54(K)@6; Carbamidomethyl(C)@17 cleaved S-H@N-term; missed K-S@6 -0.00759154977276921 2313.10571289063 772.0425 2313.11328125 772.045043945313 3 11 1.1.1.5095.5 1 44.6827 297.8378 44.6712 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.000869458774104714 68.860000371933 VDEPQNLIKQNCDQFEKLGEYGFQNALIVR acrolein addition +76(K)@9; Carbamidomethyl(C)@12; MDA adduct +54(K)@17; Deamidated(N)@25 cleaved L-V@N-term; missed K-Q@9; missed K-L@17 0.0826032012701035 3695.87548828125 740.1824 3695.79296875 740.165893554688 5 11 1.1.1.5364.5 1 51.1471 3053.251 51.0077 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.000434511806815863 94.9699997901917 SLGKVGTR Acetyl(K)@4 missed K-V@4 0.00258955010212958 858.494873046875 430.2547 858.492309570313 430.253448486328 2 11 1.1.1.4364.3 1 27.3202 911.6486 27.2046 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.000434511806815863 94.6200013160706 TKCCTESLVNR Acetyl@N-term; hexanoyl addition +98(K)@2; Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved V-T@N-term; missed K-C@2 0.0149606997147202 1506.73205566406 503.2513 1506.71704101563 503.246307373047 3 12 1.1.1.4373.7 1 27.5499 373.8377 27.46 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.000434511806815863 46.0500001907349 YLYEIAR Oxidation(Y)@3 0.00913332961499691 942.490295410156 472.2524 942.481079101563 472.247802734375 2 6 1.1.1.4737.9 1 36.2844 586.2657 36.3237 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.5800006389618 AEFVEVTK 0.00428385008126497 921.485046386719 461.7498 921.480773925781 461.747650146484 2 11 1.1.1.4524.4 1 31.1653 575.8107 31.1231 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 76.2499988079071 AEFVEVTK Oxidation(F)@3 0.00584898982197046 937.4814453125 469.748 937.475646972656 469.7451171875 2 7 1.1.1.4508.8 1 30.7816 417.3558 30.6963 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 42.9800003767014 AEFVEVTK 0.00367351993918419 921.484497070313 461.7495 921.480773925781 461.747650146484 2 10 1.1.1.4497.4 1 30.5247 13014.92 30.6724 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 42.9800003767014 AEFVEVTK 0.00367351993918419 921.484497070313 461.7495 921.480773925781 461.747650146484 2 11 1.1.1.4505.7 1 30.7084 13014.92 30.6724 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 18.7800005078316 AEFVEVTK 0.00367351993918419 921.484497070313 461.7495 921.480773925781 461.747650146484 2 10 1.1.1.4513.6 1 30.9002 13306.37 30.6724 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.0107631999999285 1691.9453125 846.9799 1691.9345703125 846.974548339844 2 24 1.1.1.5631.8 1 57.6297 11459.6 57.7198 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.0107631999999285 1691.9453125 846.9799 1691.9345703125 846.974548339844 2 26 1.1.1.5633.8 1 57.6793 11459.6 57.7198 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.0106411995366216 1691.9453125 846.9799 1691.9345703125 846.974548339844 2 22 1.1.1.5645.5 1 57.9716 11613.9 57.7198 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.0069790598936379 1691.94152832031 846.978 1691.9345703125 846.974548339844 2 14 1.1.1.5652.6 1 58.1427 945.7338 57.8906 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@14 missed K-L@5 -0.006328159943223 2497.17724609375 625.3016 2497.18359375 625.303161621094 4 19 1.1.1.5414.4 1 52.3518 3501.005 52.271 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 0.0167695004492998 2866.43798828125 956.4866 2866.42114257813 956.48095703125 3 17 1.1.1.5356.10 1 50.9527 1760.424 50.8138 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14; Methyl(E)@20; ONE addition +154(K)@21; Deamidated(Q)@22 missed K-L@5; missed K-Q@21 0.0165813006460667 3035.53662109375 608.1146 3035.52026367188 608.111328125 5 16 1.1.1.5277.5 1 49.095 1201.306 49.1485 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.0133897997438908 2994.5029296875 500.0911 2994.51611328125 500.093292236328 6 18 1.1.1.5267.3 1 48.8382 3600.46 48.9066 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.00730672013014555 2994.50927734375 599.9091 2994.51611328125 599.910522460938 5 17 1.1.1.5267.4 1 48.8391 5789.333 48.9066 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.00730672013014555 2994.50927734375 599.9091 2994.51611328125 599.910522460938 5 18 1.1.1.5274.3 1 49.0124 5789.333 48.9066 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 95.6399977207184 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.0138068003579974 2994.50244140625 749.6329 2994.51611328125 749.636291503906 4 13 1.1.1.5276.10 1 49.0626 3468.608 48.9308 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 86.2299978733063 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14; Dehydrated(T)@19; reduced acrolein addition +58(K)@21; Deamidated(Q)@22 missed K-L@5; missed K-Q@21; missed K-K@24 0.00943609979003668 3035.541015625 759.8925 3035.53149414063 759.89013671875 4 13 1.1.1.5279.11 1 49.1367 602.5167 49.1485 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.4799981117249 AFDEKLFTFHADICTLPDTEKQIKKQ Carbamidomethyl(C)@14; acrolein addition +76(K)@24; acrolein addition +94(K)@25 cleaved Q-T@C-term; missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 -0.00439252005890012 3292.64306640625 659.5359 3292.64794921875 659.536865234375 5 14 1.1.1.5271.6 1 48.9449 637.4835 48.9549 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 19.9799999594688 AFDEKLFTFHADICTLPDTEKQIKKQ Carbamidomethyl(C)@14; acrolein addition +76(K)@24; acrolein addition +94(K)@25 cleaved Q-T@C-term; missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 0.00140913994982839 3292.6494140625 824.1696 3292.64794921875 824.169250488281 4 10 1.1.1.5268.8 1 48.8674 404.7262 48.9549 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 -0.0208062995225191 3990.0966796875 666.0234 3990.11767578125 666.02685546875 6 18 1.1.1.5555.3 1 55.7417 1224.938 55.6625 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 -0.0208062995225191 3990.0966796875 666.0234 3990.11767578125 666.02685546875 6 17 1.1.1.5548.2 1 55.5678 1224.938 55.6625 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.5300004482269 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 -0.0100622996687889 3990.10766601563 799.0288 3990.11767578125 799.030822753906 5 16 1.1.1.5542.5 1 55.4213 1205.616 55.6625 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 0.00262100994586945 1032.57421875 517.2944 1032.57165527344 517.293090820313 2 14 1.1.1.4442.5 1 29.2341 7578.007 29.2155 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR missed K-A@3 0.00250909989699721 1000.58428955078 501.2994 1000.58178710938 501.298187255859 2 13 1.1.1.4476.3 1 30.0394 788.8146 30.0742 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 0.00262100994586945 1032.57421875 517.2944 1032.57165527344 517.293090820313 2 14 1.1.1.4435.7 1 29.0658 7578.007 29.2155 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.2100009918213 ALKAWSVAR missed K-A@3 -0.00109188002534211 1000.58068847656 501.2976 1000.58178710938 501.298187255859 2 10 1.1.1.4485.3 1 30.2322 253.0912 30.2456 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.9699997901917 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 0.00616094982251525 1032.57763671875 517.2961 1032.57165527344 517.293090820313 2 10 1.1.1.4460.2 1 29.6491 143.1874 29.6658 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 93.4499979019165 ALKAWSVAR Trp->Kynurenin(W)@5 missed K-A@3 0.00326955993659794 1004.580078125 503.2973 1004.57672119141 503.295623779297 2 10 1.1.1.4465.12 1 29.7752 1246.987 29.7374 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 50.2099990844727 ALKAWSVAR Trp->Hydroxykynurenin(W)@5 missed K-A@3 0.00131069996859878 1020.57287597656 511.2937 1020.57165527344 511.293090820313 2 8 1.1.1.4415.6 1 28.5774 657.6618 28.6378 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 16.6600003838539 ALKAWSVARLSQKFPKAEFVEVTK Pro->pyro-Glu(P)@15 missed K-A@3; missed R-L@9; missed K-F@13; missed K-A@16 -0.00906800013035536 2746.50756835938 550.3088 2746.51708984375 550.310668945313 5 9 1.1.1.4736.10 1 36.2601 290.8089 36.2492 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK Oxidation(M)@10 missed K-T@7 0.00851739011704922 2214.09643554688 739.0394 2214.087890625 739.036560058594 3 20 1.1.1.5528.4 1 55.07 846.0573 55.1374 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK Oxidation(M)@10 missed K-T@7 0.00485529005527496 2214.09252929688 739.0381 2214.087890625 739.036560058594 3 18 1.1.1.5541.2 1 55.3936 776.9064 55.4646 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 0.0184566006064415 4122.88671875 1031.729 4122.8681640625 1031.72436523438 4 22 1.1.1.5571.8 1 56.1508 1023.105 56.2092 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Deamidated(N)@12; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 0.010037399828434 4123.8623046875 825.7797 4123.8525390625 825.777709960938 5 14 1.1.1.5586.3 1 56.5058 1023.257 56.5999 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; reduced acrolein addition +58(K)@19; Carbamidomethyl(C)@20; No Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 -0.0263480991125107 4123.8623046875 825.7797 4123.888671875 825.785034179688 5 21 1.1.1.5593.5 1 56.68 1023.257 56.5999 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1 missed K-F@6 -0.00132976996246725 1194.58032226563 598.2974 1194.58154296875 598.298034667969 2 14 1.1.1.4376.6 1 27.6307 967.0048 27.7093 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1 missed K-F@6 -0.00132976996246725 1194.58032226563 598.2974 1194.58154296875 598.298034667969 2 11 1.1.1.4384.7 1 27.8091 967.8931 27.7093 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 79.3600022792816 CASIQKFGER Carbamidomethyl(C)@1; Deamidated(Q)@5; acrolein addition +56(K)@6 missed K-F@6 0.00913812033832073 1251.60095214844 418.2076 1251.591796875 418.204528808594 3 8 1.1.1.4377.3 1 27.6451 288.7889 27.7093 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCAADDKEACFAVEGPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@10 missed K-E@7 0.00844839029014111 1926.79943847656 964.407 1926.791015625 964.402770996094 2 26 1.1.1.4568.5 1 32.2144 526.4073 32.2435 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 -0.00159068999346346 1137.48901367188 569.7518 1137.49072265625 569.752624511719 2 11 1.1.1.4395.6 1 28.0756 226.1801 27.9909 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 -0.000736222020350397 1137.49011230469 569.7523 1137.49072265625 569.752624511719 2 11 1.1.1.4388.5 1 27.9039 5922.212 27.6602 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.4999973773956 CCTESLVNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 -0.000736222020350397 1137.49011230469 569.7523 1137.49072265625 569.752624511719 2 12 1.1.1.4373.8 1 27.5524 8059.976 27.6358 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.9699997901917 CCTESLVNR Carbamidomethyl(C)@1; No Carbamidomethyl(C)@2 0.00165300001390278 1080.47082519531 541.2427 1080.46923828125 541.241882324219 2 11 1.1.1.4376.3 1 27.6207 120.6367 27.6358 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ser->Oxoalanine(S)@5; Carbamidomethyl(C)@12 missed R-R@9 -0.0145065998658538 2997.36376953125 750.3482 2997.37841796875 750.351867675781 4 20 1.1.1.5058.7 1 43.7948 982.6425 43.8265 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 -0.00627992022782564 2999.3876953125 750.8542 2999.39404296875 750.855773925781 4 21 1.1.1.5124.8 1 45.3874 7963.743 45.3992 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 -0.00627992022782564 2999.3876953125 750.8542 2999.39404296875 750.855773925781 4 20 1.1.1.5131.12 1 45.5597 7963.743 45.3992 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 -0.00910300016403198 2982.35864257813 746.5969 2982.36743164063 746.59912109375 4 16 1.1.1.5294.6 1 49.501 1289.124 49.4628 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 -0.00910300016403198 2982.35864257813 746.5969 2982.36743164063 746.59912109375 4 16 1.1.1.5295.5 1 49.5302 1289.124 49.4628 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 -0.00517607014626265 2982.36206054688 995.128 2982.36743164063 995.129760742188 3 15 1.1.1.5289.8 1 49.3829 12173.16 49.4628 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.8600015640259 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 -0.0109184999018908 2999.38305664063 750.853 2999.39404296875 750.855773925781 4 13 1.1.1.5117.16 1 45.2186 7931.85 45.3992 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.8100011348724 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 -0.00910300016403198 2982.35864257813 746.5969 2982.36743164063 746.59912109375 4 14 1.1.1.5297.7 1 49.576 1289.124 49.4628 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 75.0100016593933 CCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12; Carbamidomethyl(C)@39 missed R-R@9; missed K-A@25; missed K-L@30; missed K-Q@46; missed K-K@49 0.0135190999135375 5975.9130859375 996.9928 5975.8994140625 996.990539550781 6 13 1.1.1.5478.12 1 53.8126 620.1147 53.7978 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(P)@5; Carbamidomethyl(C)@12 missed R-M@9 -0.00504855997860432 2887.29223632813 722.8303 2887.29736328125 722.831604003906 4 20 1.1.1.5432.7 1 52.7921 2158.899 52.7107 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 80.9300005435944 CCTKPESERMPCTEDYLSLILNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-M@9 -0.00202968996018171 2871.30004882813 718.8323 2871.30224609375 718.832885742188 4 12 1.1.1.5493.5 1 54.1826 450.398 54.201 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.0184859000146389 3766.74243164063 754.3558 3766.76098632813 754.359436035156 5 18 1.1.1.5659.3 1 58.3114 1104.632 58.4043 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.9499986171722 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.0249127000570297 3766.73583984375 628.7966 3766.76098632813 628.80078125 6 17 1.1.1.5666.2 1 58.4835 1270.162 58.4043 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.4500029087067 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.0184859000146389 3766.74243164063 754.3558 3766.76098632813 754.359436035156 5 14 1.1.1.5667.3 1 58.507 1104.632 58.4043 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30 -0.0266063995659351 4408.07275390625 735.6861 4408.099609375 735.690490722656 6 19 1.1.1.5580.2 1 56.3597 1724.281 56.3797 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.9499995708466 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30 0.00341908005066216 4408.1025390625 882.6278 4408.099609375 882.627136230469 5 15 1.1.1.5582.4 1 56.4116 969.9216 56.3797 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.5300004482269 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 -0.0249070003628731 4736.28564453125 677.6195 4736.310546875 677.623046875 7 17 1.1.1.5534.4 1 55.2198 3678.872 55.2645 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 63.620001077652 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; acrolein addition +112(K)@4; Carbamidomethyl(C)@12; Dicarbamidomethyl(D)@15; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 -0.00522586982697248 4946.40625 707.6367 4946.41064453125 707.637390136719 7 11 1.1.1.5535.6 1 55.2469 217.6254 55.2645 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 43.4399992227554 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 -0.0249070003628731 4736.28564453125 677.6195 4736.310546875 677.623046875 7 13 1.1.1.5540.3 1 55.3696 3678.872 55.2645 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.0112161003053188 1566.74670410156 784.3806 1566.73547363281 784.375 2 18 1.1.1.5709.5 1 59.5417 1962.427 59.7076 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.0112161003053188 1566.74670410156 784.3806 1566.73547363281 784.375 2 22 1.1.1.5716.4 1 59.7137 1962.427 59.7076 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.5300004482269 DAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@21 missed K-D@18 0.0158238001167774 2457.18920898438 820.0703 2457.17333984375 820.065063476563 3 15 1.1.1.5377.6 1 51.4545 1272.728 51.5903 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 56.4800024032593 DEKLFTFHADICTLPDTEK Cation:K(E)@2; reduced HNE(H)@8; Carbamidomethyl(C)@12 cleaved F-D@N-term; missed K-L@3 0.00135479995515198 2475.166015625 826.0626 2475.16455078125 826.062133789063 3 9 1.1.1.5520.11 1 54.8725 196.4538 54.86 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.2399978637695 EKVLTSSAR Formyl(K)@2 missed K-V@2 0.00313716009259224 1017.54864501953 509.7816 1017.54547119141 509.779998779297 2 10 1.1.1.4327.3 1 26.5794 129.1602 26.5909 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 84.3100011348724 GCEKSLHTLFGDELCK Delta:H(4)C(2)@N-term; Carbamidomethyl(C)@2; acrolein addition +94(K)@4; Carbamidomethyl(C)@15 cleaved A-G@N-term; missed K-S@4 0.0198056008666754 2014.96887207031 672.6636 2014.94921875 672.657043457031 3 12 1.1.1.5100.12 1 44.8046 674.094 44.7195 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK 0.00313931005075574 1304.71203613281 653.3633 1304.70886230469 653.361694335938 2 19 1.1.1.4740.4 1 36.3664 5817.337 36.3715 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK 0.00302723003551364 1304.71179199219 435.9112 1304.70886230469 435.910217285156 3 13 1.1.1.4747.6 1 36.5246 3530.208 36.3952 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 42.9800003767014 HLVDEPQNLIK 0.00339343002997339 1304.71203613281 435.9113 1304.70886230469 435.910217285156 3 11 1.1.1.4735.2 1 36.2291 2962.117 36.3478 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@14 missed K-Q@11; missed K-L@19 0.0127092003822327 3814.9228515625 954.738 3814.91015625 954.734802246094 4 20 1.1.1.5567.13 1 56.0526 3238.795 56.1366 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@14 missed K-Q@11; missed K-L@19 -0.00338045996613801 3814.90649414063 763.9886 3814.91015625 763.989318847656 5 17 1.1.1.5567.3 1 56.0442 2421.224 56.1366 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 69.3000018596649 HPEYAVSVLLR 0.00307978992350399 1282.70642089844 642.3605 1282.70336914063 642.358947753906 2 10 1.1.1.5063.9 1 43.9152 659.7425 44.0192 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 18.7800005078316 HPEYAVSVLLR 0.00112670997623354 1282.70446777344 642.3595 1282.70336914063 642.358947753906 2 9 1.1.1.5077.11 1 44.2556 667.3437 44.1881 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@17; Carbamidomethyl(C)@23; Carbamidomethyl(C)@24; Carbamidomethyl(C)@32 missed K-Y@15; missed K-G@29 0.0171028003096581 4357.01318359375 872.4099 4356.99609375 872.406433105469 5 25 1.1.1.5607.6 1 57.0284 251.4475 57.0668 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.5300004482269 HPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@23; Carbamidomethyl(C)@24; Carbamidomethyl(C)@32 missed K-Y@15; missed K-G@29 0.00660433992743492 4356.0185546875 1090.012 4356.01171875 1090.01025390625 4 16 1.1.1.5659.10 1 58.3231 979.2579 58.3802 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 46.0500001907349 IETMREKVLTSSAR Carbamidomethyl(K)@7 missed R-E@5; missed K-V@7 -0.00141655001789331 1676.88659667969 420.2289 1676.88793945313 420.229278564453 4 10 1.1.1.4325.2 1 26.5214 1477.95 26.5844 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 42.9800003767014 IETMREKVLTSSAR Oxidation(M)@4 missed R-E@5; missed K-V@7 -0.00427620019763708 1635.85729980469 546.293 1635.86145019531 546.29443359375 3 12 1.1.1.4293.10 1 25.8636 445.0742 25.8687 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.9699997901917 KECCDKPLLEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved L-K@N-term; missed K-E@1 0.00106593000236899 1418.69079589844 473.9042 1418.68981933594 473.903869628906 3 9 1.1.1.4366.5 1 27.3709 285.154 27.4089 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 24.4100004434586 KECCDKPLLEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@4; ONE addition +154(K)@6 cleaved L-K@N-term; missed K-E@1 0.0085655003786087 1572.79772949219 525.2732 1572.78918457031 525.270324707031 3 9 1.1.1.4394.3 1 28.0479 495.5253 28.1133 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KQTALVELLK missed K-Q@1 0.00530205015093088 1141.71252441406 571.8635 1141.70703125 571.860778808594 2 17 1.1.1.4931.8 1 40.7896 10371.96 40.9368 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KQTALVELLK missed K-Q@1 0.00554618006572127 1141.71264648438 571.8636 1141.70703125 571.860778808594 2 15 1.1.1.4980.5 1 41.9303 603.1525 41.9624 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.8600015640259 KQTALVELLK missed K-Q@1 0.00554618006572127 1141.71264648438 571.8636 1141.70703125 571.860778808594 2 13 1.1.1.4979.5 1 41.9098 603.1525 41.9624 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.9699997901917 KQTALVELLK Carbamyl@N-term missed K-Q@1 0.00773674016818404 1184.720703125 593.3676 1184.712890625 593.363708496094 2 12 1.1.1.5287.3 1 49.3312 217.097 49.3421 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 24.4100004434586 KQTALVELLK reduced acrolein addition +58(K)@1; Deamidated(Q)@2; Dehydrated(T)@3 missed K-Q@1 0.00231607002206147 1182.72473144531 592.3696 1182.72241210938 592.368469238281 2 10 1.1.1.4964.3 1 41.5535 770.7514 41.4872 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.00146590999793261 1638.92919921875 547.317 1638.93041992188 547.317443847656 3 22 1.1.1.4871.5 1 39.4049 44376.13 39.505 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00333407009020448 1638.93383789063 820.4742 1638.93041992188 820.472534179688 2 25 1.1.1.4873.4 1 39.4523 24504.56 39.505 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@8 missed K-V@1 0.000637036981061101 1652.91040039063 551.9774 1652.90979003906 551.977172851563 3 19 1.1.1.4878.4 1 39.5669 674.944 39.5525 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.00146590999793261 1638.92919921875 547.317 1638.93041992188 547.317443847656 3 21 1.1.1.4879.4 1 39.5907 44376.13 39.505 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@8 missed K-V@1 0.000637036981061101 1652.91040039063 551.9774 1652.90979003906 551.977172851563 3 18 1.1.1.4879.5 1 39.5949 674.944 39.5525 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.00146590999793261 1638.92919921875 547.317 1638.93041992188 547.317443847656 3 21 1.1.1.4895.5 1 39.9666 31009.44 39.7185 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.00146590999793261 1638.92919921875 547.317 1638.93041992188 547.317443847656 3 21 1.1.1.4903.6 1 40.1635 17798.09 39.9081 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00402711005881429 1638.9345703125 547.3188 1638.93041992188 547.317443847656 3 21 1.1.1.4911.5 1 40.3495 2074.255 40.2396 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00823841989040375 1638.93872070313 547.3202 1638.93041992188 547.317443847656 3 17 1.1.1.4919.9 1 40.5422 1449.681 40.2869 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Formyl(K)@1 missed K-V@1 0.00715576019138098 1666.9326171875 834.4736 1666.92541503906 834.469970703125 2 19 1.1.1.5104.3 1 44.9021 755.7653 45.0096 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Formyl(K)@1 missed K-V@1 0.00715576019138098 1666.9326171875 834.4736 1666.92541503906 834.469970703125 2 18 1.1.1.5111.6 1 45.077 755.7653 45.0096 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Butyryl(K)@1; Oxidation(P)@3 missed K-V@1 0.0133485998958349 1724.98071289063 863.4976 1724.96728515625 863.490905761719 2 19 1.1.1.5346.12 1 50.7022 3010.286 50.7148 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR acrolein addition +56(K)@1; Oxidation(P)@3; Methyl(Q)@4 missed K-V@1 0.0133485998958349 1724.98071289063 863.4976 1724.96728515625 863.490905761719 2 14 1.1.1.5353.12 1 50.8752 3010.286 50.7148 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.00146590999793261 1638.92919921875 547.317 1638.93041992188 547.317443847656 3 16 1.1.1.4874.2 1 39.4627 44376.13 39.505 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Dioxidation(P)@3 missed K-V@1 -0.00408683018758893 1670.91625976563 836.4654 1670.92028808594 836.467407226563 2 16 1.1.1.4887.5 1 39.7846 429.5487 39.7422 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Dioxidation(P)@3 missed K-V@1 0.00642644986510277 1670.92651367188 557.9828 1670.92028808594 557.980712890625 3 16 1.1.1.4884.4 1 39.7134 743.8934 39.6236 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR reduced acrolein addition +58(K)@1; Deamidated(Q)@4; Dehydrated(S)@6 missed K-V@1 0.0149349998682737 1679.96081542969 560.9942 1679.94580078125 560.989196777344 3 16 1.1.1.4899.3 1 40.0631 2739.426 40.1449 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR reduced acrolein addition +58(K)@1; Deamidated(Q)@4; Dehydrated(S)@6 missed K-V@1 0.0149349998682737 1679.96081542969 560.9942 1679.94580078125 560.989196777344 3 16 1.1.1.4907.7 1 40.2556 2739.426 40.1449 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@8 missed K-V@1 -0.00372287002392113 1652.90612792969 827.4603 1652.90979003906 827.462158203125 2 15 1.1.1.4874.6 1 39.4761 420.127 39.5288 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.7500021457672 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@8 missed K-V@1 0.00155253999400884 1652.91137695313 551.9777 1652.90979003906 551.977172851563 3 14 1.1.1.4895.6 1 39.9691 496.812 39.7897 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.8100011348724 KVPQVSTPTLVEVSR Acetyl@N-term missed K-V@1 0.00595076009631157 1680.94702148438 841.4808 1680.94104003906 841.477783203125 2 11 1.1.1.5114.11 1 45.1479 567.5152 45.2522 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.8100011348724 KVPQVSTPTLVEVSR Acetyl@N-term missed K-V@1 0.00595076009631157 1680.94702148438 841.4808 1680.94104003906 841.477783203125 2 12 1.1.1.5121.9 1 45.3175 567.5152 45.2522 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.2499976158142 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@3 missed K-V@1 -0.00274633010849357 1652.90710449219 827.4608 1652.90979003906 827.462158203125 2 13 1.1.1.4883.6 1 39.6897 422.1932 39.7422 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 90.719997882843 KVPQVSTPTLVEVSR Dioxidation(P)@8 missed K-V@1 -0.00108067004475743 1670.91906738281 557.9803 1670.92028808594 557.980712890625 3 13 1.1.1.4874.4 1 39.4694 965.1881 39.505 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 90.719997882843 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@8 missed K-V@1 0.0116576002910733 1652.92150878906 827.468 1652.90979003906 827.462158203125 2 11 1.1.1.4891.7 1 39.8794 0 -1 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 90.719997882843 KVPQVSTPTLVEVSR acrolein addition +56(K)@1; Oxidation(P)@3; Methyl(Q)@4 missed K-V@1 0.00276821991428733 1724.97009277344 863.4923 1724.96728515625 863.490905761719 2 12 1.1.1.5339.9 1 50.5344 2991.209 50.7148 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 76.2499988079071 KVPQVSTPTLVEVSR Dioxidation(P)@3 missed K-V@1 -0.014096399769187 1670.90625 836.4604 1670.92028808594 836.467407226563 2 12 1.1.1.4877.7 1 39.5474 499.3116 39.505 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 39.6800011396408 KVPQVSTPTLVEVSR Carbamidomethyl@N-term; Deamidated(Q)@4 missed K-V@1 0.00151078996714205 1696.9375 849.476 1696.93591308594 849.475280761719 2 8 1.1.1.5173.17 1 46.5813 310.6566 46.6385 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 15.5499994754791 KVPQVSTPTLVEVSR Carbamyl@N-term missed K-V@1 0.00713864015415311 1681.94348144531 841.979 1681.93627929688 841.975402832031 2 9 1.1.1.5095.6 1 44.6852 376.4209 44.6953 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.00763237988576293 1478.7958984375 740.4052 1478.78820800781 740.4013671875 2 22 1.1.1.5354.4 1 50.902 14195.07 50.8626 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Oxidation(Y)@4 0.00694247987121344 1494.7900390625 748.4023 1494.78308105469 748.398803710938 2 16 1.1.1.5358.4 1 50.9984 441.4365 50.8869 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Delta:H(2)C(2)@N-term 0.0087678600102663 1504.81262207031 753.4136 1504.80383300781 753.4091796875 2 20 1.1.1.5486.10 1 54.0089 297.2898 53.9728 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR -0.00278394995257258 1478.78527832031 493.9357 1478.78820800781 493.936676025391 3 17 1.1.1.5353.2 1 50.866 865.4855 50.8869 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Carbamidomethyl(Y)@4; Deamidated(N)@8 0.0043988199904561 1536.79809570313 769.4063 1536.79370117188 769.404113769531 2 15 1.1.1.5316.4 1 49.9927 2025.846 49.9563 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.7500021457672 LGEYGFQNALIVR Carbamidomethyl(Y)@4; Deamidated(N)@8 0.0043988199904561 1536.79809570313 769.4063 1536.79370117188 769.404113769531 2 14 1.1.1.5309.7 0 49.826 2025.846 49.9563 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.9699997901917 LGEYGFQNALIVR Carbamidomethyl(Y)@4; Deamidated(N)@8 0.0043988199904561 1536.79809570313 769.4063 1536.79370117188 769.404113769531 2 13 1.1.1.5324.6 1 50.1708 2144.638 49.9322 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 40.2700006961823 LGEYGFQNALIVR Delta:H(2)C(2)@N-term 0.00632645981386304 1504.81030273438 753.4124 1504.80383300781 753.4091796875 2 8 1.1.1.5479.10 1 53.8334 144.5602 53.8476 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 53.2700002193451 LKAWSVAR acrolein addition +112(K)@2; Dioxidation(W)@4 cleaved A-L@N-term; missed K-A@2 0.0116755999624729 1073.5986328125 537.8066 1073.5869140625 537.800720214844 2 9 1.1.1.4463.5 1 29.7257 418.459 29.7374 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-E@2 -2.3267099095392E-05 1531.77368164063 511.5985 1531.77380371094 511.598541259766 3 18 1.1.1.4365.5 1 27.3465 7794.269 27.4089 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-E@2 -2.3267099095392E-05 1531.77368164063 511.5985 1531.77380371094 511.598541259766 3 15 1.1.1.4372.4 1 27.5258 7794.269 27.4089 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 35.359999537468 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5; Dioxidation(P)@8 missed K-E@2 -0.000485758006107062 1563.76330566406 522.2617 1563.763671875 522.261840820313 3 10 1.1.1.4366.8 1 27.3784 480.3388 27.4089 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00531703978776932 2697.3056640625 675.3337 2697.31079101563 675.3349609375 4 19 1.1.1.5280.6 1 49.1627 989.0768 49.318 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00531703978776932 2697.3056640625 675.3337 2697.31079101563 675.3349609375 4 25 1.1.1.5287.4 1 49.3371 989.0768 49.318 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00531703978776932 2697.3056640625 675.3337 2697.31079101563 675.3349609375 4 16 1.1.1.5294.5 1 49.4985 989.0768 49.318 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00627622986212373 2669.30981445313 668.3347 2669.31591796875 668.336242675781 4 17 1.1.1.5308.2 1 49.7985 1020.913 49.9322 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00627622986212373 2669.30981445313 668.3347 2669.31591796875 668.336242675781 4 27 1.1.1.5315.2 1 49.9671 1031.929 49.9563 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.0111589003354311 2669.30493164063 668.3335 2669.31591796875 668.336242675781 4 17 1.1.1.5323.3 1 50.1416 988.398 50.0585 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00295960996299982 2665.31811523438 667.3368 2665.32104492188 667.337524414063 4 16 1.1.1.5328.4 1 50.2609 334.3704 50.3002 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.4999973773956 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.0102835996076465 2665.31103515625 667.335 2665.32104492188 667.337524414063 4 13 1.1.1.5336.5 1 50.4549 331.074 50.4215 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 42.9800003767014 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 0.00111650000326335 2665.322265625 534.0717 2665.32104492188 534.071472167969 5 12 1.1.1.5327.5 1 50.2367 366.4073 50.3002 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0091822799295187 3605.77709960938 722.1627 3605.78637695313 722.16455078125 5 22 1.1.1.5484.3 1 53.9543 2374.234 53.9979 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0178421996533871 3605.7685546875 601.9687 3605.78637695313 601.9716796875 6 21 1.1.1.5486.5 1 54.0048 2045.7 53.9979 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 0.0127371000126004 3605.79931640625 902.4571 3605.78637695313 902.453918457031 4 14 1.1.1.5489.8 1 54.0832 1072.453 54.0232 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0091822799295187 3605.77709960938 722.1627 3605.78637695313 722.16455078125 5 16 1.1.1.5491.6 1 54.1327 2374.234 53.9979 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0185745991766453 3605.76806640625 601.9686 3605.78637695313 601.9716796875 6 11 1.1.1.5496.3 1 54.2579 2132.516 53.9979 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0113145001232624 3577.78002929688 716.5633 3577.79150390625 716.565612792969 5 23 1.1.1.5525.4 1 54.9935 1357.756 54.9872 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.5300004482269 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.00381423998624086 3573.79321289063 715.7659 3573.79663085938 715.7666015625 5 15 1.1.1.5565.4 1 55.9949 1062.75 56.1366 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 62.0700001716614 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Oxidation(W)@20; Carbamidomethyl(K)@22 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.00740545988082886 3646.8056640625 730.3684 3646.81298828125 730.369873046875 5 11 1.1.1.5485.4 1 53.9811 317.1154 54.0232 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 46.0500001907349 LSQKFPK Oxidation(F)@5 missed K-F@4 0.000723772973287851 862.492065429688 432.2533 862.491271972656 432.252899169922 2 7 1.1.1.4252.3 1 24.9386 194.8268 25.001 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 30.9700012207031 LSQKFPK missed K-F@4 0.0035083401016891 846.499877929688 424.2572 846.496337890625 424.255432128906 2 11 1.1.1.4252.2 1 24.9344 7862.355 25.0255 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 0.00561854988336563 1749.97204589844 584.3313 1749.96655273438 584.329467773438 3 25 1.1.1.4761.2 1 36.858 1706.813 36.8714 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 0.00349621009081602 1749.97009277344 438.4998 1749.96655273438 438.498901367188 4 16 1.1.1.4763.5 1 36.9072 2605.687 36.8952 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00424626003950834 2520.41625976563 631.1113 2520.42041015625 631.112365722656 4 19 1.1.1.5663.2 1 58.4085 723.5158 58.3802 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 0.011077200062573 2520.431640625 841.1511 2520.42041015625 841.147399902344 3 17 1.1.1.5654.2 1 58.19 278.7562 58.2093 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00619937013834715 2520.4140625 631.1108 2520.42041015625 631.112365722656 4 16 1.1.1.5647.3 1 58.0189 635.1537 58.2093 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.5300004482269 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00449040019884706 2520.41577148438 631.1112 2520.42041015625 631.112365722656 4 16 1.1.1.5656.2 1 58.2374 687.3138 58.2583 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.5300004482269 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 0.0149224000051618 2520.43505859375 841.1523 2520.42041015625 841.147399902344 3 15 1.1.1.5663.4 1 58.4119 243.41 58.3071 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.5300004482269 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00424626003950834 2520.41625976563 631.1113 2520.42041015625 631.112365722656 4 13 1.1.1.5677.4 1 58.7571 1002.609 58.6027 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LVNELTEFAK 0.00430377991870046 1162.62768554688 582.3211 1162.62341308594 582.318969726563 2 12 1.1.1.5115.8 1 45.1631 1718.654 45.1547 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LVNELTEFAK 0.00430377991870046 1162.62768554688 582.3211 1162.62341308594 582.318969726563 2 12 1.1.1.5108.7 1 44.9995 1718.654 45.1547 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 91.6899979114532 LVNELTEFAK 0.00466998014599085 1162.62805175781 582.3213 1162.62341308594 582.318969726563 2 8 1.1.1.5129.5 1 45.5024 1052.449 45.2522 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.8600015640259 LVVSTQTALA 0.004174729809165 1001.57989501953 501.7972 1001.57568359375 501.795135498047 2 13 1.1.1.4957.2 1 41.3789 9249.193 41.2264 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 95.9999978542328 MPCTEDYLSLILNR Oxidation(M)@1; Carbamidomethyl(C)@3 0.0137085998430848 1739.83581542969 870.9252 1739.822265625 870.918395996094 2 13 1.1.1.5640.7 1 57.8527 956.7099 57.9638 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 -0.0126540996134281 3260.61157226563 653.1296 3260.62426757813 653.132141113281 5 22 1.1.1.5787.6 1 61.312 1037.996 61.3941 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 0.00681520998477936 3260.630859375 816.165 3260.62426757813 816.163391113281 4 23 1.1.1.5789.4 1 61.3601 566.6441 61.3941 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 -0.0126540996134281 3260.61157226563 653.1296 3260.62426757813 653.132141113281 5 23 1.1.1.5794.4 1 61.4876 1037.996 61.3941 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 28.6500006914139 MPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 -0.0151040004566312 3244.6142578125 812.1608 3244.62939453125 812.164611816406 4 12 1.1.1.5819.5 1 62.1123 330.0858 62.103 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.5300004482269 MPCTEDYLSLILNRLCVLHEKTPVSEKVTK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21; missed K-V@27 -0.0193077996373177 3588.81616210938 599.1433 3588.83544921875 599.146484375 6 17 1.1.1.5677.3 1 58.7562 911.0655 58.8011 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 NYQEAKDAFLGSFLYEYSR missed K-D@6 0.0297906007617712 2300.10546875 1151.06 2300.07495117188 1151.04479980469 2 15 1.1.1.5565.17 1 56.0057 746.2759 56.0393 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3; Carbamidomethyl(Y)@12; Deamidated(N)@16 missed K-L@8 0.0132544999942183 2586.23046875 863.0841 2586.21728515625 863.079711914063 3 16 1.1.1.5417.6 1 52.4282 1648.778 52.4903 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 0.0107330996543169 2528.22241210938 843.7481 2528.2119140625 843.744567871094 3 34 1.1.1.5475.11 1 53.7352 14256.04 53.7732 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3; Oxidation(K)@8 missed K-L@8 0.00238991994410753 2544.20922851563 849.077 2544.20678710938 849.076171875 3 15 1.1.1.5475.12 1 53.7361 616.4183 53.7732 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3; Dicarbamidomethyl(D)@4; ONE addition +154(K)@8 missed K-L@8 -0.00636756001040339 2796.34790039063 933.1232 2796.35400390625 933.125305175781 3 12 1.1.1.5477.10 1 53.7836 156.7446 53.7732 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 missed K-L@8 0.0121387001127005 2511.19750976563 838.0731 2511.18530273438 838.069030761719 3 19 1.1.1.5628.6 1 57.5515 1717.66 57.5433 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 -0.00206900993362069 2528.20971679688 633.0597 2528.2119140625 633.060241699219 4 17 1.1.1.5479.6 1 53.83 1664.032 53.7732 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 69.5800006389618 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3; Carbamidomethyl(Y)@12; Deamidated(N)@16 missed K-L@8 0.0132544999942183 2586.23046875 863.0841 2586.21728515625 863.079711914063 3 11 1.1.1.5424.8 1 52.6023 1648.778 52.4903 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 69.5800006389618 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3; Carbamidomethyl(Y)@12; Deamidated(N)@16 missed K-L@8 0.00623043021187186 2569.19702148438 857.4063 2569.19067382813 857.404174804688 3 9 1.1.1.5553.3 1 55.692 233.0617 55.7121 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 43.4399992227554 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 0.0107330996543169 2528.22241210938 843.7481 2528.2119140625 843.744567871094 3 10 1.1.1.5482.11 1 53.9094 14256.04 53.7732 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QTALVELLK 0.00663253990933299 1013.61889648438 507.8167 1013.61212158203 507.813323974609 2 14 1.1.1.5262.3 1 48.7266 37874.03 48.7135 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QTALVELLK Dehydrated(T)@2 0.00013041400234215 995.601684570313 498.8081 995.601501464844 498.808044433594 2 11 1.1.1.5266.2 1 48.814 1075.209 48.7376 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.8600015640259 QTALVELLK 0.00663253990933299 1013.61889648438 507.8167 1013.61212158203 507.813323974609 2 13 1.1.1.5255.3 1 48.564 37874.03 48.7135 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.2699990272522 QTALVELLK Gln->pyro-Glu@N-term 0.00404507014900446 996.589660644531 499.3021 996.585571289063 499.300048828125 2 14 1.1.1.5714.2 1 59.6636 1056.719 59.6312 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.4999973773956 QTALVELLK 0.00742596993222833 1013.61944580078 507.817 1013.61212158203 507.813323974609 2 12 1.1.1.5316.3 1 49.9894 1031.407 49.836 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 89.6899998188019 QTALVELLK Dehydrated(T)@2 0.00171728001441807 995.603271484375 498.8089 995.601501464844 498.808044433594 2 8 1.1.1.5259.2 1 48.6445 1092.98 48.6413 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 81.6200017929077 QTALVELLK 0.00626634014770389 1013.61846923828 507.8165 1013.61212158203 507.813323974609 2 10 1.1.1.5293.5 1 49.4719 683.8693 49.487 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 48.3000010251999 QTALVELLK 0.00644944002851844 1013.61865234375 507.8166 1013.61212158203 507.813323974609 2 10 1.1.1.5300.6 1 49.6434 910.7575 49.656 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 21.6800004243851 QTALVELLK 0.00742596993222833 1013.61944580078 507.817 1013.61212158203 507.813323974609 2 10 1.1.1.5309.5 1 49.821 1031.407 49.836 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.2000002861023 QTALVELLKHKPK missed K-H@9 0.00167963001877069 1503.91540527344 502.3124 1503.91369628906 502.311828613281 3 12 1.1.1.4737.12 1 36.2869 2130.122 36.1991 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 94.5800006389618 QTALVELLKHKPK missed K-H@9 0.00167963001877069 1503.91540527344 502.3124 1503.91369628906 502.311828613281 3 12 1.1.1.4730.7 1 36.1144 2130.122 36.1991 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 53.1899988651276 QTALVELLKHKPK Formyl(K)@11; reduced acrolein addition +58(K)@13 missed K-H@9 0.0124763995409012 1589.96301269531 795.9888 1589.95043945313 795.982543945313 2 9 1.1.1.5490.10 1 54.1145 155.6474 54.1246 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 19.9799999594688 RHPEYAVSVLLR Oxidation(Y)@5 missed R-H@1 -0.000381877005565912 1454.79907226563 485.9403 1454.79943847656 485.940399169922 3 9 1.1.1.4820.5 1 38.2434 496.1046 38.2551 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANK missed R-H@1 0.00194613996427506 2044.0224609375 512.0129 2044.02062988281 512.012451171875 4 14 1.1.1.5333.5 1 50.3788 785.163 50.4215 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANK missed R-H@1 -0.00324263004586101 2044.01733398438 682.3464 2044.02062988281 682.347534179688 3 22 1.1.1.5337.2 1 50.4775 1170.386 50.4215 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.00467426981776953 4513.1015625 903.6276 4513.09716796875 903.626647949219 5 25 1.1.1.5511.8 1 54.6418 1965.935 54.7076 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0112877003848553 4513.08544921875 753.1882 4513.09716796875 753.190124511719 6 24 1.1.1.5513.2 1 54.6867 780.4121 54.7076 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -1.00258004665375 4511.1103515625 903.2294 4512.11279296875 903.429870605469 5 19 1.1.1.5544.8 1 55.4738 1117.092 55.564 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0226313006132841 4512.08984375 753.0223 4512.11279296875 753.026123046875 6 26 1.1.1.5548.3 1 55.5687 2317.924 55.6875 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.00496356002986431 4512.10791015625 903.4289 4512.11279296875 903.429870605469 5 36 1.1.1.5551.8 1 55.6466 5383.081 55.6875 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0226313006132841 4512.08984375 753.0223 4512.11279296875 753.026123046875 6 27 1.1.1.5555.4 1 55.7425 2317.924 55.6875 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.00496356002986431 4512.10791015625 903.4289 4512.11279296875 903.429870605469 5 25 1.1.1.5558.6 1 55.8199 5383.081 55.6875 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0115000996738672 4513.08544921875 903.6244 4513.09716796875 903.626647949219 5 28 1.1.1.5600.4 1 56.8528 430.1363 56.8695 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.1300005912781 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.0315394997596741 4513.12646484375 1129.289 4513.09716796875 1129.28149414063 4 15 1.1.1.5514.10 1 54.7259 557.54 54.7076 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 31.3100010156631 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@15; HPNE addition +172(K)@16; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; acrolein addition +38(K)@30; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.0465908013284206 4723.26904296875 788.2188 4723.22265625 788.211059570313 6 9 1.1.1.5556.6 1 55.7693 331.6374 55.7869 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 0.00208647991530597 1879.91577148438 627.6459 1879.91381835938 627.645202636719 3 18 1.1.1.5012.6 1 42.6954 6055.221 42.8676 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 0.00208647991530597 1879.91577148438 627.6459 1879.91381835938 627.645202636719 3 23 1.1.1.5019.3 1 42.8567 6101.571 42.8676 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 0.00208647991530597 1879.91577148438 627.6459 1879.91381835938 627.645202636719 3 20 1.1.1.5026.4 1 43.0231 6101.571 42.8676 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SHCIAEVEK Carbamidomethyl(C)@3 0.00144681998062879 1071.50341796875 536.759 1071.501953125 536.758239746094 2 14 1.1.1.4140.3 1 23.849 466.067 23.9064 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SHCIAEVEK Carbamidomethyl(C)@3 -0.000994522008113563 1071.50109863281 536.7578 1071.501953125 536.758239746094 2 15 1.1.1.4160.2 1 24.021 499.3047 23.9485 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 78.600001335144 SLGKVGTR Acetyl(K)@4 missed K-V@4 0.00258955010212958 858.494873046875 430.2547 858.492309570313 430.253448486328 2 12 1.1.1.4356.2 1 27.1498 910.8918 27.2046 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.0140495002269745 1418.70043945313 473.9074 1418.68640136719 473.902740478516 3 17 1.1.1.5095.2 1 44.6752 2555.134 44.6953 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00441156979650259 1418.69091796875 710.3527 1418.68640136719 710.350463867188 2 19 1.1.1.5102.5 1 44.8596 4121.438 44.7195 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00221436005085707 1418.68872070313 710.3516 1418.68640136719 710.350463867188 2 15 1.1.1.5109.7 1 45.0262 351.9523 45.0338 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 87.4400019645691 SLHTLFGDELCK Carbamidomethyl(C)@11 1.01057004928589 1419.69689941406 474.2396 1418.68640136719 473.902740478516 3 12 1.1.1.5101.2 1 44.8212 1728.317 44.7437 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 81.6200017929077 SLHTLFGDELCK Carbamidomethyl(C)@11 -0.00816136039793491 1418.67822265625 710.3464 1418.68640136719 710.350463867188 2 11 1.1.1.5116.10 1 45.1916 277.4638 45.179 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -0.00365029997192323 1462.57800292969 488.5333 1462.58166503906 488.534515380859 3 15 1.1.1.3731.3 1 20.7535 393.2758 20.6771 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -0.00722075998783112 1462.57446289063 488.5321 1462.58166503906 488.534515380859 3 15 1.1.1.3762.2 1 20.9663 147.6685 20.9471 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -0.00749540980905294 1462.57421875 488.532 1462.58166503906 488.534515380859 3 14 1.1.1.3682.3 1 20.4173 778.8179 20.4735 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 86.2299978733063 TPVSEKVTK Acetyl(K)@6 missed K-V@6 0.00126699998509139 1029.57189941406 515.7932 1029.57067871094 515.792602539063 2 10 1.1.1.4364.4 1 27.3243 148.0457 27.3336 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.00296841003000736 1414.68322753906 708.3489 1414.68029785156 708.347412109375 2 14 1.1.1.5286.7 1 49.3062 406.9143 49.318 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.00528769008815289 1414.68542480469 708.35 1414.68029785156 708.347412109375 2 12 1.1.1.5293.7 1 49.4752 406.9143 49.318 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.00614215992391109 1414.6865234375 708.3505 1414.68029785156 708.347412109375 2 12 1.1.1.5265.8 1 48.7983 266.3264 48.8583 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.5700011253357 TVMENFVAFVDK Oxidation(M)@3 0.00235807010903955 1414.6826171875 708.3486 1414.68029785156 708.347412109375 2 13 1.1.1.5279.10 1 49.1351 475.3073 49.197 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 93.4599995613098 TVMENFVAFVDK 0.00767061999067664 1398.69311523438 700.3538 1398.68530273438 700.349975585938 2 9 1.1.1.5560.4 1 55.8687 296.9298 55.9386 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 -0.000481524999486282 3323.46020507813 831.8723 3323.46069335938 831.872436523438 4 22 1.1.1.5373.6 1 51.3551 2326.76 51.2729 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 0.0107488995417953 3323.47143554688 831.8751 3323.46069335938 831.872436523438 4 23 1.1.1.5380.11 1 51.5329 2047.33 51.4434 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 -9.98260974884033 3297.4833984375 825.3781 3307.4658203125 827.873718261719 4 12 1.1.1.5578.4 1 56.3127 693.9863 56.2581 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 65.149998664856 VDEPQNLIKQNCDQFEKLGEYGFQNALIVR acrolein addition +76(K)@9; Carbamidomethyl(C)@12; MDA adduct +54(K)@17 cleaved L-V@N-term; missed K-Q@9; missed K-L@17 0.0671705976128578 3694.8759765625 739.9825 3694.80908203125 739.969055175781 5 9 1.1.1.5386.7 1 51.6714 215.4427 51.6148 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 43.7900006771088 VDEPQNLIKQNCDQFEKLGEYGFQNALIVR Oxidation(P)@4; acrolein addition +56(K)@9; Carbamidomethyl(C)@12; reduced acrolein addition +58(K)@17; Deamidated(N)@25 cleaved L-V@N-term; missed K-Q@9; missed K-L@17 0.0590323992073536 3695.873046875 740.1819 3695.81420898438 740.170104980469 5 11 1.1.1.5349.7 1 50.7724 7873.454 50.7396 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VPQVSTPTLVEVSR 0.000512582017108798 1510.83605957031 756.4253 1510.83544921875 756.425048828125 2 22 1.1.1.5054.4 1 43.7011 2390.735 43.6581 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VPQVSTPTLVEVSR 0.000512582017108798 1510.83605957031 756.4253 1510.83544921875 756.425048828125 2 13 1.1.1.5047.8 1 43.5327 2390.735 43.6581 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VPQVSTPTLVEVSR 0.00393046997487545 1510.83947753906 756.427 1510.83544921875 756.425048828125 2 13 1.1.1.5068.5 1 44.0349 1686.908 43.7783 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 82.9599976539612 YGFQNALIVRYTRKVPQVSTPTLVEVSR Carbamidomethyl@N-term cleaved E-Y@N-term; missed R-Y@10; missed R-K@13; missed K-V@14 0.0590797998011112 3277.85327148438 1093.625 3277.79345703125 1093.60510253906 3 12 1.1.1.4875.6 1 39.4999 746.3596 39.5288 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 0.00114117003977299 1442.63610839844 722.3253 1442.634765625 722.324645996094 2 18 1.1.1.4368.5 1 27.4294 156.7055 27.4345 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -0.00191051000729203 1442.63293457031 722.3237 1442.634765625 722.324645996094 2 20 1.1.1.4388.6 1 27.9064 20801.99 28.0156 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -0.00191051000729203 1442.63293457031 722.3237 1442.634765625 722.324645996094 2 21 1.1.1.4395.7 1 28.0772 20801.99 28.0156 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -0.00203258008696139 1442.63293457031 722.3237 1442.634765625 722.324645996094 2 17 1.1.1.4402.7 1 28.2539 21945.63 28.0156 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3; Deamidated(N)@5 0.00111018994357437 1443.61987304688 722.8172 1443.61877441406 722.816650390625 2 17 1.1.1.4428.6 1 28.8959 141.2105 28.877 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -0.00606080004945397 1442.62890625 722.3217 1442.634765625 722.324645996094 2 12 1.1.1.4417.16 1 28.6327 159.6677 28.6378 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Dioxidation(Y)@1; Carbamidomethyl(C)@3 -0.00424177991226316 1474.62023925781 738.3174 1474.62463378906 738.319580078125 2 14 1.1.1.4391.7 1 27.9834 520.6057 28.0402 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 76.2499988079071 YICDNQDTISSK Trioxidation(Y)@1; Carbamidomethyl(C)@3 -0.00259738997556269 1490.61682128906 746.3157 1490.61950683594 746.317016601563 2 11 1.1.1.4391.8 1 27.9859 273.8496 28.0402 1 158.04 158.04 94.0699994564056 86.82000041008 85.1700007915497 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 26.6099989414215 YLYEIAR Oxidation(Y)@3 0.00309102004393935 942.484252929688 472.2494 942.481079101563 472.247802734375 2 8 1.1.1.4744.5 1 36.4538 600.2236 36.4664 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; MDA adduct +62(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.00285637006163597 3620.92309570313 725.1919 3620.92016601563 725.191345214844 5 14 1.1.1.5499.5 1 54.3367 556.85 54.2269 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 DNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@8 cleaved L-D@N-term; missed K-L@8 0.00573679013177752 2015.07788085938 672.6999 2015.07214355469 672.697998046875 3 24 1.1.1.5398.3 1 51.9687 387.5045 51.9796 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@14 cleaved N-F@N-term; missed K-L@14 0.015972999855876 2647.3798828125 883.4672 2647.36401367188 883.4619140625 3 14 1.1.1.5604.7 1 56.9512 364.2927 57.0419 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 GNTLDNDIMLIK cleaved N-G@N-term -0.000100903002021369 1345.69104003906 673.8528 1345.69116210938 673.852844238281 2 16 1.1.1.5288.3 1 49.3529 332.1936 49.3664 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR cleaved N-G@N-term; missed K-L@12 0.00143241998739541 2372.23852539063 791.7534 2372.23706054688 791.7529296875 3 11 1.1.1.5521.9 1 54.8966 312.9033 54.9117 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IDVLEGNEQFINAAK cleaved N-I@N-term -0.00247347005642951 1659.84423828125 830.9294 1659.84680175781 830.9306640625 2 23 1.1.1.5214.7 1 47.5718 762.2599 47.6077 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@15 cleaved N-I@N-term; missed K-I@15; missed K-L@35 0.0453261993825436 5006.62646484375 835.445 5006.5810546875 835.4375 6 13 1.1.1.5954.2 1 65.3827 149.5093 65.3961 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IITHPNFNGNTLDNDIMLIK Ammonia-loss(N)@10; Methyl(K)@20 0.015014199540019 2279.17700195313 760.733 2279.162109375 760.727966308594 3 12 1.1.1.5478.4 1 53.8034 263.3133 53.8226 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLN Delta:H(4)C(2)(K)@20 cleaved N-S@C-term; missed K-L@20 0.027318999171257 3093.64428710938 1032.222 3093.61694335938 1032.212890625 3 16 1.1.1.5707.9 1 59.4992 432.4579 59.5568 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 [trypsin fragment, 30 aa] Ammonia-loss(N)@10; Methyl(K)@20 missed K-L@20 0.000955655006691813 3305.70849609375 827.4344 3305.70776367188 827.434204101563 4 24 1.1.1.5599.6 1 56.8276 1596.54 56.7473 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IMLIKLSSPATLNSR Delta:H(4)C(2)(K)@5 cleaved D-I@N-term; missed K-L@5 -0.00116300000809133 1670.97436523438 557.9987 1670.97534179688 557.9990234375 3 24 1.1.1.5224.3 1 47.8092 5324.964 47.8508 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 -0.00397050986066461 2706.40502929688 903.1423 2706.40893554688 903.143615722656 3 22 1.1.1.5326.11 1 50.2141 7216.29 50.3002 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPN acrolein addition +112(K)@24; reduced HNE(H)@28; Deamidated(N)@30 cleaved N-F@C-term; missed R-L@4; missed K-I@24 -0.0295387003570795 3652.9169921875 914.2365 3652.94653320313 914.243896484375 4 12 1.1.1.5631.9 1 57.6305 366.9349 57.6204 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@24; Delta:H(2)C(2)(H)@28 cleaved F-N@C-term; missed R-L@4; missed K-I@24 -0.030519200488925 3652.90600585938 731.5885 3652.9365234375 731.594604492188 5 18 1.1.1.5630.3 1 57.6028 353.8023 57.6204 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0172850005328655 6011.11474609375 859.738 6011.1328125 859.740539550781 7 30 1.1.1.5820.6 1 62.1344 2014.016 62.1274 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATV MDA adduct +62(K)@24 cleaved V-S@C-term; missed R-L@4; missed K-I@24; missed K-L@44; missed R-V@54 0.0193691998720169 6429.3759765625 1072.57 6429.3544921875 1072.56628417969 6 14 1.1.1.5827.6 1 62.3148 1521.847 62.299 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Dehydrated(S)@11; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; Carbamidomethyl(Y)@42; hexanoyl addition +98(K)@43 0.0170079004019499 4796.27392578125 960.2621 4796.25732421875 960.258728027344 5 15 1.1.1.5476.7 1 53.7565 3842.215 53.7978 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKS Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; MDA adduct +54(K)@43 cleaved S-R@C-term; missed K-S@43 0.0795867964625359 4800.294921875 1201.081 4800.2158203125 1201.06127929688 4 14 1.1.1.5441.2 1 53.0004 564.7285 52.9818 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; MDA adduct +54(K)@43; Arg-loss@C-term missed K-S@43 0.0795867964625359 4800.294921875 1201.081 4800.2158203125 1201.06127929688 4 14 1.1.1.5441.2 1 53.0004 564.7285 52.9818 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 KIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@9; acrolein addition +56(K)@21 cleaved A-K@N-term; missed K-I@1; missed K-L@21 0.0402804017066956 3493.86401367188 699.7801 3493.82397460938 699.772033691406 5 10 1.1.1.5537.5 1 55.296 484.624 55.2892 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 KPGVYTKVCNYVNWIQQTIAAN acrolein addition +38(K)@1; acrolein addition +94(K)@7; Carbamidomethyl(C)@9; Deamidated(N)@10 cleaved N-K@N-term; missed K-V@7 0.00299190008081496 2699.3447265625 900.7889 2699.341796875 900.787841796875 3 13 1.1.1.5834.4 1 62.4761 531.1306 62.4444 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LDNDIMLIKLSSPATLNSR Dioxidation(M)@6; hexanoyl addition +98(K)@9 cleaved T-L@N-term; missed K-L@9 0.0211615990847349 2230.208984375 744.4103 2230.18798828125 744.403259277344 3 13 1.1.1.5499.9 1 54.34 8355.99 54.3294 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGN cleaved N-E@C-term 0.00423526018857956 1308.63525390625 655.3249 1308.63098144531 655.32275390625 2 15 1.1.1.4873.3 1 39.4465 989.577 39.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00976489018648863 1565.74182128906 783.8782 1565.73217773438 783.873352050781 2 17 1.1.1.4869.8 1 39.3575 1379.897 39.4337 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQF cleaved F-I@C-term 0.000285782007267699 1712.80090332031 857.4077 1712.80053710938 857.407592773438 2 18 1.1.1.5213.4 1 47.5475 1148.236 47.6077 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.00268598995171487 1921.91967773438 961.9671 1921.9169921875 961.965759277344 2 19 1.1.1.5339.11 1 50.5378 4114.02 50.5673 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINA cleaved A-A@C-term 0.00591818988323212 2010.97143554688 1006.493 2010.96472167969 1006.48962402344 2 23 1.1.1.5337.4 1 50.4892 2037.456 50.4215 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAA cleaved A-K@C-term 0.000103268997918349 2082.00170898438 695.0079 2082.00170898438 695.007873535156 3 18 1.1.1.5340.8 1 50.5522 1694.187 50.6408 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00677252979949117 2210.08984375 737.7039 2210.0966796875 737.706176757813 3 19 1.1.1.5259.8 1 48.6495 470.8468 48.6172 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Delta:H(4)C(2)(K)@20 cleaved H-P@C-term; missed K-I@20 -0.00321177998557687 2702.39965820313 676.6072 2702.40283203125 676.607971191406 4 19 1.1.1.5497.6 1 54.2859 345.6099 54.3035 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN Delta:H(4)C(2)(K)@20 cleaved N-F@C-term; missed K-I@20 0.00168383005075157 2913.50024414063 729.3823 2913.49853515625 729.381896972656 4 19 1.1.1.5508.4 1 54.5636 9150.529 54.457 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 -0.0251228008419275 3156.59936523438 790.1571 3156.62451171875 790.163391113281 4 18 1.1.1.5650.3 1 58.0908 4330.829 57.9394 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Methyl(N)@17; Deamidated(N)@28 cleaved N-G@C-term; missed K-I@20 0.000340894999681041 3161.57861328125 791.4019 3161.578125 791.401794433594 4 16 1.1.1.5633.3 1 57.6751 248.7858 57.7198 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNG Formyl(K)@20 cleaved G-N@C-term; missed K-I@20 0.0406832993030548 3231.6357421875 808.9162 3231.59497070313 808.906005859375 4 13 1.1.1.5613.3 1 57.1704 403.4386 57.1905 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20 cleaved N-T@C-term; missed K-I@20 0.00696212984621525 3345.68139648438 837.4276 3345.67431640625 837.425842285156 4 14 1.1.1.5593.8 1 56.6825 2213.223 56.5999 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNT hexanoyl addition +98(K)@20; reduced HNE(H)@24 cleaved T-L@C-term; missed K-I@20 -0.0582849010825157 3674.83618164063 919.7163 3674.89453125 919.730895996094 4 12 1.1.1.5658.2 1 58.2887 464.8178 58.3802 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(N)@17 missed K-I@20 0.0127363000065088 4488.28759765625 898.6648 4488.27490234375 898.662231445313 5 34 1.1.1.5811.4 1 61.9119 1211.958 61.8999 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN acrolein addition +56(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0727512016892433 5313.7685546875 1063.761 5313.69775390625 1063.74682617188 5 18 1.1.1.5982.3 1 65.9374 979.4062 65.9759 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 [trypsin fragment, 50 aa] missed K-I@20; missed K-L@40 -0.99345999956131 5499.8115234375 917.6425 5500.8046875 917.80810546875 6 20 1.1.1.5835.5 1 62.4991 498.637 62.4929 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LSSPATLNSR 0.0025269000325352 1044.55883789063 523.2867 1044.55639648438 523.285461425781 2 16 1.1.1.4419.4 1 28.6709 83272.09 28.6859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.0040998300537467 1773.89392089844 887.9542 1773.88977050781 887.9521484375 2 25 1.1.1.5275.7 1 49.0366 1606.56 49.1485 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 NIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@36 cleaved H-N@N-term; missed K-I@16; missed K-L@36 0.059434000402689 5120.68359375 1025.144 5120.6240234375 1025.13208007813 5 16 1.1.1.5963.5 1 65.6136 1733.042 65.702 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.014368699863553 2855.40966796875 952.8105 2855.39526367188 952.8056640625 3 22 1.1.1.6064.2 1 67.4131 545.21 67.2847 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.000708401028532535 5933.05419921875 989.8496 5933.05322265625 989.849487304688 6 16 1.1.1.5836.19 1 62.5353 1259.844 62.5911 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 SGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGN Carbamidomethyl(C)@11; Carbamidomethyl(C)@22; acrolein addition +56(K)@23 cleaved S-S@N-term; cleaved N-M@C-term; missed K-A@13; missed K-S@23 0.0357231982052326 3542.73779296875 886.6917 3542.7021484375 886.682800292969 4 11 1.1.1.5558.5 1 55.819 665.5349 55.7869 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 SSGSSYPSLLQCLK No Carbamidomethyl(C)@12 0.00806630030274391 1468.73132324219 735.3729 1468.72314453125 735.368896484375 2 13 1.1.1.5471.2 1 53.633 167.5471 53.6031 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 TLDNDIMLIKLSSPATLNSR Methyl(K)@10 cleaved N-T@N-term; missed K-L@10 0.00694782985374331 2215.19482421875 739.4056 2215.18823242188 739.4033203125 3 23 1.1.1.5495.8 1 54.2365 1091.39 54.2779 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 VCNYVNWIQQTIAAN Carbamidomethyl(C)@2; Nitro(Y)@4; Dioxidation(W)@7 -0.00302683003246784 1869.82836914063 624.2834 1869.83154296875 624.284484863281 3 14 1.1.1.5945.3 1 65.1681 473.8835 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@6; Ammonia-loss(N)@18; Carbamidomethyl(C)@24; reduced HNE(H)@39; Carbamidomethyl(C)@40; Carbamidomethyl(Y)@41; acrolein addition +56(K)@42 cleaved I-V@N-term 0.0189308002591133 4800.26025390625 961.0593 4800.2412109375 961.055480957031 5 17 1.1.1.5464.6 1 53.474 1737.93 53.4824 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@6; Ammonia-loss(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@40; MDA adduct +62(K)@42; Carbamyl(R)@44 cleaved I-V@N-term; missed K-S@42 0.0173445008695126 4877.23486328125 976.4542 4877.21728515625 976.450744628906 5 17 1.1.1.5550.10 1 55.6236 34281.43 55.3646 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 VLEGNEQFINAAK cleaved D-V@N-term 0.000960853009019047 1431.73681640625 716.8757 1431.73583984375 716.875183105469 2 17 1.1.1.4795.8 0 37.6557 0 -1 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 VNWIQQTIAAN cleaved Y-V@N-term 0.00460053002461791 1256.65612792969 629.3353 1256.6513671875 629.332946777344 2 11 1.1.1.5376.5 1 51.4283 230.0081 51.4924 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 YVNWIQQTIAAN cleaved N-Y@N-term 0.00586100993677974 1419.720703125 710.8676 1419.71472167969 710.864624023438 2 19 1.1.1.5523.5 1 54.9437 2655.052 54.9117 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.74472737312317 99.0000009536743 AAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; acrolein addition +38(K)@23 cleaved N-A@N-term; missed K-I@3; missed K-L@23 0.0286484006792307 3617.91625976563 724.5905 3617.88745117188 724.584777832031 5 10 1.1.1.5511.2 1 54.6368 338.8658 54.6326 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.958607256412506 99.0000009536743 IVGGYTCAANSIPYQVSLNSG Carbamidomethyl(C)@7 cleaved G-S@C-term 0.00385607010684907 2170.03930664063 1086.027 2170.03637695313 1086.02551269531 2 13 1.1.1.5333.13 1 50.3921 177.6886 50.3971 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.754487335681915 99.0000009536743 SQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAK Carbamidomethyl(C)@10; MDA adduct +54(K)@12 cleaved N-S@N-term; missed K-S@12; missed R-I@14; missed R-L@18 -0.0376062989234924 4420.17578125 885.0425 4420.21337890625 885.049987792969 5 17 1.1.1.5198.6 1 47.1854 466.7281 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.60554826259613 99.0000009536743 EGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@31 cleaved L-E@N-term; missed K-I@11; missed K-L@31 0.0414905995130539 4566.359375 914.2791 4566.31787109375 914.270812988281 5 11 1.1.1.5792.5 1 61.435 798.5784 61.4186 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.182434633374214 89.1499996185303 IITHPNFNGN cleaved N-T@C-term -0.00479704979807138 1125.55187988281 563.7832 1125.55676269531 563.78564453125 2 9 1.1.1.4527.7 1 31.2337 492.0785 31.2176 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.115771226584911 95.3199982643127 EQFINAAK cleaved N-E@N-term 0.00631798012182117 919.482666015625 460.7486 919.476318359375 460.745452880859 2 8 1.1.1.4426.3 0 28.833 280.4998 28.8531 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0700704455375671 98.6299991607666 VATVSLPR Dehydrated(T)@3 0.00615550996735692 823.497680664063 412.7561 823.491577148438 412.753082275391 2 11 1.1.1.4588.3 1 32.6781 24461.9 32.435 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0690509676933289 99.0000009536743 IITHPNFNGNTLDNDIMLIKLS hexanoyl addition +98(K)@20 cleaved S-S@C-term; missed K-L@20 -0.0349407009780407 2580.32690429688 861.1163 2580.36206054688 861.127990722656 3 11 1.1.1.5427.11 1 52.6744 336.2382 52.7107 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0496351458132267 75.0199973583221 FNGNTLDNDIMLIK cleaved N-F@N-term 0.0118840001523495 1606.814453125 804.4145 1606.80249023438 804.408508300781 2 7 1.1.1.5426.6 1 52.6465 183.7113 52.7107 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0324520207941532 49.1699993610382 SSPATLNSR cleaved L-S@N-term 0.000406437990022823 931.47265625 466.7436 931.472290039063 466.743438720703 2 8 1.1.1.3973.2 1 22.4433 126.1516 22.4002 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0301183573901653 92.4199998378754 VLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@33 cleaved D-V@N-term; missed K-I@13; missed K-L@33 0.0503121018409729 4778.5205078125 956.7114 4778.47021484375 956.701293945313 5 11 1.1.1.5814.9 1 61.9907 1246.956 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0231916625052691 52.3500025272369 PYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@13; Carbamidomethyl(C)@29; hexanoyl addition +98(K)@31 cleaved I-P@N-term; missed K-S@31 0.0157719999551773 3793.82543945313 949.4636 3793.80932617188 949.459594726563 4 9 1.1.1.5351.6 0 50.8298 3895.177 50.7396 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0209070984274149 75.4400014877319 EGNEQFINAAK cleaved L-E@N-term 0.00246222992427647 1219.58581542969 610.8002 1219.58337402344 610.798950195313 2 6 1.1.1.4473.10 0 29.9719 98.3806 29.9543 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0204516258090734 33.1800013780594 TLDNDIMLIK cleaved N-T@N-term 0.00500681018456817 1174.6318359375 588.3232 1174.62670898438 588.320678710938 2 12 1.1.1.5224.5 0 47.8142 474.4458 47.8268 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0127807697281241 64.9600028991699 IQVRLGEHNID cleaved D-V@C-term; missed R-L@4 0.0029647599440068 1292.68664550781 647.3506 1292.68371582031 647.34912109375 2 7 1.1.1.4689.17 1 35.1107 93.5042 35.1174 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00788851175457239 61.1800014972687 SPATLNSR cleaved S-S@N-term -0.00158887996803969 844.438659667969 423.2266 844.440307617188 423.227416992188 2 6 1.1.1.4419.3 1 28.6684 139.5691 28.662 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00524305552244186 44.6599990129471 LGEHNIDVLEGNEQFINAAKIITHP acrolein addition +112(K)@20 cleaved P-N@C-term; missed K-I@20 0.01680569909513 2883.49365234375 962.1718 2883.4765625 962.166137695313 3 9 1.1.1.5836.15 1 62.5319 199.2684 62.5665 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00524305552244186 86.8399977684021 LSSPATLNSRVATVSLPR missed R-V@10 -11.006799697876 1857.04138183594 465.2676 1868.04797363281 468.019256591797 4 11 1.1.1.4622.11 1 33.5029 606.6854 33.5096 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00436480529606342 36.4399999380112 LGEHNIDVLEG cleaved G-N@C-term 0.00252079009078443 1194.59069824219 598.3026 1194.58801269531 598.301330566406 2 9 1.1.1.4911.6 1 40.3529 751.1099 40.3579 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00305075151845813 66.8099999427795 IQQTIAAN cleaved W-I@N-term 0.00544656999409199 857.466064453125 429.7403 857.460693359375 429.737609863281 2 9 1.1.1.4355.2 1 27.1166 276.4252 27.0309 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00305075151845813 58.1099987030029 SSYPSLLQCLKAPVLSNSSCKSSYPGQITGN Carbamidomethyl(C)@9; Carbamidomethyl(C)@20; HPNE addition +172(K)@21 cleaved G-S@N-term; cleaved N-M@C-term; missed K-A@11; missed K-S@21 -0.0333517007529736 3514.69897460938 879.682 3514.732421875 879.690368652344 4 8 1.1.1.5554.5 1 55.7186 232.8105 55.7121 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00261361571028829 90.2100026607513 DIMLIKLSSPATLNSR Oxidation(M)@3; acrolein addition +112(K)@6 cleaved N-D@N-term; missed K-L@6 0.017213499173522 1886.03552246094 629.6858 1886.01831054688 629.680053710938 3 10 1.1.1.5326.4 1 50.2083 337.4307 50.2276 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00261361571028829 99.0000009536743 SRIQVRLGEHNIDVLEGNEQFINAAK Formyl@N-term; Delta:H(2)C(2)(H)@10; Deamidated(N)@11 missed R-I@2; missed R-L@6 0.0100750001147389 3004.546875 752.144 3004.53662109375 752.141418457031 4 17 1.1.1.5329.5 1 50.2851 380.6262 50.3002 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00217691925354302 72.1099972724915 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLI reduced acrolein addition +58(K)@20; Oxidation(M)@37 cleaved I-K@C-term; missed K-I@20 -0.0250355005264282 4420.17578125 885.0425 4420.20068359375 885.047485351563 5 16 1.1.1.5198.6 1 47.1854 466.7281 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00130484171677381 71.7299997806549 EQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@22; acrolein addition +56(K)@28 cleaved N-E@N-term; missed K-I@8; missed K-L@28 0.0398001000285149 4267.23486328125 854.4542 4267.19482421875 854.446228027344 5 11 1.1.1.5779.3 1 61.1125 1348.805 61.1501 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000869458774104714 63.0900025367737 IVGGY cleaved Y-T@C-term 0.00266880006529391 507.271942138672 508.2792 507.269287109375 508.276580810547 1 5 1.1.1.4433.9 0 29.0121 120.7614 29.0222 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000434511806815863 96.5399980545044 IKLSSPATLNSR Delta:H(4)C(2)@N-term cleaved L-I@N-term; missed K-L@2 0.0037742299027741 1313.7705078125 438.9308 1313.76672363281 438.929504394531 3 14 1.1.1.4551.5 1 31.7952 1145.355 31.8119 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000434511806815863 65.8999979496002 INAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; acrolein addition +38(K)@5; Deamidated(N)@19 cleaved F-I@N-term; missed K-I@5; missed K-L@25 0.0576793998479843 3846.05615234375 770.2185 3845.99853515625 770.206970214844 5 11 1.1.1.5541.3 1 55.3945 698.9929 55.4397 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000434511806815863 41.159999370575 NAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@4; reduced HNE(H)@8; Deamidated(N)@18; MDA adduct +62(K)@24 cleaved I-N@N-term; missed K-I@4; missed K-L@24 0.0044183200225234 4010.12329101563 803.0319 4010.11865234375 803.031005859375 5 10 1.1.1.5717.3 1 59.7405 484.8906 59.758 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.620001077652 AAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; acrolein addition +56(K)@23 cleaved N-A@N-term; missed K-I@3; missed K-L@23 0.0240141004323959 3635.92211914063 728.1917 3635.89819335938 728.186889648438 5 10 1.1.1.5539.3 1 55.3445 6042.818 55.4397 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Methyl(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0184135995805264 3620.94213867188 906.2428 3620.92358398438 906.238159179688 4 16 1.1.1.5494.13 1 54.2152 439.0326 54.2269 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0118247997015715 3634.94775390625 727.9968 3634.93579101563 727.994445800781 5 22 1.1.1.5495.7 1 54.2356 19605.45 54.3551 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0242168009281158 3634.96020507813 909.7473 3634.93579101563 909.741271972656 4 22 1.1.1.5496.10 1 54.2637 15750.38 54.3551 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0242168009281158 3634.96020507813 909.7473 3634.93579101563 909.741271972656 4 26 1.1.1.5497.14 1 54.2926 15750.38 54.3551 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 -0.0057291598059237 3634.93017578125 606.829 3634.93579101563 606.829956054688 6 18 1.1.1.5498.4 1 54.3102 1940.085 54.3551 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0242168009281158 3634.96020507813 909.7473 3634.93579101563 909.741271972656 4 26 1.1.1.5498.12 1 54.3169 15750.38 54.3551 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@10; Deamidated(N)@16; reduced acrolein addition +58(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 -0.00537538016214967 3665.92846679688 734.193 3665.93383789063 734.194030761719 5 14 1.1.1.5499.7 1 54.3384 210.9171 54.3294 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0242168009281158 3634.96020507813 909.7473 3634.93579101563 909.741271972656 4 26 1.1.1.5499.16 1 54.3459 15750.38 54.3551 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0242168009281158 3634.96020507813 909.7473 3634.93579101563 909.741271972656 4 27 1.1.1.5500.12 1 54.3681 15750.38 54.3551 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0242168009281158 3634.96020507813 909.7473 3634.93579101563 909.741271972656 4 28 1.1.1.5501.9 1 54.391 15750.38 54.3551 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0118247997015715 3634.94775390625 727.9968 3634.93579101563 727.994445800781 5 30 1.1.1.5502.6 1 54.414 19605.45 54.3551 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@2; Oxidation(M)@19; acrolein addition +56(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.023708900436759 3635.92211914063 728.1917 3635.89819335938 728.186889648438 5 12 1.1.1.5527.4 1 55.0423 1537.253 55.0368 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@2; Oxidation(M)@19; acrolein addition +56(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0240141004323959 3635.92211914063 728.1917 3635.89819335938 728.186889648438 5 11 1.1.1.5546.3 1 55.5192 6042.818 55.4397 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 74.0400016307831 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@2; Deamidated(N)@12; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 -0.00767379021272063 3612.88647460938 904.2289 3612.89404296875 904.230773925781 4 12 1.1.1.5576.8 1 56.2724 164.565 56.2335 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 69.5800006389618 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@12; Dethiomethyl(M)@19; MDA adduct +62(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 -0.030705900862813 3620.8896484375 906.2297 3620.92016601563 906.237365722656 4 12 1.1.1.5566.9 1 56.0242 546.2953 56.0643 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 38.4999990463257 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0269252005964518 3563.90405273438 713.7881 3563.876953125 713.782653808594 5 9 1.1.1.5492.4 1 54.1587 944.7371 54.2523 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.620001077652 EQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@28 cleaved N-E@N-term; missed K-I@8; missed K-L@28 0.0356564000248909 4266.24609375 854.2565 4266.21044921875 854.249389648438 5 10 1.1.1.5712.4 1 59.6145 2966.064 59.6566 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 52.3500025272369 EQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@8 cleaved N-E@N-term; missed K-I@8; missed K-L@28 0.0569282993674278 4266.2666015625 1067.574 4266.21044921875 1067.55993652344 4 10 1.1.1.5713.8 1 59.649 1707.285 59.6566 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.0130284000188112 2661.392578125 888.1381 2661.37963867188 888.1337890625 3 23 1.1.1.5613.4 1 57.1721 6667.859 57.2647 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Met->Hcy(M)@11; reduced acrolein addition +58(K)@14 cleaved N-F@N-term; missed K-L@14 0.0133052002638578 2677.38793945313 893.4699 2677.37451171875 893.465454101563 3 16 1.1.1.5616.5 1 57.248 286.3892 57.2647 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.00134604005143046 2661.380859375 666.3525 2661.37963867188 666.352172851563 4 18 1.1.1.5618.4 1 57.2949 830.5391 57.2893 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.0130284000188112 2661.392578125 888.1381 2661.37963867188 888.1337890625 3 22 1.1.1.5620.12 1 57.3519 6667.859 57.2647 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.00134604005143046 2661.380859375 666.3525 2661.37963867188 666.352172851563 4 12 1.1.1.5626.3 1 57.4977 830.5391 57.2893 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Dethiomethyl(M)@11; acrolein addition +76(K)@14 cleaved N-F@N-term; missed K-L@14 0.00705484999343753 2662.36743164063 888.4631 2662.3603515625 888.460693359375 3 16 1.1.1.5665.3 1 58.4641 346.9196 58.527 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Dethiomethyl(M)@11; acrolein addition +76(K)@14 cleaved N-F@N-term; missed K-L@14 0.0121817998588085 2662.37255859375 888.4648 2662.3603515625 888.460693359375 3 23 1.1.1.5688.6 1 59.0325 1299.027 58.9983 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 78.14000248909 GGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@5; Glucuronyl(S)@20; Carbamidomethyl(C)@23; reduced HNE(H)@38; Carbamidomethyl(C)@39; acrolein addition +56(K)@41 cleaved V-G@N-term 0.0341248996555805 4837.24267578125 1210.318 4837.2099609375 1210.30969238281 4 13 1.1.1.5537.14 1 55.3035 31733.18 55.2391 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.620001077652 GGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@5; Hex(N)@17; Carbamidomethyl(C)@23; reduced HNE(H)@38; Carbamidomethyl(C)@39; acrolein addition +56(K)@41 cleaved V-G@N-term -0.0264844000339508 4823.2041015625 965.6481 4823.23046875 965.653381347656 5 11 1.1.1.5506.9 1 54.5176 5705.645 54.3807 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIK cleaved N-G@N-term 0.00295078009366989 1345.69409179688 673.8543 1345.69116210938 673.852844238281 2 16 1.1.1.5280.5 1 49.1602 346.759 49.1728 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Met->Hcy(M)@9; reduced acrolein addition +58(K)@12 cleaved N-G@N-term; missed K-L@12 0.00617608986794949 2416.26953125 806.4304 2416.26318359375 806.428344726563 3 19 1.1.1.5458.5 1 53.3297 957.4002 53.4101 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Met->Hcy(M)@9; reduced acrolein addition +58(K)@12 cleaved N-G@N-term; missed K-L@12 0.00965509004890919 2416.27294921875 806.4316 2416.26318359375 806.428344726563 3 21 1.1.1.5465.3 1 53.493 957.4002 53.4101 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Oxidation(M)@9; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.0100213000550866 2416.27319335938 806.4317 2416.26318359375 806.428344726563 3 25 1.1.1.5472.4 1 53.6613 1119.445 53.5789 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00884991977363825 2401.26123046875 801.4277 2401.25219726563 801.424682617188 3 19 1.1.1.5492.5 1 54.1604 1789.741 54.2523 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.0092239398509264 2400.27758789063 801.0998 2400.26831054688 801.0966796875 3 16 1.1.1.5529.8 1 55.0961 22013.32 55.2391 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00452494993805885 2400.263671875 601.0732 2400.26831054688 601.074340820313 4 18 1.1.1.5533.4 1 55.1945 1292.524 55.2391 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Methyl(K)@12 cleaved N-G@N-term; missed K-L@12 0.00688382983207703 2386.25952148438 796.4271 2386.25268554688 796.4248046875 3 16 1.1.1.5533.8 1 55.1978 1741.765 55.1374 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00452494993805885 2400.263671875 601.0732 2400.26831054688 601.074340820313 4 18 1.1.1.5536.3 1 55.2691 1292.524 55.2391 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.0092239398509264 2400.27758789063 801.0998 2400.26831054688 801.0966796875 3 27 1.1.1.5536.4 1 55.2699 22013.32 55.2391 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.0092239398509264 2400.27758789063 801.0998 2400.26831054688 801.0966796875 3 15 1.1.1.5543.4 1 55.4454 22013.32 55.2391 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00720197986811399 2401.25952148438 801.4271 2401.25219726563 801.424682617188 3 19 1.1.1.5552.3 1 55.6674 2713.846 55.564 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12; Deamidated(N)@20 cleaved N-G@N-term; missed K-L@12 0.00738508021458983 2401.259765625 801.4272 2401.25219726563 801.424682617188 3 21 1.1.1.5559.4 1 55.8435 2475.944 55.5888 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Dethiomethyl(M)@9; acrolein addition +76(K)@12 cleaved N-G@N-term; missed K-L@12 0.0188124999403954 2401.26782226563 801.4299 2401.2490234375 801.423583984375 3 19 1.1.1.5571.3 1 56.1424 604.8574 56.2092 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IDVLEGNEQFINAAK cleaved N-I@N-term -0.00247347005642951 1659.84423828125 830.9294 1659.84680175781 830.9306640625 2 11 1.1.1.5221.9 1 47.7385 762.2599 47.6077 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@35 cleaved N-I@N-term; missed K-I@15; missed K-L@35 0.056308601051569 5006.638671875 1002.335 5006.5810546875 1002.32348632813 5 13 1.1.1.5956.6 1 65.435 869.5435 65.4451 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@35 cleaved N-I@N-term; missed K-I@15; missed K-L@35 0.056308601051569 5006.638671875 1002.335 5006.5810546875 1002.32348632813 5 11 1.1.1.5949.5 1 65.2672 865.7287 65.4451 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.0100189000368118 2298.177734375 767.0665 2298.16772460938 767.063232421875 3 23 1.1.1.5348.10 1 50.7502 2844.441 50.6901 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17; Methyl(K)@20 0.00612396001815796 2312.189453125 771.7371 2312.18334960938 771.735107421875 3 19 1.1.1.5352.11 1 50.8575 470.9536 50.8869 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.0204473994672298 2299.17211914063 767.398 2299.15185546875 767.391235351563 3 17 1.1.1.5380.8 1 51.5279 229.8867 51.5903 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.0074469200335443 2299.1591796875 767.3937 2299.15185546875 767.391235351563 3 29 1.1.1.5398.4 1 51.9745 686.5164 52.004 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK -0.00647330982610583 2282.16650390625 571.5489 2282.1728515625 571.550476074219 4 20 1.1.1.5428.3 1 52.6923 1552.303 52.7107 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK -0.00647330982610583 2282.16650390625 571.5489 2282.1728515625 571.550476074219 4 21 1.1.1.5429.8 1 52.7252 1552.303 52.7107 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.00740509992465377 2282.18041992188 761.7341 2282.1728515625 761.731567382813 3 27 1.1.1.5431.2 1 52.7668 18935.56 52.6861 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.0012298800284043 2298.1689453125 767.0636 2298.16772460938 767.063232421875 3 25 1.1.1.5433.3 1 52.8196 1620.062 52.6861 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Methyl(K)@20 0.00717044994235039 2296.19555664063 766.4058 2296.1884765625 766.403442382813 3 28 1.1.1.5439.5 1 52.9678 6644.199 53.0992 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Methyl(K)@20 0.00735354982316494 2296.19580078125 766.4059 2296.1884765625 766.403442382813 3 28 1.1.1.5450.3 1 53.1317 6235.609 53.0754 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17; Methyl(K)@20 0.00703947991132736 2312.1904296875 771.7374 2312.18334960938 771.735107421875 3 16 1.1.1.5450.4 1 53.1351 353.1899 53.022 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10 0.0117908995598555 2283.16870117188 762.0635 2283.15698242188 762.0595703125 3 28 1.1.1.5455.3 1 53.2553 348.3798 53.2185 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.00648086983710527 2283.16357421875 762.0618 2283.15698242188 762.0595703125 3 24 1.1.1.5462.6 1 53.419 1908.22 53.4824 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Dethiomethyl(M)@17; MDA adduct +62(K)@20 0.0112650999799371 2297.18041992188 766.7341 2297.16918945313 766.730346679688 3 13 1.1.1.5474.4 1 53.7072 583.9125 53.7486 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.00611465983092785 2283.16284179688 762.0616 2283.15698242188 762.0595703125 3 26 1.1.1.5476.4 1 53.754 8161.803 53.7978 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Dethiomethyl(M)@17; MDA adduct +62(K)@20 0.0110820000991225 2297.18017578125 766.734 2297.16918945313 766.730346679688 3 10 1.1.1.5482.10 1 53.9085 1576.839 54.0232 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Methyl(K)@20 0.0077111697755754 2297.18017578125 766.734 2297.17260742188 766.7314453125 3 21 1.1.1.5489.6 1 54.0815 1576.839 54.0232 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.00740509992465377 2282.18041992188 761.7341 2282.1728515625 761.731567382813 3 19 1.1.1.5439.4 1 52.9645 18606.52 52.7107 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.0100189000368118 2298.177734375 767.0665 2298.16772460938 767.063232421875 3 19 1.1.1.5341.8 1 50.5768 2844.441 50.6901 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@6 0.00648086983710527 2283.16357421875 762.0618 2283.15698242188 762.0595703125 3 23 1.1.1.5469.4 1 53.5881 1908.22 53.4824 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK -0.00647330982610583 2282.16650390625 571.5489 2282.1728515625 571.550476074219 4 18 1.1.1.5426.2 1 52.6407 1552.303 52.7107 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10 0.0192981995642185 2283.17602539063 762.066 2283.15698242188 762.0595703125 3 20 1.1.1.5428.6 1 52.6982 10932.07 52.6861 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK -0.00647330982610583 2282.16650390625 571.5489 2282.1728515625 571.550476074219 4 18 1.1.1.5430.2 1 52.7406 1552.303 52.7107 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.00740509992465377 2282.18041992188 761.7341 2282.1728515625 761.731567382813 3 17 1.1.1.5423.2 1 52.5695 18935.56 52.6861 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.00120276003144681 2283.158203125 571.7968 2283.15698242188 571.796508789063 4 15 1.1.1.5479.3 1 53.8275 498.5537 53.7978 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5300004482269 IITHPNFNGNTLDNDIMLIK -0.00647330982610583 2282.16650390625 571.5489 2282.1728515625 571.550476074219 4 16 1.1.1.5427.5 1 52.6677 1552.303 52.7107 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.9499995708466 IITHPNFNGNTLDNDIMLIK 0.0262458994984627 2282.19946289063 1142.107 2282.1728515625 1142.09375 2 14 1.1.1.5424.11 1 52.6073 3456.12 52.6861 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.9499995708466 IITHPNFNGNTLDNDIMLIK -0.00647330982610583 2282.16650390625 571.5489 2282.1728515625 571.550476074219 4 14 1.1.1.5425.4 1 52.6178 1552.303 52.7107 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.9499995708466 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.00611465983092785 2283.16284179688 762.0616 2283.15698242188 762.0595703125 3 14 1.1.1.5483.4 1 53.9311 8161.803 53.7978 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Arg-add@N-term; Dethiomethyl(M)@17; acrolein addition +76(K)@20 missed K-L@20 0.0326530002057552 3492.88061523438 874.2274 3492.84765625 874.21923828125 4 14 1.1.1.5488.11 1 54.0604 2729.69 54.1246 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.0131882997229695 3336.76342773438 835.1981 3336.75 835.194763183594 4 15 1.1.1.5501.7 1 54.3893 278.8044 54.3551 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.00902081001549959 3338.73803710938 835.6918 3338.72924804688 835.689575195313 4 28 1.1.1.5508.6 1 54.5653 2276.561 54.6577 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.000637542980257422 3323.71899414063 831.937 3323.71826171875 831.936889648438 4 25 1.1.1.5511.7 1 54.641 1167.706 54.6827 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00264467997476459 3352.74780273438 839.1942 3352.74487304688 839.193481445313 4 27 1.1.1.5516.8 1 54.7675 2384.987 54.7076 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.00755596999078989 3338.73706054688 835.6915 3338.72924804688 835.689575195313 4 24 1.1.1.5518.12 1 54.822 2671.464 54.8859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.00755596999078989 3338.73706054688 835.6915 3338.72924804688 835.689575195313 4 24 1.1.1.5519.8 1 54.8441 2671.464 54.8859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.00755596999078989 3338.73706054688 835.6915 3338.72924804688 835.689575195313 4 31 1.1.1.5520.12 1 54.8733 2671.464 54.8859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Dioxidation(M)@17 missed K-L@20 0.0370799005031586 3340.74584960938 836.1937 3340.70849609375 836.184387207031 4 13 1.1.1.5521.11 1 54.8982 801.6724 54.8859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0021563998889178 3352.74682617188 839.194 3352.74487304688 839.193481445313 4 35 1.1.1.5523.8 1 54.9462 3778.82 54.9622 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0108609003946185 3352.73388671875 671.5541 3352.74487304688 671.556274414063 5 18 1.1.1.5524.2 1 54.9663 479.7655 54.9622 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0021563998889178 3352.74682617188 839.194 3352.74487304688 839.193481445313 4 17 1.1.1.5530.6 1 55.1198 3778.82 54.9622 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00691014993935823 3353.73583984375 839.4412 3353.72900390625 839.439514160156 4 16 1.1.1.5537.9 1 55.2993 432.7693 55.3646 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Deamidated(N)@14; Dethiomethyl(M)@17; acrolein addition +76(K)@20 missed K-L@20 0.0155683998018503 3338.73022460938 835.6898 3338.71459960938 835.685974121094 4 16 1.1.1.5538.5 1 55.3211 509.5576 55.3897 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0121975997462869 3338.73022460938 835.6898 3338.71801757813 835.686767578125 4 17 1.1.1.5541.9 1 55.3995 509.5576 55.3897 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Met->Hcy(M)@17; reduced acrolein addition +58(K)@20 missed K-L@20 0.0130137000232935 3353.74169921875 839.4427 3353.72900390625 839.439514160156 4 15 1.1.1.5544.5 1 55.4713 334.1156 55.4897 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00854024011641741 3336.74145507813 835.1926 3336.75 835.194763183594 4 13 1.1.1.5557.7 1 55.7954 172.2675 55.8121 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 0.00909817032516003 3308.72778320313 828.1892 3308.71875 828.186950683594 4 34 1.1.1.5560.6 1 55.8704 8997.539 55.8879 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 -0.0109384004026651 3308.70751953125 662.7488 3308.71875 662.751037597656 5 22 1.1.1.5561.3 1 55.8932 859.6731 55.8879 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00446875020861626 3353.7333984375 839.4406 3353.72900390625 839.439514160156 4 26 1.1.1.5562.8 1 55.9227 998.637 56.0141 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 -0.0109384004026651 3308.70751953125 662.7488 3308.71875 662.751037597656 5 20 1.1.1.5563.4 1 55.9444 859.6731 55.8879 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 0.00638198992237449 3322.74047851563 831.6924 3322.734375 831.690856933594 4 25 1.1.1.5563.9 1 55.9486 71699.59 56.0643 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 -0.0126753998920321 3322.72143554688 665.5516 3322.734375 665.554138183594 5 28 1.1.1.5565.3 1 55.9941 8079.302 56.0885 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 -0.0126753998920321 3322.72143554688 665.5516 3322.734375 665.554138183594 5 27 1.1.1.5566.3 1 56.0192 8079.302 56.0885 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.0253781992942095 3338.75463867188 835.6959 3338.72924804688 835.689575195313 4 17 1.1.1.5566.7 1 56.0226 11137.92 56.2581 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Dioxidation(M)@17 missed K-L@20 0.0226755999028683 3340.7314453125 836.1901 3340.70849609375 836.184387207031 4 14 1.1.1.5567.5 1 56.0459 1018.045 56.0393 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10; Deamidated(N)@14; Met->Hcy(M)@17; reduced acrolein addition +58(K)@20 missed K-L@20 0.0204530004411936 3354.7333984375 839.6906 3354.712890625 839.685485839844 4 18 1.1.1.5567.7 1 56.0476 930.5881 56.0393 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] CHDH(D)@15 missed K-L@20 -0.0205988008528948 3602.88134765625 901.7276 3602.90185546875 901.732727050781 4 17 1.1.1.5567.12 1 56.0517 587.295 56.0643 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Hex(N)@14; MDA adduct +62(K)@20 missed K-L@20 0.069175697863102 3532.85668945313 707.5786 3532.787109375 707.564697265625 5 17 1.1.1.5568.2 1 56.0692 293.894 56.0643 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 -0.988460004329681 3307.73022460938 827.9398 3308.71875 828.186950683594 4 20 1.1.1.5569.3 1 56.095 896.3228 56.0141 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00773828011006117 3353.72143554688 839.4376 3353.72900390625 839.439514160156 4 19 1.1.1.5569.4 1 56.0975 1016.036 56.0885 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0390329994261265 3337.77221679688 1113.598 3337.73413085938 1113.58532714844 3 17 1.1.1.5569.8 1 56.1075 7578.781 56.2825 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 0.00638198992237449 3322.74047851563 831.6924 3322.734375 831.690856933594 4 36 1.1.1.5570.2 1 56.1191 71699.59 56.0643 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0101386997848749 3336.73974609375 668.3552 3336.75 668.357299804688 5 28 1.1.1.5571.2 1 56.1408 8253.176 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0101386997848749 3336.73974609375 668.3552 3336.75 668.357299804688 5 28 1.1.1.5572.2 1 56.165 8253.176 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.00439921021461487 3336.75463867188 835.1959 3336.75 835.194763183594 4 34 1.1.1.5573.2 1 56.1891 65918.92 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0101386997848749 3336.73974609375 668.3552 3336.75 668.357299804688 5 30 1.1.1.5574.3 1 56.2134 8253.176 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 0.00638198992237449 3322.74047851563 831.6924 3322.734375 831.690856933594 4 19 1.1.1.5574.5 1 56.2151 71699.59 56.0643 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Carbamyl(K)@20 missed K-L@20 0.0164099000394344 3367.73583984375 842.9412 3367.71948242188 842.937133789063 4 16 1.1.1.5574.7 1 56.2168 474.6415 56.2581 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] ONE addition +154(K)@20; Glycerophospho(S)@22 missed K-L@20 0.0595475994050503 3616.880859375 905.2275 3616.8212890625 905.212585449219 4 14 1.1.1.5574.8 1 56.2176 420.6634 56.3311 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] CHDH(D)@15; Oxidation(M)@17 missed K-L@20 -0.00499822990968823 3618.89184570313 905.7302 3618.89672851563 905.7314453125 4 15 1.1.1.5574.9 1 56.2184 324.6537 56.2335 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0101386997848749 3336.73974609375 668.3552 3336.75 668.357299804688 5 28 1.1.1.5575.2 1 56.2372 8253.176 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.00439921021461487 3336.75463867188 835.1959 3336.75 835.194763183594 4 16 1.1.1.5575.7 1 56.2413 65918.92 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Dioxidation(K)@20 missed K-L@20 0.054169800132513 3340.76245117188 836.1979 3340.70849609375 836.184387207031 4 14 1.1.1.5575.8 1 56.2422 2422.906 56.2581 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0101386997848749 3336.73974609375 668.3552 3336.75 668.357299804688 5 32 1.1.1.5576.2 1 56.2624 8253.176 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Cation:Na(D)@15; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00670595979318023 3358.72509765625 672.7523 3358.73193359375 672.753662109375 5 26 1.1.1.5576.4 1 56.2657 487.8783 56.2825 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] HPNE addition +172(K)@20; Glycerophospho(S)@22 missed K-L@20 0.0731733962893486 3634.90502929688 909.7335 3634.83178710938 909.715209960938 4 17 1.1.1.5576.9 1 56.2741 465.942 56.2581 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0101386997848749 3336.73974609375 668.3552 3336.75 668.357299804688 5 29 1.1.1.5577.2 1 56.286 8253.176 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 0.00638198992237449 3322.74047851563 831.6924 3322.734375 831.690856933594 4 32 1.1.1.5577.4 1 56.2885 75049.71 56.0393 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0101386997848749 3336.73974609375 668.3552 3336.75 668.357299804688 5 30 1.1.1.5578.2 1 56.3102 8253.176 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Ammonia-loss(N)@14; Methyl(D)@15 missed K-L@20 0.0468541011214256 3305.75463867188 827.4459 3305.70776367188 827.434204101563 4 14 1.1.1.5578.5 1 56.3144 340.3557 56.2581 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0101386997848749 3336.73974609375 668.3552 3336.75 668.357299804688 5 31 1.1.1.5579.2 1 56.3345 8253.176 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00101742998231202 3352.74365234375 839.1932 3352.74487304688 839.193481445313 4 31 1.1.1.5579.4 1 56.337 2524.898 56.3311 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.00439921021461487 3336.75463867188 835.1959 3336.75 835.194763183594 4 34 1.1.1.5580.4 1 56.3647 65918.92 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Hex(1)HexNAc(1)(N)@14; acrolein addition +112(K)@20 missed K-L@20 0.00964502990245819 3785.91284179688 947.4855 3785.9033203125 947.483093261719 4 17 1.1.1.5580.5 1 56.3672 327.6989 56.3311 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0427445992827415 3324.74487304688 832.1935 3324.70239257813 832.182861328125 4 21 1.1.1.5581.2 1 56.384 10293.11 56.1366 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Dioxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.000403206009650603 3368.740234375 843.1923 3368.73974609375 843.192260742188 4 16 1.1.1.5581.3 1 56.3856 679.1039 56.3554 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0101386997848749 3336.73974609375 668.3552 3336.75 668.357299804688 5 27 1.1.1.5584.2 1 56.456 8253.176 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 0.00467301020398736 3322.73901367188 831.692 3322.734375 831.690856933594 4 29 1.1.1.5584.6 1 56.4594 13636.01 56.2092 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0101386997848749 3336.73974609375 668.3552 3336.75 668.357299804688 5 29 1.1.1.5585.3 1 56.4829 8253.176 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.00439921021461487 3336.75463867188 835.1959 3336.75 835.194763183594 4 21 1.1.1.5585.5 1 56.4862 65918.92 56.3069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@28 missed K-L@20 0.0174537003040314 3337.75146484375 835.4451 3337.73413085938 835.440795898438 4 22 1.1.1.5585.6 1 56.4879 35165.64 56.2825 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00712093990296125 3352.73779296875 839.1917 3352.74487304688 839.193481445313 4 13 1.1.1.5586.7 1 56.5091 2505.223 56.2581 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 0.00439921021461487 3336.75463867188 835.1959 3336.75 835.194763183594 4 35 1.1.1.5587.5 1 56.5339 67578.72 56.2825 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.000529146986082196 3352.74462890625 839.1934 3352.74487304688 839.193481445313 4 17 1.1.1.5589.2 1 56.5798 2530.561 56.3311 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Dethiomethyl(M)@17; MDA adduct +62(K)@20; Deamidated(N)@28 missed K-L@20 -0.00821714010089636 3323.70727539063 665.7487 3323.71508789063 665.750305175781 5 17 1.1.1.5590.4 1 56.6055 547.8327 56.5754 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0162422005087137 3336.73364257813 668.354 3336.75 668.357299804688 5 16 1.1.1.5590.5 1 56.6063 6982.737 56.3554 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.00674105994403362 3323.72485351563 831.9385 3323.71826171875 831.936889648438 4 28 1.1.1.5591.5 1 56.6309 4430.188 56.5506 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10; Methyl(K)@20 missed K-L@20 0.00674105994403362 3323.72485351563 831.9385 3323.71826171875 831.936889648438 4 24 1.1.1.5594.4 1 56.706 4430.188 56.5506 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@28 missed K-L@20 0.0071997600607574 3337.74145507813 835.4426 3337.73413085938 835.440795898438 4 30 1.1.1.5594.5 1 56.7077 4651.086 56.7228 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Met->Hcy(M)@17; reduced acrolein addition +58(K)@20; Deamidated(N)@28 missed K-L@20 0.00739842979237437 3353.73608398438 839.4413 3353.72900390625 839.439514160156 4 17 1.1.1.5596.2 1 56.7517 265.8079 56.7473 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Ammonia-loss(N)@10; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00409856019541621 3319.72729492188 830.9391 3319.72338867188 830.938171386719 4 20 1.1.1.5599.7 1 56.8284 1785.806 56.968 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Methyl(K)@20 missed K-L@20 -0.00216293008998036 3322.73217773438 831.6903 3322.734375 831.690856933594 4 17 1.1.1.5601.5 1 56.8757 2098.042 57.0668 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0071997600607574 3337.74145507813 835.4426 3337.73413085938 835.440795898438 4 30 1.1.1.5601.6 1 56.8774 4651.086 56.7228 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Ammonia-loss(N)@10; Formyl(K)@20 missed K-L@20 0.0316931009292603 3319.71850585938 664.951 3319.68701171875 664.944702148438 5 11 1.1.1.5604.3 1 56.9479 212.6455 56.9431 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00817632023245096 3337.7421875 835.4428 3337.73413085938 835.440795898438 4 22 1.1.1.5608.5 1 57.0484 1835.569 57.0915 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0125035000964999 3323.7060546875 665.7485 3323.71826171875 665.7509765625 5 19 1.1.1.5611.2 1 57.1203 673.3697 57.1412 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Dehydrated(T)@11; Dethiomethyl(M)@17; acrolein addition +76(K)@20 missed K-L@20 0.00746939005330205 3319.72729492188 830.9391 3319.71997070313 830.937316894531 4 21 1.1.1.5611.3 1 57.1211 1785.806 56.968 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00915287993848324 3337.74340820313 835.4431 3337.73413085938 835.440795898438 4 25 1.1.1.5615.3 1 57.2223 7175.824 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00915287993848324 3337.74340820313 835.4431 3337.73413085938 835.440795898438 4 27 1.1.1.5616.4 1 57.2463 7175.824 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0114946998655796 3324.7138671875 832.1857 3324.70239257813 832.182861328125 4 20 1.1.1.5617.4 1 57.2726 3121.507 57.1164 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0222072992473841 3338.740234375 835.6923 3338.71801757813 835.686767578125 4 13 1.1.1.5617.5 1 57.2743 4000.171 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@6; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00722021004185081 3337.7265625 668.5526 3337.73413085938 668.554077148438 5 27 1.1.1.5620.3 1 57.3443 916.2297 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@6; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 7.42150004953146E-05 3353.72900390625 839.4395 3353.72900390625 839.439514160156 4 18 1.1.1.5621.7 1 57.3732 276.0864 57.3644 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0295113995671272 3337.76318359375 1113.595 3337.73413085938 1113.58532714844 3 17 1.1.1.5621.12 1 57.3816 1655.984 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00722021004185081 3337.7265625 668.5526 3337.73413085938 668.554077148438 5 26 1.1.1.5622.2 1 57.3956 916.2297 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00722021004185081 3337.7265625 668.5526 3337.73413085938 668.554077148438 5 25 1.1.1.5623.3 1 57.421 916.2297 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00722021004185081 3337.7265625 668.5526 3337.73413085938 668.554077148438 5 24 1.1.1.5625.2 1 57.4721 916.2297 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@6; Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0112621998414397 3338.72924804688 668.7531 3338.71801757813 668.750854492188 5 15 1.1.1.5625.3 1 57.4737 571.5941 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8 missed K-L@20 0.00359778990969062 3309.7060546875 828.4338 3309.70263671875 828.432983398438 4 29 1.1.1.5625.4 1 57.4754 3740.617 57.5433 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00722021004185081 3337.7265625 668.5526 3337.73413085938 668.554077148438 5 23 1.1.1.5626.4 1 57.4986 916.2297 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0175982005894184 3324.72021484375 832.1873 3324.70239257813 832.182861328125 4 24 1.1.1.5627.5 1 57.5283 10272.89 57.6952 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@6; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00915287993848324 3337.74340820313 835.4431 3337.73413085938 835.440795898438 4 31 1.1.1.5628.4 1 57.5499 7175.824 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.0126291001215577 3323.73217773438 1108.918 3323.71826171875 1108.91345214844 3 21 1.1.1.5629.15 1 57.585 4603.393 57.6952 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0134190004318953 3323.705078125 665.7483 3323.71826171875 665.7509765625 5 28 1.1.1.5631.2 1 57.6247 2219.557 57.6952 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0134190004318953 3323.705078125 665.7483 3323.71826171875 665.7509765625 5 28 1.1.1.5632.2 1 57.6495 2219.557 57.6952 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0134190004318953 3323.705078125 665.7483 3323.71826171875 665.7509765625 5 26 1.1.1.5633.2 1 57.6743 2219.557 57.6952 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.000827300013042986 3323.71728515625 831.9366 3323.71826171875 831.936889648438 4 18 1.1.1.5633.6 1 57.6776 19764.69 57.6952 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.000827300013042986 3323.71728515625 831.9366 3323.71826171875 831.936889648438 4 28 1.1.1.5633.7 1 57.6785 19764.69 57.6952 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0134190004318953 3323.705078125 665.7483 3323.71826171875 665.7509765625 5 28 1.1.1.5634.2 1 57.6989 2219.557 57.6952 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0175982005894184 3324.72021484375 832.1873 3324.70239257813 832.182861328125 4 32 1.1.1.5634.7 1 57.7031 10272.89 57.6952 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.0213428009301424 3339.73461914063 835.9409 3339.71337890625 835.935607910156 4 24 1.1.1.5634.8 1 57.7039 4112.423 57.8661 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.000607960973866284 3337.73461914063 835.4409 3337.73413085938 835.440795898438 4 33 1.1.1.5635.2 1 57.7241 18612.61 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.0126291001215577 3323.73217773438 1108.918 3323.71826171875 1108.91345214844 3 21 1.1.1.5636.10 1 57.7569 4603.393 57.6952 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0093564298003912 3337.724609375 668.5522 3337.73413085938 668.554077148438 5 24 1.1.1.5638.4 1 57.7982 2577.397 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0093564298003912 3337.724609375 668.5522 3337.73413085938 668.554077148438 5 29 1.1.1.5639.2 1 57.8226 2577.397 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0093564298003912 3337.724609375 668.5522 3337.73413085938 668.554077148438 5 28 1.1.1.5640.2 1 57.8452 2577.397 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.000827300013042986 3323.71728515625 831.9366 3323.71826171875 831.936889648438 4 28 1.1.1.5640.5 1 57.8494 19764.69 57.6952 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00495703006163239 3353.73364257813 839.4407 3353.72900390625 839.439514160156 4 30 1.1.1.5640.6 1 57.8511 784.3829 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0175982005894184 3324.72021484375 832.1873 3324.70239257813 832.182861328125 4 24 1.1.1.5641.5 1 57.8722 10272.89 57.6952 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00495703006163239 3353.73364257813 839.4407 3353.72900390625 839.439514160156 4 18 1.1.1.5641.6 1 57.873 784.3829 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10; Deamidated(N)@14; reduced acrolein addition +58(K)@20 missed K-L@20 0.0028475399594754 3368.7314453125 843.1901 3368.728515625 843.189453125 4 11 1.1.1.5641.8 1 57.8755 217.8647 57.8661 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.000607960973866284 3337.73461914063 835.4409 3337.73413085938 835.440795898438 4 35 1.1.1.5642.2 1 57.8948 18612.61 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.000607960973866284 3337.73461914063 835.4409 3337.73413085938 835.440795898438 4 26 1.1.1.5642.3 1 57.8965 18612.61 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Deamidated(N)@10; Oxidation(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0145936002954841 3354.72729492188 839.6891 3354.712890625 839.685485839844 4 19 1.1.1.5642.4 1 57.8982 675.0847 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0151546997949481 3337.71875 668.551 3337.73413085938 668.554077148438 5 28 1.1.1.5643.3 1 57.9193 2573.732 57.9149 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.000607960973866284 3337.73461914063 835.4409 3337.73413085938 835.440795898438 4 16 1.1.1.5643.6 1 57.9218 18612.61 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0151546997949481 3337.71875 668.551 3337.73413085938 668.554077148438 5 28 1.1.1.5646.2 1 57.9928 2573.732 57.9149 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00495703006163239 3353.73364257813 839.4407 3353.72900390625 839.439514160156 4 12 1.1.1.5648.9 1 58.0467 784.3829 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.000607960973866284 3337.73461914063 835.4409 3337.73413085938 835.440795898438 4 35 1.1.1.5649.4 1 58.0697 18612.61 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.00161410996224731 3323.72021484375 831.9373 3323.71826171875 831.936889648438 4 17 1.1.1.5650.6 1 58.0933 3073.029 57.8418 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00109624001197517 3337.73486328125 835.441 3337.73413085938 835.440795898438 4 25 1.1.1.5656.5 1 58.2399 9803.129 57.9883 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -9.48786982917227E-05 3323.71826171875 831.9368 3323.71826171875 831.936889648438 4 17 1.1.1.5657.5 1 58.2659 434.071 58.2583 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.000856882019434124 3337.7333984375 835.4406 3337.73413085938 835.440795898438 4 22 1.1.1.5663.3 1 58.4102 2164.776 58.1602 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@8; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0110063999891281 3324.71337890625 832.1856 3324.70239257813 832.182861328125 4 21 1.1.1.5665.2 1 58.4599 534.6042 58.527 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10; Delta:H(4)C(2)(K)@20 missed K-L@20 0.000607960973866284 3337.73461914063 835.4409 3337.73413085938 835.440795898438 4 14 1.1.1.5671.6 1 58.6103 1103.248 58.527 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@6; Deamidated(N)@8; Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0143772000446916 3324.71337890625 832.1856 3324.69897460938 832.182006835938 4 14 1.1.1.5672.5 1 58.6344 534.6042 58.527 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(2)C(2)@N-term; Methyl(K)@20 missed K-L@20 0.0139175998046994 3348.763671875 838.1982 3348.75 838.194763183594 4 25 1.1.1.5807.6 1 61.8064 247.0679 61.7955 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(2)C(2)(H)@4; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0114484000951052 3362.77685546875 841.7015 3362.765625 841.698669433594 4 30 1.1.1.5811.3 1 61.9094 390.6428 61.8999 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Delta:H(2)C(2)@N-term; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00490897987037897 3362.76049804688 841.6974 3362.765625 841.698669433594 4 28 1.1.1.5833.2 1 62.4486 278.7867 62.4686 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10; Deamidated(N)@14; Dethiomethyl(M)@17; reduced acrolein addition +96(K)@20 missed K-L@20 -0.00381496991030872 3358.73706054688 840.6915 3358.74096679688 840.692504882813 4 12 1.1.1.5578.6 1 56.316 513.5096 56.2825 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Phosphoadenosine(T)@11; Oxidation(M)@17; MDA adduct +54(K)@20 missed K-L@20 -0.0232842992991209 3707.75341796875 927.9456 3707.77661132813 927.951477050781 4 13 1.1.1.5578.7 1 56.3177 390.0242 56.3311 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@10; Met->Hcy(M)@17; reduced acrolein addition +58(K)@20 missed K-L@20 -0.00114648998714983 3353.72778320313 839.4392 3353.72900390625 839.439514160156 4 11 1.1.1.5632.4 1 57.6512 225.973 57.6456 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] missed K-L@20 0.00909817032516003 3308.72778320313 828.1892 3308.71875 828.186950683594 4 17 1.1.1.5553.2 1 55.6912 8980.533 55.8879 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 30 aa] Deamidated(N)@14 missed K-L@20 0.0204434990882874 3309.72290039063 828.438 3309.70263671875 828.432983398438 4 17 1.1.1.5565.7 1 55.9974 4905.506 55.8879 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9499986171722 [trypsin fragment, 30 aa] Oxidation(M)@17 missed K-L@20 0.0290697999298573 3324.74243164063 832.1929 3324.71362304688 832.185668945313 4 16 1.1.1.5557.6 1 55.7945 9374.245 56.0393 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5300004482269 [trypsin fragment, 30 aa] Deamidated(N)@6 missed K-L@20 0.0268757995218039 3309.72827148438 1104.25 3309.70263671875 1104.24157714844 3 16 1.1.1.5626.12 1 57.5094 761.3782 57.5433 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.9499995708466 [trypsin fragment, 30 aa] Oxidation(M)@17 missed K-L@20 0.0158862005919218 3324.72924804688 832.1896 3324.71362304688 832.185668945313 4 14 1.1.1.5504.10 1 54.4678 250.8555 54.457 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.9499995708466 [trypsin fragment, 30 aa] missed K-L@20 -0.00408540992066264 3308.71459960938 828.1859 3308.71875 828.186950683594 4 15 1.1.1.5593.6 1 56.6808 1029.268 56.7473 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.9999978542328 [trypsin fragment, 30 aa] missed K-L@20 0.0195962004363537 3308.73803710938 828.1918 3308.71875 828.186950683594 4 14 1.1.1.5577.3 1 56.2868 513.7938 56.2581 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 69.5800006389618 [trypsin fragment, 30 aa] Deamidated(N)@14; Dethiomethyl(M)@17; reduced acrolein addition +58(K)@20 missed K-L@20 -0.00487091997638345 3319.73608398438 830.9413 3319.7412109375 830.942565917969 4 10 1.1.1.5620.8 1 57.3485 287.1913 57.3644 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.620001077652 [trypsin fragment, 30 aa] Deamidated(N)@10; Deamidated(N)@14; Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0204806998372078 3324.71923828125 832.1871 3324.69897460938 832.182006835938 4 11 1.1.1.5543.8 1 55.4487 275.0874 55.4145 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.620001077652 [trypsin fragment, 30 aa] Deamidated(N)@10; Deamidated(N)@14; acrolein addition +38(K)@20 missed K-L@20 0.0432259999215603 3348.74584960938 838.1937 3348.70239257813 838.182861328125 4 10 1.1.1.5574.6 1 56.2159 317.7357 56.2581 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.620001077652 [trypsin fragment, 30 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@28 missed K-L@20 0.0302438996732235 3337.76318359375 1113.595 3337.73413085938 1113.58532714844 3 11 1.1.1.5591.11 1 56.6409 1005.379 56.6984 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.620001077652 [trypsin fragment, 30 aa] Oxidation(M)@17; Formyl(K)@20 missed K-L@20 0.0153486002236605 3352.7236328125 839.1882 3352.70849609375 839.184387207031 4 9 1.1.1.5604.5 1 56.9495 158.4495 56.9431 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.620001077652 [trypsin fragment, 30 aa] Deamidated(N)@8; Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0280850008130074 3323.744140625 1108.922 3323.71508789063 1108.91223144531 3 8 1.1.1.5618.13 1 57.3024 1160.007 57.1164 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 52.3500025272369 [trypsin fragment, 30 aa] Dethiomethyl(M)@17; MDA adduct +62(K)@20; Deamidated(N)@28 missed K-L@20 0.0258876997977495 3323.7412109375 1108.921 3323.71508789063 1108.91223144531 3 9 1.1.1.5586.14 1 56.5149 930.3574 56.5754 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 40.2700006961823 [trypsin fragment, 30 aa] Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0219752006232738 3352.76611328125 1118.596 3352.74487304688 1118.5888671875 3 9 1.1.1.5581.5 1 56.389 677.5106 56.3554 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 70.3000009059906 IMLIKLSSPATLNSR Oxidation(M)@2; acrolein addition +112(K)@5 cleaved D-I@N-term; missed K-L@5 0.0172495990991592 1771.00866699219 591.3435 1770.99133300781 591.337707519531 3 10 1.1.1.5391.2 1 51.7923 154.0196 51.8342 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 58.9100003242493 INAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; acrolein addition +38(K)@5 cleaved F-I@N-term; missed K-I@5; missed K-L@25 0.0590307004749775 3845.07348632813 770.022 3845.0146484375 770.010192871094 5 10 1.1.1.5497.9 1 54.2885 4188.249 54.3551 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 -0.00303525989875197 2706.40625 677.6088 2706.40893554688 677.609497070313 4 27 1.1.1.5333.6 1 50.3804 14154.73 50.3002 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@38; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0496583990752697 6054.17236328125 1010.036 6054.1240234375 1010.02795410156 6 23 1.1.1.5807.10 1 61.8131 1357.031 61.8475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@38; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00530292978510261 6054.166015625 865.8881 6054.16015625 865.887329101563 7 26 1.1.1.5808.2 1 61.8308 1212.142 61.8475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@24; Oxidation(H)@28; Dethiomethyl(M)@41; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0225594006478786 6069.1962890625 1012.54 6069.17138671875 1012.53582763672 6 33 1.1.1.5808.4 1 61.8424 3302.362 61.8999 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@24; Oxidation(P)@29; Dethiomethyl(M)@41; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00100110005587339 6069.17236328125 868.0319 6069.17138671875 868.03173828125 7 28 1.1.1.5809.4 1 61.8645 2806.35 61.8999 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Cation:Na(E)@17; reduced acrolein addition +96(K)@24; reduced HNE(H)@28; HPNE addition +172(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00678086001425982 6445.390625 1075.239 6445.39697265625 1075.24011230469 6 14 1.1.1.5810.6 1 61.8915 367.9497 61.8737 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0462875999510288 6054.17236328125 1010.036 6054.12744140625 1010.02850341797 6 16 1.1.1.5811.7 1 61.921 1357.031 61.8475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0322642996907234 6036.1484375 1007.032 6036.11669921875 1007.02673339844 6 14 1.1.1.5813.13 1 61.9699 1021.878 62.1768 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.070218600332737 6070.1923828125 1012.706 6070.1220703125 1012.6943359375 6 14 1.1.1.5815.9 1 62.02 2197.262 61.8999 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@28 missed R-L@4; missed K-I@24; missed K-L@44 -0.000758439011406153 6011.13427734375 1002.863 6011.1328125 1002.86273193359 6 19 1.1.1.5817.8 1 62.0686 2475.886 62.1274 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24 missed R-L@4; missed K-I@24; missed K-L@44 0.0440642014145851 6025.15625 1005.2 6025.11181640625 1005.19262695313 6 19 1.1.1.5817.9 1 62.0702 3737.857 62.1274 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(Q)@18; Deamidated(N)@21; Delta:H(2)C(2)(H)@28 missed R-L@4; missed K-I@24; missed K-L@44 0.0322043001651764 6025.13232421875 861.7405 6025.1005859375 861.735961914063 7 33 1.1.1.5818.2 1 62.0828 2901.94 62.1274 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28 missed R-L@4; missed K-I@24; missed K-L@44 0.00767868990078568 6025.15625 1005.2 6025.1484375 1005.19866943359 6 29 1.1.1.5818.6 1 62.0895 3737.857 62.1274 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.000347888009855524 6053.17626953125 1009.87 6053.1796875 1009.87054443359 6 23 1.1.1.5818.7 1 62.0912 41978.01 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24 missed R-L@4; missed K-I@24; missed K-L@44 0.0720001980662346 6025.18310546875 1206.044 6025.11181640625 1206.02966308594 5 16 1.1.1.5818.10 1 62.0979 1410.206 62.1274 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0236351992934942 6053.1552734375 865.7438 6053.1796875 865.747253417969 7 33 1.1.1.5819.6 1 62.114 40597.29 62.299 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0244925003498793 6053.203125 1211.648 6053.1796875 1211.64318847656 5 24 1.1.1.5819.10 1 62.1223 17528.32 62.3475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0199523996561766 6039.14404296875 863.7421 6039.1640625 863.744995117188 7 32 1.1.1.5820.7 1 62.1352 4764.407 62.152 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Dehydrated(T)@35; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00252427998930216 6069.1552734375 868.0295 6069.1533203125 868.029174804688 7 24 1.1.1.5820.8 1 62.1361 2392.299 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.000729401013813913 6039.16015625 1007.534 6039.1640625 1007.53460693359 6 36 1.1.1.5820.12 1 62.1394 5484.195 62.152 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; Formyl(K)@24; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0507570989429951 6054.17236328125 1010.036 6054.1240234375 1010.02795410156 6 24 1.1.1.5820.13 1 62.1402 30571.32 62.3232 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; reduced acrolein addition +58(K)@24; Deamidated(N)@38; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0049149701371789 6085.162109375 1015.201 6085.158203125 1015.20031738281 6 17 1.1.1.5820.14 1 62.1411 959.7712 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; reduced HNE(H)@28; Hex(N)@38; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0207065995782614 6429.3759765625 1072.57 6429.35302734375 1072.56616210938 6 17 1.1.1.5820.16 1 62.1427 1500.114 62.3232 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0257808994501829 6039.1884765625 1208.845 6039.1640625 1208.84008789063 5 26 1.1.1.5820.18 1 62.1452 2024.002 62.152 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0821669027209282 6070.20361328125 1215.048 6070.1220703125 1215.03173828125 5 13 1.1.1.5820.19 1 62.1469 670.8113 62.1768 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.011468599550426 6053.1552734375 865.7437 6053.14306640625 865.742004394531 7 23 1.1.1.5821.8 1 62.1618 41277.89 62.3475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@24; reduced HNE(H)@28; Dioxidation(M)@41; acrolein addition +112(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0388671010732651 6395.30859375 914.6228 6395.34765625 914.628356933594 7 16 1.1.1.5821.9 1 62.1635 133.619 62.2014 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@28; Hex(N)@38; acrolein addition +112(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00208511995151639 6429.35498046875 919.4866 6429.35302734375 919.486267089844 7 18 1.1.1.5821.10 1 62.1651 1423.276 62.2503 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Deamidated(N)@38; Oxidation(M)@41 missed R-L@4; missed K-I@24; missed K-L@44 0.0614487007260323 6068.17041015625 1012.369 6068.1064453125 1012.3583984375 6 18 1.1.1.5821.11 1 62.1668 1928.029 62.299 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@32; Deamidated(N)@34; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0220478996634483 6027.1376953125 862.027 6027.1162109375 862.02392578125 7 18 1.1.1.5822.4 1 62.1821 1313.076 62.1274 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; reduced HNE(H)@28; Dioxidation(M)@41; acrolein addition +94(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0107818003743887 6335.279296875 906.0472 6335.2900390625 906.048706054688 7 20 1.1.1.5822.6 1 62.1838 209.8077 62.2014 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@24; reduced HNE(H)@28; Dioxidation(P)@29; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0827670991420746 6369.28564453125 910.9052 6369.3681640625 910.917053222656 7 22 1.1.1.5822.7 1 62.1846 568.9579 62.2503 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0356560982763767 6039.16015625 1007.534 6039.12744140625 1007.52856445313 6 23 1.1.1.5822.9 1 62.1863 5484.195 62.152 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Met->Hcy(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0394607000052929 6069.17822265625 1012.537 6069.13818359375 1012.53033447266 6 20 1.1.1.5822.10 1 62.188 2518.406 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0480967015028 6074.18212890625 1013.371 6074.13232421875 1013.36267089844 6 14 1.1.1.5822.11 1 62.1897 844.1904 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; reduced acrolein addition +96(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0373392999172211 6094.12109375 871.596 6094.15869140625 871.601379394531 7 17 1.1.1.5823.2 1 62.2073 250.2738 62.2014 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@16; Delta:H(2)C(2)(H)@28; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0316698998212814 6100.18017578125 1017.704 6100.14794921875 1017.69860839844 6 16 1.1.1.5823.5 1 62.2173 316.6076 62.2503 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@16; Deamidated(N)@21; Deamidated(N)@38; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0487296991050243 6076.1494140625 869.0286 6076.1005859375 869.021606445313 7 17 1.1.1.5824.3 1 62.2302 793.6722 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Deamidated(N)@34; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0236358009278774 6084.14990234375 870.1716 6084.17431640625 870.175048828125 7 25 1.1.1.5824.4 1 62.2311 692.4491 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0366162993013859 6101.14306640625 872.5991 6101.1796875 872.604370117188 7 21 1.1.1.5824.6 1 62.2336 359.7182 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 0.0567664988338947 6024.17236328125 1005.036 6024.11669921875 1005.02673339844 6 14 1.1.1.5824.10 1 62.2403 1751.958 62.152 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(E)@17; ONE addition +154(K)@24; reduced HNE(H)@28; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0381258018314838 6428.34423828125 1072.398 6428.38427734375 1072.40466308594 6 15 1.1.1.5824.11 1 62.2419 813.2974 62.2257 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR HPNE addition +172(K)@24; reduced HNE(H)@28; Oxidation(M)@41; hexanoyl addition +98(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0249182991683483 6441.400390625 1074.574 6441.42578125 1074.57824707031 6 12 1.1.1.5824.12 1 62.2436 113.3509 62.299 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.000758019974455237 6068.154296875 867.8865 6068.154296875 867.886474609375 7 24 1.1.1.5825.3 1 62.2571 1749.566 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.000347888009855524 6053.17626953125 1009.87 6053.1796875 1009.87054443359 6 46 1.1.1.5825.5 1 62.2621 45316.88 62.3475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@38; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0170610006898642 6078.142578125 1014.031 6078.12744140625 1014.02850341797 6 14 1.1.1.5825.6 1 62.2646 413.8586 62.2014 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0215460993349552 6053.1552734375 865.7437 6053.17626953125 865.746765136719 7 37 1.1.1.5826.3 1 62.2839 41766.51 62.3475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +94(K)@24; Dethiomethyl(M)@41; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0206907000392675 6071.166015625 868.3167 6071.18701171875 868.319702148438 7 22 1.1.1.5826.4 1 62.2872 1573.235 62.299 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0238821003586054 6053.203125 1211.648 6053.1796875 1211.64318847656 5 40 1.1.1.5826.6 1 62.2939 17663.16 62.3232 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.012733300216496 6038.14111328125 863.5989 6038.12890625 863.597106933594 7 23 1.1.1.5827.3 1 62.3064 2872.586 62.152 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.000347888009855524 6053.17626953125 1009.87 6053.1796875 1009.87054443359 6 30 1.1.1.5827.4 1 62.3089 45316.88 62.3475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; reduced acrolein addition +58(K)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0049149701371789 6085.162109375 1015.201 6085.158203125 1015.20031738281 6 23 1.1.1.5827.5 1 62.3115 959.7712 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0830349028110504 6068.1884765625 1214.645 6068.1064453125 1214.62854003906 5 12 1.1.1.5827.7 1 62.3181 837.3416 62.2503 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Oxidation(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0135877002030611 6095.140625 1016.864 6095.15380859375 1016.86627197266 6 24 1.1.1.5828.3 1 62.3424 298.2977 62.3232 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Met->Hcy(M)@41; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0279695000499487 6021.14453125 861.1708 6021.1171875 861.166870117188 7 17 1.1.1.5829.2 1 62.3516 371.4669 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@16; acrolein addition +56(K)@24; Dethiomethyl(M)@41; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00609738985076547 6034.1494140625 863.0286 6034.1552734375 863.029479980469 7 20 1.1.1.5829.3 1 62.3533 1242.87 62.3475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Met->Hcy(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0177804008126259 6069.1552734375 868.0295 6069.13818359375 868.027038574219 7 26 1.1.1.5829.4 1 62.355 2392.299 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Dehydrated(T)@27; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0260355994105339 6069.17822265625 1012.537 6069.1533203125 1012.53283691406 6 24 1.1.1.5829.7 1 62.36 2517.026 62.3959 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0495616011321545 6074.18212890625 1013.371 6074.13232421875 1013.36267089844 6 12 1.1.1.5829.8 1 62.3616 888.2734 62.3475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@24; reduced HNE(H)@28; Deamidated(N)@38; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0140174003317952 6274.28759765625 897.3341 6274.2734375 897.332092285156 7 18 1.1.1.5830.3 1 62.3808 452.2454 62.3959 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; Deamidated(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0663179978728294 6037.16845703125 1007.202 6037.1005859375 1007.19073486328 6 19 1.1.1.5830.5 1 62.3875 3229.267 62.4686 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.060716301202774 6068.1640625 1012.368 6068.1064453125 1012.3583984375 6 18 1.1.1.5830.6 1 62.3908 1997.734 62.3959 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@24; Delta:H(4)C(2)(H)@28; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0488920994102955 6091.14453125 1016.198 6091.19189453125 1016.20593261719 6 25 1.1.1.5831.2 1 62.415 430.0211 62.4201 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Deamidated(N)@34; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0116729000583291 6084.162109375 870.1733 6084.17431640625 870.175048828125 7 25 1.1.1.5832.2 1 62.4251 670.4523 62.3959 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@24; Oxidation(P)@29; Deamidated(N)@38; Dethiomethyl(M)@41 missed R-L@4; missed K-I@24; missed K-L@44 0.0793106034398079 6022.1982421875 1004.707 6022.11865234375 1004.69372558594 6 19 1.1.1.5832.3 1 62.4276 480.3791 62.4201 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.000347888009855524 6053.17626953125 1009.87 6053.1796875 1009.87054443359 6 46 1.1.1.5832.4 1 62.4301 45316.88 62.3475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@24; reduced HNE(H)@28; Hex(N)@34 missed R-L@4; missed K-I@24; missed K-L@44 0.00208511995151639 6429.35498046875 919.4866 6429.35302734375 919.486267089844 7 21 1.1.1.5833.4 1 62.4519 1423.276 62.2503 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Deamidated(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0481683984398842 6098.18212890625 1017.371 6098.13232421875 1017.36267089844 6 12 1.1.1.5833.8 1 62.4586 360.0497 62.3959 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Delta:H(2)C(2)(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0729892998933792 6105.10009765625 1018.524 6105.1748046875 1018.53637695313 6 19 1.1.1.5833.9 1 62.4603 509.6947 62.3959 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0272528994828463 6053.203125 1211.648 6053.17626953125 1211.642578125 5 35 1.1.1.5833.11 1 62.4636 17663.16 62.3232 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0215460993349552 6053.1552734375 865.7437 6053.17626953125 865.746765136719 7 29 1.1.1.5834.3 1 62.4744 41766.51 62.3475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(Q)@18; Deamidated(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0356866009533405 6037.13623046875 863.4553 6037.1005859375 863.450256347656 7 19 1.1.1.5835.4 1 62.4982 2971.374 62.4686 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Deamidated(N)@38; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.011926899664104 6084.16015625 1015.034 6084.17431640625 1015.03631591797 6 14 1.1.1.5835.13 1 62.5091 762.3581 62.3959 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0065760500729084 6026.140625 1005.364 6026.13232421875 1005.36267089844 6 12 1.1.1.5836.20 1 62.5361 639.1419 62.4929 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@16; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0344615988433361 6036.1484375 1007.032 6036.11669921875 1007.02673339844 6 13 1.1.1.5837.14 1 62.5581 3421.497 62.4686 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0437280982732773 6053.1884765625 1009.872 6053.14306640625 1009.86450195313 6 35 1.1.1.5839.6 1 62.6055 45560.24 62.3475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0214406996965408 6053.1982421875 1211.647 6053.1796875 1211.64318847656 5 27 1.1.1.5841.5 1 62.6597 16474.1 62.3959 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; Formyl(K)@24; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0632082968950272 6054.1845703125 1010.038 6054.1240234375 1010.02795410156 6 25 1.1.1.5847.5 1 62.8038 1879.605 62.8089 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@30; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0114419003948569 6054.17236328125 1010.036 6054.16015625 1010.03399658203 6 29 1.1.1.5855.6 1 62.9922 2817.501 63.0245 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0692996978759766 6054.19873046875 1211.847 6054.12744140625 1211.83276367188 5 17 1.1.1.5856.6 1 63.0194 1056.047 63.0723 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0143716000020504 6054.17236328125 1010.036 6054.16015625 1010.03399658203 6 35 1.1.1.5862.3 1 63.1573 3567.341 63.2399 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0833379030227661 6054.20849609375 1211.849 6054.12744140625 1211.83276367188 5 13 1.1.1.5863.6 1 63.187 1242.649 63.1682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0160594005137682 6054.14404296875 865.885 6054.16015625 865.887329101563 7 33 1.1.1.5866.2 1 63.2587 2614.519 63.2643 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0114419003948569 6054.17236328125 1010.036 6054.16015625 1010.03399658203 6 33 1.1.1.5869.3 1 63.3261 4571.263 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@16; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0808963999152184 6054.20849609375 1211.849 6054.12744140625 1211.83276367188 5 16 1.1.1.5870.8 1 63.3559 1324.639 63.3848 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0169082004576921 6054.140625 865.8845 6054.1240234375 865.882141113281 7 25 1.1.1.5875.2 1 63.4626 3559.266 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0125404996797442 6054.17236328125 1010.036 6054.16015625 1010.03399658203 6 37 1.1.1.5876.3 1 63.4941 4692.833 63.5289 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0472714006900787 6054.20849609375 1211.849 6054.16015625 1211.83935546875 5 29 1.1.1.5877.5 1 63.5239 1849.494 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0125404996797442 6054.17236328125 1010.036 6054.16015625 1010.03399658203 6 29 1.1.1.5883.4 1 63.6635 4554.792 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0186170991510153 6054.14306640625 865.8848 6054.1240234375 865.882141113281 7 27 1.1.1.5884.3 1 63.68 3733.065 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0368954017758369 6054.19873046875 1211.847 6054.16015625 1211.83935546875 5 26 1.1.1.5884.7 1 63.6917 1721.443 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0125404996797442 6054.17236328125 1010.036 6054.16015625 1010.03399658203 6 30 1.1.1.5890.5 1 63.8356 4554.792 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0699099972844124 6054.19873046875 1211.847 6054.12744140625 1211.83276367188 5 13 1.1.1.5891.7 1 63.8596 1721.443 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0177683997899294 6054.14306640625 865.8848 6054.16015625 865.887329101563 7 33 1.1.1.5893.3 1 63.9018 3733.065 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0459963008761406 6054.17236328125 1010.036 6054.1240234375 1010.02795410156 6 24 1.1.1.5897.6 1 64.0029 3616.843 63.7446 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@24; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0454403012990952 6054.20361328125 1211.848 6054.16015625 1211.83935546875 5 21 1.1.1.5898.7 1 64.0302 1280.247 63.7686 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0164809003472328 6054.140625 865.8845 6054.1240234375 865.882141113281 7 26 1.1.1.5902.2 1 64.1135 2048.839 63.915 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.024625500664115 6054.1845703125 1010.038 6054.16015625 1010.03399658203 6 25 1.1.1.5904.6 1 64.1717 2398.705 63.915 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0500246994197369 6054.17236328125 1010.036 6054.1240234375 1010.02795410156 6 24 1.1.1.5911.7 1 64.3444 1673.232 64.0837 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0525683984160423 6079.21044921875 1014.209 6079.1591796875 1014.20043945313 6 15 1.1.1.5953.7 1 65.364 422.1879 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9499986171722 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR missed R-L@4; missed K-I@24; missed K-L@44 0.0036223700735718 5997.1181640625 1000.527 5997.1171875 1000.52679443359 6 17 1.1.1.5817.7 1 62.0669 264.0853 62.0786 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.9999978542328 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0124337999150157 6105.12451171875 1018.528 6105.13818359375 1018.53033447266 6 15 1.1.1.5822.13 1 62.193 365.1049 62.2014 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.9999978542328 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0526139996945858 6059.185546875 866.6052 6059.1328125 866.59765625 7 15 1.1.1.5833.3 1 62.4502 1003.793 62.3959 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.4500029087067 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0568143017590046 6035.18896484375 1208.045 6035.1328125 1208.03381347656 5 14 1.1.1.5832.6 1 62.4359 862.4716 62.4686 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.510000705719 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(E)@17; acrolein addition +94(K)@24; reduced HNE(H)@28; acrolein addition +94(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.000828846998047084 6400.3544921875 1067.733 6400.35302734375 1067.73278808594 6 10 1.1.1.5820.15 1 62.1419 190.1683 62.1274 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.9300005435944 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@24; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0494277998805046 6107.10400390625 873.4507 6107.15380859375 873.457824707031 7 13 1.1.1.5822.5 1 62.183 478.834 62.2747 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.620001077652 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0619754008948803 6054.1884765625 1211.845 6054.12744140625 1211.83276367188 5 10 1.1.1.5810.7 1 61.8948 364.585 61.8737 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.0700001716614 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Ammonia-loss(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 0.0432699993252754 6034.14453125 1006.698 6034.10107421875 1006.69079589844 6 11 1.1.1.5829.6 1 62.3583 1290.826 62.3475 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 45.5300003290176 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Delta:H(2)C(2)(H)@28 missed R-L@4; missed K-I@24; missed K-L@44 0.0272621996700764 6085.17431640625 1015.203 6085.1484375 1015.19866943359 6 10 1.1.1.5834.6 1 62.4794 964.2128 62.3959 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.4399992227554 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0158418007194996 6121.13232421875 1021.196 6121.1484375 1021.19866943359 6 13 1.1.1.5822.14 1 62.1947 173.1159 62.152 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.6699990034103 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0412917993962765 6069.17822265625 1012.537 6069.13818359375 1012.53033447266 6 9 1.1.1.5836.21 1 62.5369 2517.026 62.3959 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 67.7100002765656 IVGGYTCAANSIPYQVSLNSG Carbamidomethyl(C)@7; Dehydrated(S)@11 cleaved G-S@C-term 0.0111384000629187 2152.03735351563 1077.026 2152.02587890625 1077.02026367188 2 11 1.1.1.5334.13 1 50.4164 234.0281 50.4215 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK No Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.0147086996585131 4757.25 952.4573 4757.2353515625 952.454345703125 5 13 1.1.1.5645.6 1 57.9733 632.2573 57.8906 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.7799994945526 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; reduced HNE(H)@40; Carbamidomethyl(C)@41; Dehydrated(Y)@42 -0.0159288998693228 4800.26123046875 961.0596 4800.27734375 961.062744140625 5 12 1.1.1.5439.6 1 52.9712 2689.005 52.9818 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 36.719998717308 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKS Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; MDA adduct +54(K)@43 cleaved S-R@C-term; missed K-S@43 0.0440828986465931 4800.26025390625 961.0593 4800.2158203125 961.050476074219 5 10 1.1.1.5471.4 1 53.6397 1737.93 53.4824 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGN cleaved N-E@C-term 0.00423526018857956 1308.63525390625 655.3249 1308.63098144531 655.32275390625 2 14 1.1.1.4881.3 1 39.6423 989.577 39.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 LGEHNIDVLEGN Dehydrated(E)@10 cleaved N-E@C-term 0.0048853000625968 1290.62524414063 646.3199 1290.62048339844 646.317504882813 2 12 1.1.1.4899.4 1 40.0689 1739.876 40.0503 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.6800011396408 LGEHNIDVLEGN Dehydrated(E)@10 cleaved N-E@C-term 0.00403083022683859 1290.62451171875 646.3195 1290.62048339844 646.317504882813 2 11 1.1.1.4907.8 1 40.2582 1723.744 40.1213 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00976489018648863 1565.74182128906 783.8782 1565.73217773438 783.873352050781 2 19 1.1.1.4877.6 1 39.5441 1379.897 39.4337 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00258935010060668 1939.93029785156 970.9724 1939.92761230469 970.971069335938 2 23 1.1.1.5278.3 1 49.1134 16510.87 49.2454 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00258935010060668 1939.93029785156 970.9724 1939.92761230469 970.971069335938 2 24 1.1.1.5285.4 1 49.2886 16510.87 49.2454 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00258935010060668 1939.93029785156 970.9724 1939.92761230469 970.971069335938 2 21 1.1.1.5292.6 1 49.4577 16510.87 49.2454 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -0.00156094995327294 1939.92602539063 970.9703 1939.92761230469 970.971069335938 2 20 1.1.1.5299.5 1 49.6267 3269.113 49.3664 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Delta:H(4)C(2)(H)@4 cleaved N-A@C-term 0.0016811799723655 1967.96044921875 984.9875 1967.95886230469 984.986694335938 2 23 1.1.1.5308.3 1 49.8069 379.2726 49.836 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00918100029230118 1939.93664550781 970.9756 1939.92761230469 970.971069335938 2 19 1.1.1.5310.3 1 49.855 292.141 49.8601 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Deamidated(N)@17 cleaved N-A@C-term 0.00353749003261328 1940.9150390625 971.4648 1940.91162109375 971.463073730469 2 17 1.1.1.5318.5 1 50.0291 2597.764 50.155 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Deamidated(N)@17 cleaved N-A@C-term 0.00353749003261328 1940.9150390625 971.4648 1940.91162109375 971.463073730469 2 22 1.1.1.5319.7 1 50.0534 2597.764 50.155 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Deamidated(N)@17 cleaved N-A@C-term 0.00353749003261328 1940.9150390625 971.4648 1940.91162109375 971.463073730469 2 21 1.1.1.5326.14 1 50.2192 2597.764 50.155 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.00268598995171487 1921.91967773438 961.9671 1921.9169921875 961.965759277344 2 18 1.1.1.5332.3 1 50.3678 4298.341 50.5673 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Deamidated(N)@12 cleaved N-A@C-term 0.00353749003261328 1940.9150390625 971.4648 1940.91162109375 971.463073730469 2 18 1.1.1.5333.10 1 50.3871 2639.19 50.1308 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.00291594001464546 1921.92004394531 641.6473 1921.9169921875 641.646301269531 3 13 1.1.1.5342.4 1 50.5996 946.4733 50.5673 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.0179361999034882 1921.93481445313 961.9747 1921.9169921875 961.965759277344 2 12 1.1.1.5346.16 1 50.7081 4117.326 50.5673 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Delta:H(2)C(2)(H)@4 cleaved N-A@C-term 0.0267347004264593 1965.96984863281 983.9922 1965.94323730469 983.978881835938 2 12 1.1.1.5384.9 1 51.6316 303.7777 51.5658 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -0.991041004657745 1938.9365234375 970.4755 1939.92761230469 970.971069335938 2 14 1.1.1.5276.13 1 49.0676 263.2088 49.1485 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.000533882004674524 1939.92822265625 647.65 1939.92761230469 647.649780273438 3 14 1.1.1.5279.8 1 49.1326 4390.289 49.2454 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.000533882004674524 1939.92822265625 647.65 1939.92761230469 647.649780273438 3 14 1.1.1.5291.2 1 49.4202 4390.289 49.2454 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.8100011348724 LGEHNIDVLEGNEQFIN Oxidation(F)@15 cleaved N-A@C-term 0.00268533988855779 1955.92504882813 978.9698 1955.92248535156 978.968505859375 2 14 1.1.1.5283.7 1 49.2404 228.3406 49.2212 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINA cleaved A-A@C-term 0.00591818988323212 2010.97143554688 1006.493 2010.96472167969 1006.48962402344 2 21 1.1.1.5330.11 1 50.3161 2037.456 50.4215 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAA Deamidated(N)@17 cleaved A-K@C-term 0.0253525003790855 2083.01123046875 1042.513 2082.98583984375 1042.50012207031 2 17 1.1.1.5335.5 1 50.4407 168.601 50.3971 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAA cleaved A-K@C-term 0.00469178985804319 2082.0068359375 695.0095 2082.00170898438 695.007873535156 3 12 1.1.1.5345.10 1 50.6758 1692.933 50.6408 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAA cleaved A-K@C-term 0.0219656992703676 2082.0234375 1042.019 2082.00170898438 1042.00817871094 2 18 1.1.1.5347.21 1 50.7345 3686.962 50.6408 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 -0.00249455007724464 2211.07739257813 1106.546 2211.08081054688 1106.54760742188 2 17 1.1.1.5170.21 1 46.5111 964.7374 46.6385 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 -0.00405680015683174 2211.07641601563 738.0328 2211.08081054688 738.0341796875 3 21 1.1.1.5174.4 1 46.6023 3438.061 46.614 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 -0.00405680015683174 2211.07641601563 738.0328 2211.08081054688 738.0341796875 3 25 1.1.1.5177.8 1 46.6721 3438.061 46.614 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17; Methyl(K)@20 -0.00771905994042754 2225.08862304688 742.7035 2225.09643554688 742.706115722656 3 23 1.1.1.5188.7 1 46.9399 1190.634 46.8568 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17; Delta:H(4)C(2)(K)@20 0.00015488600183744 2239.11206054688 747.378 2239.11206054688 747.377990722656 3 19 1.1.1.5188.8 1 46.9416 212.5455 46.9291 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00014789099805057 2210.09741210938 1106.056 2210.0966796875 1106.0556640625 2 26 1.1.1.5193.11 1 47.0691 42930.29 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00183466996531934 2210.09497070313 553.531 2210.0966796875 553.531494140625 4 20 1.1.1.5196.4 1 47.1277 4183.358 47.1713 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.0109574999660254 2211.09155273438 738.0378 2211.08081054688 738.0341796875 3 22 1.1.1.5198.5 1 47.1829 40561.2 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00292740995064378 2210.09375 737.7052 2210.0966796875 737.706176757813 3 21 1.1.1.5199.9 1 47.2079 58092.42 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00292740995064378 2210.09375 737.7052 2210.0966796875 737.706176757813 3 23 1.1.1.5199.10 1 47.2096 58092.42 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00014789099805057 2210.09741210938 1106.056 2210.0966796875 1106.0556640625 2 25 1.1.1.5200.6 1 47.2388 42930.29 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00183466996531934 2210.09497070313 553.531 2210.0966796875 553.531494140625 4 22 1.1.1.5201.4 1 47.2497 4183.358 47.1713 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.0109574999660254 2211.09155273438 738.0378 2211.08081054688 738.0341796875 3 22 1.1.1.5201.7 1 47.2548 40561.2 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Oxidation(F)@15 -0.00369738996960223 2226.08740234375 1114.051 2226.091796875 1114.05310058594 2 17 1.1.1.5201.12 1 47.2631 642.9722 47.2682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00183466996531934 2210.09497070313 553.531 2210.0966796875 553.531494140625 4 22 1.1.1.5202.6 1 47.2756 4183.358 47.1713 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(H)@4 -0.0331394001841545 2224.0791015625 742.367 2224.1123046875 742.378051757813 3 24 1.1.1.5202.8 0 47.279 1001.708 47.2682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00183466996531934 2210.09497070313 553.531 2210.0966796875 553.531494140625 4 18 1.1.1.5203.8 1 47.3009 4183.358 47.1713 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00183466996531934 2210.09497070313 553.531 2210.0966796875 553.531494140625 4 20 1.1.1.5204.2 1 47.3211 4183.358 47.1713 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00183466996531934 2210.09497070313 553.531 2210.0966796875 553.531494140625 4 21 1.1.1.5205.6 1 47.3521 4183.358 47.1713 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.0109574999660254 2211.09155273438 738.0378 2211.08081054688 738.0341796875 3 23 1.1.1.5205.8 1 47.3554 40561.2 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00183466996531934 2210.09497070313 553.531 2210.0966796875 553.531494140625 4 19 1.1.1.5206.6 1 47.3723 4183.358 47.1713 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00292740995064378 2210.09375 737.7052 2210.0966796875 737.706176757813 3 25 1.1.1.5206.10 1 47.3756 59901.24 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00014789099805057 2210.09741210938 1106.056 2210.0966796875 1106.0556640625 2 25 1.1.1.5207.6 1 47.4091 44891.98 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.00457561016082764 2224.10766601563 742.3765 2224.1123046875 742.378051757813 3 25 1.1.1.5209.4 1 47.4474 30657.14 47.5835 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00256119994446635 2210.09423828125 737.7053 2210.0966796875 737.706176757813 3 26 1.1.1.5214.3 1 47.5651 42077.74 47.3168 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5; Deamidated(N)@17; Methyl(K)@20 0.0303351990878582 2226.11083984375 743.0442 2226.08032226563 743.034118652344 3 21 1.1.1.5214.4 1 47.5667 6511.121 47.6077 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.000777288980316371 2224.11181640625 557.0352 2224.1123046875 557.035400390625 4 22 1.1.1.5215.4 1 47.5885 2052.096 47.6077 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.00457561016082764 2224.10766601563 742.3765 2224.1123046875 742.378051757813 3 27 1.1.1.5216.3 1 47.6151 30657.14 47.5835 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(K)@20 -0.00585677986964583 2238.1220703125 747.048 2238.12817382813 747.049987792969 3 25 1.1.1.5216.4 1 47.6176 3555.869 47.7535 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.000777288980316371 2224.11181640625 557.0352 2224.1123046875 557.035400390625 4 23 1.1.1.5217.5 1 47.6393 2052.096 47.6077 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00677252979949117 2210.08984375 737.7039 2210.0966796875 737.706176757813 3 23 1.1.1.5221.7 1 47.7368 14167.48 47.4867 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.00457561016082764 2224.10766601563 742.3765 2224.1123046875 742.378051757813 3 26 1.1.1.5223.10 1 47.7886 30657.14 47.5835 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(K)@20 -0.00585677986964583 2238.1220703125 747.048 2238.12817382813 747.049987792969 3 25 1.1.1.5223.11 1 47.7894 3555.869 47.7535 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.0021949999500066 2210.09423828125 737.7054 2210.0966796875 737.706176757813 3 26 1.1.1.5228.7 1 47.9109 1246.067 47.9227 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.00549111980944872 2224.10693359375 742.3762 2224.1123046875 742.378051757813 3 24 1.1.1.5230.4 1 47.9538 13880.99 47.7047 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term -0.00384267000481486 2238.12426757813 747.0487 2238.12817382813 747.049987792969 3 26 1.1.1.5230.5 1 47.9554 3634.485 47.8988 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.00897981971502304 2211.08935546875 1106.552 2211.08081054688 1106.54760742188 2 19 1.1.1.5234.7 1 48.0561 512.7982 48.0662 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00824175029993057 2210.10498046875 737.7089 2210.0966796875 737.706176757813 3 24 1.1.1.5235.3 1 48.0733 1086.853 48.0662 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term -0.00384267000481486 2238.12426757813 747.0487 2238.12817382813 747.049987792969 3 26 1.1.1.5237.7 1 48.1228 3654.879 47.8988 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0036642299965024 2210.10034179688 737.7074 2210.0966796875 737.706176757813 3 21 1.1.1.5244.4 1 48.2889 613.642 48.3296 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term; Methyl(K)@20 -0.00201029004529119 2252.14184570313 751.7212 2252.14379882813 751.721862792969 3 29 1.1.1.5247.2 1 48.3591 1110.418 48.4014 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.0157447997480631 2224.0966796875 742.3728 2224.1123046875 742.378051757813 3 21 1.1.1.5252.6 1 48.4821 299.1676 48.4493 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.0227026008069515 2224.08959960938 742.3705 2224.1123046875 742.378051757813 3 16 1.1.1.5259.9 1 48.6503 287.9132 48.6172 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.0161109995096922 2224.09619140625 742.3727 2224.1123046875 742.378051757813 3 17 1.1.1.5266.7 1 48.8266 254.5042 48.7859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 0.00399965001270175 2211.08471679688 738.0355 2211.08081054688 738.0341796875 3 19 1.1.1.5275.5 1 49.0332 843.1942 49.1243 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.988014996051788 2211.08471679688 738.0355 2210.0966796875 737.706176757813 3 22 1.1.1.5282.6 1 49.2045 843.1942 49.1243 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 -0.00149338005576283 2211.07934570313 738.0337 2211.08081054688 738.0341796875 3 23 1.1.1.5289.5 1 49.3754 3841.759 49.4628 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.00605018995702267 2211.08740234375 1106.551 2211.08081054688 1106.54760742188 2 20 1.1.1.5290.5 1 49.4095 789.2505 49.4628 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 -0.00149338005576283 2211.07934570313 738.0337 2211.08081054688 738.0341796875 3 22 1.1.1.5297.6 1 49.5735 3841.759 49.4628 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12; Methyl(K)@20 -0.00167672999668866 2225.0947265625 742.7055 2225.09643554688 742.706115722656 3 24 1.1.1.5303.5 1 49.7198 865.4666 49.7637 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 -0.00193766003940254 2236.1103515625 746.3774 2236.1123046875 746.378051757813 3 26 1.1.1.5312.4 1 49.8989 3771.516 50.0341 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00274872989393771 2210.09936523438 737.7071 2210.0966796875 737.706176757813 3 23 1.1.1.5314.4 1 49.9446 218.0326 49.9563 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 -0.00193766003940254 2236.1103515625 746.3774 2236.1123046875 746.378051757813 3 25 1.1.1.5320.3 1 50.0691 3770.851 50.0341 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4; Methyl(K)@20 -0.000471603008918464 2250.12768554688 751.0498 2250.12817382813 751.049987792969 3 15 1.1.1.5326.6 1 50.21 1541.986 50.4457 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 -0.0015714600449428 2236.11108398438 746.3776 2236.1123046875 746.378051757813 3 26 1.1.1.5327.7 1 50.2417 4015.71 50.1308 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00348113011568785 2210.10009765625 737.7073 2210.0966796875 737.706176757813 3 18 1.1.1.5329.3 1 50.2818 270.4987 50.2759 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4; Methyl(K)@20 -0.000471603008918464 2250.12768554688 751.0498 2250.12817382813 751.049987792969 3 24 1.1.1.5333.7 1 50.3821 1455.766 50.4215 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.987465977668762 2211.083984375 738.0353 2210.0966796875 737.706176757813 3 20 1.1.1.5336.6 1 50.4574 612.2562 50.3728 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Formyl@N-term 0.0108452998101711 2238.10229492188 747.0414 2238.091796875 747.037841796875 3 22 1.1.1.5456.3 1 53.2751 707.1843 53.3381 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Formyl@N-term 0.0252362992614508 2238.11743164063 1120.066 2238.091796875 1120.05310058594 2 26 1.1.1.5457.3 1 53.309 929.7163 53.3381 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Formyl@N-term 0.0108452998101711 2238.10229492188 747.0414 2238.091796875 747.037841796875 3 14 1.1.1.5463.4 1 53.4415 707.1843 53.3381 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)@N-term; Delta:H(2)C(2)(H)@4 0.00992915034294128 2262.13793945313 755.0533 2262.12817382813 755.049987792969 3 17 1.1.1.5479.11 1 53.8342 574.0103 53.9228 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)@N-term; Delta:H(2)C(2)(H)@4 0.010478500276804 2262.138671875 755.0535 2262.12817382813 755.049987792969 3 22 1.1.1.5486.11 1 54.0098 595.1179 53.9979 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@3 0.0267047006636858 2232.10546875 1117.06 2232.07861328125 1117.04663085938 2 9 1.1.1.5522.18 1 54.9295 201.9758 54.9371 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Oxidation(H)@4; Ammonia-loss(N)@5 0.0220231004059315 2209.08715820313 737.3697 2209.06518554688 737.3623046875 3 15 1.1.1.5565.6 1 55.9966 249.771 56.0643 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 0.0101811001077294 2296.1435546875 766.3885 2296.13354492188 766.385131835938 3 14 1.1.1.5613.2 1 57.1696 621.576 57.2399 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 0.0101811001077294 2296.1435546875 766.3885 2296.13354492188 766.385131835938 3 11 1.1.1.5620.6 1 57.3468 621.576 57.2399 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00183466996531934 2210.09497070313 553.531 2210.0966796875 553.531494140625 4 15 1.1.1.5211.5 1 47.4958 3172.31 47.2439 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.0086038401350379 2224.10375976563 742.3752 2224.1123046875 742.378051757813 3 16 1.1.1.5292.4 1 49.451 223.1304 49.4628 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00292740995064378 2210.09375 737.7052 2210.0966796875 737.706176757813 3 14 1.1.1.5192.8 1 47.0399 58092.42 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Dehydrated(E)@10 -0.00474007986485958 2192.08154296875 731.7011 2192.08618164063 731.702697753906 3 12 1.1.1.5195.4 1 47.1034 285.1471 47.0984 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl+Deamidated(Q)@14 -0.0135543998330832 2225.08325195313 1113.549 2225.09643554688 1113.55554199219 2 14 1.1.1.5195.17 1 47.1159 619.4371 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(Q)@14; Delta:H(4)C(2)(K)@20 0.00663580000400543 2239.11938476563 1120.567 2239.11206054688 1120.56335449219 2 14 1.1.1.5216.6 1 47.6235 508.1537 47.7781 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.769998550415 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@12 -0.0321657992899418 2240.0751953125 747.699 2240.107421875 747.709716796875 3 15 1.1.1.5195.8 0 47.1067 420.6262 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.769998550415 LGEHNIDVLEGNEQFINAAK Dioxidation(F)@15 0.00129874004051089 2242.08740234375 1122.051 2242.08666992188 1122.05053710938 2 15 1.1.1.5195.18 1 47.1175 675.8637 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.8100011348724 LGEHNIDVLEGNEQFINAAK Carboxy(E)@10 -0.0144550995901227 2254.072265625 752.3647 2254.08666992188 752.369445800781 3 14 1.1.1.5197.4 1 47.1562 240.0462 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.8100011348724 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@10 0.00427766982465982 2232.0830078125 745.0349 2232.07861328125 745.033508300781 3 12 1.1.1.5203.13 1 47.3051 562.6218 47.2439 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.2499976158142 LGEHNIDVLEGNEQFINAAK HexNAc(N)@17; reduced acrolein addition +96(K)@20 -0.016499100252986 2509.21728515625 837.413 2509.23364257813 837.418518066406 3 14 1.1.1.5177.12 1 46.6787 533.8629 46.614 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.9699997901917 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@10 0.00464387005195022 2232.0830078125 745.035 2232.07861328125 745.033508300781 3 12 1.1.1.5196.10 1 47.1327 557.43 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.719997882843 LGEHNIDVLEGNEQFINAAK Methyl(E)@13 -0.0353365987539291 2224.07690429688 742.3663 2224.1123046875 742.378051757813 3 14 1.1.1.5195.6 0 47.105 1096.533 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.6899998188019 LGEHNIDVLEGNEQFINAAK Formyl(K)@20 -0.02616379968822 2238.0654296875 1120.04 2238.091796875 1120.05310058594 2 13 1.1.1.5281.4 1 49.1878 459.726 49.2212 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.3600022792816 LGEHNIDVLEGNEQFINAAK Deamidated(Q)@14; acrolein addition +112(K)@20 -0.0599847994744778 2323.0732421875 775.365 2323.13330078125 775.385009765625 3 9 1.1.1.5203.16 1 47.3076 170.4722 47.2924 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.3600022792816 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@12; Deamidated(Q)@14 -0.0127878002822399 2241.07836914063 748.0334 2241.09130859375 748.037719726563 3 13 1.1.1.5204.4 0 47.3244 763.6158 47.2682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 LGEHNIDVLEGNEQFINAAK Ammonia-loss(N)@17; reduced acrolein addition +58(K)@20 -0.0316293984651566 2251.08032226563 751.3674 2251.11206054688 751.377990722656 3 10 1.1.1.5196.11 1 47.1336 228.7977 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 LGEHNIDVLEGNEQFINAAK Dioxidation(F)@15 0.00129874004051089 2242.08740234375 1122.051 2242.08666992188 1122.05053710938 2 11 1.1.1.5205.11 1 47.3604 675.8637 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 24.4100004434586 LGEHNIDVLEGNEQFINAAK HexNAc(N)@17; reduced acrolein addition +96(K)@20 -0.016499100252986 2509.21728515625 837.413 2509.23364257813 837.418518066406 3 10 1.1.1.5170.16 1 46.507 533.8629 46.614 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +62(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.0123616997152567 2895.4892578125 724.8796 2895.50170898438 724.882751464844 4 13 1.1.1.5527.3 1 55.0415 2984.669 55.2137 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +62(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.0123616997152567 2895.4892578125 724.8796 2895.50170898438 724.882751464844 4 16 1.1.1.5534.7 1 55.2223 2984.669 55.2137 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +54(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.00239803991280496 2887.49438476563 963.5054 2887.49682617188 963.506164550781 3 10 1.1.1.5856.4 1 63.0128 330.4538 63.0484 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; acrolein addition +94(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.0171897001564503 2927.5107421875 976.8442 2927.52807617188 976.849975585938 3 10 1.1.1.5877.4 1 63.5197 330.7291 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +54(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 0.0107856001704931 2887.50756835938 963.5098 2887.49682617188 963.506164550781 3 10 1.1.1.5881.5 1 63.6161 200.3711 63.5768 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; acrolein addition +94(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.0214010998606682 2927.50659179688 976.8428 2927.52807617188 976.849975585938 3 10 1.1.1.5854.6 1 62.9717 496.6925 62.8567 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 65.149998664856 LGEHNIDVLEGNEQFINAAKIITH MDA adduct +54(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 0.00291670998558402 2886.51538085938 963.1791 2886.5126953125 963.178161621094 3 9 1.1.1.5891.4 1 63.8504 121.8411 63.7928 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN Delta:H(4)C(2)(K)@20 cleaved N-F@C-term; missed K-I@20 0.00168383005075157 2913.50024414063 729.3823 2913.49853515625 729.381896972656 4 22 1.1.1.5501.3 1 54.386 9150.529 54.457 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN Delta:H(4)C(2)(K)@20 cleaved N-F@C-term; missed K-I@20 0.0175956003367901 2913.51611328125 972.1793 2913.49853515625 972.173461914063 3 22 1.1.1.5502.17 1 54.4232 4070.462 54.457 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN MDA adduct +54(K)@20; Dehydrated(T)@23 cleaved N-F@C-term; missed K-I@20 0.02022759988904 2921.48754882813 974.8364 2921.46728515625 974.829650878906 3 11 1.1.1.5876.2 1 63.4882 224.8481 63.4571 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.2999995350838 LGEHNIDVLEGNEQFINAAKIITHPN MDA adduct +62(K)@20 cleaved N-F@C-term; missed K-I@20 -0.0521422997117043 2947.4306640625 737.8649 2947.48291015625 737.877990722656 4 10 1.1.1.5167.8 1 46.4293 371.47 46.4184 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF acrolein addition +38(K)@20; Hex(N)@26 cleaved F-N@C-term; missed K-I@20 0.0183311998844147 3232.62255859375 809.1629 3232.60400390625 809.158264160156 4 15 1.1.1.5629.3 1 57.575 245.9403 57.5691 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 -0.0251228008419275 3156.59936523438 790.1571 3156.62451171875 790.163391113281 4 16 1.1.1.5636.2 1 57.7477 4300.355 57.9394 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 -0.0251228008419275 3156.59936523438 790.1571 3156.62451171875 790.163391113281 4 17 1.1.1.5643.4 1 57.9202 4330.829 57.9394 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 63.620001077652 LGEHNIDVLEGNEQFINAAKIITHPNF Deamidated(Q)@14; Deamidated(N)@17; reduced HNE(H)@24; Deamidated(N)@26 cleaved F-N@C-term; missed K-I@20 0.032191701233387 3193.65063476563 799.4199 3193.61840820313 799.411865234375 4 11 1.1.1.5504.5 1 54.4637 133.9126 54.457 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN ONE addition +154(K)@20; Delta:H(2)C(2)(H)@24 cleaved N-G@C-term; missed K-I@20 0.0120433000847697 3326.70581054688 832.6837 3326.69360351563 832.6806640625 4 12 1.1.1.5597.5 1 56.7795 1807.353 56.6738 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(H)@24 cleaved N-G@C-term; missed K-I@20 0.00872964039444923 3174.61865234375 794.6619 3174.60986328125 794.659729003906 4 15 1.1.1.5615.2 1 57.2198 1941.998 57.3644 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Formyl(K)@20 cleaved N-G@C-term; missed K-I@20 0.0600568987429142 3174.63232421875 1059.218 3174.57348632813 1059.19836425781 3 16 1.1.1.5617.9 1 57.2818 737.5174 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN ONE addition +154(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@26; Deamidated(N)@28 cleaved N-G@C-term; missed K-I@20 -0.0048166299238801 3328.65649414063 833.1714 3328.66162109375 833.172668457031 4 21 1.1.1.5620.9 1 57.3493 1072.274 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20 cleaved N-G@C-term; missed K-I@20 0.00872964039444923 3174.61865234375 794.6619 3174.60986328125 794.659729003906 4 26 1.1.1.5624.3 1 57.4466 1941.998 57.3644 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(H)@24 cleaved N-G@C-term; missed K-I@20 -0.0292876996099949 3232.62255859375 809.1629 3232.65161132813 809.170166015625 4 16 1.1.1.5629.3 1 57.575 245.9403 57.5691 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20; Deamidated(N)@28 cleaved N-G@C-term; missed K-I@20 -0.000677709991578013 3175.59326171875 794.9056 3175.59375 794.90576171875 4 24 1.1.1.5631.3 1 57.6255 7653.902 57.7686 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.510000705719 LGEHNIDVLEGNEQFINAAKIITHPNFN reduced acrolein addition +58(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@28 cleaved N-G@C-term; missed K-I@20 0.0155311999842525 3231.6357421875 808.9162 3231.6201171875 808.912292480469 4 11 1.1.1.5613.3 1 57.1704 403.4386 57.1905 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20 cleaved N-T@C-term; missed K-I@20 0.0258932001888752 3345.701171875 1116.241 3345.67431640625 1116.23205566406 3 11 1.1.1.5586.15 1 56.5158 931.8188 56.5999 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20; Deamidated(N)@30 cleaved N-T@C-term; missed K-I@20 0.00292677991092205 3346.66088867188 837.6725 3346.658203125 837.671813964844 4 22 1.1.1.5621.6 1 57.3724 989.6315 57.2647 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNT Deamidated(N)@17; reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Deamidated(N)@28 cleaved T-L@C-term; missed K-I@20 -0.00309760007075965 3674.84375 919.7182 3674.84692382813 919.718994140625 4 14 1.1.1.5665.4 1 58.4682 840.5558 58.527 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 72.4500000476837 LGEHNIDVLEGNEQFINAAKIITHPNFNGNT Deamidated(N)@17; hexanoyl addition +98(K)@20; reduced HNE(H)@24 cleaved T-L@C-term; missed K-I@20 -0.0510881990194321 3675.82739257813 919.9641 3675.87841796875 919.976867675781 4 10 1.1.1.5678.7 1 58.7844 694.3433 58.8997 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.3100010156631 LGEHNIDVLEGNEQFINAAKIITHPNFNGNT hexanoyl addition +98(K)@20; reduced HNE(H)@24; Deamidated(N)@28 cleaved T-L@C-term; missed K-I@20 -0.0510881990194321 3675.82739257813 919.9641 3675.87841796875 919.976867675781 4 9 1.1.1.5685.8 1 58.9578 694.3433 58.8997 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Delta:H(4)C(2)(H)@24 missed K-I@20 0.0180964004248381 4502.30859375 901.469 4502.29052734375 901.46533203125 5 32 1.1.1.5810.3 1 61.8831 2186.865 61.8999 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Formyl(K)@20; Methyl(K)@40 missed K-I@20 0.0273298006504774 4516.296875 753.7234 4516.26953125 753.718872070313 6 15 1.1.1.5812.5 1 61.9349 162.3959 61.9533 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20 0.0139966998249292 4516.3203125 904.2713 4516.30615234375 904.268493652344 5 29 1.1.1.5812.9 1 61.9399 689.0464 61.9261 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Delta:H(4)C(2)(H)@24; Deamidated(N)@28 missed K-I@20 0.00759253976866603 4503.2822265625 901.6637 4503.2744140625 901.662170410156 5 29 1.1.1.5818.3 1 62.0845 1027.095 62.103 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Formyl(K)@20; Deamidated(N)@28 missed K-I@20 0.0740431025624275 4503.310546875 1126.835 4503.23779296875 1126.81677246094 4 19 1.1.1.5818.9 1 62.0954 416.4258 62.103 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24; Deamidated(N)@28 missed K-I@20 0.00986182037740946 4489.2685546875 898.861 4489.2587890625 898.859008789063 5 22 1.1.1.5819.7 1 62.1156 462.0368 62.103 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN Deamidated(N)@34; acrolein addition +56(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.069574199616909 5314.75341796875 1063.958 5314.68212890625 1063.94372558594 5 15 1.1.1.6020.3 1 66.6592 418.9648 66.5912 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0177954006940126 5539.8408203125 924.3141 5539.85888671875 924.317077636719 6 27 1.1.1.5781.3 1 61.1592 596.0096 61.1501 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0665649995207787 5573.87646484375 929.9867 5573.81005859375 929.975646972656 6 13 1.1.1.5783.6 1 61.2178 278.3764 61.2714 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00830276031047106 5557.83984375 927.3139 5557.84814453125 927.315307617188 6 33 1.1.1.5800.4 1 61.6273 1874.922 61.6678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0612039007246494 5557.87841796875 1112.583 5557.81494140625 1112.5703125 5 17 1.1.1.5800.6 1 61.6323 825.1429 61.6678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0346826016902924 5575.8603515625 930.3173 5575.82568359375 930.311584472656 6 15 1.1.1.5803.4 1 61.7135 156.7812 61.6932 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00407881010323763 5556.87158203125 927.1525 5556.86767578125 927.15185546875 6 26 1.1.1.5807.7 1 61.8081 4162.484 61.9533 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0290808007121086 5588.865234375 932.4848 5588.83642578125 932.47998046875 6 19 1.1.1.5807.8 1 61.8097 1243.469 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0231158006936312 5572.8642578125 929.818 5572.84130859375 929.814147949219 6 32 1.1.1.5808.3 1 61.8366 33977.53 62.03 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00671618990600109 5543.83935546875 924.9805 5543.83251953125 924.979370117188 6 18 1.1.1.5810.4 1 61.8857 1462.134 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.011914299800992 5556.8525390625 794.8433 5556.8642578125 794.845031738281 7 27 1.1.1.5811.2 1 61.9069 1208.867 61.9533 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00700500002130866 5572.8486328125 797.1285 5572.84130859375 797.12744140625 7 24 1.1.1.5812.6 1 61.9357 8367.232 62.03 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@34; Formyl(K)@40 missed K-I@20; missed K-L@40 0.0193441994488239 5587.84521484375 799.2709 5587.82568359375 799.26806640625 7 18 1.1.1.5812.7 1 61.9365 389.836 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24 missed K-I@20; missed K-L@40 0.0370692983269691 5526.857421875 922.1502 5526.8203125 922.14404296875 6 16 1.1.1.5812.10 1 61.9415 277.5083 61.9533 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0543842017650604 5529.83837890625 922.647 5529.78369140625 922.637939453125 6 19 1.1.1.5812.11 1 61.9432 467.935 61.9533 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Cation:K(D)@35; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.00496994983404875 5949.05908203125 992.5171 5949.06396484375 992.517944335938 6 16 1.1.1.5812.12 1 61.9449 2393.265 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0206704996526241 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 29 1.1.1.5812.13 1 61.9465 1973.538 61.9533 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Dehydrated(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0467119999229908 5572.88818359375 1115.585 5572.84130859375 1115.57556152344 5 31 1.1.1.5812.14 1 61.9482 16654.76 62.0542 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0120117999613285 5588.84814453125 799.4142 5588.83642578125 799.412475585938 7 16 1.1.1.5813.3 1 61.9598 439.3593 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0199455991387367 5582.82666015625 931.4784 5582.8466796875 931.481750488281 6 14 1.1.1.5813.4 1 61.9607 349.536 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@34; Formyl(K)@40 missed K-I@20; missed K-L@40 0.086313396692276 5591.8857421875 932.9882 5591.79931640625 932.973876953125 6 16 1.1.1.5813.5 1 61.9615 804.8527 62.03 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0306759998202324 5600.8876953125 934.4886 5600.857421875 934.483520507813 6 20 1.1.1.5813.6 1 61.9623 1248.545 62.0786 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; reduced acrolein addition +58(K)@20; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0105074001476169 5603.86767578125 934.9852 5603.85693359375 934.983459472656 6 22 1.1.1.5813.7 1 61.9632 711.3349 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0215569995343685 5611.84716796875 936.3151 5611.82568359375 936.311584472656 6 16 1.1.1.5813.8 1 61.964 344.5133 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.0373773984611034 5870.0078125 979.3419 5870.04541015625 979.34814453125 6 13 1.1.1.5813.9 1 61.9648 444.3483 62.0542 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; reduced HNE(H)@24; Phospho(T)@31; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0315316990017891 5949.05908203125 992.5171 5949.02734375 992.511840820313 6 20 1.1.1.5813.10 1 61.9657 2393.265 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0125713003799319 5557.86083984375 927.3174 5557.84814453125 927.315307617188 6 32 1.1.1.5814.6 1 61.9882 7814.39 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; reduced acrolein addition +96(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0426670983433723 5626.8193359375 938.8105 5626.86181640625 938.817565917969 6 20 1.1.1.5814.7 1 61.989 419.0127 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.039088599383831 5631.8701171875 939.6523 5631.83056640625 939.645751953125 6 10 1.1.1.5814.8 1 61.9898 185.101 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] GlnThrGlyGly(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0157197993248701 5872.0009765625 979.6741 5871.9853515625 979.671508789063 6 18 1.1.1.5814.11 1 61.9923 303.1725 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; Hex(N)@28; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00316479988396168 5977.04296875 997.1811 5977.0458984375 997.181579589844 6 13 1.1.1.5814.13 1 61.994 165.4363 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.0284975003451109 5543.83935546875 924.9805 5543.810546875 924.975708007813 6 16 1.1.1.5815.2 1 62.0091 1462.134 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40; Oxidation(P)@44 missed K-I@20; missed K-L@40 0.00535725988447666 5572.8642578125 929.818 5572.85888671875 929.817138671875 6 30 1.1.1.5815.3 1 62.01 34158.22 62.03 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +58(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0191849004477263 5588.865234375 932.4848 5588.84619140625 932.481628417969 6 23 1.1.1.5815.4 1 62.0116 1290.926 62.03 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0281704999506474 5609.837890625 935.9803 5609.81005859375 935.975646972656 6 16 1.1.1.5815.5 1 62.0133 378.5889 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Oxidation(P)@25; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0340334996581078 5622.87646484375 938.1533 5622.841796875 938.147583007813 6 21 1.1.1.5815.6 1 62.015 297.6071 62.03 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; ONE addition +154(K)@20; HexNAc(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.013981300406158 5971.00634765625 996.175 5971.02001953125 996.177307128906 6 13 1.1.1.5815.8 1 62.0183 190.2935 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0125713003799319 5557.86083984375 927.3174 5557.84814453125 927.315307617188 6 26 1.1.1.5816.4 1 62.0392 7814.39 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Oxidation(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0277503002434969 5787.01025390625 965.509 5786.98291015625 965.504455566406 6 17 1.1.1.5816.5 1 62.0417 179.4676 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.066056102514267 5853.00048828125 976.5073 5853.06640625 976.518310546875 6 15 1.1.1.5816.6 1 62.0442 197.6124 62.03 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0326979011297226 5587.89404296875 1118.586 5587.8623046875 1118.57971191406 5 14 1.1.1.5816.8 1 62.0492 533.3652 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0693570971488953 5561.8681640625 927.9853 5561.798828125 927.973754882813 6 13 1.1.1.5817.2 1 62.0585 1160.69 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0676636025309563 5573.87744140625 929.9869 5573.81005859375 929.975646972656 6 17 1.1.1.5817.3 1 62.0602 23805.17 62.03 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; reduced HNE(H)@24; Deamidated(N)@34; Formyl(K)@40 missed K-I@20; missed K-L@40 0.0226450003683567 5799.9892578125 967.6722 5799.966796875 967.66845703125 6 22 1.1.1.5817.5 1 62.0635 213.3769 62.03 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] GlnThrGlyGly(K)@20; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.00485278014093637 5887.98486328125 982.3381 5887.98046875 982.337341308594 6 22 1.1.1.5817.6 1 62.0652 311.0396 62.0542 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Cation:K(D)@35; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.00496994983404875 5949.05908203125 992.5171 5949.06396484375 992.517944335938 6 17 1.1.1.5818.5 1 62.0879 2393.265 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0222610998898745 5572.8486328125 797.1285 5572.826171875 797.125305175781 7 25 1.1.1.5819.4 1 62.1106 8367.232 62.03 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Oxidation(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0289533995091915 5572.88818359375 1115.585 5572.85888671875 1115.5791015625 5 30 1.1.1.5819.9 1 62.1198 16654.76 62.0542 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.052462000399828 5539.85693359375 924.3168 5539.8046875 924.308044433594 6 15 1.1.1.5820.9 1 62.1369 628.6612 62.1768 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dehydrated(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0231158006936312 5572.8642578125 929.818 5572.84130859375 929.814147949219 6 21 1.1.1.5822.8 1 62.1855 34158.22 62.03 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0133036999031901 5557.861328125 927.3175 5557.84814453125 927.315307617188 6 27 1.1.1.5823.4 1 62.214 8435.826 61.9533 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@34; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0134009001776576 5539.84521484375 924.3148 5539.85888671875 924.317077636719 6 33 1.1.1.5828.2 1 62.3341 2422.328 62.5174 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0347045995295048 5573.8447265625 929.9814 5573.81005859375 929.975646972656 6 21 1.1.1.5829.5 1 62.3566 5556.503 62.4686 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0106706004589796 5556.8779296875 927.1536 5556.86767578125 927.15185546875 6 37 1.1.1.5830.4 1 62.3842 77020.05 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.024651600047946 5556.888671875 1112.385 5556.8642578125 1112.38012695313 5 20 1.1.1.5832.5 1 62.4326 51895.8 62.6648 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24 missed K-I@20; missed K-L@40 0.00994743034243584 5528.84619140625 922.4816 5528.83642578125 922.47998046875 6 40 1.1.1.5833.5 1 62.4536 12396.8 62.5174 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0177471004426479 5585.8642578125 931.9846 5585.8466796875 931.981689453125 6 17 1.1.1.5833.6 1 62.4552 1316.857 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Methyl(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0327823981642723 5573.87841796875 1115.783 5573.8466796875 1115.77661132813 5 18 1.1.1.5833.10 1 62.4619 2589.921 62.4929 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24 missed K-I@20; missed K-L@40 0.000431446998845786 5514.82080078125 920.1441 5514.8203125 920.14404296875 6 32 1.1.1.5834.5 1 62.4778 5273.261 62.4929 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(D)@35 missed K-I@20; missed K-L@40 0.0239806994795799 5514.84326171875 1103.976 5514.8203125 1103.97143554688 5 31 1.1.1.5834.7 1 62.4811 2487.454 62.4929 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20 missed K-I@20; missed K-L@40 0.0208422001451254 5528.85888671875 1106.779 5528.83642578125 1106.77453613281 5 34 1.1.1.5834.8 1 62.4828 5841.29 62.5174 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0459164008498192 5541.86376953125 1109.38 5541.8203125 1109.37133789063 5 21 1.1.1.5834.9 1 62.4853 6095.405 62.542 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00298450002446771 5542.85498046875 924.8164 5542.85205078125 924.81591796875 6 35 1.1.1.5835.6 1 62.4999 24894.77 62.542 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31 missed K-I@20; missed K-L@40 0.0458288006484509 5544.85595703125 925.1499 5544.81005859375 925.142272949219 6 17 1.1.1.5835.7 1 62.5007 10214.29 62.542 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +38(K)@20; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0159114003181458 5601.8359375 934.6466 5601.8203125 934.643981933594 6 13 1.1.1.5835.8 1 62.5016 742.9849 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; acrolein addition +56(K)@20; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.00507749989628792 5611.83056640625 936.3124 5611.82568359375 936.311584472656 6 13 1.1.1.5835.9 1 62.5024 827.6475 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0110074002295732 5514.8095703125 788.8372 5514.8203125 788.838806152344 7 22 1.1.1.5836.3 1 62.5219 844.7164 62.4929 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0217409990727901 5556.84228515625 794.8419 5556.8642578125 794.845031738281 7 28 1.1.1.5836.4 1 62.5227 22947.23 62.6406 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00572325987741351 5572.84716796875 797.1283 5572.84130859375 797.12744140625 7 24 1.1.1.5836.5 1 62.5236 1955.9 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Dethiomethyl(M)@37 missed K-I@20; missed K-L@40 0.0133183002471924 5528.84619140625 922.4816 5528.8330078125 922.479431152344 6 19 1.1.1.5836.7 1 62.5252 12396.8 62.5174 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(Q)@14; Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0330305993556976 5541.85302734375 924.6495 5541.8203125 924.643981933594 6 22 1.1.1.5836.8 1 62.5261 13628.85 62.542 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0492480993270874 5557.8642578125 927.318 5557.81494140625 927.309814453125 6 14 1.1.1.5836.9 1 62.5269 68903.59 62.6648 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0190875008702278 5572.8603515625 929.8173 5572.84130859375 929.814147949219 6 20 1.1.1.5836.10 1 62.5277 7509.361 62.5911 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0190875008702278 5572.8603515625 929.8173 5572.84130859375 929.814147949219 6 25 1.1.1.5836.11 1 62.5286 7509.361 62.5911 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0356952995061874 5596.82666015625 933.8117 5596.8623046875 933.817687988281 6 20 1.1.1.5836.13 1 62.5302 869.8125 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dioxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.00124848005361855 5644.84912109375 941.8154 5644.84716796875 941.815124511719 6 14 1.1.1.5836.14 1 62.5311 412.995 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; reduced HNE(H)@24; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 -0.0952546969056129 5870.9814453125 979.5042 5871.07666015625 979.520080566406 6 14 1.1.1.5836.16 1 62.5327 445.3244 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Hex(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0132791996002197 5933.05419921875 989.8496 5933.041015625 989.847412109375 6 15 1.1.1.5836.19 1 62.5353 1259.844 62.5911 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0171354003250599 5542.8349609375 792.8408 5542.85205078125 792.84326171875 7 33 1.1.1.5837.2 1 62.5456 4385.15 62.542 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00224775006063282 5556.86962890625 927.1522 5556.86767578125 927.15185546875 6 40 1.1.1.5837.3 1 62.5465 97373.83 62.6648 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(Q)@14; Deamidated(N)@17; reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00783231016248465 5588.85400390625 932.4829 5588.84619140625 932.481628417969 6 25 1.1.1.5837.4 1 62.5473 2009.341 62.5911 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dioxidation(F)@15; MDA adduct +54(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0581407994031906 5773.02587890625 963.1782 5772.96728515625 963.168518066406 6 26 1.1.1.5837.7 1 62.5498 406.5121 62.5911 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; reduced HNE(H)@24; Deamidated(N)@34; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0133058996871114 5777.97509765625 964.0031 5777.96142578125 964.000854492188 6 17 1.1.1.5837.8 1 62.5506 387.5629 62.5665 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamidomethyl(E)@13; reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0151068000122905 5802.01513671875 968.0098 5802.0302734375 968.012329101563 6 19 1.1.1.5837.10 1 62.5523 249.3938 62.6406 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0675411969423294 5855.0146484375 976.843 5855.08203125 976.854248046875 6 18 1.1.1.5837.12 1 62.5548 842.2263 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0206704996526241 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 27 1.1.1.5837.15 1 62.5598 53190.38 62.6648 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +58(K)@20; Deamidated(N)@26; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0209768004715443 5588.86865234375 1118.781 5588.84619140625 1118.77648925781 5 21 1.1.1.5837.16 1 62.5615 1154.995 62.5911 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0389414988458157 5591.87451171875 932.9864 5591.8359375 932.979919433594 6 25 1.1.1.5838.2 1 62.5711 1139.745 62.6887 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0105074001476169 5603.86767578125 934.9852 5603.85693359375 934.983459472656 6 24 1.1.1.5838.3 1 62.5728 864.959 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00278501003049314 5630.880859375 939.4874 5630.88330078125 939.48779296875 6 24 1.1.1.5838.4 1 62.5744 754.066 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Deamidated(N)@26; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0858640968799591 5841.96435546875 974.668 5842.05029296875 974.682312011719 6 27 1.1.1.5838.6 1 62.5786 407.6405 62.5665 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Hex(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.000542310997843742 5969.041015625 995.8474 5969.041015625 995.847412109375 6 17 1.1.1.5838.7 1 62.5811 385.2956 62.6406 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0352369993925095 5571.87890625 1115.383 5571.841796875 1115.37573242188 5 19 1.1.1.5838.8 1 62.5836 2687.15 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; reduced acrolein addition +58(K)@20; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0207359008491039 5621.86767578125 937.9852 5621.8466796875 937.981689453125 6 13 1.1.1.5839.2 1 62.5954 548.1282 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0511070005595684 5639.8876953125 940.9885 5639.8359375 940.979919433594 6 16 1.1.1.5839.3 1 62.5979 373.3964 62.5911 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Hex(N)@28; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0539823994040489 5820.98486328125 971.1714 5820.9306640625 971.162414550781 6 17 1.1.1.5839.4 1 62.6004 330.4259 62.6406 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; HexNAc(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0211309995502234 5830.00634765625 972.675 5829.9853515625 972.671508789063 6 22 1.1.1.5839.5 1 62.6029 273.6697 62.713 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24 missed K-I@20; missed K-L@40 0.0278165992349386 5526.84814453125 1106.377 5526.8203125 1106.37133789063 5 14 1.1.1.5839.7 1 62.608 916.2252 62.5911 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0206704996526241 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 51 1.1.1.5839.8 1 62.6105 53190.38 62.6648 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0325408987700939 5575.8583984375 797.5585 5575.82568359375 797.553833007813 7 17 1.1.1.5840.2 1 62.635 1230.274 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0350688993930817 5580.83251953125 931.146 5580.86767578125 931.15185546875 6 25 1.1.1.5841.3 1 62.6514 1526.508 62.6406 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0244181994348764 5542.87841796875 1109.583 5542.85205078125 1109.57763671875 5 24 1.1.1.5841.4 1 62.6555 12338.41 62.542 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Pro->pyro-Glu(P)@25; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0463328994810581 5528.84619140625 922.4816 5528.7998046875 922.473937988281 6 27 1.1.1.5842.3 1 62.672 12396.8 62.5174 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00298450002446771 5542.85498046875 924.8164 5542.85205078125 924.81591796875 6 37 1.1.1.5842.4 1 62.6745 24894.77 62.542 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00103459996171296 5598.8427734375 934.1477 5598.841796875 934.147583007813 6 26 1.1.1.5842.5 1 62.677 801.2692 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Phospho(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00523544987663627 5609.7880859375 935.972 5609.783203125 935.971130371094 6 22 1.1.1.5842.6 1 62.6804 1060.876 62.6887 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0244181994348764 5542.87841796875 1109.583 5542.85205078125 1109.57763671875 5 36 1.1.1.5842.7 1 62.6837 12338.41 62.542 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0251118000596762 5556.84228515625 794.8419 5556.86767578125 794.845520019531 7 33 1.1.1.5843.2 1 62.6951 22947.23 62.6406 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0386333018541336 5556.86962890625 927.1522 5556.8310546875 927.145812988281 6 20 1.1.1.5843.4 1 62.7035 97373.83 62.6648 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Oxidation(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00425862008705735 5572.86328125 929.8178 5572.85888671875 929.817138671875 6 33 1.1.1.5843.5 1 62.7076 7192.41 62.713 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00486877001821995 5572.84619140625 797.1282 5572.84130859375 797.12744140625 7 27 1.1.1.5844.2 1 62.7186 1863.125 62.737 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Met->Hcy(M)@37; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0554021000862122 5524.8603515625 921.8173 5524.8046875 921.80810546875 6 19 1.1.1.5844.3 1 62.7219 784.2721 62.737 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00224775006063282 5556.86962890625 927.1522 5556.86767578125 927.15185546875 6 45 1.1.1.5844.4 1 62.7253 97373.83 62.6648 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0426495000720024 5585.88916015625 931.9888 5585.8466796875 931.981689453125 6 27 1.1.1.5844.5 1 62.7286 1875.451 62.761 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0675411969423294 5855.0146484375 976.843 5855.08203125 976.854248046875 6 18 1.1.1.5844.6 1 62.7319 842.2263 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0386333018541336 5556.86962890625 927.1522 5556.8310546875 927.145812988281 6 20 1.1.1.5845.2 1 62.7409 97373.83 62.6648 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0598217993974686 5563.8642578125 928.318 5563.8046875 928.308044433594 6 14 1.1.1.5845.3 1 62.7434 1750.468 62.713 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0302696004509926 5604.8369140625 935.1468 5604.86767578125 935.15185546875 6 24 1.1.1.5845.4 1 62.7459 1047.61 62.713 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dioxidation(F)@15; acrolein addition +56(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.000258615997154266 5774.9833984375 963.5045 5774.98291015625 963.504455566406 6 27 1.1.1.5845.5 1 62.7484 621.7182 62.713 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0206704996526241 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 28 1.1.1.5845.7 1 62.7534 56963.76 62.8806 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0206704996526241 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 53 1.1.1.5846.2 1 62.7714 56963.76 62.8806 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0248610004782677 5571.86865234375 1115.381 5571.841796875 1115.37573242188 5 27 1.1.1.5846.3 1 62.7798 2819.49 62.761 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0243427995592356 5596.837890625 933.8136 5596.8623046875 933.817687988281 6 28 1.1.1.5847.2 1 62.7913 809.601 62.737 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.000512126018293202 5616.86767578125 937.1519 5616.86767578125 937.15185546875 6 23 1.1.1.5847.3 1 62.7954 522.3462 62.6887 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0100908000022173 5627.8837890625 938.9879 5627.8935546875 938.989501953125 6 25 1.1.1.5847.4 1 62.7996 503.37 62.8089 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Dethiomethyl(M)@37; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0363260991871357 5578.8330078125 930.8128 5578.86962890625 930.818908691406 6 23 1.1.1.5848.3 1 62.8177 1949.374 62.8089 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; Delta:H(2)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0284109991043806 5581.84326171875 931.3145 5581.81494140625 931.309814453125 6 14 1.1.1.5848.4 1 62.821 1335.768 62.8328 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0641267001628876 5871.0126953125 979.5094 5871.07666015625 979.520080566406 6 17 1.1.1.5848.5 1 62.8244 280.3658 62.8089 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Lys->Allysine(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.047392699867487 5527.84912109375 922.3154 5527.80126953125 922.307495117188 6 21 1.1.1.5849.2 1 62.8383 1946.971 62.8806 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00298450002446771 5542.85498046875 924.8164 5542.85205078125 924.81591796875 6 35 1.1.1.5849.3 1 62.8416 7909.285 62.8806 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +58(K)@20; Deamidated(N)@26; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00526882987469435 5588.85107421875 932.4825 5588.84619140625 932.481628417969 6 24 1.1.1.5849.4 1 62.8449 1938.641 62.9046 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0225871000438929 5542.87353515625 1109.582 5542.85205078125 1109.57763671875 5 32 1.1.1.5849.6 1 62.8516 4087.313 62.8567 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.021313700824976 5556.8427734375 794.842 5556.8642578125 794.845031738281 7 30 1.1.1.5850.4 1 62.8656 21677.55 62.8567 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00812823045998812 5541.828125 924.6453 5541.8203125 924.643981933594 6 29 1.1.1.5850.5 1 62.8681 5677.213 62.8806 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0176225993782282 5572.85888671875 929.8171 5572.84130859375 929.814147949219 6 27 1.1.1.5850.6 1 62.8706 7668.648 62.9046 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; Oxidation(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00286046997644007 5599.82861328125 934.312 5599.82568359375 934.311584472656 6 25 1.1.1.5850.7 1 62.8731 931.3665 62.8806 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00690753012895584 5556.8603515625 927.1507 5556.86767578125 927.15185546875 6 46 1.1.1.5851.2 1 62.8879 105460.2 62.8567 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0433818995952606 5585.8896484375 931.9889 5585.8466796875 931.981689453125 6 25 1.1.1.5851.3 1 62.8937 2216.157 62.8806 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0273292008787394 5586.9033203125 1118.388 5586.8779296875 1118.38293457031 5 21 1.1.1.5851.4 1 62.8995 995.8969 62.8806 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00871398020535707 5572.85009765625 797.1287 5572.84130859375 797.12744140625 7 28 1.1.1.5853.2 1 62.9339 1749.626 62.9046 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0532984994351864 5555.8525390625 926.9827 5555.79931640625 926.973876953125 6 14 1.1.1.5853.3 1 62.9373 52817.96 62.9046 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0206704996526241 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 53 1.1.1.5853.6 1 62.9473 56963.76 62.8806 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0308146998286247 5573.85302734375 797.272 5573.82177734375 797.267578125 7 23 1.1.1.5854.2 1 62.9583 1712.803 62.8806 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.028379300609231 5556.859375 927.1505 5556.8310546875 927.145812988281 6 23 1.1.1.5854.3 1 62.9616 98551.47 63.0006 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0625182017683983 5561.87255859375 927.986 5561.81005859375 927.975646972656 6 23 1.1.1.5854.4 1 62.965 4770.719 62.9046 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0176225993782282 5572.85888671875 929.8171 5572.84130859375 929.814147949219 6 23 1.1.1.5854.5 1 62.9683 7668.648 62.9046 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0843440964818001 5579.87255859375 930.986 5579.7880859375 930.971984863281 6 14 1.1.1.5855.4 1 62.9863 1741.832 62.9046 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0364576987922192 5571.87890625 1115.383 5571.841796875 1115.37573242188 5 18 1.1.1.5855.7 1 62.9955 2853.647 62.8806 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Lys->Allysine(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0349415987730026 5527.8359375 922.3133 5527.80126953125 922.307495117188 6 19 1.1.1.5856.2 1 63.0061 1568.917 63.0484 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0229963008314371 5571.86474609375 929.6514 5571.841796875 929.647583007813 6 24 1.1.1.5856.3 1 63.0094 3760.312 63.0484 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0238771997392178 5556.84033203125 794.8416 5556.8642578125 794.845031738281 7 27 1.1.1.5857.2 1 63.0308 20349.79 63.0245 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.034570399671793 5541.8515625 924.6492 5541.81689453125 924.643432617188 6 23 1.1.1.5857.3 1 63.035 6468.739 63.0963 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00497986981645226 5587.85693359375 932.3168 5587.8623046875 932.317626953125 6 21 1.1.1.5857.4 1 63.0392 2173.966 63.1442 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0385765992105007 5543.87109375 924.9858 5543.83251953125 924.979370117188 6 27 1.1.1.5858.2 1 63.0547 4846.142 63.0484 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00800617039203644 5556.859375 927.1505 5556.86767578125 927.15185546875 6 49 1.1.1.5858.3 1 63.0589 98551.47 63.0006 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00639976980164647 5584.86865234375 931.8187 5584.8623046875 931.817687988281 6 23 1.1.1.5858.4 1 63.0631 2214.348 63.0245 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Oxidation(D)@35; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.000135914000566117 5572.85888671875 929.8171 5572.85888671875 929.817138671875 6 36 1.1.1.5859.3 1 63.0854 7601.667 63.1682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Dehydrated(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0337092988193035 5541.85400390625 1109.378 5541.8203125 1109.37133789063 5 16 1.1.1.5860.5 1 63.1084 3078.237 63.0484 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0206704996526241 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 51 1.1.1.5860.6 1 63.1117 48090.2 63.0245 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00562993017956614 5586.87353515625 1118.382 5586.8779296875 1118.38293457031 5 22 1.1.1.5860.7 1 63.1151 1050.693 63.1682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0209806002676487 5542.8310546875 792.8403 5542.85205078125 792.84326171875 7 27 1.1.1.5861.2 1 63.1264 1225.499 63.0484 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0311996005475521 5541.8515625 924.6492 5541.8203125 924.643981933594 6 29 1.1.1.5861.3 1 63.1306 6468.739 63.0963 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0154480999335647 5555.85107421875 926.9825 5555.8359375 926.979919433594 6 21 1.1.1.5861.4 1 63.1347 46156.56 63.0723 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; Dethiomethyl(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0224968008697033 5574.85205078125 930.1493 5574.87451171875 930.153076171875 6 22 1.1.1.5861.5 1 63.1389 4075.444 63.1682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.0340162999927998 5571.87353515625 1115.382 5571.841796875 1115.37573242188 5 19 1.1.1.5862.4 1 63.1631 2654.998 63.1682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0327467992901802 5525.8759765625 921.9866 5525.84326171875 921.981140136719 6 21 1.1.1.5863.2 1 63.1737 1061.815 63.1442 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00562993017956614 5586.87353515625 1118.382 5586.8779296875 1118.38293457031 5 18 1.1.1.5863.5 1 63.1837 1050.693 63.1682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0234500002115965 5556.8408203125 794.8417 5556.8642578125 794.845031738281 7 28 1.1.1.5864.2 1 63.1975 18046.04 63.2159 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0454985983669758 5540.833984375 924.4796 5540.78857421875 924.472045898438 6 16 1.1.1.5864.3 1 63.2008 4848.77 63.2159 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0171246007084847 5580.85009765625 931.149 5580.86767578125 931.15185546875 6 27 1.1.1.5864.4 1 63.2042 1372.759 63.1442 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00092582602519542 5596.86328125 933.8178 5596.8623046875 933.817687988281 6 25 1.1.1.5864.5 1 63.2075 881.7111 63.1682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00800617039203644 5556.859375 927.1505 5556.86767578125 927.15185546875 6 47 1.1.1.5865.2 1 63.2198 98656.12 63.0006 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(P)@25; Deamidated(N)@26; Oxidation(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0738708004355431 5561.8837890625 927.9879 5561.81005859375 927.975646972656 6 23 1.1.1.5865.3 1 63.2223 3914.792 63.2399 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0433818995952606 5585.8896484375 931.9889 5585.8466796875 931.981689453125 6 21 1.1.1.5865.4 1 63.2248 2213.034 63.1682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0393294990062714 5589.859375 932.6505 5589.8203125 932.643981933594 6 16 1.1.1.5865.5 1 63.2273 1648.678 63.1442 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0202948004007339 5608.841796875 935.8143 5608.8623046875 935.817687988281 6 26 1.1.1.5865.7 1 63.2323 948.1352 63.1442 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0206704996526241 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 29 1.1.1.5865.8 1 63.2348 43696.9 63.2159 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0303873997181654 5573.8525390625 797.2719 5573.82177734375 797.267578125 7 24 1.1.1.5867.2 1 63.2698 1335.378 63.2886 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Oxidation(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.000135914000566117 5572.85888671875 929.8171 5572.85888671875 929.817138671875 6 37 1.1.1.5867.3 1 63.2731 7601.667 63.1682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0206704996526241 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 50 1.1.1.5867.6 1 63.2831 43696.9 63.2159 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00833574961870909 5541.82861328125 792.6971 5541.8203125 792.695861816406 7 25 1.1.1.5868.2 1 63.299 1175.329 63.1921 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0282699000090361 5541.8486328125 924.6487 5541.8203125 924.643981933594 6 24 1.1.1.5868.3 1 63.3074 6642.91 63.1921 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0352369993925095 5571.87890625 1115.383 5571.841796875 1115.37573242188 5 22 1.1.1.5869.4 1 63.3319 1821.678 63.3131 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0294780004769564 5556.8603515625 927.1507 5556.8310546875 927.145812988281 6 24 1.1.1.5870.3 1 63.3434 70208.74 63.361 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00673888996243477 5587.86865234375 932.3187 5587.8623046875 932.317626953125 6 23 1.1.1.5870.4 1 63.3459 1744.087 63.337 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0217409990727901 5556.84228515625 794.8419 5556.8642578125 794.845031738281 7 30 1.1.1.5871.2 1 63.3664 14283.94 63.337 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0144341001287103 5540.84716796875 924.4818 5540.8330078125 924.479431152344 6 21 1.1.1.5871.4 1 63.3731 4727.501 63.4088 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0345483012497425 5543.8671875 924.9851 5543.83251953125 924.979370117188 6 22 1.1.1.5871.5 1 63.3764 4588.525 63.1442 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@30; Delta:H(2)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0547781996428967 5581.86962890625 931.3189 5581.81494140625 931.309814453125 6 15 1.1.1.5871.6 1 63.3798 1489.703 63.1202 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00353670003823936 5556.8603515625 927.1507 5556.8642578125 927.151306152344 6 42 1.1.1.5872.2 1 63.3912 70208.74 63.361 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0155009999871254 5557.86376953125 927.3179 5557.84814453125 927.315307617188 6 35 1.1.1.5872.3 1 63.3954 52143.23 63.361 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0233625005930662 5571.865234375 929.6515 5571.841796875 929.647583007813 6 27 1.1.1.5872.4 1 63.3995 3311.265 63.3848 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dioxidation(K)@20; Oxidation(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00769688002765179 5576.82861328125 930.4787 5576.82080078125 930.477416992188 6 24 1.1.1.5873.3 1 63.4159 1782.106 63.4088 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Deamidated(N)@28; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0244204998016357 5606.8115234375 935.4758 5606.83544921875 935.479858398438 6 25 1.1.1.5873.5 1 63.4209 665.5537 63.2643 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0555411987006664 5585.9033203125 1118.188 5585.8466796875 1118.17651367188 5 15 1.1.1.5873.7 1 63.4275 876.3307 63.1682 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0206704996526241 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 51 1.1.1.5874.4 1 63.4515 37056.88 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0212846994400024 5572.8623046875 929.8177 5572.84130859375 929.814147949219 6 25 1.1.1.5875.3 1 63.4659 4495.205 63.481 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.04704400151968 5585.8935546875 931.9895 5585.8466796875 931.981689453125 6 22 1.1.1.5875.4 1 63.4693 1997.008 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0413126982748508 5599.86669921875 934.3184 5599.82568359375 934.311584472656 6 20 1.1.1.5875.5 1 63.4726 829.6232 63.5289 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(Q)@14; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0765699967741966 5540.86376953125 1109.18 5540.78857421875 1109.1650390625 5 15 1.1.1.5875.6 1 63.476 2355.098 63.481 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Delta:H(2)C(2)(H)@24; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0464703999459744 5571.87890625 1115.383 5571.83056640625 1115.37341308594 5 23 1.1.1.5876.4 1 63.4999 1893.974 63.2399 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24 missed K-I@20; missed K-L@40 0.0345057994127274 5526.85498046875 922.1498 5526.8203125 922.14404296875 6 20 1.1.1.5877.2 1 63.5113 927.9354 63.5289 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.028745599091053 5556.85986328125 927.1506 5556.8310546875 927.145812988281 6 22 1.1.1.5877.3 1 63.5155 71592.7 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0234500002115965 5556.8408203125 794.8417 5556.8642578125 794.845031738281 7 30 1.1.1.5878.2 1 63.5352 15915.57 63.481 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0118706002831459 5540.8447265625 924.4814 5540.8330078125 924.479431152344 6 20 1.1.1.5878.3 1 63.5394 5060.047 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.028745599091053 5556.85986328125 927.1506 5556.8310546875 927.145812988281 6 23 1.1.1.5878.4 1 63.5436 71592.7 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00314882001839578 5587.85888671875 932.3171 5587.8623046875 932.317626953125 6 23 1.1.1.5878.5 1 63.5477 1501.048 63.5289 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00763995992019773 5556.85986328125 927.1506 5556.86767578125 927.15185546875 6 46 1.1.1.5879.2 1 63.56 71592.7 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0160383004695177 5571.8583984375 929.6503 5571.841796875 929.647583007813 6 24 1.1.1.5879.3 1 63.5658 3060.067 63.5289 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0216780994087458 5541.841796875 924.6476 5541.8203125 924.643981933594 6 26 1.1.1.5880.4 1 63.5864 5837.001 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0712796002626419 5579.87060546875 930.9857 5579.79931640625 930.973876953125 6 15 1.1.1.5880.5 1 63.5889 1415.74 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.00235347007401288 5595.828125 933.6453 5595.83056640625 933.645751953125 6 16 1.1.1.5880.6 1 63.5922 582.2426 63.5528 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@26; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0777741000056267 5583.908203125 1117.789 5583.83056640625 1117.7734375 5 18 1.1.1.5880.7 1 63.5955 583.2673 63.5289 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(H)@24; Oxidation(P)@25; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0768005028367043 5561.88671875 927.9884 5561.81005859375 927.975646972656 6 18 1.1.1.5881.3 1 63.6094 3208.08 63.505 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0547403991222382 5610.8232421875 936.1445 5610.8779296875 936.153625488281 6 24 1.1.1.5881.4 1 63.6127 642.2865 63.6248 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0206704996526241 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 44 1.1.1.5881.6 1 63.6194 28212.55 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00700500002130866 5572.8486328125 797.1285 5572.84130859375 797.12744140625 7 26 1.1.1.5882.2 1 63.6303 927.4019 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; MDA adduct +62(K)@40; Dehydrated(S)@42 missed K-I@20; missed K-L@40 0.0106645999476314 5572.85205078125 929.8159 5572.84130859375 929.814147949219 6 32 1.1.1.5882.3 1 63.6337 3909.212 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0160492993891239 5598.857421875 934.1502 5598.841796875 934.147583007813 6 25 1.1.1.5882.4 1 63.637 880.3046 63.6488 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0269313994795084 5626.88232421875 938.821 5626.9091796875 938.825500488281 6 22 1.1.1.5882.5 1 63.6404 357.0354 63.5528 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0140707995742559 5539.84326171875 1108.976 5539.85888671875 1108.97900390625 5 25 1.1.1.5882.6 1 63.6437 1577.478 63.6488 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0181185007095337 5584.88037109375 931.8207 5584.8623046875 931.817687988281 6 27 1.1.1.5883.2 1 63.6551 1645.899 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dehydrated(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0351152010262012 5572.87841796875 1115.583 5572.84130859375 1115.57556152344 5 19 1.1.1.5883.5 1 63.6677 2039.358 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0713355019688606 5541.84423828125 792.6993 5541.7724609375 792.689086914063 7 18 1.1.1.5884.2 1 63.6775 922.0806 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Met->Hcy(M)@37; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0502697005867958 5525.83935546875 921.9805 5525.7890625 921.972106933594 6 18 1.1.1.5884.4 1 63.6825 584.7615 63.6488 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0686398968100548 5855.01318359375 976.8428 5855.08203125 976.854248046875 6 19 1.1.1.5884.6 1 63.6883 603.05 63.7207 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0234500002115965 5556.8408203125 794.8417 5556.8642578125 794.845031738281 7 31 1.1.1.5885.2 1 63.7031 15993.74 63.481 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0317475982010365 5603.888671875 934.9887 5603.85693359375 934.983459472656 6 24 1.1.1.5885.4 1 63.7115 462.3007 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.022571999579668 5620.88525390625 937.8215 5620.8623046875 937.817687988281 6 25 1.1.1.5885.5 1 63.7156 306.5149 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00763995992019773 5556.85986328125 927.1506 5556.86767578125 927.15185546875 6 45 1.1.1.5886.2 1 63.727 57171.79 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0184576995670795 5587.88037109375 932.3207 5587.8623046875 932.317626953125 6 22 1.1.1.5886.3 1 63.7312 1418.1 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0261084996163845 5586.9033203125 1118.388 5586.8779296875 1118.38293457031 5 18 1.1.1.5886.4 1 63.7354 684.9849 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0563277006149292 5597.90380859375 1120.588 5597.8466796875 1120.57653808594 5 12 1.1.1.5886.5 1 63.7396 414.5611 63.7207 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0282699000090361 5541.8486328125 924.6487 5541.8203125 924.643981933594 6 30 1.1.1.5887.2 1 63.751 5128.098 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(T)@31; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0203986000269651 5578.83154296875 930.8125 5578.85205078125 930.81591796875 6 19 1.1.1.5887.4 1 63.7594 1139.288 63.7207 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Lys->Allysine(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0572804994881153 5527.8583984375 922.317 5527.80126953125 922.307495117188 6 22 1.1.1.5888.3 1 63.7775 1024.992 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@26; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0554120987653732 5573.87744140625 929.9868 5573.82177734375 929.977600097656 6 22 1.1.1.5888.4 1 63.7808 3366.052 63.6488 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0206704996526241 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 40 1.1.1.5888.6 1 63.7875 28256.94 63.6488 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00700500002130866 5572.8486328125 797.1285 5572.84130859375 797.12744140625 7 27 1.1.1.5889.2 1 63.7991 927.4019 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Methyl(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0345483012497425 5543.8671875 924.9851 5543.83251953125 924.979370117188 6 19 1.1.1.5889.3 1 63.8032 3385.979 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0106645999476314 5572.85205078125 929.8159 5572.84130859375 929.814147949219 6 23 1.1.1.5889.4 1 63.8074 3909.212 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0655836015939713 5540.853515625 1109.178 5540.78857421875 1109.1650390625 5 15 1.1.1.5889.5 1 63.8116 2103.663 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.041550800204277 5585.8876953125 931.9886 5585.8466796875 931.981689453125 6 23 1.1.1.5890.3 1 63.8272 1518.566 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; reduced HNE(H)@24; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00461598020046949 5794.99267578125 966.8394 5794.98779296875 966.838623046875 6 29 1.1.1.5890.4 1 63.8314 506.9793 64.0113 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0187045000493526 5609.791015625 935.9725 5609.81005859375 935.975646972656 6 20 1.1.1.5891.2 1 63.8454 602.2854 63.7207 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0712198987603188 5610.806640625 936.1417 5610.8779296875 936.153625488281 6 22 1.1.1.5891.3 1 63.8479 495.9413 63.7928 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0686398968100548 5855.01318359375 976.8428 5855.08203125 976.854248046875 6 20 1.1.1.5891.5 1 63.8529 603.05 63.7207 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0456129983067513 5571.888671875 1115.385 5571.841796875 1115.37573242188 5 18 1.1.1.5891.6 1 63.8563 887.7186 63.8407 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0401149988174438 5626.869140625 938.8188 5626.9091796875 938.825500488281 6 24 1.1.1.5892.4 1 63.8795 285.3149 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; Carbamidomethyl(T)@23; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0218857005238533 5856.0185546875 977.0104 5856.041015625 977.014099121094 6 27 1.1.1.5892.5 1 63.8836 429.7091 63.8167 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00177702005021274 5577.818359375 797.8385 5577.8203125 797.838745117188 7 21 1.1.1.5893.2 1 63.8959 493.8793 63.8887 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00763995992019773 5556.85986328125 927.1506 5556.86767578125 927.15185546875 6 47 1.1.1.5893.4 1 63.9076 57880.84 63.6488 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0225955005735159 5556.841796875 794.8418 5556.8642578125 794.845031738281 7 31 1.1.1.5894.3 1 63.9215 6960.576 63.8887 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0255708005279303 5598.8671875 934.1518 5598.841796875 934.147583007813 6 22 1.1.1.5894.4 1 63.924 706.3937 63.915 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0490030981600285 5599.87451171875 934.3197 5599.82568359375 934.311584472656 6 19 1.1.1.5894.5 1 63.9265 626.7781 63.8887 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Met->Hcy(M)@37; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0623546987771988 5525.85107421875 921.9825 5525.7890625 921.972106933594 6 18 1.1.1.5895.2 1 63.9439 425.9739 63.8407 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(P)@25; Deamidated(N)@34; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.060293298214674 5579.85986328125 930.9839 5579.79931640625 930.973876953125 6 13 1.1.1.5895.3 1 63.9464 1083.325 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0200600996613503 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 46 1.1.1.5895.6 1 63.9548 26211.87 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0458999983966351 5584.90869140625 1117.989 5584.8623046875 1117.97973632813 5 20 1.1.1.5895.7 1 63.9581 333.0714 63.9391 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00138984003569931 5571.84326171875 929.6478 5571.841796875 929.647583007813 6 24 1.1.1.5896.3 1 63.9821 1791.079 63.8407 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0308062005788088 5572.8720703125 929.8193 5572.84130859375 929.814147949219 6 28 1.1.1.5897.2 1 63.992 2843.506 63.7446 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0195834003388882 5584.8818359375 931.8209 5584.8623046875 931.817687988281 6 21 1.1.1.5897.3 1 63.9945 1325.488 63.7446 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0180862005800009 5588.8642578125 932.4846 5588.84619140625 932.481628417969 6 21 1.1.1.5897.4 1 63.997 688.8521 64.0353 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0692536979913712 5871.00732421875 979.5085 5871.07666015625 979.520080566406 6 15 1.1.1.5897.5 1 63.9995 213.5652 63.7446 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.06387709826231 5539.8681640625 1108.981 5539.8046875 1108.96813964844 5 13 1.1.1.5897.7 1 64.0062 958.1711 64.0595 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0297347009181976 5541.85009765625 924.6489 5541.8203125 924.643981933594 6 24 1.1.1.5898.3 1 64.0185 2858.674 64.0353 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0356808006763458 5609.810546875 935.9757 5609.8466796875 935.981689453125 6 23 1.1.1.5898.4 1 64.021 448.2105 64.0595 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0676636025309563 5573.87744140625 929.9869 5573.81005859375 929.975646972656 6 18 1.1.1.5899.4 1 64.0444 1789.788 64.0837 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; reduced HNE(H)@24; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00461598020046949 5794.99267578125 966.8394 5794.98779296875 966.838623046875 6 25 1.1.1.5899.6 1 64.0494 533.6108 64.0353 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; reduced HNE(H)@24; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00461598020046949 5794.99267578125 966.8394 5794.98779296875 966.838623046875 6 27 1.1.1.5899.7 1 64.0519 533.6108 64.0353 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0583060011267662 5572.88330078125 1115.584 5572.826171875 1115.57250976563 5 14 1.1.1.5899.8 1 64.0544 945.8367 64.0595 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00763995992019773 5556.85986328125 927.1506 5556.86767578125 927.15185546875 6 45 1.1.1.5900.2 1 64.0653 37843.81 63.8167 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(N)@17; acrolein addition +94(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0060601900331676 5797.00927734375 967.1755 5797.00390625 967.174560546875 6 25 1.1.1.5900.3 1 64.0686 340.8847 64.0353 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24 missed K-I@20; missed K-L@40 0.0729828029870987 5526.8935546875 1106.386 5526.8203125 1106.37133789063 5 15 1.1.1.5900.6 1 64.0787 263.7861 63.915 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00232350011356175 5540.83056640625 792.5545 5540.8330078125 792.554809570313 7 20 1.1.1.5901.2 1 64.0902 484.0502 64.0837 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(D)@33; Methyl(K)@40 missed K-I@20; missed K-L@40 0.000792147999163717 5528.8369140625 922.4801 5528.83642578125 922.47998046875 6 29 1.1.1.5901.3 1 64.0944 765.4542 64.0595 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0255708005279303 5598.8671875 934.1518 5598.841796875 934.147583007813 6 25 1.1.1.5901.4 1 64.0986 543.8056 64.0353 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +58(K)@20; reduced HNE(H)@24; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0290997996926308 5794.0234375 1159.812 5793.99267578125 1159.80578613281 5 15 1.1.1.5901.5 1 64.1028 258.2971 64.0353 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.028745599091053 5556.85986328125 927.1506 5556.8310546875 927.145812988281 6 24 1.1.1.5902.3 1 64.1169 35018.41 63.8887 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0292096007615328 5580.83837890625 931.147 5580.86767578125 931.15185546875 6 25 1.1.1.5902.4 1 64.1202 620.895 64.0595 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0160006005316973 5603.873046875 934.9861 5603.85693359375 934.983459472656 6 19 1.1.1.5902.5 1 64.1235 303.7941 64.0595 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0225015003234148 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 43 1.1.1.5902.6 1 64.1269 14280.44 64.0353 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.021313700824976 5556.8427734375 794.842 5556.8642578125 794.845031738281 7 31 1.1.1.5903.3 1 64.141 5750.782 64.0595 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; HexNAc(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0519068017601967 5835.99365234375 973.6729 5835.94189453125 973.664245605469 6 15 1.1.1.5903.5 1 64.1477 273.1807 64.0353 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30 missed K-I@20; missed K-L@40 0.0297397002577782 5527.83447265625 922.313 5527.8046875 922.308044433594 6 19 1.1.1.5904.2 1 64.1609 587.152 64.0595 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0190875008702278 5572.8603515625 929.8173 5572.84130859375 929.814147949219 6 28 1.1.1.5904.3 1 64.1634 1930.914 64.0595 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0170198995620012 5584.87939453125 931.8205 5584.8623046875 931.817687988281 6 20 1.1.1.5904.4 1 64.1659 858.3853 64.0837 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@26; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.041550800204277 5585.8876953125 931.9886 5585.8466796875 931.981689453125 6 19 1.1.1.5904.5 1 64.1684 860.989 64.0595 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.06387709826231 5539.8681640625 1108.981 5539.8046875 1108.96813964844 5 13 1.1.1.5904.7 1 64.175 958.1711 64.0595 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0660929009318352 5610.81201171875 936.1426 5610.8779296875 936.153625488281 6 22 1.1.1.5905.4 1 64.19 403.3821 64.0353 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0825558975338936 5854.99951171875 976.8405 5855.08203125 976.854248046875 6 15 1.1.1.5905.6 1 64.1959 358.7574 64.0595 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dioxidation(F)@15; acrolein addition +76(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0217512995004654 5794.96630859375 966.835 5794.98779296875 966.838623046875 6 28 1.1.1.5906.3 1 64.2175 360.7681 64.2043 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0619680993258953 5572.88818359375 1115.585 5572.826171875 1115.57250976563 5 14 1.1.1.5906.4 1 64.2233 597.3636 64.2285 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00225208001211286 5542.85400390625 924.8163 5542.85205078125 924.81591796875 6 27 1.1.1.5907.2 1 64.235 2061.346 64.2043 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00426913006231189 5556.85986328125 927.1506 5556.8642578125 927.151306152344 6 31 1.1.1.5907.3 1 64.2392 29971.93 64.0113 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0209184996783733 5572.8623046875 929.8176 5572.84130859375 929.814147949219 6 27 1.1.1.5907.4 1 64.2434 1315.031 64.2526 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0274017993360758 5598.869140625 934.1521 5598.841796875 934.147583007813 6 20 1.1.1.5908.3 1 64.2658 422.9867 64.2285 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0556043013930321 5574.89892578125 1115.987 5574.841796875 1115.9755859375 5 13 1.1.1.5908.4 1 64.2717 508.7718 64.2526 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Oxidation(H)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0389549992978573 5607.79150390625 935.6392 5607.83056640625 935.645751953125 6 25 1.1.1.5909.3 1 64.2876 253.6084 64.5196 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00166281999554485 5626.908203125 938.8253 5626.9091796875 938.825500488281 6 23 1.1.1.5909.4 1 64.2917 263.5988 64.4224 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.021891200914979 5556.888671875 1112.385 5556.86767578125 1112.38073730469 5 41 1.1.1.5909.5 1 64.2959 14326.01 64.0353 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.00191813998389989 5541.818359375 792.6956 5541.8203125 792.695861816406 7 25 1.1.1.5910.2 1 64.3085 479.1322 64.398 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0694485977292061 5579.86865234375 930.9854 5579.79931640625 930.973876953125 6 14 1.1.1.5910.4 1 64.3201 494.0923 64.3011 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0286746993660927 5557.84033203125 794.9845 5557.8115234375 794.980407714844 7 26 1.1.1.5911.3 1 64.3327 7278.96 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Deamidated(N)@28; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00920961983501911 5529.82958984375 922.6455 5529.8203125 922.643981933594 6 33 1.1.1.5911.4 1 64.3352 1846.271 64.4224 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +112(K)@20; Dethiomethyl(M)@37 missed K-I@20; missed K-L@40 0.0123781999573112 5565.85009765625 928.649 5565.837890625 928.646911621094 6 13 1.1.1.5911.5 1 64.3377 447.2005 64.4469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00859703961759806 5584.87109375 931.8191 5584.8623046875 931.817687988281 6 21 1.1.1.5911.6 1 64.341 629.3926 64.3011 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(K)@40 missed K-I@20; missed K-L@40 0.00922052003443241 5514.830078125 920.1456 5514.8203125 920.14404296875 6 23 1.1.1.5912.3 1 64.3569 322.3956 64.3736 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0209184996783733 5572.8623046875 929.8176 5572.84130859375 929.814147949219 6 27 1.1.1.5912.4 1 64.3594 1315.031 64.2526 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0807249024510384 5855.00146484375 976.8408 5855.08203125 976.854248046875 6 16 1.1.1.5912.5 1 64.3619 321.0974 64.4956 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.059604600071907 5539.86328125 1108.98 5539.8046875 1108.96813964844 5 13 1.1.1.5912.7 1 64.3686 616.3342 64.3252 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.00543835991993546 5542.84619140625 924.815 5542.85205078125 924.81591796875 6 30 1.1.1.5913.2 1 64.3812 3901.57 64.4224 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0151348002254963 5557.86328125 927.3178 5557.84814453125 927.315307617188 6 33 1.1.1.5914.2 1 64.4031 33512.91 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0232440996915102 5596.8388671875 933.8138 5596.8623046875 933.817687988281 6 22 1.1.1.5914.3 1 64.4056 373.9468 64.4224 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Deamidated(N)@34; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0262107998132706 5529.8486328125 1106.977 5529.8203125 1106.97131347656 5 23 1.1.1.5914.6 1 64.414 935.6663 64.4224 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0688782036304474 5559.89892578125 1112.987 5559.83056640625 1112.97338867188 5 17 1.1.1.5914.7 1 64.4173 6497.562 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Delta:H(2)C(2)(H)@24; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.00408117985352874 5581.81103515625 798.4089 5581.81494140625 798.409423828125 7 15 1.1.1.5915.3 1 64.4284 441.3488 64.4714 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0223986990749836 5515.8271484375 920.3118 5515.8046875 920.308044433594 6 22 1.1.1.5915.4 1 64.4301 403.5644 64.3736 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.017816100269556 5590.833984375 932.8129 5590.85205078125 932.81591796875 6 19 1.1.1.5915.5 1 64.4318 606.2178 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; Deamidated(N)@34; Oxidation(M)@37 missed K-I@20; missed K-L@40 -0.0176276005804539 5611.80810546875 936.3086 5611.82568359375 936.311584472656 6 15 1.1.1.5915.6 1 64.4334 555.1276 64.5196 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; acrolein addition +38(K)@20; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0060631399974227 5615.82958984375 936.9789 5615.8359375 936.979919433594 6 13 1.1.1.5915.7 1 64.4351 299.1145 64.4469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; Carbamidomethyl(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0457870997488499 5837.984375 974.0047 5838.0302734375 974.012329101563 6 21 1.1.1.5915.8 1 64.4368 225.4073 64.4469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(Q)@14; ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0308574996888638 5990.0205078125 999.344 5990.05126953125 999.34912109375 6 15 1.1.1.5916.8 1 64.4637 267.7661 64.4224 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0330720990896225 5557.87841796875 1112.583 5557.84814453125 1112.57690429688 5 27 1.1.1.5916.9 1 64.4662 17680.44 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0295330006629229 5573.8515625 797.2718 5573.82177734375 797.267578125 7 23 1.1.1.5917.2 1 64.4763 576.6093 64.4469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0244494993239641 5579.82421875 798.125 5579.79931640625 798.121459960938 7 18 1.1.1.5917.3 1 64.4788 614.2377 64.5438 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.00634997989982367 5543.8388671875 924.9804 5543.83251953125 924.979370117188 6 27 1.1.1.5917.4 1 64.4813 5629.032 64.4224 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00673888996243477 5587.86865234375 932.3187 5587.8623046875 932.317626953125 6 22 1.1.1.5917.6 1 64.4872 646.9681 64.4714 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@26; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0295292008668184 5557.84130859375 794.9846 5557.8115234375 794.980407714844 7 25 1.1.1.5918.2 1 64.5012 7658.947 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 5.97252983425278E-05 5528.83642578125 922.48 5528.83642578125 922.47998046875 6 25 1.1.1.5918.4 1 64.5079 1210.686 64.4224 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Deamidated(N)@34; reduced acrolein addition +58(K)@40; Deamidated(N)@48 missed K-I@20; missed K-L@40 0.0700894966721535 5561.86865234375 927.9854 5561.798828125 927.973754882813 6 13 1.1.1.5918.5 1 64.5112 2959.638 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0341718010604382 5573.85595703125 929.9833 5573.82177734375 929.977600097656 6 22 1.1.1.5919.2 1 64.527 2370.823 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0807249024510384 5855.00146484375 976.8408 5855.08203125 976.854248046875 6 17 1.1.1.5919.3 1 64.5328 321.0974 64.4956 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0134317995980382 5542.86328125 1109.58 5542.85205078125 1109.57763671875 5 25 1.1.1.5919.4 1 64.5387 1236.358 64.5438 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.00543835991993546 5542.84619140625 924.815 5542.85205078125 924.81591796875 6 27 1.1.1.5920.2 1 64.5502 3901.57 64.4224 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0543900988996029 5583.88525390625 931.6548 5583.83056640625 931.645751953125 6 26 1.1.1.5920.3 1 64.5544 683.4066 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0293827001005411 5600.82763671875 934.4786 5600.857421875 934.483520507813 6 23 1.1.1.5920.4 1 64.5586 373.3193 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0155009999871254 5557.86376953125 927.3179 5557.84814453125 927.315307617188 6 37 1.1.1.5921.2 1 64.5743 33831.09 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; Dethiomethyl(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00931314006447792 5574.865234375 930.1515 5574.87451171875 930.153076171875 6 21 1.1.1.5921.3 1 64.5785 1686.798 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Oxidation(M)@37; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 0.0316845998167992 5769.00341796875 962.5079 5768.97216796875 962.502685546875 6 19 1.1.1.5921.4 1 64.5827 237.8643 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; reduced HNE(H)@24; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00490552000701427 5794.9833984375 966.8378 5794.98779296875 966.838623046875 6 26 1.1.1.5921.5 1 64.5869 309.9471 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00353656988590956 5544.8349609375 793.1265 5544.8310546875 793.126037597656 7 18 1.1.1.5922.2 1 64.5959 427.2598 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0334784016013145 5608.82861328125 935.8121 5608.8623046875 935.817687988281 6 27 1.1.1.5922.6 1 64.6034 434.5287 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0176276005804539 5611.80810546875 936.3086 5611.82568359375 936.311584472656 6 14 1.1.1.5922.7 1 64.6059 555.1276 64.5196 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Dioxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0505748987197876 5615.87109375 936.9858 5615.82080078125 936.977355957031 6 22 1.1.1.5922.8 1 64.6084 272.1704 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.063188798725605 5572.88818359375 1115.585 5572.826171875 1115.57250976563 5 12 1.1.1.5922.9 1 64.6109 983.0908 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0330720990896225 5557.87841796875 1112.583 5557.84814453125 1112.57690429688 5 41 1.1.1.5923.3 1 64.635 17680.44 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0672022998332977 5584.8818359375 931.8209 5584.81494140625 931.809753417969 6 22 1.1.1.5924.2 1 64.6593 821.2727 64.6645 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0151391001418233 5543.84765625 924.9819 5543.83251953125 924.979370117188 6 26 1.1.1.5926.2 1 64.6941 4633.111 64.4469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0106645999476314 5572.85205078125 929.8159 5572.84130859375 929.814147949219 6 28 1.1.1.5926.3 1 64.6974 1278.828 64.7366 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; reduced HNE(H)@24; Carbamidomethyl(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0215195007622242 5856.01953125 977.0105 5856.041015625 977.014099121094 6 23 1.1.1.5926.4 1 64.7008 479.3428 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0410921983420849 5543.87353515625 1109.782 5543.83251953125 1109.77380371094 5 16 1.1.1.5926.6 1 64.7075 1467.222 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.00617079017683864 5542.845703125 924.8149 5542.85205078125 924.81591796875 6 30 1.1.1.5927.3 1 64.7314 2614.507 64.4714 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0405637994408607 5573.85107421875 797.2717 5573.81005859375 797.265869140625 7 18 1.1.1.5928.2 1 64.7406 463.863 64.7366 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0531772002577782 5527.85791015625 922.3169 5527.8046875 922.308044433594 6 16 1.1.1.5928.3 1 64.7423 307.296 64.7366 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0155009999871254 5557.86376953125 927.3179 5557.84814453125 927.315307617188 6 37 1.1.1.5928.4 1 64.7439 33831.09 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0174922998994589 5600.87451171875 934.4864 5600.857421875 934.483520507813 6 21 1.1.1.5928.5 1 64.7456 309.1448 64.7607 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0090592298656702 5631.83984375 939.6473 5631.83056640625 939.645751953125 6 11 1.1.1.5928.6 1 64.7473 189.2183 64.7607 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0354624018073082 5783.97265625 965.0027 5784.00830078125 965.008666992188 6 20 1.1.1.5928.7 1 64.7489 166.2193 64.7366 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.00357585004530847 5796.0048828125 967.0081 5796.00830078125 967.008666992188 6 14 1.1.1.5928.8 1 64.7506 294.6446 64.7125 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0163746997714043 5835.03564453125 973.5132 5835.01953125 973.510498046875 6 14 1.1.1.5928.9 1 64.7523 161.1091 64.7366 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0557782985270023 5573.87744140625 929.9869 5573.82177734375 929.977600097656 6 22 1.1.1.5929.3 1 64.768 1553.569 64.7366 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0160492993891239 5598.857421875 934.1502 5598.841796875 934.147583007813 6 20 1.1.1.5929.4 1 64.7705 341.6364 64.7607 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.00436164019629359 5610.79833984375 936.1403 5610.7939453125 936.1396484375 6 18 1.1.1.5929.5 1 64.773 427.7832 64.7125 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0174246001988649 5581.83251953125 931.3127 5581.81494140625 931.309814453125 6 14 1.1.1.5930.2 1 64.7911 650.0507 64.7607 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0330720990896225 5557.87841796875 1112.583 5557.84814453125 1112.57690429688 5 40 1.1.1.5930.4 1 64.7994 17680.44 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0448809005320072 5572.88330078125 1115.584 5572.84130859375 1115.57556152344 5 19 1.1.1.5930.5 1 64.8036 731.7808 64.7366 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0195834003388882 5584.8818359375 931.8209 5584.8623046875 931.817687988281 6 22 1.1.1.5931.2 1 64.8193 821.2727 64.6645 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; HexNAc(N)@28; Oxidation(M)@37; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0267099998891354 5990.0361328125 999.3466 5990.0625 999.351013183594 6 18 1.1.1.5931.3 1 64.8276 160.2135 64.8086 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0299564003944397 5557.841796875 794.9847 5557.8115234375 794.980407714844 7 25 1.1.1.5932.2 1 64.8516 5264.862 64.7848 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.04383410140872 5543.83984375 924.9806 5543.7958984375 924.973266601563 6 27 1.1.1.5934.3 1 64.8923 2323.266 64.6645 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0212846994400024 5572.8623046875 929.8177 5572.84130859375 929.814147949219 6 26 1.1.1.5934.4 1 64.8964 953.4399 64.9057 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0155009999871254 5557.86376953125 927.3179 5557.84814453125 927.315307617188 6 36 1.1.1.5935.3 1 64.9164 28938.96 64.6645 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@34; Delta:H(2)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0162582006305456 5589.8369140625 932.6467 5589.8203125 932.643981933594 6 16 1.1.1.5935.4 1 64.9205 323.2423 64.9057 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0128771001473069 5528.84912109375 922.4821 5528.83642578125 922.47998046875 6 22 1.1.1.5936.2 1 64.9363 396.5922 64.6885 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +96(K)@20; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0924710035324097 5770.04931640625 962.6821 5769.95654296875 962.666687011719 6 18 1.1.1.5936.3 1 64.9405 298.6339 64.8576 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0174129996448755 5542.86328125 1109.58 5542.8486328125 1109.57702636719 5 18 1.1.1.5936.4 1 64.9446 683.3447 64.6885 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; Met->Hcy(M)@37; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0518703982234001 5579.85107421875 930.9825 5579.79931640625 930.973876953125 6 18 1.1.1.5937.4 1 64.9687 472.0785 64.9057 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0416169986128807 5557.88818359375 1112.585 5557.84814453125 1112.57690429688 5 33 1.1.1.5937.5 1 64.9729 14191.18 64.7366 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dioxidation(P)@25; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0731384009122849 5561.88330078125 927.9878 5561.81005859375 927.975646972656 6 19 1.1.1.5938.2 1 64.9847 2263.157 64.7366 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0803859010338783 5584.89501953125 931.8231 5584.81494140625 931.809753417969 6 22 1.1.1.5938.3 1 64.9888 3588.046 65.2226 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0295637995004654 5572.88818359375 1115.585 5572.85888671875 1115.5791015625 5 16 1.1.1.5938.5 1 64.9972 489.4468 65.0752 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00642909994348884 5557.841796875 794.9847 5557.84814453125 794.985595703125 7 28 1.1.1.5939.3 1 65.013 3239.537 65.0022 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0122482003644109 5544.84326171875 925.1478 5544.8310546875 925.145812988281 6 17 1.1.1.5939.4 1 65.0172 749.4344 65.0264 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0134857995435596 5598.85498046875 934.1498 5598.841796875 934.147583007813 6 19 1.1.1.5939.5 1 65.0213 269.857 65.0264 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0737107023596764 5568.9033203125 1114.788 5568.8310546875 1114.77355957031 5 14 1.1.1.5940.2 1 65.0341 907.9445 65.1732 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0229989998042583 5582.8701171875 798.5601 5582.8466796875 798.556823730469 7 22 1.1.1.5942.3 1 65.0859 2611.621 65.2723 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0268853008747101 5540.85986328125 924.4839 5540.8330078125 924.479431152344 6 18 1.1.1.5942.4 1 65.0901 461.7748 65.1243 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0151348002254963 5557.86328125 927.3178 5557.84814453125 927.315307617188 6 33 1.1.1.5942.5 1 65.0943 20893.8 64.8327 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0360029004514217 5573.85791015625 929.9836 5573.82177734375 929.977600097656 6 21 1.1.1.5943.4 1 65.1125 840.8736 65.0022 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.00561755010858178 5543.837890625 924.9803 5543.83251953125 924.979370117188 6 24 1.1.1.5944.2 1 65.1312 1163.031 64.8816 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@20 missed K-I@20; missed K-L@40 0.0441414006054401 5582.890625 931.4891 5582.8466796875 931.481750488281 6 19 1.1.1.5944.3 1 65.1353 12171.88 65.322 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0416169986128807 5557.88818359375 1112.585 5557.84814453125 1112.57690429688 5 27 1.1.1.5944.4 1 65.1395 9442.315 64.8816 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0705742985010147 5582.91845703125 1117.591 5582.8466796875 1117.57666015625 5 17 1.1.1.5944.5 1 65.1437 9735.583 65.3716 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0299564003944397 5557.841796875 794.9847 5557.8115234375 794.980407714844 7 25 1.1.1.5946.3 1 65.1846 3239.537 65.0022 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0536662004888058 5568.884765625 929.1547 5568.8310546875 929.145812988281 6 18 1.1.1.5946.4 1 65.1888 1098.836 65.1487 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0515718013048172 5598.89306640625 934.1561 5598.841796875 934.147583007813 6 18 1.1.1.5948.3 1 65.2423 917.4817 65.322 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0229989998042583 5582.8701171875 798.5601 5582.8466796875 798.556823730469 7 18 1.1.1.5949.3 1 65.2588 2873.303 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0151348002254963 5557.86328125 927.3178 5557.84814453125 927.315307617188 6 32 1.1.1.5949.4 1 65.263 15842.93 65.0022 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@20; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0399422012269497 5636.81787109375 940.4769 5636.857421875 940.483520507813 6 14 1.1.1.5950.4 1 65.2854 235.7632 65.2723 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Delta:H(2)C(2)(H)@24; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.0737107023596764 5568.9033203125 1114.788 5568.8310546875 1114.77355957031 5 14 1.1.1.5950.6 1 65.2921 907.9445 65.1732 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0441414006054401 5582.890625 931.4891 5582.8466796875 931.481750488281 6 16 1.1.1.5951.2 1 65.3035 12292.75 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0752421021461487 5557.88818359375 1112.585 5557.81494140625 1112.5703125 5 15 1.1.1.5951.5 1 65.3135 6749.375 65.0508 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0705742985010147 5582.91845703125 1117.591 5582.8466796875 1117.57666015625 5 17 1.1.1.5951.6 1 65.3169 9539.364 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0441414006054401 5582.890625 931.4891 5582.8466796875 931.481750488281 6 20 1.1.1.5952.3 1 65.336 12292.75 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00349899008870125 5627.890625 938.989 5627.8935546875 938.989501953125 6 17 1.1.1.5952.4 1 65.3418 150.6923 65.322 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0323119983077049 5567.8681640625 928.9853 5567.8359375 928.979919433594 6 18 1.1.1.5953.3 1 65.354 687.7512 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0287417992949486 5570.87548828125 929.4865 5570.8466796875 929.481750488281 6 20 1.1.1.5953.4 1 65.3565 683.4614 65.2723 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0608794987201691 5540.849609375 924.4822 5540.78857421875 924.472045898438 6 17 1.1.1.5954.3 1 65.391 320.9814 65.322 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00446324981749058 5568.8720703125 929.1526 5568.86767578125 929.15185546875 6 20 1.1.1.5955.3 1 65.4153 884.6514 65.322 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0229989998042583 5582.8701171875 798.5601 5582.8466796875 798.556823730469 7 18 1.1.1.5956.2 1 65.4249 2873.303 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0162333995103836 5557.8642578125 927.318 5557.84814453125 927.315307617188 6 28 1.1.1.5956.3 1 65.4274 6082.334 65.1732 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Oxidation(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0332393981516361 5600.890625 934.489 5600.857421875 934.483520507813 6 15 1.1.1.5956.4 1 65.43 534.1815 65.2723 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0705742985010147 5582.91845703125 1117.591 5582.8466796875 1117.57666015625 5 18 1.1.1.5958.2 1 65.4891 9539.364 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0441414006054401 5582.890625 931.4891 5582.8466796875 931.481750488281 6 18 1.1.1.5959.2 1 65.5024 12292.75 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Dehydrated(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0220634005963802 5566.8740234375 928.8196 5566.85205078125 928.81591796875 6 18 1.1.1.5962.3 1 65.5886 494.6524 65.3716 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0229989998042583 5582.8701171875 798.5601 5582.8466796875 798.556823730469 7 17 1.1.1.5963.3 1 65.6053 2794.495 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@26; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0133036999031901 5557.861328125 927.3175 5557.84814453125 927.315307617188 6 30 1.1.1.5963.4 1 65.6095 2819.723 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0705742985010147 5582.91845703125 1117.591 5582.8466796875 1117.57666015625 5 20 1.1.1.5965.2 1 65.6641 7426.289 65.3961 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0430428013205528 5582.8896484375 931.4889 5582.8466796875 931.481750488281 6 20 1.1.1.5966.3 1 65.6813 9307.273 65.4204 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0169711001217365 5556.880859375 927.1541 5556.8642578125 927.151306152344 6 34 1.1.1.5971.2 1 65.7692 924.4237 65.8337 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0433631986379623 5672.92236328125 946.4943 5672.87841796875 946.486999511719 6 28 1.1.1.5971.3 1 65.775 384.2578 65.6438 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0532914996147156 5583.8837890625 931.6546 5583.83056640625 931.645751953125 6 19 1.1.1.5977.3 1 65.8541 1113.44 65.8085 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@28; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0771638005971909 5583.908203125 1117.789 5583.83056640625 1117.7734375 5 15 1.1.1.5979.3 1 65.8955 1016.269 65.8085 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0162333995103836 5557.8642578125 927.318 5557.84814453125 927.315307617188 6 26 1.1.1.5983.2 1 65.963 832.2525 65.9089 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0532914996147156 5583.8837890625 931.6546 5583.83056640625 931.645751953125 6 18 1.1.1.5987.2 1 66.0214 2580.1 66.1664 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0765533968806267 5583.908203125 1117.789 5583.83056640625 1117.7734375 5 15 1.1.1.5989.4 1 66.0828 2309.848 66.1402 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0621404014527798 5557.8740234375 927.3196 5557.8115234375 927.309265136719 6 24 1.1.1.5991.2 1 66.135 872.7627 66.0348 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(E)@3; Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0613506995141506 5596.923828125 933.8279 5596.8623046875 933.817687988281 6 17 1.1.1.5993.4 1 66.1872 298.0945 66.2185 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0532914996147156 5583.8837890625 931.6546 5583.83056640625 931.645751953125 6 17 1.1.1.5994.3 1 66.2131 2580.1 66.1664 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0125553999096155 5556.84375 794.8421 5556.8310546875 794.840270996094 7 24 1.1.1.5995.4 1 66.2346 129.8744 66.2439 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Carbamidomethyl(K)@40 missed K-I@20; missed K-L@40 0.0653200000524521 5583.908203125 1117.789 5583.841796875 1117.77563476563 5 19 1.1.1.5996.4 1 66.2636 2309.849 66.1402 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0518168993294239 5556.8828125 927.1544 5556.8310546875 927.145812988281 6 29 1.1.1.5999.3 1 66.3217 588.8584 66.2687 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0510844998061657 5556.88232421875 927.1543 5556.8310546875 927.145812988281 6 27 1.1.1.6010.2 1 66.4963 534.163 66.5103 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0510946996510029 5610.92919921875 936.1621 5610.8779296875 936.153625488281 6 20 1.1.1.6019.5 1 66.6356 448.9983 66.6701 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@28; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0561515986919403 5585.9033203125 1118.188 5585.8466796875 1118.17651367188 5 16 1.1.1.6019.6 1 66.6389 286.9279 66.6701 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00407881010323763 5556.87158203125 927.1525 5556.86767578125 927.15185546875 6 32 1.1.1.6020.2 1 66.6534 507.4622 66.6181 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0391861014068127 5584.90380859375 1117.988 5584.8623046875 1117.97973632813 5 14 1.1.1.6020.4 1 66.6651 350.9225 66.6701 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0128678996115923 5556.88037109375 927.154 5556.86767578125 927.15185546875 6 34 1.1.1.6037.2 1 66.9022 340.5957 66.8734 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00960399955511093 5608.908203125 935.8253 5608.89892578125 935.82373046875 6 21 1.1.1.6042.2 1 67.0156 1231.487 67.0882 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(D)@7; hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.034891601651907 5608.93310546875 1122.794 5608.89892578125 1122.78698730469 5 29 1.1.1.6046.3 1 67.0831 2056.943 67.1141 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00997020956128836 5608.90869140625 935.8254 5608.89892578125 935.82373046875 6 25 1.1.1.6051.2 1 67.194 1232.348 67.0882 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(D)@7; hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.034891601651907 5608.93310546875 1122.794 5608.89892578125 1122.78698730469 5 22 1.1.1.6054.4 1 67.2536 2056.943 67.1141 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00777294021099806 5608.90625 935.825 5608.89892578125 935.82373046875 6 24 1.1.1.6063.3 1 67.3947 851.7593 67.2587 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00151533004827797 5556.869140625 927.1521 5556.86767578125 927.15185546875 6 34 1.1.1.6071.2 1 67.5097 267.1701 67.4897 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0037875201087445 5556.86767578125 927.1519 5556.8642578125 927.151306152344 6 34 1.1.1.6104.2 1 67.8998 348.1349 67.9382 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00261397007852793 5556.8701171875 927.1523 5556.86767578125 927.15185546875 6 31 1.1.1.6294.2 1 69.7438 314.3941 69.7168 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00151533004827797 5556.869140625 927.1521 5556.86767578125 927.15185546875 6 38 1.1.1.6331.2 1 70.0741 361.9831 70.093 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00690753012895584 5556.8603515625 927.1507 5556.86767578125 927.15185546875 6 36 1.1.1.6358.2 1 70.3167 390.1352 70.3294 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0276468992233276 5556.85888671875 927.1504 5556.8310546875 927.145812988281 6 30 1.1.1.6378.2 1 70.512 419.9613 70.4909 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.028379300609231 5556.859375 927.1505 5556.8310546875 927.145812988281 6 29 1.1.1.6394.2 1 70.6793 413.7548 70.7606 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0230208002030849 5556.84423828125 927.148 5556.86767578125 927.15185546875 6 33 1.1.1.6407.2 1 70.9139 438.1203 70.8834 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0185513999313116 5556.845703125 927.1482 5556.8642578125 927.151306152344 6 26 1.1.1.6415.3 1 71.1084 451.4088 71.0652 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0247172005474567 5556.85595703125 927.1499 5556.8310546875 927.145812988281 6 30 1.1.1.6424.2 1 71.3087 532.7188 71.2895 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00151533004827797 5556.869140625 927.1521 5556.86767578125 927.15185546875 6 32 1.1.1.6437.2 1 71.5376 462.3666 71.5427 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00617511011660099 5556.861328125 927.1508 5556.86767578125 927.15185546875 6 36 1.1.1.6455.2 1 71.7369 431.6116 71.7096 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00151533004827797 5556.869140625 927.1521 5556.86767578125 927.15185546875 6 34 1.1.1.6468.2 1 71.919 481.2745 72.0399 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00610018987208605 5556.8583984375 927.1503 5556.8642578125 927.151306152344 6 31 1.1.1.6479.2 1 72.0881 453.5993 72.1192 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0269144997000694 5556.8583984375 927.1503 5556.8310546875 927.145812988281 6 27 1.1.1.6492.2 1 72.2726 465.515 72.2056 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00983722973614931 5556.857421875 927.1502 5556.86767578125 927.15185546875 6 32 1.1.1.6506.3 1 72.4445 485.4464 72.4817 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00873859040439129 5556.85888671875 927.1504 5556.86767578125 927.15185546875 6 29 1.1.1.6520.3 1 72.6145 532.5135 72.6272 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00800617039203644 5556.859375 927.1505 5556.86767578125 927.15185546875 6 36 1.1.1.6532.3 1 72.7906 566.7045 72.7703 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0239847991615534 5556.85498046875 927.1498 5556.8310546875 927.145812988281 6 30 1.1.1.6543.3 1 72.9589 518.0797 72.9388 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00536776008084416 5556.85888671875 927.1504 5556.8642578125 927.151306152344 6 33 1.1.1.6554.3 1 73.1458 708.5423 73.0741 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0211897995322943 5556.84619140625 927.1483 5556.86767578125 927.15185546875 6 35 1.1.1.6564.3 1 73.3253 682.7239 73.2786 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0105696003884077 5556.85693359375 927.1501 5556.86767578125 927.15185546875 6 38 1.1.1.6576.6 1 73.5332 899.4548 73.5734 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0144632998853922 5556.845703125 927.1482 5556.8310546875 927.145812988281 6 28 1.1.1.6588.5 1 73.7028 633.6514 73.6311 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0124006997793913 5556.85498046875 927.1498 5556.86767578125 927.15185546875 6 33 1.1.1.6603.4 1 73.8724 686.6203 73.8817 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00041669700294733 5556.86767578125 927.1519 5556.86767578125 927.15185546875 6 35 1.1.1.6617.4 1 74.0478 946.5224 74.0529 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.025449600070715 5556.8564453125 927.15 5556.8310546875 927.145812988281 6 31 1.1.1.6626.4 1 74.2413 1105.539 74.2537 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0082974499091506 5556.85595703125 927.1499 5556.8642578125 927.151306152344 6 26 1.1.1.6637.3 1 74.4117 1068.47 74.4168 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00426913006231189 5556.85986328125 927.1506 5556.8642578125 927.151306152344 6 31 1.1.1.6646.3 1 74.5841 1126.893 74.5971 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00763995992019773 5556.85986328125 927.1506 5556.86767578125 927.15185546875 6 29 1.1.1.6657.3 1 74.7546 1239.899 74.7734 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0105696003884077 5556.85693359375 927.1501 5556.86767578125 927.15185546875 6 30 1.1.1.6669.3 1 74.9442 982.5978 74.8987 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00947101041674614 5556.8583984375 927.1503 5556.86767578125 927.15185546875 6 35 1.1.1.6680.5 1 75.128 1013.372 75.081 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00947101041674614 5556.8583984375 927.1503 5556.86767578125 927.15185546875 6 32 1.1.1.6690.3 1 75.3086 1314.363 75.2224 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0368021987378597 5556.86767578125 927.1519 5556.8310546875 927.145812988281 6 29 1.1.1.6697.2 1 75.4871 1342.169 75.3897 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0397319011390209 5556.87060546875 927.1524 5556.8310546875 927.145812988281 6 29 1.1.1.6705.2 1 75.6671 1090.837 75.6725 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00224775006063282 5556.86962890625 927.1522 5556.86767578125 927.15185546875 6 33 1.1.1.6712.3 1 75.8424 891.3376 75.7721 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00488616013899446 5556.869140625 927.1521 5556.8642578125 927.151306152344 6 33 1.1.1.6720.5 1 76.0266 1078.685 76.0316 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00407881010323763 5556.87158203125 927.1525 5556.86767578125 927.15185546875 6 32 1.1.1.6728.2 1 76.2102 1215.48 76.2681 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0037875201087445 5556.86767578125 927.1519 5556.8642578125 927.151306152344 6 30 1.1.1.6736.2 1 76.3811 1051.461 76.4122 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00151533004827797 5556.869140625 927.1521 5556.86767578125 927.15185546875 6 32 1.1.1.6747.3 1 76.5541 1119.513 76.5593 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00151533004827797 5556.869140625 927.1521 5556.86767578125 927.15185546875 6 31 1.1.1.6756.3 1 76.7338 1014.652 76.6861 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00261397007852793 5556.8701171875 927.1523 5556.86767578125 927.15185546875 6 32 1.1.1.6764.2 1 76.9258 954.0425 76.8781 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00041669700294733 5556.86767578125 927.1519 5556.86767578125 927.15185546875 6 34 1.1.1.6772.3 1 77.1167 871.2582 77.2011 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0371683984994888 5556.8681640625 927.152 5556.8310546875 927.145812988281 6 31 1.1.1.6780.5 1 77.3261 763.2255 77.3052 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00617511011660099 5556.861328125 927.1508 5556.86767578125 927.15185546875 6 29 1.1.1.6788.2 1 77.5273 726.658 77.4839 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00104815000668168 5556.8662109375 927.1517 5556.86767578125 927.15185546875 6 31 1.1.1.6799.5 1 77.7025 680.9037 77.6831 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00407881010323763 5556.87158203125 927.1525 5556.86767578125 927.15185546875 6 28 1.1.1.6806.9 1 77.877 576.1187 77.9078 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0404643006622791 5556.87158203125 927.1525 5556.8310546875 927.145812988281 6 27 1.1.1.6814.9 1 78.0844 667.9818 78.1683 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0404643006622791 5556.87158203125 927.1525 5556.8310546875 927.145812988281 6 27 1.1.1.6821.10 1 78.2687 667.9818 78.1683 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00261397007852793 5556.8701171875 927.1523 5556.86767578125 927.15185546875 6 29 1.1.1.6831.19 1 78.5325 531.0288 78.3787 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0342386998236179 5556.865234375 927.1515 5556.8310546875 927.145812988281 6 26 1.1.1.6855.13 1 78.9976 512.2524 79.0285 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0155619001016021 5556.8466796875 927.1484 5556.8310546875 927.145812988281 6 24 1.1.1.6863.5 1 79.2063 413.3994 79.1589 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +58(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0203664004802704 5588.86865234375 1118.781 5588.84619140625 1118.77648925781 5 13 1.1.1.5915.10 1 64.4418 338.1703 64.5438 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0455497987568378 5582.89404296875 1117.586 5582.8466796875 1117.57666015625 5 11 1.1.1.5928.10 1 64.7539 265.6545 64.7125 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0568250007927418 5574.89892578125 1115.987 5574.841796875 1115.9755859375 5 11 1.1.1.5940.3 1 65.0399 410.6525 65.0264 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.069488599896431 5559.89892578125 1112.987 5559.83056640625 1112.97338867188 5 11 1.1.1.5950.5 1 65.2888 2838.079 65.0264 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0161649994552135 5604.84765625 801.6998 5604.8310546875 801.697448730469 7 12 1.1.1.5953.2 1 65.3515 230.8922 65.322 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0257284007966518 5539.830078125 924.3123 5539.8046875 924.308044433594 6 20 1.1.1.5885.3 1 63.7073 3618.597 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0261582005769014 5557.84130859375 794.9846 5557.81494140625 794.980895996094 7 20 1.1.1.5925.2 1 64.6701 7658.947 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0299379993230104 5672.92431640625 946.4946 5672.8935546875 946.489562988281 6 20 1.1.1.5953.6 1 65.3615 375.4793 65.4945 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0243360009044409 5589.85009765625 932.6489 5589.87451171875 932.653015136719 6 12 1.1.1.5925.5 1 64.6801 549.0685 64.6645 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0602282993495464 5771.0478515625 962.8486 5770.98779296875 962.838623046875 6 19 1.1.1.5920.5 1 64.5628 417.2925 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; reduced HNE(H)@24; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 -0.0491901002824306 5851.00146484375 976.1742 5851.05078125 976.182373046875 6 19 1.1.1.5925.6 1 64.6835 177.4429 64.6645 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0370809994637966 5539.841796875 924.3142 5539.8046875 924.308044433594 6 18 1.1.1.5906.2 1 64.2117 1535.662 64.2043 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0247265007346869 5768.9970703125 962.5068 5768.97216796875 962.502685546875 6 18 1.1.1.5913.3 1 64.387 239.4104 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.053270298987627 5771.041015625 962.8475 5770.98779296875 962.838623046875 6 18 1.1.1.5929.6 1 64.7764 433.2288 64.7607 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5599994659424 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.151868000626564 5928.966796875 989.1684 5929.11865234375 989.193725585938 6 12 1.1.1.5814.12 1 61.9932 176.3865 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5300004482269 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@26 missed K-I@20; missed K-L@40 0.013340899720788 5557.82861328125 794.9828 5557.81494140625 794.980895996094 7 17 1.1.1.5804.3 1 61.7332 411.6955 61.6678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5300004482269 [trypsin fragment, 50 aa] acrolein addition +76(K)@20 missed K-I@20; missed K-L@40 0.0166106000542641 5576.8525390625 930.4827 5576.83642578125 930.47998046875 6 16 1.1.1.5836.12 1 62.5294 2608.016 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5300004482269 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0217946004122496 5597.8681640625 933.9853 5597.8466796875 933.981689453125 6 17 1.1.1.5865.6 1 63.2298 897.6724 63.0723 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5300004482269 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; Deamidated(N)@34 missed K-I@20; missed K-L@40 -0.0099589703604579 5613.8310546875 936.6458 5613.84130859375 936.647521972656 6 17 1.1.1.5879.4 1 63.5717 540.8079 63.3848 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5300004482269 [trypsin fragment, 50 aa] Deamidated(N)@12; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0122731002047658 5597.8583984375 933.9837 5597.8466796875 933.981689453125 6 16 1.1.1.5887.5 1 63.7635 691.5652 63.7446 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5300004482269 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0257284007966518 5539.830078125 924.3123 5539.8046875 924.308044433594 6 17 1.1.1.5892.3 1 63.8753 3618.597 63.6967 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5300004482269 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0272377002984285 5853.0390625 976.5138 5853.06640625 976.518310546875 6 17 1.1.1.5898.5 1 64.0235 292.4651 63.9632 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.9499995708466 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0327496007084847 5624.80322265625 938.4745 5624.83642578125 938.47998046875 6 15 1.1.1.5815.7 1 62.0167 390.1602 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.9499995708466 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0295761991292238 5557.8447265625 794.9851 5557.81494140625 794.980895996094 7 16 1.1.1.5820.3 1 62.1319 1950.313 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.9499995708466 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0287455003708601 5556.85986328125 927.1506 5556.8310546875 927.145812988281 6 15 1.1.1.5887.3 1 63.7552 57171.79 63.6727 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.9499995708466 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0269143991172314 5556.8583984375 927.1503 5556.8310546875 927.145812988281 6 15 1.1.1.5917.5 1 64.4838 18180.51 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.9499995708466 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.0232442002743483 5596.8388671875 933.8138 5596.8623046875 933.817687988281 6 15 1.1.1.5922.5 1 64.6009 370.0208 64.5919 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.9999978542328 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0257284007966518 5539.830078125 924.3123 5539.8046875 924.308044433594 6 15 1.1.1.5899.3 1 64.0419 2056.807 64.0353 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.9999978542328 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0221107993274927 5853.0439453125 976.5146 5853.06640625 976.518310546875 6 15 1.1.1.5935.5 1 64.9247 162.684 64.9057 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 [trypsin fragment, 50 aa] Carbamidomethyl(E)@13; ONE addition +154(K)@20; reduced HNE(H)@24; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.00617850013077259 5966.12060546875 995.3607 5966.11376953125 995.359619140625 6 12 1.1.1.5813.12 1 61.9682 167.2075 61.9533 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.4299986362457 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; Phospho(T)@31; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0315316990017891 5949.05908203125 992.5171 5949.02734375 992.511840820313 6 12 1.1.1.5820.11 1 62.1386 2393.265 62.0058 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.4500029087067 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.00963300000876188 5618.8369140625 937.4801 5618.8466796875 937.481750488281 6 14 1.1.1.5917.7 1 64.4905 219.6205 64.5438 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.4500029087067 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0269143991172314 5556.8583984375 927.1503 5556.8310546875 927.145812988281 6 14 1.1.1.5925.4 1 64.6768 18180.51 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.4500029087067 [trypsin fragment, 50 aa] HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.00917488988488913 5672.92431640625 946.4946 5672.9150390625 946.493103027344 6 14 1.1.1.5987.3 1 66.0298 456.4553 66.0097 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.3200011253357 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; reduced HNE(H)@24; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.0239358991384506 5791.01708984375 966.1768 5790.9931640625 966.172790527344 6 14 1.1.1.5837.9 1 62.5515 352.8861 62.616 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.3200011253357 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0455663986504078 5539.8486328125 1108.977 5539.8046875 1108.96813964844 5 14 1.1.1.5867.5 1 63.2798 1699.592 63.2399 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.3200011253357 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.0255165006965399 5807.013671875 968.8429 5806.98779296875 968.838623046875 6 14 1.1.1.5916.5 1 64.4562 178.3327 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.3200011253357 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0553422011435032 5610.7861328125 936.1383 5610.841796875 936.147583007813 6 14 1.1.1.5938.4 1 64.993 424.8989 64.7366 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.4699990749359 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.0393849015235901 5572.86328125 1115.58 5572.826171875 1115.57250976563 5 14 1.1.1.5826.5 1 62.2905 688.7036 62.2503 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 72.4500000476837 [trypsin fragment, 50 aa] Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.0549389012157917 5543.86376953125 1109.78 5543.810546875 1109.76940917969 5 11 1.1.1.5817.10 1 62.0719 660.7951 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 65.149998664856 [trypsin fragment, 50 aa] ONE addition +154(K)@20; CHDH(D)@35 missed K-I@20; missed K-L@40 0.00913579016923904 5949.0986328125 1190.827 5949.08740234375 1190.82470703125 5 12 1.1.1.5815.11 1 62.0233 1208.031 62.03 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 65.149998664856 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0760980024933815 5598.91845703125 1120.791 5598.841796875 1120.77563476563 5 11 1.1.1.5956.8 1 65.44 694.1277 65.322 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.4399992227554 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0698734000325203 5556.8984375 1112.387 5556.8310546875 1112.37353515625 5 13 1.1.1.5825.8 1 62.2696 2789.784 62.4929 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.4399992227554 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0465749986469746 5612.810546875 936.4757 5612.857421875 936.483520507813 6 13 1.1.1.5943.5 1 65.1159 237.055 64.9297 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.6500006914139 [trypsin fragment, 50 aa] Deamidated(N)@30; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.00249222991988063 5613.84375 936.6479 5613.84130859375 936.647521972656 6 13 1.1.1.5837.5 1 62.5481 739.162 62.5665 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.6500006914139 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.00826657004654408 5595.8388671875 933.6471 5595.83056640625 933.645751953125 6 13 1.1.1.5922.4 1 64.5992 358.2361 64.5678 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Deamidated(N)@8 0.00407950021326542 1045.54443359375 523.7795 1045.54040527344 523.777465820313 2 16 1.1.1.4433.10 1 29.0138 4637.616 29.0222 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR 0.0025269000325352 1044.55883789063 523.2867 1044.55639648438 523.285461425781 2 15 1.1.1.4426.6 1 28.8363 83272.09 28.6859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR 0.0025269000325352 1044.55883789063 523.2867 1044.55639648438 523.285461425781 2 14 1.1.1.4420.3 1 28.6964 83272.09 28.6859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Deamidated(N)@8 0.00481190020218492 1045.54504394531 523.7798 1045.54040527344 523.777465820313 2 14 1.1.1.4454.3 1 29.51 800.4394 29.5234 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR 0.00667718006297946 1044.56311035156 523.2888 1044.55639648438 523.285461425781 2 12 1.1.1.4679.4 1 34.8696 95.6517 34.8265 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8600015640259 LSSPATLNSR 0.00264897011220455 1044.55908203125 523.2868 1044.55639648438 523.285461425781 2 13 1.1.1.4440.2 1 29.1866 4593.744 28.9251 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.4999973773956 LSSPATLNSR 8.55664984555915E-05 1044.55651855469 523.2855 1044.55639648438 523.285461425781 2 8 1.1.1.4404.5 1 28.2965 115.1672 28.2864 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.4999973773956 LSSPATLNSR 0.0025269000325352 1044.55883789063 523.2867 1044.55639648438 523.285461425781 2 12 1.1.1.4412.4 1 28.5027 82777.98 28.6859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.5800006389618 LSSPATLNSR 0.000329700007569045 1044.556640625 523.2856 1044.55639648438 523.285461425781 2 10 1.1.1.4479.4 1 30.1167 211.6758 29.8572 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.2299978733063 LSSPATLNSR Oxidation(N)@8 -0.000645634019747376 1060.55065917969 531.2826 1060.55126953125 531.282897949219 2 11 1.1.1.4416.5 1 28.6004 1596.191 28.662 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.2700023651123 LSSPATLNSR Dioxidation(P)@4; Deamidated(N)@8 -0.00128602003678679 1077.52893066406 539.7717 1077.5302734375 539.772399902344 2 9 1.1.1.4436.13 1 29.0869 186.7617 29.0222 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.3600022792816 LSSPATLNSR Methyl(L)@1 -0.00972915999591351 1058.5625 530.2885 1058.57202148438 530.293273925781 2 9 1.1.1.4436.12 1 29.0852 249.7297 29.0464 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 LSSPATLNSR Delta:H(2)C(2)@N-term 0.0050744297914207 1070.57702636719 536.2958 1070.57202148438 536.293273925781 2 10 1.1.1.4505.10 1 30.7134 477.8479 30.7202 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 74.6299982070923 LSSPATLNSR Dioxidation(P)@4 0.000945126987062395 1076.54711914063 539.2808 1076.54614257813 539.280395507813 2 11 1.1.1.4426.10 1 28.843 2851.157 28.6859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 60.2199971675873 LSSPATLNSR Dioxidation(P)@4 0.000945126987062395 1076.54711914063 539.2808 1076.54614257813 539.280395507813 2 11 1.1.1.4419.5 1 28.6734 2851.157 28.6859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.2900006771088 LSSPATLNSR Oxidation(P)@4; Deamidated(N)@8 0.00505740009248257 1061.54052734375 531.7775 1061.53527832031 531.77490234375 2 7 1.1.1.4433.11 1 29.0155 157.4866 28.9979 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9800003767014 LSSPATLNSR 0.00667718006297946 1044.56311035156 523.2888 1044.55639648438 523.285461425781 2 6 1.1.1.4720.8 1 35.8601 77.4878 35.8512 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.6800011396408 LSSPATLNSR Pro->pyro-Glu(P)@4 0.00102228997275233 1058.53662109375 530.2756 1058.53564453125 530.275085449219 2 9 1.1.1.4415.7 1 28.5799 1952.281 28.6859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.6800011396408 LSSPATLNSR Pro->pyro-Glu(P)@4 0.00102228997275233 1058.53662109375 530.2756 1058.53564453125 530.275085449219 2 10 1.1.1.4422.3 1 28.7466 1952.281 28.6859 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.6800011396408 LSSPATLNSR Oxidation(P)@4 -0.000645634019747376 1060.55065917969 531.2826 1060.55126953125 531.282897949219 2 9 1.1.1.4424.5 1 28.7902 1596.191 28.662 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 26.6099989414215 LSSPATLNSR Ammonia-loss(N)@8 0.00233159004710615 1027.5322265625 514.7734 1027.52978515625 514.772216796875 2 6 1.1.1.4472.14 1 29.9434 118.0963 29.9299 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.9799999594688 LSSPATLNSR Pro->pyro-Glu(P)@4 0.00102228997275233 1058.53662109375 530.2756 1058.53564453125 530.275085449219 2 7 1.1.1.4429.7 1 28.9134 2071.487 28.662 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 65.8900022506714 LSSPATLNSRVATVSLPR missed R-V@10 -11.0451002120972 1857.0029296875 465.258 1868.04797363281 468.019256591797 4 11 1.1.1.4597.6 1 32.9031 1062.026 32.9371 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.0040998300537467 1773.89392089844 887.9542 1773.88977050781 887.9521484375 2 26 1.1.1.5282.7 1 49.2062 1606.56 49.1485 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@36 cleaved H-N@N-term; missed K-I@16; missed K-L@36 0.059434000402689 5120.68359375 1025.144 5120.6240234375 1025.13208007813 5 12 1.1.1.5956.7 1 65.4375 1671.071 65.6693 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@36 cleaved H-N@N-term; missed K-I@16; missed K-L@36 0.059434000402689 5120.68359375 1025.144 5120.6240234375 1025.13208007813 5 15 1.1.1.5971.4 1 65.7809 1736.06 65.702 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@16; Deamidated(N)@30 cleaved H-N@N-term; missed K-I@16; missed K-L@36 0.068463496863842 5121.6787109375 1025.343 5121.60791015625 1025.32885742188 5 13 1.1.1.6005.2 1 66.4023 645.7855 66.5014 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0149180004373193 2855.41040039063 952.8107 2855.39526367188 952.8056640625 3 23 1.1.1.6017.2 1 66.5861 487.278 66.6701 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0149180004373193 2855.41040039063 952.8107 2855.39526367188 952.8056640625 3 23 1.1.1.6027.2 1 66.7531 463.7801 66.7249 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0149180004373193 2855.41040039063 952.8107 2855.39526367188 952.8056640625 3 21 1.1.1.6046.2 1 67.0747 538.0262 67.2069 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0145517997443676 2855.40966796875 952.8105 2855.39526367188 952.8056640625 3 22 1.1.1.6054.3 1 67.2477 546.6664 67.232 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 73.7999975681305 QVRLGEHNIDVLEGNEQFINAAK Oxidation(R)@3; GlycerylPE(E)@6 cleaved I-Q@N-term; missed R-L@3 0.00662333006039262 2806.37158203125 936.4645 2806.36499023438 936.462280273438 3 14 1.1.1.5194.6 1 47.09 1402.209 47.147 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 50.2099990844727 QVRLGEHNIDVLEGNEQFINAAK Gln->pyro-Glu@N-term; Dehydrated(D)@10 cleaved I-Q@N-term; missed R-L@3 -0.0485416017472744 2558.2392578125 853.7537 2558.28784179688 853.769836425781 3 12 1.1.1.5204.7 1 47.3311 370.0239 47.2924 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.3900007009506 QVSLNSGSHFCGGSLINSQWVVSAAHCYK Gln->pyro-Glu@N-term; Carbamidomethyl(C)@11; Deamidated(N)@17; Carbamidomethyl(C)@27; ONE addition +154(K)@29 cleaved Y-Q@N-term 0.0272794999182224 3330.57104492188 833.65 3330.54370117188 833.643249511719 4 10 1.1.1.5383.9 1 51.6072 747.6757 51.6391 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5599994659424 SSGSSYPSLLQCLK Phospho(S)@8; Deamidated(Q)@11; Carbamidomethyl(C)@12; acrolein addition +38(K)@14 0.026316199451685 1644.73681640625 823.3757 1644.71069335938 823.362609863281 2 11 1.1.1.5816.2 1 62.0342 1069.872 61.9799 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.3100028038025 SSGSSYPSLLQCLK Pro->pyro-Glu(P)@7; Deamidated(Q)@11; Carbamidomethyl(C)@12; MDA adduct +62(K)@14 0.00047502398956567 1602.72412109375 802.3693 1602.7236328125 802.369079589844 2 10 1.1.1.5600.2 1 56.8494 345.6705 56.8207 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 40.2700006961823 SSGSSYPSLLQCLK Deamidated(Q)@11; Carbamidomethyl(C)@12; acrolein addition +76(K)@14 -0.0359104983508587 1602.72412109375 802.3693 1602.76000976563 802.387268066406 2 7 1.1.1.5621.4 1 57.3707 369.9185 57.39 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.00198812992312014 2245.20068359375 749.4075 2245.19873046875 749.406860351563 3 19 1.1.1.5393.4 1 51.8491 889.1508 51.7368 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.00198812992312014 2245.20068359375 749.4075 2245.19873046875 749.406860351563 3 17 1.1.1.5396.6 1 51.9261 889.1508 51.7368 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.00890269037336111 2229.21264648438 744.0782 2229.20385742188 744.075256347656 3 20 1.1.1.5494.6 1 54.2093 13793.01 54.3294 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Methyl(K)@10 cleaved N-T@N-term; missed K-L@10 0.00694782985374331 2215.19482421875 739.4056 2215.18823242188 739.4033203125 3 13 1.1.1.5497.7 1 54.2868 1091.39 54.2779 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.00179728004150093 2229.20581054688 558.3087 2229.20385742188 558.308227539063 4 14 1.1.1.5499.3 1 54.335 574.9803 54.3294 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Deamidated(N)@4; reduced acrolein addition +58(K)@10 cleaved N-T@N-term; missed K-L@10 0.00869833026081324 2260.20727539063 754.4097 2260.19848632813 754.40673828125 3 10 1.1.1.5499.10 1 54.3409 159.7807 54.3294 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.00890269037336111 2229.21264648438 744.0782 2229.20385742188 744.075256347656 3 27 1.1.1.5501.4 1 54.3868 13793.01 54.3294 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10; Deamidated(N)@18 cleaved N-T@N-term; missed K-L@10 0.00706251012161374 2230.19482421875 744.4056 2230.18798828125 744.403259277344 3 18 1.1.1.5508.5 1 54.5645 1067.071 54.6577 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10; Deamidated(N)@18 cleaved N-T@N-term; missed K-L@10 0.00724561000242829 2230.19482421875 744.4056 2230.18798828125 744.403259277344 3 22 1.1.1.5522.8 1 54.9212 272.2527 54.9117 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 54.0199995040894 TLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@7; acrolein addition +76(K)@10 cleaved N-T@N-term; missed K-L@10 0.00516811013221741 2229.20581054688 558.3087 2229.20043945313 558.307373046875 4 7 1.1.1.5502.3 1 54.4115 574.9803 54.3294 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.8100011348724 VATVSLPR Dehydrated(T)@3 0.00597241008654237 823.497497558594 412.756 823.491577148438 412.753082275391 2 11 1.1.1.4581.4 1 32.5116 26316.98 32.3631 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.8100011348724 VATVSLPR Delta:H(4)C(2)@N-term 0.00750647019594908 869.541076660156 435.7778 869.533447265625 435.774017333984 2 13 1.1.1.4668.2 1 34.592 246663.1 34.516 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.2499976158142 VATVSLPR Dehydrated(T)@3 0.00597241008654237 823.497497558594 412.756 823.491577148438 412.753082275391 2 11 1.1.1.4574.3 1 32.343 26316.98 32.3631 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.2499976158142 VATVSLPR Dehydrated(T)@3 0.00597241008654237 823.497497558594 412.756 823.491577148438 412.753082275391 2 11 1.1.1.4623.2 1 33.5134 15404.04 33.271 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.6399977207184 VATVSLPR Oxidation(P)@7 0.00421623978763819 857.501281738281 429.7579 857.4970703125 429.755798339844 2 12 1.1.1.4576.4 1 32.3968 9175.171 32.3871 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.6399977207184 VATVSLPR Dehydrated(T)@3 0.00816959980875254 823.499694824219 412.7571 823.491577148438 412.753082275391 2 10 1.1.1.4645.3 1 34.0422 1610.459 34.0359 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.9699997901917 VATVSLPR Dehydrated(T)@3 0.00597241008654237 823.497497558594 412.756 823.491577148438 412.753082275391 2 12 1.1.1.4553.2 1 31.84 27694.55 31.8841 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.9699997901917 VATVSLPR Oxidation(P)@7 0.00385004002600908 857.500854492188 429.7577 857.4970703125 429.755798339844 2 12 1.1.1.4555.6 1 31.8913 10668.86 31.9081 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.9699997901917 VATVSLPR Oxidation(P)@7 0.00183594005648047 857.498901367188 429.7567 857.4970703125 429.755798339844 2 12 1.1.1.4562.3 1 32.0574 10352.51 32.0279 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.9699997901917 VATVSLPR Oxidation(P)@7 0.00366693991236389 857.500671386719 429.7576 857.4970703125 429.755798339844 2 12 1.1.1.4569.3 1 32.2258 9745.62 32.2674 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.9699997901917 VATVSLPR Oxidation(P)@7 0.00183594005648047 857.498901367188 429.7567 857.4970703125 429.755798339844 2 12 1.1.1.4583.5 1 32.5635 9173.496 32.6025 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.9699997901917 VATVSLPR Oxidation(P)@7 0.00201904005371034 857.499084472656 429.7568 857.4970703125 429.755798339844 2 12 1.1.1.4590.4 1 32.7293 9224.433 32.6503 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.9699997901917 VATVSLPR Dehydrated(T)@3 0.00414140988141298 823.495666503906 412.7551 823.491577148438 412.753082275391 2 11 1.1.1.4602.2 1 33.0125 18592.91 32.9848 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.9699997901917 VATVSLPR Delta:H(4)C(2)@N-term 0.00750647019594908 869.541076660156 435.7778 869.533447265625 435.774017333984 2 11 1.1.1.4669.4 1 34.6233 246663.1 34.516 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.9699997901917 VATVSLPR Deamidated(R)@8 0.0263737998902798 842.512451171875 422.2635 842.486145019531 422.250366210938 2 9 1.1.1.4731.5 1 36.1309 1018.078 36.1493 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.2399978637695 VATVSLPR Dehydrated(T)@3 0.00377520988695323 823.495300292969 412.7549 823.491577148438 412.753082275391 2 12 1.1.1.4560.2 1 32.0111 26838.91 32.0279 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 94.2399978637695 VATVSLPR Delta:H(4)C(2)@N-term 0.00750647019594908 869.541076660156 435.7778 869.533447265625 435.774017333984 2 12 1.1.1.4661.4 1 34.4274 246663.1 34.516 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.4499979019165 VATVSLPR Delta:H(4)C(2)@N-term 0.00787266995757818 869.54150390625 435.778 869.533447265625 435.774017333984 2 12 1.1.1.4654.4 1 34.2641 210218.3 34.4921 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 91.6899979114532 VATVSLPR Dioxidation(P)@7 0.00424173986539245 873.496276855469 437.7554 873.492004394531 437.753265380859 2 13 1.1.1.4571.6 1 32.2746 18876.25 32.2674 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.719997882843 VATVSLPR Dioxidation(P)@7 0.00466897990554571 873.496704101563 437.7556 873.492004394531 437.753265380859 2 13 1.1.1.4564.4 1 32.1069 17684.13 32.1477 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.719997882843 VATVSLPR Dioxidation(P)@7 0.00387555011548102 873.495849609375 437.7552 873.492004394531 437.753265380859 2 13 1.1.1.4578.4 1 32.4447 17874.65 32.411 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.719997882843 VATVSLPR Dehydrated(T)@3 0.00377520988695323 823.495300292969 412.7549 823.491577148438 412.753082275391 2 8 1.1.1.4631.2 1 33.703 9102.494 33.4618 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.719997882843 VATVSLPR Delta:H(4)C(2)@N-term 0.00591959990561008 869.539489746094 435.777 869.533447265625 435.774017333984 2 10 1.1.1.4703.10 1 35.4464 4217.602 35.1903 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.719997882843 VATVSLPR Delta:H(2)C(2)@N-term 0.0061884499154985 867.524047851563 434.7693 867.517822265625 434.766174316406 2 12 1.1.1.4844.5 1 38.8167 14432.13 38.8725 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.719997882843 VATVSLPR Delta:H(2)C(2)@N-term 0.0061884499154985 867.524047851563 434.7693 867.517822265625 434.766174316406 2 12 1.1.1.4852.6 1 38.9911 13439.39 38.9488 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.719997882843 VATVSLPR Delta:H(2)C(2)@N-term 0.0061884499154985 867.524047851563 434.7693 867.517822265625 434.766174316406 2 12 1.1.1.4860.4 1 39.158 13006.86 38.9252 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.6899998188019 VATVSLPR Oxidation(P)@7 0.00421623978763819 857.501281738281 429.7579 857.4970703125 429.755798339844 2 11 1.1.1.4597.3 1 32.8956 7935.689 32.9132 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.6899998188019 VATVSLPR Dehydrated(T)@3 0.00578931020572782 823.497497558594 412.756 823.491577148438 412.753082275391 2 10 1.1.1.4609.2 1 33.1793 17978.99 33.0564 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.5900020599365 VATVSLPR Pro->pyro-Glu(P)@7 0.00497369980439544 855.486450195313 428.7505 855.4814453125 428.747985839844 2 12 1.1.1.4552.8 1 31.8203 18911.64 31.9321 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.5900020599365 VATVSLPR Dehydrated(T)@3 0.00615550996735692 823.497680664063 412.7561 823.491577148438 412.753082275391 2 10 1.1.1.4595.4 1 32.8462 20030.68 32.7938 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.4400019645691 VATVSLPR Oxidation(P)@7 0.00403313990682364 857.501098632813 429.7578 857.4970703125 429.755798339844 2 11 1.1.1.4604.5 1 33.0651 7975.905 33.1041 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.2299978733063 VATVSLPR Dioxidation(P)@7 0.00405865022912622 873.49609375 437.7553 873.492004394531 437.753265380859 2 12 1.1.1.4592.6 1 32.7812 16163.45 32.7221 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.2299978733063 VATVSLPR Dioxidation(P)@7 0.00405865022912622 873.49609375 437.7553 873.492004394531 437.753265380859 2 12 1.1.1.4599.6 1 32.9509 16249.18 32.6982 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.2299978733063 VATVSLPR Dioxidation(P)@7 0.00405865022912622 873.49609375 437.7553 873.492004394531 437.753265380859 2 13 1.1.1.4613.4 1 33.2897 11926.71 33.2471 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.2299978733063 VATVSLPR Delta:H(4)C(2)@N-term 0.00567546999081969 869.539245605469 435.7769 869.533447265625 435.774017333984 2 11 1.1.1.4647.5 1 34.0952 39126.72 34.3238 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.2299978733063 VATVSLPR Delta:H(4)C(2)@N-term 0.0034782700240612 869.537048339844 435.7758 869.533447265625 435.774017333984 2 10 1.1.1.4689.7 1 35.1007 10919.25 34.8506 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.960001707077 VATVSLPR Oxidation(P)@7 -0.000544354028534144 857.496459960938 429.7555 857.4970703125 429.755798339844 2 7 1.1.1.4347.2 1 26.9307 120.1717 26.876 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.960001707077 VATVSLPR Dioxidation(P)@7 0.00442484999075532 873.496459960938 437.7555 873.492004394531 437.753265380859 2 12 1.1.1.4557.4 1 31.9393 19619.54 31.9081 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.960001707077 VATVSLPR Deamidated(R)@8 0.0272282008081675 842.513488769531 422.264 842.486145019531 422.250366210938 2 11 1.1.1.4559.5 1 31.9855 198976 31.9321 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.960001707077 VATVSLPR Deamidated(R)@8 0.0269840992987156 842.513244628906 422.2639 842.486145019531 422.250366210938 2 11 1.1.1.4587.6 1 32.6609 176171.4 32.5308 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.960001707077 VATVSLPR Deamidated(R)@8 0.026800999417901 842.513061523438 422.2638 842.486145019531 422.250366210938 2 11 1.1.1.4595.7 1 32.8504 143383.2 32.8416 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.960001707077 VATVSLPR Deamidated(R)@8 0.0266178995370865 842.512878417969 422.2637 842.486145019531 422.250366210938 2 11 1.1.1.4599.4 1 32.9459 133372.5 32.9848 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.960001707077 VATVSLPR Deamidated(R)@8 0.0266178995370865 842.512878417969 422.2637 842.486145019531 422.250366210938 2 11 1.1.1.4602.5 1 33.0175 133372.5 32.9848 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.960001707077 VATVSLPR Deamidated(R)@8 0.0266178995370865 842.512878417969 422.2637 842.486145019531 422.250366210938 2 11 1.1.1.4606.2 1 33.1078 130403 33.1279 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.960001707077 VATVSLPR Dehydrated(T)@3 0.00597241008654237 823.497497558594 412.756 823.491577148438 412.753082275391 2 10 1.1.1.4616.2 1 33.3463 15503.49 33.3425 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.960001707077 VATVSLPR Methyl(T)@3; Deamidated(R)@8 0.0231154002249241 856.52490234375 429.2697 856.501831054688 429.258178710938 2 13 1.1.1.4631.4 1 33.7055 75696.98 33.5336 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 83.4699988365173 VATVSLPR 0.000761662027798593 841.502868652344 421.7587 841.502136230469 421.758361816406 2 8 1.1.1.5490.2 1 54.1037 478.8033 54.1246 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.2700023651123 VATVSLPR Deamidated(R)@8 0.0272282008081675 842.513488769531 422.264 842.486145019531 422.250366210938 2 11 1.1.1.4558.3 1 31.9615 198976 31.9321 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.2700023651123 VATVSLPR Deamidated(R)@8 0.0272282008081675 842.513488769531 422.264 842.486145019531 422.250366210938 2 11 1.1.1.4565.2 1 32.1276 190881.3 32.0279 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.2700023651123 VATVSLPR Deamidated(R)@8 0.0269840992987156 842.513244628906 422.2639 842.486145019531 422.250366210938 2 11 1.1.1.4566.7 1 32.1565 193044.7 32.1955 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.2700023651123 VATVSLPR Deamidated(R)@8 0.0269840992987156 842.513244628906 422.2639 842.486145019531 422.250366210938 2 11 1.1.1.4573.4 1 32.3241 182975.7 32.3631 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.2700023651123 VATVSLPR Deamidated(R)@8 0.0269840992987156 842.513244628906 422.2639 842.486145019531 422.250366210938 2 11 1.1.1.4584.3 1 32.5841 176171.4 32.5308 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.2700023651123 VATVSLPR Deamidated(R)@8 0.026800999417901 842.513061523438 422.2638 842.486145019531 422.250366210938 2 11 1.1.1.4592.2 1 32.7737 175897.3 32.5308 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.2700023651123 VATVSLPR Dioxidation(P)@7 0.00405865022912622 873.49609375 437.7553 873.492004394531 437.753265380859 2 12 1.1.1.4620.4 1 33.4475 11926.71 33.2471 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.9300005435944 VATVSLPR 0.00338614010252059 841.505493164063 421.76 841.502136230469 421.758361816406 2 8 1.1.1.5505.2 1 54.4865 332.5034 54.457 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.9300005435944 VATVSLPR 0.00277578993700445 841.5048828125 421.7597 841.502136230469 421.758361816406 2 7 1.1.1.5619.2 1 57.3182 271.2037 57.2893 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.9300005435944 VATVSLPR 0.00234854989685118 841.504455566406 421.7595 841.502136230469 421.758361816406 2 8 1.1.1.5943.2 1 65.1059 107.6055 65.0752 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.8399975299835 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 0.0036895798984915 885.532043457031 443.7733 885.528381347656 443.771453857422 2 12 1.1.1.4661.5 1 34.429 4714.88 34.4921 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.8399975299835 VATVSLPR Delta:H(2)C(2)@N-term 0.00661568017676473 867.524475097656 434.7695 867.517822265625 434.766174316406 2 11 1.1.1.4893.3 1 39.9184 10782.35 39.671 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.3600022792816 VATVSLPR Oxidation(P)@7 -0.00414532003924251 857.492858886719 429.7537 857.4970703125 429.755798339844 2 6 1.1.1.4388.2 1 27.8964 177.9749 27.8913 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.3600022792816 VATVSLPR Pro->pyro-Glu(P)@7 0.032743901014328 855.514099121094 428.7643 855.4814453125 428.747985839844 2 8 1.1.1.4491.4 1 30.3826 0 -1 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.3600022792816 VATVSLPR Pro->pyro-Glu(P)@7 0.00497369980439544 855.486450195313 428.7505 855.4814453125 428.747985839844 2 12 1.1.1.4580.6 1 32.4968 16919.56 32.4829 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.3600022792816 VATVSLPR Delta:H(4)C(2)@N-term 0.00750647019594908 869.541076660156 435.7778 869.533447265625 435.774017333984 2 11 1.1.1.4666.5 1 34.5512 246663.1 34.516 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.3600022792816 VATVSLPR Delta:H(2)C(2)@N-term 0.0061884499154985 867.524047851563 434.7693 867.517822265625 434.766174316406 2 11 1.1.1.4836.2 1 38.622 12482.09 38.8488 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 79.3600022792816 VATVSLPR Delta:H(2)C(2)@N-term 0.0147941000759602 867.532653808594 434.7736 867.517822265625 434.766174316406 2 8 1.1.1.4919.4 1 40.5306 717.2156 40.3343 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 VATVSLPR Oxidation(P)@7 0.00421623978763819 857.501281738281 429.7579 857.4970703125 429.755798339844 2 8 1.1.1.4327.2 1 26.571 134.0185 26.6163 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 VATVSLPR Oxidation(P)@7 -0.00738009018823504 857.489685058594 429.7521 857.4970703125 429.755798339844 2 7 1.1.1.4380.4 1 27.7188 240.0643 27.46 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 VATVSLPR Dioxidation(P)@7 0.00405865022912622 873.49609375 437.7553 873.492004394531 437.753265380859 2 7 1.1.1.4417.4 1 28.6185 136.6833 28.6378 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 VATVSLPR Pro->pyro-Glu(P)@7 0.00472956988960505 855.486083984375 428.7503 855.4814453125 428.747985839844 2 12 1.1.1.4566.9 1 32.1598 19076.32 32.0039 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 VATVSLPR Pro->pyro-Glu(P)@7 0.00472956988960505 855.486083984375 428.7503 855.4814453125 428.747985839844 2 11 1.1.1.4587.7 1 32.6625 15893.88 32.6025 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 VATVSLPR Pro->pyro-Glu(P)@7 0.00692676985636353 855.48828125 428.7514 855.4814453125 428.747985839844 2 11 1.1.1.4591.3 1 32.7565 15294.89 32.7938 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 VATVSLPR Formyl@N-term 0.00385411991737783 869.501098632813 435.7578 869.4970703125 435.755798339844 2 11 1.1.1.4625.2 1 33.5644 7181.502 33.5336 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 VATVSLPR Delta:H(2)C(2)@N-term 0.00643257983028889 867.524291992188 434.7694 867.517822265625 434.766174316406 2 11 1.1.1.4877.3 1 39.5357 11832.54 39.6474 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 76.2499988079071 VATVSLPR Delta:H(2)C(2)@N-term 0.00643257983028889 867.524291992188 434.7694 867.517822265625 434.766174316406 2 11 1.1.1.4885.2 1 39.7246 11832.54 39.6474 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 75.0100016593933 VATVSLPR 0.00277578993700445 841.5048828125 421.7597 841.502136230469 421.758361816406 2 8 1.1.1.5996.2 1 66.2519 132.1004 66.2687 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 75.0100016593933 VATVSLPR -0.00161866995040327 841.50048828125 421.7575 841.502136230469 421.758361816406 2 8 1.1.1.6562.2 1 73.2619 141.315 73.2786 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 75.0100016593933 VATVSLPR 0.000151319007272832 841.502258300781 421.7584 841.502136230469 421.758361816406 2 7 1.1.1.6824.2 1 78.3322 162.7831 78.2737 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 74.6299982070923 VATVSLPR Pro->pyro-Glu(P)@7 0.00472956988960505 855.486083984375 428.7503 855.4814453125 428.747985839844 2 11 1.1.1.4559.7 1 31.9871 19076.32 32.0039 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 74.6299982070923 VATVSLPR Pro->pyro-Glu(P)@7 0.00778122991323471 855.4892578125 428.7519 855.4814453125 428.747985839844 2 11 1.1.1.4601.3 1 32.9886 14438.52 33.0087 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 72.9600012302399 VATVSLPR Dehydrated(T)@3 0.00438553979620337 823.495849609375 412.7552 823.491577148438 412.753082275391 2 10 1.1.1.4567.2 1 32.1755 28289 32.1955 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 72.9600012302399 VATVSLPR Pro->pyro-Glu(P)@7 0.00454647000879049 855.485900878906 428.7502 855.4814453125 428.747985839844 2 11 1.1.1.4573.5 1 32.3267 18850.5 32.2674 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 72.9600012302399 VATVSLPR Pro->pyro-Glu(P)@7 0.00692676985636353 855.48828125 428.7514 855.4814453125 428.747985839844 2 11 1.1.1.4594.5 1 32.8265 15294.89 32.7938 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 71.2499976158142 VATVSLPR Oxidation(P)@7 -0.00756317982450128 857.489501953125 429.752 857.4970703125 429.755798339844 2 6 1.1.1.4373.3 1 27.5415 240.889 27.46 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 71.2499976158142 VATVSLPR Pro->pyro-Glu(P)@7 0.0189503002911806 855.500244140625 428.7574 855.4814453125 428.747985839844 2 11 1.1.1.4608.3 1 33.1589 14271.82 33.1279 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 71.2499976158142 VATVSLPR Oxidation(P)@7 0.0184369999915361 857.515502929688 429.765 857.4970703125 429.755798339844 2 8 1.1.1.4674.8 1 34.7427 480.6872 34.6588 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 69.4999992847443 VATVSLPR Oxidation(P)@7 0.0102585004642606 857.507263183594 429.7609 857.4970703125 429.755798339844 2 6 1.1.1.4436.5 1 29.0769 150.922 29.1201 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 69.4999992847443 VATVSLPR Oxidation(P)@7 0.00842753984034061 857.505493164063 429.76 857.4970703125 429.755798339844 2 7 1.1.1.4520.4 1 31.0592 252.7949 30.9577 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 69.4999992847443 VATVSLPR Deamidated(R)@8 0.0272282008081675 842.513488769531 422.264 842.486145019531 422.250366210938 2 9 1.1.1.4551.3 1 31.7918 198976 31.9321 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 69.4999992847443 VATVSLPR Dioxidation(P)@7 0.00442484999075532 873.496459960938 437.7555 873.492004394531 437.753265380859 2 11 1.1.1.4585.3 1 32.608 14826.07 32.6025 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 69.4999992847443 VATVSLPR Formyl@N-term 0.0180748999118805 869.515258789063 435.7649 869.4970703125 435.755798339844 2 10 1.1.1.5061.4 1 43.8603 748.2025 43.8265 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 68.010002374649 VATVSLPR 0.00039545600884594 841.502502441406 421.7585 841.502136230469 421.758361816406 2 8 1.1.1.5422.2 1 52.5426 1303.185 52.3441 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 65.8900022506714 VATVSLPR Formyl@N-term -0.0317283011972904 869.465454101563 435.74 869.4970703125 435.755798339844 2 11 1.1.1.4583.6 1 32.566 1524.105 32.5786 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 65.8900022506714 VATVSLPR Delta:H(4)C(2)@N-term 0.00750647019594908 869.541076660156 435.7778 869.533447265625 435.774017333984 2 10 1.1.1.4659.5 1 34.3776 246663.1 34.516 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 64.029997587204 VATVSLPR Deamidated(R)@8 0.0263737998902798 842.512451171875 422.2635 842.486145019531 422.250366210938 2 10 1.1.1.4616.5 1 33.3513 119305.6 33.3187 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.1399998664856 VATVSLPR Deamidated(R)@8 0.0263737998902798 842.512451171875 422.2635 842.486145019531 422.250366210938 2 10 1.1.1.4623.4 1 33.5168 119305.6 33.3187 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.1399998664856 VATVSLPR Delta:H(2)C(2)@N-term 0.0127800004556775 867.530700683594 434.7726 867.517822265625 434.766174316406 2 10 1.1.1.4901.3 1 40.1078 853.5916 40.0976 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 60.2199971675873 VATVSLPR Deamidated(R)@8 0.0269840992987156 842.513244628906 422.2639 842.486145019531 422.250366210938 2 10 1.1.1.4577.2 1 32.4149 182975.7 32.3631 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 60.2199971675873 VATVSLPR Deamidated(R)@8 0.0266178995370865 842.512878417969 422.2637 842.486145019531 422.250366210938 2 10 1.1.1.4609.5 1 33.1844 130403 33.1279 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.2900006771088 VATVSLPR Dioxidation(P)@7 0.00186145002953708 873.493896484375 437.7542 873.492004394531 437.753265380859 2 8 1.1.1.4387.2 1 27.8712 158.4823 27.8657 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.2900006771088 VATVSLPR Pro->pyro-Glu(P)@7 0.0411664992570877 855.522644042969 428.7686 855.4814453125 428.747985839844 2 11 1.1.1.4615.3 1 33.3241 260033.6 33.5096 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.2900006771088 VATVSLPR Pro->pyro-Glu(P)@7 0.0409834012389183 855.5224609375 428.7685 855.4814453125 428.747985839844 2 11 1.1.1.4637.4 1 33.8493 158383.9 33.605 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.2900006771088 VATVSLPR Delta:H(4)C(2)@N-term 0.00750647019594908 869.541076660156 435.7778 869.533447265625 435.774017333984 2 9 1.1.1.4662.4 1 34.4514 246663.1 34.516 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.2900006771088 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 0.0036895798984915 885.532043457031 443.7733 885.528381347656 443.771453857422 2 11 1.1.1.4668.3 1 34.5945 4714.88 34.4921 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 56.2900006771088 VATVSLPR Delta:H(2)C(2)@N-term 0.00600535003468394 867.523864746094 434.7692 867.517822265625 434.766174316406 2 10 1.1.1.4869.4 1 39.3475 6910.43 39.1382 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.7799973487854 VATVSLPR 0.000761662027798593 841.502868652344 421.7587 841.502136230469 421.758361816406 2 10 1.1.1.5366.3 1 51.1836 1621.887 51.2004 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.7799973487854 VATVSLPR -0.00222901999950409 841.499877929688 421.7572 841.502136230469 421.758361816406 2 8 1.1.1.6574.2 1 73.4765 129.8562 73.5157 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 50.2099990844727 VATVSLPR Pro->pyro-Glu(P)@7 0.0427533015608788 855.524047851563 428.7693 855.4814453125 428.747985839844 2 11 1.1.1.4622.3 1 33.4896 268746.8 33.5336 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 48.1299996376038 VATVSLPR Pro->pyro-Glu(P)@7 0.0373824015259743 855.518859863281 428.7667 855.4814453125 428.747985839844 2 8 1.1.1.4716.5 1 35.7623 459.8167 35.6302 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.0500001907349 VATVSLPR Oxidation(R)@8 0.00201904005371034 857.499084472656 429.7568 857.4970703125 429.755798339844 2 9 1.1.1.4548.2 1 31.7227 10618.12 31.9081 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.0500001907349 VATVSLPR Formyl@N-term 0.00385411991737783 869.501098632813 435.7578 869.4970703125 435.755798339844 2 10 1.1.1.4618.3 1 33.4006 7181.502 33.5336 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.0500001907349 VATVSLPR Formyl@N-term 0.00409825006499887 869.501281738281 435.7579 869.4970703125 435.755798339844 2 9 1.1.1.4640.3 1 33.9213 2950.534 33.6763 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.0500001907349 VATVSLPR Dioxidation(P)@7 0.0068661798723042 873.498901367188 437.7567 873.492004394531 437.753265380859 2 10 1.1.1.4655.6 1 34.2914 896.9265 34.0838 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.0500001907349 VATVSLPR Pro->pyro-Glu(P)@7 0.0417767986655235 855.523254394531 428.7689 855.4814453125 428.747985839844 2 9 1.1.1.4687.6 1 35.0554 1238.057 35.0688 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.4399992227554 VATVSLPR 0.000944764993619174 841.503051757813 421.7588 841.502136230469 421.758361816406 2 8 1.1.1.5380.2 1 51.5204 1339.367 51.4924 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.4399992227554 VATVSLPR 0.00039545600884594 841.502502441406 421.7585 841.502136230469 421.758361816406 2 8 1.1.1.5401.2 1 52.0316 1462.385 52.0283 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.4399992227554 VATVSLPR 0.00259269005618989 841.504699707031 421.7596 841.502136230469 421.758361816406 2 8 1.1.1.5528.2 1 55.0666 417.7948 55.0368 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.4399992227554 VATVSLPR -0.0014355699531734 841.500671386719 421.7576 841.502136230469 421.758361816406 2 8 1.1.1.6497.2 1 72.3359 122.3738 72.3171 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.4399992227554 VATVSLPR -0.00161866995040327 841.50048828125 421.7575 841.502136230469 421.758361816406 2 8 1.1.1.6686.2 1 75.2312 164.338 75.1705 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 43.4399992227554 VATVSLPR -0.00125246995594352 841.500854492188 421.7577 841.502136230469 421.758361816406 2 8 1.1.1.6735.2 1 76.3439 176.106 76.3343 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 41.8099999427795 VATVSLPR Delta:H(4)C(2)@N-term 0.00408860016614199 869.537658691406 435.7761 869.533447265625 435.774017333984 2 9 1.1.1.4682.9 1 34.9321 47365.06 34.6827 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.6800011396408 VATVSLPR Pro->pyro-Glu(P)@7 0.0395796000957489 855.521057128906 428.7678 855.4814453125 428.747985839844 2 10 1.1.1.4673.5 1 34.7154 3859.841 34.4681 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 39.6800011396408 VATVSLPR Formyl@N-term 0.0163049008697271 869.513488769531 435.764 869.4970703125 435.755798339844 2 9 1.1.1.5068.2 1 44.0249 578.8366 43.9951 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 35.6099992990494 VATVSLPR 0.000151319007272832 841.502258300781 421.7584 841.502136230469 421.758361816406 2 8 1.1.1.5373.2 1 51.3493 1361.307 51.2972 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.1900000572205 VATVSLPR Carbamyl@N-term 0.0127072995528579 884.520690917969 443.2676 884.507995605469 443.261260986328 2 9 1.1.1.4662.6 1 34.4547 3046.884 34.4921 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.8100004196167 VATVSLPR Dioxidation(P)@7 0.016448400914669 873.508483886719 437.7615 873.492004394531 437.753265380859 2 7 1.1.1.4696.7 1 35.2712 264.609 35.3125 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.8100004196167 VATVSLPR Delta:H(2)C(2)@N-term 0.0147941000759602 867.532653808594 434.7736 867.517822265625 434.766174316406 2 9 1.1.1.4910.4 1 40.3225 717.2156 40.3343 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.6500006914139 VATVSLPR -0.00204591010697186 841.500061035156 421.7573 841.502136230469 421.758361816406 2 8 1.1.1.6595.2 1 73.7605 109.6221 73.7424 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.6500006914139 VATVSLPR 0.00234854989685118 841.504455566406 421.7595 841.502136230469 421.758361816406 2 8 1.1.1.6726.2 1 76.1709 173.0883 76.1087 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 26.6099989414215 VATVSLPR Dioxidation(P)@7 0.00442484999075532 873.496459960938 437.7555 873.492004394531 437.753265380859 2 10 1.1.1.4606.4 1 33.1112 12651.59 33.0802 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 26.6099989414215 VATVSLPR Delta:H(4)C(2)@N-term 0.00610269978642464 869.539672851563 435.7771 869.533447265625 435.774017333984 2 7 1.1.1.4710.6 1 35.6169 3302.494 35.3615 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.9799999594688 VATVSLPR Amidated@C-term 0.00288851000368595 840.521057128906 421.2678 840.518127441406 421.266357421875 2 8 1.1.1.4506.3 1 30.7256 880.8223 30.7679 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.9799999594688 VATVSLPR Dehydrated(T)@3 0.00597241008654237 823.497497558594 412.756 823.491577148438 412.753082275391 2 6 1.1.1.4638.3 1 33.8733 2701.166 33.7478 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.0000007152557 VATVSLPR 0.000151319007272832 841.502258300781 421.7584 841.502136230469 421.758361816406 2 9 1.1.1.6609.2 1 73.9359 148.8019 73.941 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.0000007152557 VATVSLPR 0.00259269005618989 841.504699707031 421.7596 841.502136230469 421.758361816406 2 8 1.1.1.6755.2 1 76.6956 157.8861 76.5593 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.5499994754791 VATVSLPR Delta:H(4)C(2)@N-term 0.00750647019594908 869.541076660156 435.7778 869.533447265625 435.774017333984 2 9 1.1.1.4675.5 1 34.76 243734.3 34.516 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 80.7799994945526 VATVSLPRSCAAAGTECLISGWGN Carbamidomethyl(C)@10; Carbamidomethyl(C)@17; Octanoyl(S)@20; Deamidated(N)@24 cleaved N-T@C-term; missed R-S@8 0.0281955990940332 2603.30053710938 868.7741 2603.2724609375 868.764709472656 3 12 1.1.1.5369.2 1 51.2594 758.5909 51.2972 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.0227186009287834 1869.84301757813 935.9288 1869.8203125 935.917419433594 2 16 1.1.1.5947.3 1 65.2175 1739.181 65.322 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.0227186009287834 1869.84301757813 935.9288 1869.8203125 935.917419433594 2 17 1.1.1.5950.3 1 65.2821 1739.181 65.322 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.00820656958967447 1869.82836914063 624.2834 1869.8203125 624.280700683594 3 15 1.1.1.5952.2 1 65.3301 475.2677 65.3469 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.0227186009287834 1869.84301757813 935.9288 1869.8203125 935.917419433594 2 17 1.1.1.5959.3 1 65.5082 1739.181 65.322 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.0269910991191864 1869.84729003906 935.9309 1869.8203125 935.917419433594 2 16 1.1.1.5966.4 1 65.6855 911.9087 65.4204 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamidomethyl(C)@2; Nitro(Y)@4; Dioxidation(W)@7 0.0127060003578663 1869.84423828125 935.9294 1869.83154296875 935.923034667969 2 14 1.1.1.5977.4 1 65.8583 226.8351 65.8085 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 51.5100002288818 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAH Carbamidomethyl(C)@6; Ammonia-loss(N)@18; Carbamidomethyl(C)@24 cleaved I-V@N-term; cleaved H-C@C-term 0.0548122003674507 4077.92700195313 1020.489 4077.87377929688 1020.47570800781 4 11 1.1.1.5561.12 1 55.9007 665.1951 55.9637 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@6; Glucuronyl(S)@10; Carbamidomethyl(C)@24; Deamidated(N)@30; Carbamidomethyl(C)@40; ONE addition +154(K)@42 cleaved I-V@N-term 0.00724706007167697 4877.2119140625 813.8759 4877.20458984375 813.874755859375 6 14 1.1.1.5507.3 1 54.5394 6143.901 54.5578 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 69.5800006389618 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@6; Glucuronyl(S)@10; Carbamidomethyl(C)@24; Deamidated(N)@30; Carbamidomethyl(C)@40; ONE addition +154(K)@42 cleaved I-V@N-term 0.033882599323988 4877.23876953125 976.455 4877.20458984375 976.4482421875 5 13 1.1.1.5501.12 1 54.3935 38527.14 54.5578 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 50.6699979305267 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@6; Ammonia-loss(N)@18; Carbamidomethyl(C)@24; reduced HNE(H)@39; Carbamidomethyl(C)@40; acrolein addition +56(K)@42 cleaved I-V@N-term 0.0102513004094362 4743.22998046875 949.6533 4743.2197265625 949.651184082031 5 9 1.1.1.5650.7 1 58.0942 359.7792 58.1109 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@6; Ammonia-loss(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@40; MDA adduct +62(K)@42; Carbamyl(R)@44 cleaved I-V@N-term; missed K-S@42 0.0182600002735853 4877.23583984375 976.4544 4877.21728515625 976.450744628906 5 14 1.1.1.5536.9 1 55.2741 34805.23 55.3646 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@6; Ammonia-loss(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@40; MDA adduct +62(K)@42; Carbamyl(R)@44 cleaved I-V@N-term; missed K-S@42 0.0182600002735853 4877.23583984375 976.4544 4877.21728515625 976.450744628906 5 15 1.1.1.5543.12 1 55.4521 34805.23 55.3646 2 110.73 110.73 80.7200014591217 80.7200014591217 73.5400021076202 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 YVNWIQQTIAAN cleaved N-Y@N-term 0.00586100993677974 1419.720703125 710.8676 1419.71472167969 710.864624023438 2 7 1.1.1.5516.5 1 54.765 2655.052 54.9117 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 AALGKLPQQANDYLNSFNWER Dioxidation(W)@19 missed K-L@5 0.0132339000701904 2466.2060546875 823.0759 2466.19287109375 823.071533203125 3 25 1.1.1.5403.6 1 52.0959 305.8953 52.1253 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 HIQNIDIQHLAGK -0.00027883899747394 1485.80493164063 496.2756 1485.80517578125 496.275665283203 3 18 1.1.1.4708.5 1 35.5694 224.3621 35.582 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 HSITNPLAVLCEFISQSIK Carbamidomethyl(C)@11 0.00523396022617817 2156.13525390625 719.719 2156.1298828125 719.71728515625 3 25 1.1.1.6622.3 1 74.1333 185.7298 74.1192 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 IAELSATAQEIIK 0.00304740993306041 1385.77966308594 693.8971 1385.77661132813 693.895568847656 2 16 1.1.1.5177.7 1 46.6704 367.075 46.7115 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 IGQDGISTSATTNLK -0.00170967995654792 1504.77172851563 753.3931 1504.77331542969 753.393920898438 2 17 1.1.1.4637.12 1 33.8627 126.3345 33.8677 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 MTSNFPVDLSDYPK Oxidation(M)@1 0.00255889003165066 1628.74182128906 815.3782 1628.7392578125 815.376892089844 2 14 1.1.1.5196.15 1 47.1369 445.3477 47.147 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 NLQNNAEWVYQGAIR Dioxidation(W)@8 -0.0179708991199732 1806.84692382813 904.4307 1806.86486816406 904.439758300781 2 18 1.1.1.5114.12 1 45.1496 470.0201 45.2522 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 QVFLYPEKDEPTYILNIKR missed K-D@8; missed K-R@18 -0.00238934997469187 2365.26586914063 592.3237 2365.26806640625 592.324340820313 4 18 1.1.1.5302.2 1 49.6908 454.5339 49.6318 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 SVSDGIAALDLNAVANK -0.000552389014046639 1656.86791992188 829.4412 1656.86828613281 829.44140625 2 25 1.1.1.5320.4 1 50.0733 172.7145 50.0341 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 YKSVSLPSLDPASAKIEGNLIFDPNNYLPK MDA adduct +54(K)@2; MDA adduct +62(K)@15; Deamidated(N)@26; acrolein addition +38(K)@30 cleaved L-Y@N-term; missed K-S@2; missed K-I@15 0.0414605997502804 3444.791015625 862.205 3444.74926757813 862.194580078125 4 12 1.1.1.5790.3 1 61.3807 342.8983 61.3694 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 1.49484992027283 99.0000009536743 KGNVATEISTER missed K-G@1 0.00224714004434645 1303.67553710938 435.5658 1303.67321777344 435.565002441406 3 14 1.1.1.4363.2 1 27.2923 273.6427 27.3091 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 1.36653172969818 99.0000009536743 TGISPLALIK 0.000792810984421521 1011.63366699219 506.8241 1011.6328125 506.823699951172 2 15 1.1.1.5411.2 1 52.2745 1385.291 52.271 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.872895181179047 99.0000009536743 TLQGIPQMIGEVIR Oxidation(M)@8 0.00753076979890466 1569.86242675781 785.9385 1569.85485839844 785.934692382813 2 16 1.1.1.5386.12 1 51.6781 771.5917 51.6391 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.853872001171112 98.4000027179718 GTYGLSCQRDPNTGR Carbamidomethyl(C)@7 missed R-D@9 -0.0047765402123332 1680.75915527344 561.2603 1680.76379394531 561.261901855469 3 12 1.1.1.4365.6 1 27.3499 108.4599 27.3583 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.769551038742065 98.0000019073486 TEVIPPLIENR 0.00452311988919973 1279.71801757813 640.8663 1279.71362304688 640.864074707031 2 10 1.1.1.5167.2 1 46.4218 565.7013 46.3457 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.628932118415833 99.0000009536743 MNFKQELNGNTK Oxidation(M)@1 missed K-Q@4 0.000474914006190374 1438.68786621094 480.5699 1438.6875 480.569763183594 3 10 1.1.1.4366.6 1 27.3734 116.076 27.3583 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.406713902950287 93.9599990844727 TGLKEFLK missed K-E@4 0.00405716989189386 934.552856445313 468.2837 934.548767089844 468.281646728516 2 8 1.1.1.4705.6 1 35.4961 164.9576 35.5338 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.0273344088345766 39.4300013780594 ALVDTLKFVTQAEGAK missed K-F@7 0.014813800342381 1689.94482421875 845.9797 1689.93017578125 845.972351074219 2 11 1.1.1.5395.4 1 51.8977 106.0026 51.8826 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.00788851175457239 45.6200003623962 MGLAFESTK Oxidation(M)@1 -0.0130823999643326 998.461303710938 500.2379 998.474304199219 500.244415283203 2 11 1.1.1.4525.5 1 31.1855 0 -1 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.00261361571028829 99.0000009536743 DLVITLPFELRKHK Oxidation(P)@7; MDA adduct +54(K)@12; acrolein addition +76(K)@14 cleaved Q-D@N-term; missed R-K@11; missed K-H@12 -0.000922905979678035 1854.03942871094 928.027 1854.04040527344 928.027465820313 2 9 1.1.1.5494.14 1 54.216 504.1033 54.2779 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.000434511806815863 18.8700005412102 PLPFGGKSSRDLK MDA adduct +54(K)@7; reduced acrolein addition +96(K)@13 cleaved I-P@N-term; missed K-S@7; missed R-D@10 -0.000854097015690058 1550.84484863281 776.4297 1550.845703125 776.430114746094 2 8 1.1.1.5204.5 1 47.3261 293.4786 47.3655 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 88.510000705719 FLDSNIKFSHVEKL Carbamyl(K)@7 cleaved L-G@C-term; missed K-F@7; missed K-L@13 0.00842848978936672 1718.90771484375 860.4611 1718.89916992188 860.456848144531 2 11 1.1.1.6785.3 1 77.4463 202.0615 77.4597 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 62.1399998664856 LKDLSK Carbamidomethyl@N-term; reduced acrolein addition +58(K)@2; acrolein addition +38(K)@6 cleaved L-L@N-term; missed K-D@2 0.0171739999204874 855.523681640625 428.7691 855.506591796875 428.760559082031 2 7 1.1.1.4682.7 1 34.9305 2083.239 34.6827 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 96.4999973773956 QVFLYPEKDEPTYILNIKR missed K-D@8; missed K-R@18 0.00361666991375387 2365.27172851563 789.4312 2365.26806640625 789.429992675781 3 13 1.1.1.5301.6 1 49.6676 216.6515 49.6318 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 98.5300004482269 TGISPLALIK 0.000792810984421521 1011.63366699219 506.8241 1011.6328125 506.823699951172 2 14 1.1.1.5404.3 1 52.1202 1385.291 52.271 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 28.6500006914139 TGISPLALIK 0.000792810984421521 1011.63366699219 506.8241 1011.6328125 506.823699951172 2 8 1.1.1.5418.2 1 52.4459 1385.291 52.271 3 26.44 26.44 40.0400012731552 6.39899969100952 5.78599981963634 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 26.6099989414215 TISEQNIQR cleaved L-T@N-term -0.0242532007396221 1087.53784179688 544.7762 1087.56213378906 544.788391113281 2 9 1.1.1.4298.2 1 25.9827 3072.265 25.8925 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 DALSSVQESQVAQQAR -0.000545007002074271 1715.84326171875 572.955 1715.84387207031 572.955200195313 3 24 1.1.1.4745.7 1 36.4801 19758.57 36.2995 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK MDA adduct +62(K)@27; Bromo(W)@30; acrolein addition +76(K)@34 missed R-G@16; missed K-D@27 0.0365188010036945 3988.82739257813 998.2141 3988.79077148438 998.204956054688 4 17 1.1.1.5748.5 1 60.4543 517.4251 60.4863 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK acrolein addition +112(K)@27; Bromo(W)@30 missed R-G@16; missed K-D@27; missed K-D@34 -0.0117474999278784 4205.90576171875 842.1885 4205.91796875 842.19091796875 5 13 1.1.1.5548.6 1 55.5712 1681.819 55.6378 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 MQGYMKHATKTAKDALSSVQESQVAQQAR Oxidation(M)@5; acrolein addition +112(K)@10; acrolein addition +112(K)@13 cleaved F-M@N-term; missed K-H@6; missed K-T@10; missed K-D@13 -0.0112536996603012 3431.66918945313 1144.897 3431.68139648438 1144.90100097656 3 15 1.1.1.4736.20 1 36.2693 546.9948 36.2744 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 SSVQESQVAQQAR cleaved L-S@N-term 0.00185563997365534 1416.69763183594 709.3561 1416.69567871094 709.355163574219 2 16 1.1.1.4736.16 1 36.2651 111.9518 36.2744 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00502261007204652 2016.01867675781 673.0135 2016.02355957031 673.01513671875 3 28 1.1.1.4621.4 1 33.4805 15733.15 33.4141 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK Delta:H(2)C(2)(K)@30; Iodo(Y)@32; reduced acrolein addition +96(K)@37 missed K-D@3; missed R-G@19; missed K-D@30 -0.0206043999642134 4320.9619140625 865.1997 4320.98291015625 865.203857421875 5 16 1.1.1.5525.7 1 54.9985 787.0228 55.0368 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Bromo(W)@33; acrolein addition +112(K)@39 missed K-D@3; missed R-G@19; missed K-D@30; missed K-D@37 -0.0393964983522892 4506.05859375 752.017 4506.09765625 752.023620605469 6 19 1.1.1.5472.3 1 53.6588 746.0583 53.6755 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.645891547203064 99.0000009536743 SLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR HPNE addition +172(K)@15; acrolein addition +112(K)@18 cleaved A-S@N-term; missed K-H@11; missed K-T@15; missed K-D@18 -0.0295970998704433 4023.01513671875 805.6103 4023.04443359375 805.6162109375 5 11 1.1.1.5820.4 1 62.1327 319.3976 62.1274 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 98.9099979400635 ATKTAKDALSSVQESQVAQQAR Carbamidomethyl@N-term; acrolein addition +56(K)@6; Oxidation(D)@7 cleaved H-A@N-term; missed K-T@3; missed K-D@6 -0.00423535984009504 2445.24169921875 612.3177 2445.24584960938 612.318786621094 4 16 1.1.1.4678.5 1 34.838 499.752 34.8747 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR 0.00114337995182723 1715.84484863281 858.9297 1715.84387207031 858.92919921875 2 25 1.1.1.4731.21 1 36.1442 21220.07 36.2995 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Cation:Na(E)@8 -0.00108575995545834 1737.82482910156 580.2822 1737.82580566406 580.282531738281 3 20 1.1.1.4734.10 1 36.2107 839.1085 36.3237 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Methyl(S)@5 -0.0316735990345478 1729.82788085938 865.9212 1729.85949707031 865.93701171875 2 18 1.1.1.4735.10 1 36.2441 362.7962 36.2995 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR 0.00114337995182723 1715.84484863281 858.9297 1715.84387207031 858.92919921875 2 26 1.1.1.4738.6 1 36.3185 21220.07 36.2995 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Cation:Na(E)@8 -0.00108575995545834 1737.82482910156 580.2822 1737.82580566406 580.282531738281 3 21 1.1.1.4742.5 1 36.4105 839.1085 36.3237 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Deamidated(Q)@7; Methyl(E)@8 -0.0126604000106454 1730.83093261719 866.4227 1730.84350585938 866.429016113281 2 15 1.1.1.4742.6 1 36.4138 420.6818 36.3237 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 96.2499976158142 DALSSVQESQVAQQAR Deamidated(Q)@7; Cation:Na(E)@8 0.00895159970968962 1738.81872558594 580.6135 1738.80981445313 580.610534667969 3 14 1.1.1.4735.7 1 36.2375 696.4318 36.2995 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK acrolein addition +76(K)@27; Bromo(W)@30; acrolein addition +94(K)@34 missed R-G@16; missed K-D@27 -0.0157303009182215 4020.80297851563 1006.208 4020.81689453125 1006.21148681641 4 18 1.1.1.5651.3 1 58.1246 795.674 58.0864 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK acrolein addition +76(K)@27; Bromo(W)@30; acrolein addition +94(K)@34 missed R-G@16; missed K-D@27 -0.00889431033283472 4020.80688476563 1006.209 4020.81689453125 1006.21148681641 4 22 1.1.1.5658.5 1 58.2987 1601.697 58.2826 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 0.00268296990543604 2016.02551269531 1009.02 2016.02355957031 1009.01910400391 2 26 1.1.1.4614.10 1 33.3136 5151.035 33.4141 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 0.00268296990543604 2016.02551269531 1009.02 2016.02355957031 1009.01910400391 2 16 1.1.1.4620.7 1 33.4567 5151.035 33.4141 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR acrolein addition +56(K)@3; Ser->LacticAcid(S)@8 missed K-D@3 0.00121174997184426 2057.0400390625 686.6873 2057.03881835938 686.686889648438 3 20 1.1.1.4652.13 1 34.2228 616.1054 34.2039 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR Formyl@N-term; reduced acrolein addition +58(K)@3 missed K-D@3 -0.0232069008052349 2102.037109375 701.6863 2102.06030273438 701.694091796875 3 17 1.1.1.5169.7 1 46.4865 255.5059 46.5162 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK Delta:H(2)C(2)(K)@30; Iodo(Y)@32; reduced acrolein addition +96(K)@37 missed K-D@3; missed R-G@19; missed K-D@30 -0.0050404598005116 4320.9775390625 865.2028 4320.98291015625 865.203857421875 5 16 1.1.1.5539.10 1 55.3504 692.468 55.3646 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 69.5800006389618 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK acrolein addition +94(K)@30; Dichloro(Y)@32; MDA adduct +54(K)@37 missed K-D@3; missed R-G@19; missed K-D@30 -0.0101530002430081 4288.97705078125 858.8027 4288.9873046875 858.804809570313 5 12 1.1.1.5608.6 1 57.05 526.0092 57.1164 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK reduced acrolein addition +58(K)@30; Bromo(W)@33; MDA adduct +54(K)@39 missed K-D@3; missed R-G@19; missed K-D@30; missed K-D@37 0.00303207989782095 4506.10107421875 902.2275 4506.09765625 902.226867675781 5 19 1.1.1.5463.6 1 53.4457 769.5801 53.4583 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK reduced acrolein addition +58(K)@30; Bromo(W)@33; MDA adduct +54(K)@39 missed K-D@3; missed R-G@19; missed K-D@30; missed K-D@37 -0.00398697005584836 4506.09375 902.2261 4506.09765625 902.226867675781 5 22 1.1.1.5470.5 1 53.6189 993.51 53.6755 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Deamidated(Q)@13; Deamidated(Q)@17; Phospho(S)@28; acrolein addition +76(K)@39 missed K-D@3; missed R-G@19; missed K-D@30; missed K-D@37 0.0148077998310328 4474.11572265625 895.8304 4474.1005859375 895.827392578125 5 13 1.1.1.5521.12 1 54.8991 483.3176 54.9117 4 16.65 16.65 54.5499980449677 54.5499980449677 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 58.9100003242493 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK reduced acrolein addition +96(K)@30; MDA adduct +62(K)@39 missed K-D@3; missed R-G@19; missed K-D@30; missed K-D@37 -0.120860002934933 4474.08740234375 746.6885 4474.2080078125 746.708618164063 6 10 1.1.1.5527.5 1 55.0432 458.0552 55.0368 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 GGKYAATSQVLLPSK Carbamyl@N-term; HPNE addition +172(K)@3 missed K-Y@3 0.0164381004869938 1733.97290039063 867.9937 1733.95629882813 867.985473632813 2 12 1.1.1.5416.12 1 52.4055 198.4006 52.4172 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 STGKPTLYNVSLVMSDTAGTC Oxidation(M)@14; Carbamidomethyl(C)@21 cleaved C-Y@C-term -0.00464374013245106 2217.025390625 1109.52 2217.029296875 1109.52197265625 2 17 1.1.1.5183.3 1 46.8277 967.476 46.7602 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 STGKPTLYNVSLVMSDTAGTCY Oxidation(M)@14; Carbamidomethyl(C)@21 -0.00871460977941751 2380.083984375 794.3686 2380.0927734375 794.371520996094 3 19 1.1.1.5284.4 1 49.2603 1999.816 49.3664 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTC Carbamidomethyl(C)@25 cleaved C-Y@C-term; missed K-S@4 -0.00234454008750618 2644.27026367188 882.4307 2644.2724609375 882.431396484375 3 20 1.1.1.5328.8 1 50.2709 628.8389 50.3002 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 -0.0126537000760436 2823.31811523438 706.8368 2823.33056640625 706.839965820313 4 19 1.1.1.5192.6 1 47.0366 648.8753 47.0258 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00409300997853279 1318.75390625 660.3842 1318.74963378906 660.382080078125 2 18 1.1.1.5038.8 1 43.3169 19507.47 43.0588 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0.57511842250824 99.0000009536743 QTISRPKGVALHRPDVYLLPPAR Gln->pyro-Glu@N-term; acrolein addition +56(K)@7; Oxidation(P)@14 missed K-G@7 -0.00271248002536595 2638.46826171875 528.7009 2638.470703125 528.701416015625 5 16 1.1.1.4709.11 1 35.596 4739.821 35.6302 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 GGKYAATSQVLLPSK Lys-add@N-term; acrolein addition +56(K)@3 missed K-Y@3 0.00205043004825711 1702.96398925781 568.6619 1702.96179199219 568.661193847656 3 16 1.1.1.4917.4 1 40.4949 913.9916 40.4526 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 74.6299982070923 GGKYAATSQVLLPSK hexanoyl addition +98(K)@3; Nitro(Y)@4 missed K-Y@3 0.0369242988526821 1661.935546875 554.9858 1661.89880371094 554.973571777344 3 13 1.1.1.4895.7 1 39.9716 744.3968 39.9791 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 38.4999990463257 GGKYAATSQVLLPSK Carbamidomethyl@N-term; HPNE addition +172(K)@3 missed K-Y@3 0.01214690040797 1747.98413085938 874.9993 1747.97204589844 874.993286132813 2 7 1.1.1.5513.3 1 54.6875 762.9706 54.7834 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 98.769998550415 QTISRPKGVALHRPDVYLLPPAR Gln->pyro-Glu@N-term; acrolein addition +56(K)@7; Oxidation(P)@14 missed K-G@7 -0.00271248002536595 2638.46826171875 528.7009 2638.470703125 528.701416015625 5 14 1.1.1.4716.8 1 35.7673 4739.821 35.6302 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 24.4100004434586 RGGKYAATSQVLLPSK Deamidated(R)@1 cleaved L-R@N-term; missed R-G@1; missed K-Y@4 -0.00144861999433488 1675.92419433594 559.6487 1675.92565917969 559.649169921875 3 10 1.1.1.4861.6 1 39.186 493.9339 39.3152 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 STGKPTLYNVSLVMSDTAGTC Oxidation(M)@14; Carbamidomethyl(C)@21 cleaved C-Y@C-term 0.00182984001003206 2217.03100585938 740.0176 2217.029296875 740.017028808594 3 18 1.1.1.5185.3 1 46.8759 397.068 46.7359 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 98.769998550415 STGKPTLYNVSLVMSDTAGTC Oxidation(D)@16; Carbamidomethyl(C)@21 cleaved C-Y@C-term -0.00464374013245106 2217.025390625 1109.52 2217.029296875 1109.52197265625 2 14 1.1.1.5176.13 1 46.6577 967.476 46.7602 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 STGKPTLYNVSLVMSDTAGTCY Oxidation(M)@14; Carbamidomethyl(C)@21 -0.00248736003413796 2380.08935546875 1191.052 2380.0927734375 1191.05358886719 2 19 1.1.1.5289.9 1 49.3854 3266.034 49.3664 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 STGKPTLYNVSLVMSDTAGTCY Oxidation(M)@14; Carbamidomethyl(C)@21 -0.00248736003413796 2380.08935546875 1191.052 2380.0927734375 1191.05358886719 2 13 1.1.1.5296.9 1 49.5543 3266.034 49.3664 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 96.4999973773956 STGKPTLYNVSLVMSDTAGTCY Oxidation(M)@14; Carbamidomethyl(C)@21 -0.00248736003413796 2380.08935546875 1191.052 2380.0927734375 1191.05358886719 2 12 1.1.1.5282.13 1 49.2162 3266.034 49.3664 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 81.5599977970123 TISRPKGVALHRPDVYLLPPAR MDA adduct +54(K)@6; Deamidated(R)@12 cleaved Q-T@N-term; missed K-G@6 -0.0356789007782936 2510.37646484375 628.6014 2510.412109375 628.610290527344 4 13 1.1.1.4800.5 1 37.7746 1486.367 37.8034 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTC Oxidation(M)@18; Carbamidomethyl(C)@25 cleaved C-Y@C-term; missed K-S@4 -0.00757153006270528 2660.26000976563 887.7606 2660.26733398438 887.763061523438 3 24 1.1.1.5092.11 1 44.6127 2435.908 44.7195 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTC Oxidation(M)@18; Carbamidomethyl(C)@25 cleaved C-Y@C-term; missed K-S@4 -0.00757153006270528 2660.26000976563 887.7606 2660.26733398438 887.763061523438 3 25 1.1.1.5099.6 1 44.7869 2435.908 44.7195 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 -0.0105365999042988 2823.3203125 942.114 2823.33056640625 942.117492675781 3 24 1.1.1.5186.4 1 46.8958 15881.26 47.05 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 -0.0105365999042988 2823.3203125 942.114 2823.33056640625 942.117492675781 3 25 1.1.1.5193.8 1 47.0641 15881.26 47.05 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY acrolein addition +56(K)@4; Ser->LacticAcid(S)@5; Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 0.00277990009635687 2864.34887695313 955.7902 2864.34594726563 955.789245605469 3 20 1.1.1.5194.7 1 47.0933 499.7717 47.1226 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 -0.00357871991582215 2823.32690429688 942.1163 2823.33056640625 942.117492675781 3 17 1.1.1.5208.7 1 47.4333 295.4374 47.3899 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Carbamidomethyl(C)@25 missed K-S@4 0.0190372001379728 2807.35473632813 936.7922 2807.33569335938 936.785888671875 3 24 1.1.1.5410.6 1 52.2659 2322.763 52.3441 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Carbamidomethyl(C)@25 missed K-S@4 0.0190372001379728 2807.35473632813 936.7922 2807.33569335938 936.785888671875 3 22 1.1.1.5417.8 1 52.4316 2322.763 52.3441 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 98.5300004482269 TVDKSTGKPTLYNVSLVMSDTAGTCY Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 0.00852505955845118 2823.33935546875 942.1204 2823.33056640625 942.117492675781 3 16 1.1.1.5413.10 1 52.339 232.2967 52.3441 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 46.0500001907349 TVDKSTGKPTLYNVSLVMSDTAGTCY acrolein addition +112(K)@4; HPNE addition +172(K)@8; Pro->pyro-Glu(P)@9; Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 -0.0104174995794892 3121.46313476563 1041.495 3121.47241210938 1041.498046875 3 12 1.1.1.5189.5 1 46.9724 1564.476 47.05 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 88.0299985408783 VTERTVDKSTGKPTLYNVSLVMSDTAGTC MDA adduct +54(K)@8; Carbamidomethyl(K)@12; Oxidation(M)@22; Carbamidomethyl(C)@29 cleaved C-Y@C-term; missed R-T@4; missed K-S@8 -0.0126181002706289 3256.54711914063 1086.523 3256.55908203125 1086.52697753906 3 12 1.1.1.5100.16 1 44.8113 350.8318 44.792 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00433713989332318 1318.75402832031 660.3843 1318.74963378906 660.382080078125 2 17 1.1.1.5017.3 1 42.8089 14815.56 43.0349 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00409300997853279 1318.75390625 660.3842 1318.74963378906 660.382080078125 2 19 1.1.1.5024.5 1 42.9752 19200.04 43.0588 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00409300997853279 1318.75390625 660.3842 1318.74963378906 660.382080078125 2 18 1.1.1.5031.9 1 43.146 19200.04 43.0588 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.0045812800526619 1318.75427246094 660.3844 1318.74963378906 660.382080078125 2 18 1.1.1.5045.6 1 43.4813 1385.654 43.5137 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Oxidation(Y)@1; Trimethyl(A)@2 0.00144782999996096 1334.74609375 668.3803 1334.74450683594 668.379577636719 2 17 1.1.1.5028.4 1 43.0776 808.2643 43.0827 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.0045812800526619 1318.75427246094 660.3844 1318.74963378906 660.382080078125 2 15 1.1.1.5052.10 1 43.6514 1385.654 43.5137 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 94.9699997901917 YAATSQVLLPSK Oxidation(Y)@1; Trimethyl(A)@2 0.00144782999996096 1334.74609375 668.3803 1334.74450683594 668.379577636719 2 15 1.1.1.5036.5 1 43.2689 808.2643 43.0827 5 12.58 12.58 33.4100008010864 15.0399997830391 14.1599997878075 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 89.6899998188019 YAATSQVLLPSK Trimethyl(A)@2 0.00372680998407304 1318.75341796875 660.384 1318.74963378906 660.382080078125 2 12 1.1.1.5066.9 1 43.9875 329.1498 43.9709 6 10.1 10.1 36.9100004434586 22.4000006914139 19.5600003004074 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 AATVGSLAGQPLQER 0.00161544000729918 1496.79650878906 749.4055 1496.79467773438 749.404602050781 2 24 1.1.1.4752.4 1 36.6521 473.3366 36.6334 6 10.1 10.1 36.9100004434586 22.4000006914139 19.5600003004074 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 LAVYQAGAR 0.000989670981653035 947.519897460938 474.7672 947.518859863281 474.766723632813 2 11 1.1.1.4429.5 1 28.91 448.5017 28.9492 6 10.1 10.1 36.9100004434586 22.4000006914139 19.5600003004074 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 LGADMEDVCGR Oxidation(M)@5; Carbamidomethyl(C)@9 0.000950196001213044 1237.50769042969 619.7611 1237.50671386719 619.760620117188 2 17 1.1.1.4353.2 1 27.067 215.0567 27.1052 6 10.1 10.1 36.9100004434586 22.4000006914139 19.5600003004074 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 LSKELQAAQAR missed K-E@3 -0.00116081000305712 1213.6767578125 405.5662 1213.67785644531 405.566558837891 3 16 1.1.1.4286.2 1 25.7196 386.8224 25.7692 6 10.1 10.1 36.9100004434586 22.4000006914139 19.5600003004074 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 TRDRLDEVKEQVAEVR missed R-D@2; missed R-L@4; missed K-E@9 0.00550496997311711 1942.02893066406 486.5145 1942.02319335938 486.513092041016 4 15 1.1.1.4672.2 1 34.6931 324.6628 34.6588 6 10.1 10.1 36.9100004434586 22.4000006914139 19.5600003004074 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.0952844545245171 83.2599997520447 LQAEAFQAR 0.0114193996414542 1032.54663085938 517.2806 1032.53527832031 517.27490234375 2 9 1.1.1.4471.12 1 29.9232 191.8706 29.9299 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 2 99.0000009536743 FSGSGSGTDFTLK -0.0138512998819351 1302.59521484375 652.3049 1302.60925292969 652.311889648438 2 15 1.1.1.4772.6 1 37.1093 0 -1 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 2 99.0000009536743 FSGSGSGTDFTLKISR missed K-I@13 -0.00609637005254626 1658.8203125 830.4174 1658.82641601563 830.420471191406 2 17 1.1.1.4923.5 1 40.6187 0 -1 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 2 99.0000009536743 ISRVEAEDVGVYYCMQGLQTPQTFGQGTK Methyl(D)@8; Carbamidomethyl(C)@14; Oxidation(M)@15 missed R-V@3 -0.0229732003062963 3291.53100585938 823.89 3291.55395507813 823.895751953125 4 13 1.1.1.5435.2 1 52.8759 2017.381 52.7598 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 2 99.0000009536743 ISRVEAEDVGVYYCMQGLQTPQTFGQGTKVEIK Methyl(D)@8; Carbamidomethyl(C)@14; Oxidation(M)@15; acrolein addition +112(K)@29; reduced acrolein addition +58(K)@33 missed R-V@3; missed K-V@29 -0.0172712001949549 3930.92138671875 656.1608 3930.93823242188 656.163696289063 6 18 1.1.1.5377.4 1 51.4511 1403.32 51.4679 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 2 99.0000009536743 VEAEDVGVYYCMQGLQTPQTFGQGTKVEIK Methyl(D)@5; Carbamidomethyl(C)@11; Oxidation(M)@12; reduced acrolein addition +58(K)@26; acrolein addition +112(K)@30 missed K-V@26 0.0091770701110363 3574.73046875 894.6899 3574.72119140625 894.687561035156 4 15 1.1.1.5409.9 1 52.2391 653.0799 52.271 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0.0347982980310917 99.0000009536743 DRFSGSGSGTDFTLK cleaved P-D@N-term; missed R-F@2 -0.992313027381897 1572.7451171875 787.3798 1573.7373046875 787.875915527344 2 15 1.1.1.5116.11 1 45.1932 3393.205 45.3259 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0.00174066168256104 99.0000009536743 SNRASGVPDRFSGSGSGTDFTLK Deamidated(N)@2; Oxidation(R)@3 cleaved G-S@N-term; missed R-A@3; missed R-F@10 0.0133741004392505 2359.11767578125 787.3798 2359.10400390625 787.375305175781 3 18 1.1.1.5123.15 1 45.3648 3393.205 45.3259 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0 97.9499995708466 ASGVPDRFSGSGSGTDFTLK Delta:H(4)C(2)@N-term; Oxidation(P)@5; Oxidation(D)@6; Oxidation(R)@7 missed R-F@7 0.0159255992621183 2060.98095703125 688.0009 2060.96508789063 687.99560546875 3 18 1.1.1.5115.14 1 45.1689 7832.961 45.3259 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0 46.0500001907349 DRFSGSGSGTDFTLK cleaved P-D@N-term; missed R-F@2 -0.992313027381897 1572.7451171875 787.3798 1573.7373046875 787.875915527344 2 14 1.1.1.5123.15 1 45.3648 3393.205 45.3259 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0 99.0000009536743 FSGSGSGTDFTLK 0.00360432988964021 1302.61291503906 652.3137 1302.60925292969 652.311889648438 2 20 1.1.1.4756.4 1 36.7474 3400.009 36.8238 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0 99.0000009536743 FSGSGSGTDFTLK 0.00360432988964021 1302.61291503906 652.3137 1302.60925292969 652.311889648438 2 20 1.1.1.4764.7 1 36.9376 3400.009 36.8238 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0 63.620001077652 ISRVEAEDVGVYYCMQGLQTPQTFGQGTK Methyl(D)@8; Carbamidomethyl(C)@14; Oxidation(M)@15 missed R-V@3 -0.0229732003062963 3291.53100585938 823.89 3291.55395507813 823.895751953125 4 11 1.1.1.5428.8 1 52.7032 2017.381 52.7598 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0 99.0000009536743 ISRVEAEDVGVYYCMQGLQTPQTFGQGTKVEIK Methyl(D)@8; Carbamidomethyl(C)@14; Oxidation(M)@15; reduced acrolein addition +58(K)@29; acrolein addition +112(K)@33 missed R-V@3; missed K-V@29 -0.00123779999557883 3930.93701171875 787.1947 3930.93823242188 787.194946289063 5 14 1.1.1.5376.9 1 51.4384 1071.605 51.4679 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0 99.0000009536743 ISRVEAEDVGVYYCMQGLQTPQTFGQGTKVEIK Methyl(D)@8; Carbamidomethyl(C)@14; Oxidation(M)@15; reduced acrolein addition +58(K)@29; acrolein addition +112(K)@33 missed R-V@3; missed K-V@29 0.00156599003821611 3930.93969726563 983.7422 3930.93823242188 983.741882324219 4 13 1.1.1.5377.11 1 51.4628 473.8526 51.4679 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0 99.0000009536743 ISRVEAEDVGVYYCMQGLQTPQTFGQGTKVEIK Methyl(D)@8; Carbamidomethyl(C)@14; Oxidation(M)@15; acrolein addition +76(K)@29; acrolein addition +94(K)@33 missed R-V@3; missed K-V@29 0.00385819002985954 3930.92138671875 656.1608 3930.91723632813 656.16015625 6 13 1.1.1.5384.3 1 51.6207 1403.32 51.4679 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0 42.8799986839294 QSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISR cleaved Q-Q@N-term; missed R-A@13; missed R-F@20; missed K-I@33 -5.07263994216919 3805.892578125 635.3227 3810.96533203125 636.168151855469 6 12 1.1.1.5092.8 1 44.6077 909.1583 44.6227 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0 80.0999999046326 RFSGSGSGTDFTLKISR cleaved D-R@N-term; missed R-F@1; missed K-I@14 -2.03010010719299 1812.89733886719 605.3064 1814.92749023438 605.983093261719 3 12 1.1.1.5165.4 1 46.3849 1758.288 46.2731 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0 25.5100011825562 SSQSLLHSNGYNYLDWYLQKPQQSP Delta:H(2)C(2)(H)@7; Deamidated(N)@9 cleaved P-Q@C-term 0.0216035004705191 2979.42529296875 745.8636 2979.40380859375 745.858276367188 4 11 1.1.1.5160.8 1 46.263 8752.336 46.2006 7 10.04 10.04 75.2099990844727 47.859999537468 47.859999537468 sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1 0 88.510000705719 VEAEDVGVYYCMQGLQTPQTFGQGTKVEIK Methyl(D)@5; Carbamidomethyl(C)@11; Oxidation(M)@12; reduced acrolein addition +58(K)@26; acrolein addition +112(K)@30 missed K-V@26 -0.0134114995598793 3574.70751953125 715.9488 3574.72119140625 715.951477050781 5 12 1.1.1.5409.7 1 52.2349 1031.575 52.271 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 2 99.0000009536743 EHNIEVLEGNEQFINAAK reduced HNE(H)@2; Deamidated(N)@3; Deamidated(N)@15 cleaved G-E@N-term -0.00441215978935361 2214.10131835938 739.041 2214.10571289063 739.04248046875 3 17 1.1.1.5196.6 1 47.1294 2014.782 47.1713 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 2 99.0000009536743 IVGGYTCEENSVPYQVSLNSG Carbamidomethyl(C)@7 cleaved G-S@C-term 2.99081993103027 2275.0234375 1138.519 2272.03173828125 1137.02319335938 2 13 1.1.1.5597.10 1 56.7878 2873.052 56.7962 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 2 99.0000009536743 IVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@7; Deamidated(N)@10; Oxidation(P)@13; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 cleaved K-P@C-term -0.00337893003597856 4933.22802734375 823.2119 4933.23095703125 823.212463378906 6 15 1.1.1.5634.5 1 57.7014 11101.65 57.6952 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 2 99.0000009536743 IVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYKP Carbamidomethyl(C)@7; Deamidated(N)@10; Oxidation(P)@13; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; reduced acrolein addition +58(K)@43 cleaved P-H@C-term 0.0270239003002644 4934.2529296875 987.8579 4934.22607421875 987.8525390625 5 15 1.1.1.5670.3 1 58.5851 18914.36 58.5775 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 2 99.0000009536743 SVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@15; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term; cleaved K-P@C-term 0.0215597003698349 3793.80859375 759.769 3793.78686523438 759.7646484375 5 14 1.1.1.5344.11 1 50.6568 4478.789 50.7396 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0.00568284746259451 69.4999992847443 LGEHNIEVLEGNEQFINAAK -3.06070995330811 2221.05151367188 741.3578 2224.1123046875 742.378051757813 3 12 1.1.1.5206.11 1 47.3765 354.1125 47.3655 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0.00524305552244186 92.519998550415 TLNNDIMLIK Deamidated(N)@3 cleaved I-T@N-term 0.0050068199634552 1174.6318359375 588.3232 1174.62670898438 588.320678710938 2 12 1.1.1.5224.5 0 47.8142 474.4458 47.8268 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 75.4400014877319 EGNEQFINAAK cleaved L-E@N-term 0.00246222992427647 1219.58581542969 610.8002 1219.58337402344 610.798950195313 2 6 1.1.1.4473.10 0 29.9719 98.3806 29.9543 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 95.3199982643127 EQFINAAK cleaved N-E@N-term 0.00631798012182117 919.482666015625 460.7486 919.476318359375 460.745452880859 2 8 1.1.1.4426.3 0 28.833 280.4998 28.8531 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 63.0900025367737 IVGGY cleaved Y-T@C-term 0.00266880006529391 507.271942138672 508.2792 507.269287109375 508.276580810547 1 5 1.1.1.4433.9 0 29.0121 120.7614 29.0222 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 67.3900008201599 IVGGYTCEENSVPYQVSLN Oxidation(Y)@5; Carbamidomethyl(C)@7; Deamidated(N)@10 cleaved N-S@C-term 0.0225872993469238 2144.97924804688 1073.497 2144.95727539063 1073.48583984375 2 11 1.1.1.5714.6 1 59.677 443.2917 59.6312 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 64.3899977207184 IVGGYTCEENSVPYQVSLNS Carbamidomethyl(C)@7; Deamidated(N)@10; Oxidation(P)@13 cleaved S-G@C-term 0.0251014996320009 2232.01342773438 1117.014 2231.9892578125 1117.001953125 2 11 1.1.1.5702.8 1 59.3811 1723.797 59.217 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 IVGGYTCEENSVPYQVSLNSG Carbamidomethyl(C)@7; Deamidated(N)@10; Oxidation(P)@13 cleaved G-S@C-term 0.0270971991121769 2289.03735351563 1145.526 2289.0107421875 1145.51257324219 2 12 1.1.1.5678.15 1 58.7927 4697.766 58.8011 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 IVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@7; Deamidated(N)@10; Oxidation(P)@13; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 cleaved K-P@C-term 0.0261765997856855 4933.2568359375 987.6587 4933.23095703125 987.653442382813 5 17 1.1.1.5635.6 1 57.7308 51075.99 57.7198 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 IVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@7; Deamidated(N)@10; Oxidation(P)@13; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 cleaved K-P@C-term 0.0252611003816128 4933.25634765625 987.6585 4933.23095703125 987.653442382813 5 15 1.1.1.5642.5 1 57.8998 52908.92 57.8174 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 IVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@7; Deamidated(N)@10; Oxidation(P)@13; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 cleaved K-P@C-term -0.00228030001744628 4933.22802734375 823.212 4933.23095703125 823.212463378906 6 13 1.1.1.5648.4 1 58.0426 7539.894 57.9638 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 IVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@7; Deamidated(N)@10; Oxidation(P)@13; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 cleaved K-P@C-term 0.0252611003816128 4933.25634765625 987.6585 4933.23095703125 987.653442382813 5 17 1.1.1.5649.6 1 58.073 52874.14 57.8174 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.5599994659424 IVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@7; Deamidated(N)@10; Oxidation(P)@13; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 cleaved K-P@C-term 0.0501748993992805 4933.28271484375 1234.328 4933.23095703125 1234.31506347656 4 12 1.1.1.5657.12 1 58.2776 13184.49 58.1109 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 63.620001077652 IVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@7; Deamidated(N)@10; Oxidation(P)@13; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 cleaved K-P@C-term -0.00154788000509143 4933.2294921875 823.2122 4933.23095703125 823.212463378906 6 11 1.1.1.5641.2 1 57.8697 10814.36 57.8174 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 63.620001077652 IVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@7; Deamidated(N)@10; Oxidation(P)@13; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 cleaved K-P@C-term 0.0252611003816128 4933.25634765625 987.6585 4933.23095703125 987.653442382813 5 11 1.1.1.5656.8 1 58.2424 36880.92 57.9883 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 69.5800006389618 IVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYKP Carbamidomethyl(C)@7; Oxidation(N)@10; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; reduced acrolein addition +58(K)@43 cleaved P-H@C-term 0.0301523990929127 4933.2705078125 1234.325 4933.2421875 1234.31787109375 4 12 1.1.1.5688.11 1 59.0408 21510.96 59.0476 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 95.1300024986267 LGEHNIEVLEGNEQFINAAK -0.0353365987539291 2224.07690429688 742.3663 2224.1123046875 742.378051757813 3 13 1.1.1.5195.6 0 47.105 1096.533 47.147 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 54.2800009250641 LGEHNIEVLEGNEQFINAAK Oxidation(H)@4; Deamidated(N)@5 -0.0127878002822399 2241.07836914063 748.0334 2241.09130859375 748.037719726563 3 11 1.1.1.5204.4 0 47.3244 763.6158 47.2682 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 41.8099999427795 LGEHNIEVLEGNEQFINAAK Oxidation(N)@5 -0.0321657992899418 2240.0751953125 747.699 2240.107421875 747.709716796875 3 12 1.1.1.5195.8 0 47.1067 420.6262 47.147 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 59.7100019454956 PLLILAFVGAAVAVPFDDDDKIVGGYTCEENSVPYQVSLNSG acrolein addition +76(K)@21; Carbamidomethyl(C)@28 cleaved N-P@N-term; cleaved G-S@C-term; missed K-I@21 -0.0300165005028248 4515.19091796875 1129.805 4515.2197265625 1129.81213378906 4 10 1.1.1.5427.15 1 52.6811 309.3402 52.6861 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 SVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@15; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term; cleaved K-P@C-term 0.0382388010621071 3793.82543945313 949.4636 3793.78686523438 949.453979492188 4 11 1.1.1.5351.6 0 50.8298 3895.177 50.7396 8 10.01 12.13 46.560001373291 38.4600013494492 25.9099990129471 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 VLEGNEQFINAAK cleaved E-V@N-term 0.000960853009019047 1431.73681640625 716.8757 1431.73583984375 716.875183105469 2 17 1.1.1.4795.8 0 37.6557 0 -1 9 4.36 4.36 23.3899995684624 1.56299993395805 1.56299993395805 sp|P01024|CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 2 99.0000009536743 TRFISLGEACKK Carbamidomethyl(C)@10 missed R-F@2; missed K-K@11 -0.000803424976766109 1408.74877929688 470.5902 1408.74963378906 470.590484619141 3 14 1.1.1.4472.11 1 29.9409 1056.81 29.9543 9 4.36 4.36 23.3899995684624 1.56299993395805 1.56299993395805 sp|P01024|CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 1.72124660015106 99.0000009536743 VFLDCCNYITELR Carbamidomethyl(C)@5; Carbamidomethyl(C)@6 0.0162988994270563 1701.80163574219 851.9081 1701.78552246094 851.900024414063 2 17 1.1.1.5388.7 1 51.7292 281.2921 51.7611 9 4.36 4.36 23.3899995684624 1.56299993395805 1.56299993395805 sp|P01024|CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 0.250263690948486 96.8699991703033 VFLDCCNYITELRR Carbamidomethyl(C)@5; Carbamidomethyl(C)@6 missed R-R@13 -0.00517428014427423 1857.88146972656 620.3011 1857.88659667969 620.302795410156 3 13 1.1.1.5236.5 1 48.1022 2102.978 48.1379 9 4.36 4.36 23.3899995684624 1.56299993395805 1.56299993395805 sp|P01024|CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 0.209011524915695 96.0900008678436 TRFISLGEACKKVFLDCCNYITELRR Carbamidomethyl(C)@10; Carbamidomethyl(C)@17; Carbamidomethyl(C)@18 missed R-F@2; missed K-K@11; missed K-V@12; missed R-R@25 0.00186163000762463 3248.62744140625 650.7328 3248.62573242188 650.732421875 5 13 1.1.1.5322.6 1 50.1182 350.3561 50.155 9 4.36 4.36 23.3899995684624 1.56299993395805 1.56299993395805 sp|P01024|CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 0.179142013192177 95.2899992465973 FISLGEACKKVFLDCCNYITELRR Carbamidomethyl(C)@8; Carbamidomethyl(C)@15; Carbamidomethyl(C)@16 missed K-K@9; missed K-V@10; missed R-R@23 -0.0112977996468544 2991.46557617188 599.3004 2991.47680664063 599.302673339844 5 14 1.1.1.5416.6 1 52.3997 608.2421 52.4172 9 4.36 4.36 23.3899995684624 1.56299993395805 1.56299993395805 sp|P01024|CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 0 39.6800011396408 SVQLTEKRMDKVGK Carbamidomethyl@N-term; acrolein addition +56(K)@7; reduced acrolein addition +96(K)@11; MDA adduct +54(K)@14 missed K-R@7; missed R-M@8; missed K-V@11 0.0289358999580145 1881.03186035156 628.0179 1881.0029296875 628.00830078125 3 10 1.1.1.4954.4 1 41.3161 26128.7 41.5348 10 2.8 2.8 13.7999996542931 4.01300005614758 4.01300005614758 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 SGGGGGGGLGSGGSIR -0.00091270700795576 1231.58972167969 616.8021 1231.59057617188 616.802551269531 2 26 1.1.1.4336.4 1 26.6739 200.3259 26.7037 10 2.8 2.8 13.7999996542931 4.01300005614758 4.01300005614758 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0.804100334644318 99.0000009536743 STMQELNSR 0.000491022015921772 1064.49243164063 533.2535 1064.49206542969 533.253295898438 2 12 1.1.1.4349.3 1 26.9757 118.8466 26.9808 10 2.8 2.8 13.7999996542931 4.01300005614758 4.01300005614758 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 46.0500001907349 DLKDQIVDLTVGNNK hexanoyl addition +98(K)@3; Oxidation(D)@4; reduced acrolein addition +96(K)@15 cleaved D-D@N-term; missed K-D@3 0.0224108006805182 1881.03186035156 628.0179 1881.00952148438 628.010437011719 3 12 1.1.1.4962.5 1 41.4992 24729.48 41.511 10 2.8 2.8 13.7999996542931 4.01300005614758 4.01300005614758 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 32.1000009775162 SKKAALEK acrolein addition +56(K)@8 cleaved L-S@N-term; missed K-K@2; missed K-A@3 -0.00319710001349449 929.551452636719 465.783 929.554565429688 465.784576416016 2 8 1.1.1.4541.5 1 31.5655 1237.016 31.5262 11 2.25 2.25 31.9700002670288 23.1299996376038 23.1299996376038 cont|000069 gi|27806789|ref|NP_776392.1| transthyretin (prealbumin, amyloidosis type I) [Bos taurus (contaminant)] 2 99.0000009536743 HYTIAALLSPYSYSTTALVSSPKA missed K-A@23 0.0124851996079087 2540.32861328125 847.7835 2540.31616210938 847.779357910156 3 21 1.1.1.5622.4 1 57.399 141.1558 57.39 11 2.25 2.25 31.9700002670288 23.1299996376038 23.1299996376038 cont|000069 gi|27806789|ref|NP_776392.1| transthyretin (prealbumin, amyloidosis type I) [Bos taurus (contaminant)] 0.253365814685822 97.4900007247925 GSPAANVGVK 0.00366870989091694 898.490844726563 450.2527 898.487243652344 450.250885009766 2 10 1.1.1.4278.3 1 25.5253 212.1294 25.5856 12 2 2 84.5099985599518 9.29199978709221 6.6370002925396 sp|P16401|H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 2 99.0000009536743 ALAAGGYDVEKNNSR missed K-N@11 -0.000405453989515081 1563.76354980469 522.2618 1563.76416015625 522.261962890625 3 13 1.1.1.4395.4 1 28.0722 256.5285 28.1133 12 2 2 84.5099985599518 9.29199978709221 6.6370002925396 sp|P16401|H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 0.000434511806815863 30.4100006818771 KAKAAAKPKKATK reduced acrolein addition +58(K)@1; acrolein addition +94(K)@7; reduced acrolein addition +58(K)@9; MDA adduct +54(K)@13 missed K-A@1; missed K-A@3; missed K-K@9; missed K-A@10 -0.0139156999066472 1603.98852539063 402.0044 1604.00256347656 402.007904052734 4 7 1.1.1.5350.2 1 50.7929 7297.863 50.8626 12 2 2 84.5099985599518 9.29199978709221 6.6370002925396 sp|P16401|H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 0.000434511806815863 35.359999537468 KAVKKTPKK hexanoyl addition +98(K)@1; acrolein addition +56(K)@4; acrolein addition +112(K)@8; ONE addition +154(K)@9 missed K-A@1; missed K-K@4; missed K-T@5; missed K-K@8 -0.00791633035987616 1446.93469238281 724.4746 1446.94250488281 724.478515625 2 7 1.1.1.4632.9 1 33.7427 571.6864 33.7957 12 2 2 84.5099985599518 9.29199978709221 6.6370002925396 sp|P16401|H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 0 19.4100007414818 AAKPKAAKAKKA hexanoyl addition +98(K)@3; acrolein addition +76(K)@10; acrolein addition +76(K)@11 cleaved A-A@C-term; missed K-A@5; missed K-A@8; missed K-K@10; missed K-A@11 -0.01031310018152 1431.88623046875 478.3027 1431.89660644531 478.30615234375 3 6 1.1.1.5349.4 1 50.7699 1715.271 50.8626 12 2 2 84.5099985599518 9.29199978709221 6.6370002925396 sp|P16401|H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 0 66.6499972343445 VKKVAK MDA adduct +54(K)@2; MDA adduct +62(K)@3; MDA adduct +54(K)@6 cleaved G-V@N-term; missed K-K@2; missed K-V@3 -0.000636585988104343 841.505493164063 421.76 841.506164550781 421.760375976563 2 5 1.1.1.6765.2 0 76.938 165.8254 76.9573 12 2 2 84.5099985599518 9.29199978709221 6.6370002925396 sp|P16401|H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 0 63.620001077652 VKKVAK MDA adduct +54(K)@2; MDA adduct +62(K)@3; MDA adduct +54(K)@6 cleaved G-V@N-term; missed K-K@2; missed K-V@3 -0.00362725998274982 841.502502441406 421.7585 841.506164550781 421.760375976563 2 5 1.1.1.6813.4 1 78.0467 164.8808 78.0374 13 2 2 8.88400003314018 0.580399995669723 0.580399995669723 sp|P02751-9|FINC_HUMAN Isoform Fibronectin not containing EIIIA and EIIIB and uses V64 variant of IIICS region of Fibronectin OS=Homo sapiens GN=FN1 2 99.0000009536743 LGVRPSQGGEAPR 0.00135525001678616 1322.70666503906 441.9095 1322.70544433594 441.909118652344 3 16 1.1.1.4275.4 1 25.4571 298.7372 25.4868 13 2 2 8.88400003314018 0.580399995669723 0.580399995669723 sp|P02751-9|FINC_HUMAN Isoform Fibronectin not containing EIIIA and EIIIB and uses V64 variant of IIICS region of Fibronectin OS=Homo sapiens GN=FN1 0 17.5600007176399 EATIPGHLNSYTIK Glu->pyro-Glu@N-term; acrolein addition +94(K)@14 -0.0121082002297044 1618.82348632813 810.419 1618.83544921875 810.425048828125 2 6 1.1.1.5417.5 1 52.4266 588.1068 52.6616 14 2 2 40.1399999856949 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 2 99.0000009536743 VGAHAGEYGAEALERMFLSFPTTK missed R-M@15 0.00356510002166033 2581.26684570313 646.324 2581.26342773438 646.323181152344 4 25 1.1.1.5785.3 1 61.2605 174.108 61.2714 14 2 2 40.1399999856949 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 0 98.5300004482269 VGAHAGEYGAEALERMFLSFPTTK Oxidation(M)@16 missed R-M@15 0.000513184000737965 2597.25903320313 650.322 2597.25854492188 650.321899414063 4 14 1.1.1.5497.5 1 54.2851 1125.74 54.3551 15 1.37 1.37 78.2999992370605 14.1499996185303 14.1499996185303 sp|P0CG06|LAC3_HUMAN Ig lambda-3 chain C regions OS=Homo sapiens GN=IGLC3 PE=1 SV=1 1.36653172969818 99.0000009536743 SYSCQVTHEGSTVEK Carbamidomethyl(C)@4 -0.00632038991898298 1710.74560546875 571.2558 1710.751953125 571.257934570313 3 15 1.1.1.4318.2 1 26.3565 299.7366 26.3868